F495345
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1689 | 691 | 3378 | 281 |
Family's Representative Sequence
| Representative Sequence | 3300031731|Ga0307405_10022939|Ga0307405_100229392 |
| Length | 324 |
| Sequence | MPGSLGQSRRDLVGHGGDRVGLKPLSSPPHPGIDTAAGLAELTAMTTGTRPPAACLIGWPAAHSRSPLIHHYWLRTLGIEGGYVIEAVPPDEFQDFVFRLSLRGFVGANVTLPHKERALALSKPDERARAVGAANTLWFEQGELCSTNTDVEGFINNLDACAPGWDRAEDALVLGAGGSSRAVLFGLIERGIKRVHLANRTMERARALADQFGASVLPVEWEAFGELLPRAGLLVNTTSLGMHGQPALELDIGRLPHHAVVADLVYAPLETPLLAAARAHGLRTADGLGMLLHQAVRGFELWFGKRPEVTSELRALIEADLKKV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 2 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 3 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 4 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 5 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 6 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 7 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 8 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 9 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 10 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 11 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 12 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 20 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 24 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 52 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 57 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 60 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 68 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 70 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 71 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 72 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 74 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 75 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 76 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 77 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 78 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 79 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 80 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 81 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 82 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 83 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 84 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 86 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 87 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 88 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 89 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 90 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 91 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 92 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 93 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 95 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 96 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 97 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 98 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 99 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 100 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 101 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 102 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 103 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 105 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 106 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 107 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 108 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 109 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 110 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 111 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 125 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 128 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 144 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 145 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 146 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 147 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 148 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 149 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 150 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 151 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 152 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 153 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 154 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 159 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 160 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 229 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 230 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 231 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 232 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 236 | 3300028023 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 | Metagenome | Rhizosphere |
| 237 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 241 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 242 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 243 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 244 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 245 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 246 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 247 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 248 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 249 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 250 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 251 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 252 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 253 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 254 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 255 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 256 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 257 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 258 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 259 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 260 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 261 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 262 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 263 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 264 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 265 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 266 | 3300033546 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE2 | Metagenome | Unclassified |
| 267 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 268 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 269 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 270 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 271 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 272 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 273 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 274 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 275 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 276 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 277 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 278 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 279 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 280 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 281 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 282 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 283 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 284 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 285 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 286 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 287 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 288 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 289 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 290 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 291 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 292 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 293 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 294 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 295 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 296 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 297 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 298 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 299 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 300 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 301 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 302 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 303 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 304 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 305 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 306 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 307 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 308 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 309 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 310 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 311 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 312 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 313 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 314 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 315 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 316 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 317 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 318 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 319 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 320 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 321 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 322 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 323 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 324 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 405 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 406 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 407 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 408 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 409 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 410 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 411 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 412 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 413 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 414 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 415 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 416 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 417 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 418 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 419 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 420 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 421 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 422 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 423 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 424 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 425 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 426 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 427 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 428 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 430 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 431 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 432 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 433 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 434 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 435 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 436 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 437 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 438 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 439 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 440 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 441 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 442 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 443 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 444 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 445 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 446 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 447 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 448 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 449 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 450 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 451 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 452 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 453 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 454 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 455 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 456 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 457 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 458 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 459 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 460 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 461 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 462 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 463 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 464 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 465 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 466 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 467 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 468 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 469 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 470 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 471 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 472 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 473 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 474 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 475 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 476 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 477 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 478 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 479 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 480 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 481 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 482 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 483 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 484 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 485 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 486 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 487 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 488 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 489 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 490 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 491 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 492 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 493 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 494 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 495 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 496 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 497 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 498 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 499 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 500 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 501 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 502 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 503 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 504 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 505 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 506 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 507 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 508 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 509 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 510 | 3300053728 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere | Metagenome | Endosphere |
| 511 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 512 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 513 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 514 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 515 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 516 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 517 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 518 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 519 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 520 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 521 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 522 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 523 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 524 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 525 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 526 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 527 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 528 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 529 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 530 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 531 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 532 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 533 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 534 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 535 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 536 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 537 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 538 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 539 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 540 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 541 | 2791355199 | |||
| 542 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 543 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 544 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 545 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 546 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 547 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 548 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 549 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 550 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 551 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 552 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 553 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 554 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 555 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 556 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 557 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 558 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 559 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 560 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 561 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 562 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 563 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 564 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 565 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 566 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 567 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 568 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 569 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 570 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 571 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 572 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 573 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 574 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 575 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 576 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 577 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 578 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 579 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 580 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 581 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 582 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 583 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 584 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 585 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 586 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 587 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 588 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 589 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 590 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 591 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 592 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 593 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 594 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 595 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 596 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 597 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 598 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 599 | 2904699407 | |||
| 600 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 601 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 602 | 2906610324 | |||
| 603 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 604 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 605 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 606 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 607 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 608 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 609 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 610 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 611 | 2922368715 | |||
| 612 | 2922425934 | |||
| 613 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 614 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 615 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 616 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 617 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 618 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 619 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 620 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 621 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 622 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 623 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 624 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 625 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 626 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 627 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 628 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 629 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 630 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 631 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 632 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 633 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 634 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 635 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 636 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 637 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 638 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 639 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 640 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 641 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 642 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 643 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 644 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 645 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 646 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 647 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 648 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 649 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 650 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 651 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 652 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 653 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 654 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 655 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 656 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 657 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 658 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 659 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 660 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 661 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 662 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 663 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 664 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 665 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 666 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 667 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 668 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 669 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 670 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 671 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 672 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 673 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 674 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 675 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 676 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 677 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 678 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 679 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 680 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 681 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 682 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 683 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 684 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 685 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 686 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 687 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 688 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 689 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 690 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 691 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 89.55 |
| Metatranscriptomes | 0.36 |
| Isolates | 10.1 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.8 |
| Nodule | 8.29 |
| Rhizoplane | 5.86 |
| Rhizosphere | 73.42 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.03 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0307405_10022939 | 3300031731 | Bacteria | 3538 |
| 2 | JGI24739J22299_10000871 | 3300001989 | Bacteria | 11154 |
| 3 | JGI24739J22299_10008928 | 3300001989 | Bacteria | 3739 |
| 4 | JGI24739J22299_10025017 | 3300001989 | Bacteria | 2101 |
| 5 | JGI24743J22301_10013185 | 3300001991 | Bacteria | 1512 |
| 6 | JGI24750J21931_1000457 | 3300002070 | Bacteria | 6532 |
| 7 | JGI24035J26624_1000248 | 3300002126 | Bacteria | 4965 |
| 8 | JGI25153J46596_10004620 | 3300003215 | Bacteria | 7372 |
| 9 | JGI25153J46596_10005210 | 3300003215 | Bacteria | 6841 |
| 10 | JGI25153J46596_10010025 | 3300003215 | Bacteria | 4327 |
| 11 | JGI25153J46596_10031215 | 3300003215 | Bacteria | 1797 |
| 12 | rootL2_10335649 | 3300003322 | Bacteria | 1925 |
| 13 | JGI25160J50197_1003286 | 3300003354 | Bacteria | 7284 |
| 14 | JGI25160J50197_1007225 | 3300003354 | Bacteria | 4369 |
| 15 | Ga0055531_10010351 | 3300003794 | Bacteria | 4645 |
| 16 | Ga0055531_10010606 | 3300003794 | Bacteria | 4554 |
| 17 | Ga0055543_1008336 | 3300004625 | Bacteria | 2301 |
| 18 | Ga0065165_1002476 | 3300005262 | Bacteria | 15530 |
| 19 | Ga0065165_1002846 | 3300005262 | Bacteria | 13437 |
| 20 | Ga0065165_1025765 | 3300005262 | Bacteria | 1948 |
| 21 | Ga0065715_10243240 | 3300005293 | Bacteria | 1172 |
| 22 | Ga0070658_10029391 | 3300005327 | Bacteria | 4415 |
| 23 | Ga0070658_10044726 | 3300005327 | Bacteria | 3579 |
| 24 | Ga0070658_10142354 | 3300005327 | Bacteria | 2004 |
| 25 | Ga0070658_10349485 | 3300005327 | Bacteria | 1265 |
| 26 | Ga0070658_10461582 | 3300005327 | Bacteria | 1095 |
| 27 | Ga0070676_10020837 | 3300005328 | Bacteria | 3665 |
| 28 | Ga0070676_10086242 | 3300005328 | Bacteria | 1915 |
| 29 | Ga0070676_10165191 | 3300005328 | Bacteria | 1428 |
| 30 | Ga0070683_100031309 | 3300005329 | Bacteria | 4836 |
| 31 | Ga0070683_100041896 | 3300005329 | Bacteria | 4215 |
| 32 | Ga0070683_100045265 | 3300005329 | Bacteria | 4061 |
| 33 | Ga0070690_100017313 | 3300005330 | Plasmid | 4331 |
| 34 | Ga0070670_100126553 | 3300005331 | Unclassified | 2205 |
| 35 | Ga0070670_100316986 | 3300005331 | Bacteria | 1366 |
| 36 | Ga0070677_10005521 | 3300005333 | Bacteria | 4168 |
| 37 | Ga0068869_100059222 | 3300005334 | Bacteria | 2803 |
| 38 | Ga0070666_10103477 | 3300005335 | Unclassified | 1964 |
| 39 | Ga0070680_100003647 | 3300005336 | Bacteria | 11501 |
| 40 | Ga0070680_100123326 | 3300005336 | Bacteria | 2164 |
| 41 | Ga0070682_100007969 | 3300005337 | Bacteria | 5962 |
| 42 | Ga0070682_100028580 | 3300005337 | Bacteria | 3355 |
| 43 | Ga0070682_100030805 | 3300005337 | Plasmid | 3241 |
| 44 | Ga0068868_100018112 | 3300005338 | Bacteria | 5258 |
| 45 | Ga0068868_100208673 | 3300005338 | Bacteria | 1632 |
| 46 | Ga0070660_100003870 | 3300005339 | Bacteria | 10336 |
| 47 | Ga0070660_100019473 | 3300005339 | Bacteria | 4974 |
| 48 | Ga0070660_100022278 | 3300005339 | Bacteria | 4682 |
| 49 | Ga0070660_100026453 | 3300005339 | Bacteria | 4319 |
| 50 | Ga0070660_100277754 | 3300005339 | Bacteria | 1370 |
| 51 | Ga0070689_100031062 | 3300005340 | Bacteria | 4058 |
| 52 | Ga0070689_100258241 | 3300005340 | Unclassified | 1439 |
| 53 | Ga0070691_10004859 | 3300005341 | Bacteria | 6121 |
| 54 | Ga0070691_10089795 | 3300005341 | Bacteria | 1514 |
| 55 | Ga0070661_100009866 | 3300005344 | Bacteria | 6624 |
| 56 | Ga0070661_100048625 | 3300005344 | Bacteria | 3105 |
| 57 | Ga0070661_100063664 | 3300005344 | Plasmid | 2709 |
| 58 | Ga0070661_100116508 | 3300005344 | Bacteria | 1998 |
| 59 | Ga0070661_100156226 | 3300005344 | Bacteria | 1726 |
| 60 | Ga0070668_100013726 | 3300005347 | Bacteria | 6051 |
| 61 | Ga0070669_100014406 | 3300005353 | Bacteria | 5628 |
| 62 | Ga0070669_100414063 | 3300005353 | Bacteria | 1105 |
| 63 | Ga0070675_100018170 | 3300005354 | Bacteria | 5596 |
| 64 | Ga0070675_100276160 | 3300005354 | Bacteria | 1476 |
| 65 | Ga0070671_100016514 | 3300005355 | Bacteria | 5967 |
| 66 | Ga0070671_100024253 | 3300005355 | Bacteria | 4965 |
| 67 | Ga0070671_100034258 | 3300005355 | Bacteria | 4203 |
| 68 | Ga0070671_100048918 | 3300005355 | Bacteria | 3518 |
| 69 | Ga0070671_100170292 | 3300005355 | Bacteria | 1842 |
| 70 | Ga0070674_100005693 | 3300005356 | Bacteria | 7227 |
| 71 | Ga0070674_100558009 | 3300005356 | Bacteria | 962 |
| 72 | Ga0070673_100040424 | 3300005364 | Bacteria | 3578 |
| 73 | Ga0070673_100045977 | 3300005364 | Plasmid | 3389 |
| 74 | Ga0070673_100055936 | 3300005364 | Bacteria | 3110 |
| 75 | Ga0070659_100058630 | 3300005366 | Bacteria | 3039 |
| 76 | Ga0070659_100144527 | 3300005366 | Unclassified | 1937 |
| 77 | Ga0070659_100281140 | 3300005366 | Bacteria | 1384 |
| 78 | Ga0070667_100014138 | 3300005367 | Bacteria | 6595 |
| 79 | Ga0070667_100024258 | 3300005367 | Bacteria | 5037 |
| 80 | Ga0070703_10003201 | 3300005406 | Bacteria | 4676 |
| 81 | Ga0070709_10002262 | 3300005434 | Bacteria | 10432 |
| 82 | Ga0070709_10010070 | 3300005434 | Bacteria | 5225 |
| 83 | Ga0070709_10013419 | 3300005434 | Bacteria | 4606 |
| 84 | Ga0070709_10018177 | 3300005434 | Plasmid | 4044 |
| 85 | Ga0070714_100022361 | 3300005435 | Bacteria | 5185 |
| 86 | Ga0070714_100054927 | 3300005435 | Plasmid | 3403 |
| 87 | Ga0070714_100152613 | 3300005435 | Bacteria | 2083 |
| 88 | Ga0070714_100181091 | 3300005435 | Bacteria | 1917 |
| 89 | Ga0070714_100269818 | 3300005435 | Bacteria | 1578 |
| 90 | Ga0070714_100452677 | 3300005435 | Bacteria | 1220 |
| 91 | Ga0070713_100003057 | 3300005436 | Bacteria | 10992 |
| 92 | Ga0070713_100043687 | 3300005436 | Plasmid | 3665 |
| 93 | Ga0070713_100055202 | 3300005436 | Bacteria | 3300 |
| 94 | Ga0070713_100055241 | 3300005436 | Bacteria | 3299 |
| 95 | Ga0070713_100055279 | 3300005436 | Bacteria | 3297 |
| 96 | Ga0070713_100194352 | 3300005436 | Bacteria | 1830 |
| 97 | Ga0070710_10002325 | 3300005437 | Bacteria | 8998 |
| 98 | Ga0070710_10072646 | 3300005437 | Bacteria | 1987 |
| 99 | Ga0070710_10119431 | 3300005437 | Bacteria | 1594 |
| 100 | Ga0070701_10004348 | 3300005438 | Bacteria | 5724 |
| 101 | Ga0070711_100002208 | 3300005439 | Bacteria | 11048 |
| 102 | Ga0070711_100011944 | 3300005439 | Bacteria | 5407 |
| 103 | Ga0070711_100013080 | 3300005439 | Bacteria | 5204 |
| 104 | Ga0070711_100130120 | 3300005439 | Bacteria | 1873 |
| 105 | Ga0070711_100187418 | 3300005439 | Bacteria | 1587 |
| 106 | Ga0070711_100237930 | 3300005439 | Unclassified | 1422 |
| 107 | Ga0070705_100023373 | 3300005440 | Bacteria | 3318 |
| 108 | Ga0070700_100199792 | 3300005441 | Unclassified | 1404 |
| 109 | Ga0070694_100019693 | 3300005444 | Bacteria | 4294 |
| 110 | Ga0070708_100120926 | 3300005445 | Bacteria | 2416 |
| 111 | Ga0070708_100130012 | 3300005445 | Bacteria | 2330 |
| 112 | Ga0070663_100011845 | 3300005455 | Bacteria | 5495 |
| 113 | Ga0070663_100027341 | 3300005455 | Bacteria | 3873 |
| 114 | Ga0070678_100022020 | 3300005456 | Bacteria | 4213 |
| 115 | Ga0070678_100066613 | 3300005456 | Bacteria | 2677 |
| 116 | Ga0070678_100189994 | 3300005456 | Bacteria | 1688 |
| 117 | Ga0070678_100408231 | 3300005456 | Bacteria | 1181 |
| 118 | Ga0070662_100033312 | 3300005457 | Bacteria | 3626 |
| 119 | Ga0070662_100164122 | 3300005457 | Unclassified | 1739 |
| 120 | Ga0070681_10023502 | 3300005458 | Bacteria | 6200 |
| 121 | Ga0070681_10032947 | 3300005458 | Bacteria | 5201 |
| 122 | Ga0070681_10059728 | 3300005458 | Bacteria | 3792 |
| 123 | Ga0070681_10076670 | 3300005458 | Bacteria | 3301 |
| 124 | Ga0070681_10112479 | 3300005458 | Bacteria | 2662 |
| 125 | Ga0068867_100021271 | 3300005459 | Bacteria | 4629 |
| 126 | Ga0068867_100128322 | 3300005459 | Unclassified | 1968 |
| 127 | Ga0068867_100185270 | 3300005459 | Bacteria | 1657 |
| 128 | Ga0070685_10074353 | 3300005466 | Unclassified | 2022 |
| 129 | Ga0070707_100055777 | 3300005468 | Bacteria | 3788 |
| 130 | Ga0070698_100028359 | 3300005471 | Bacteria | 5815 |
| 131 | Ga0070699_100143856 | 3300005518 | Bacteria | 2107 |
| 132 | Ga0070679_100009249 | 3300005530 | Bacteria | 9313 |
| 133 | Ga0070679_100009709 | 3300005530 | Bacteria | 9103 |
| 134 | Ga0070679_100051732 | 3300005530 | Bacteria | 4091 |
| 135 | Ga0070679_100098832 | 3300005530 | Bacteria | 2906 |
| 136 | Ga0070679_100173681 | 3300005530 | Bacteria | 2128 |
| 137 | Ga0070679_100342777 | 3300005530 | Bacteria | 1442 |
| 138 | Ga0070684_100008556 | 3300005535 | Bacteria | 8010 |
| 139 | Ga0070684_100022473 | 3300005535 | Bacteria | 5261 |
| 140 | Ga0070684_100063130 | 3300005535 | Bacteria | 3246 |
| 141 | Ga0070684_100092000 | 3300005535 | Bacteria | 2699 |
| 142 | Ga0070684_100271447 | 3300005535 | Bacteria | 1553 |
| 143 | Ga0070697_100079996 | 3300005536 | Bacteria | 2692 |
| 144 | Ga0068853_100003634 | 3300005539 | Bacteria | 11828 |
| 145 | Ga0068853_100045254 | 3300005539 | Bacteria | 3769 |
| 146 | Ga0068853_100097553 | 3300005539 | Bacteria | 2595 |
| 147 | Ga0068853_100175843 | 3300005539 | Bacteria | 1939 |
| 148 | Ga0068853_100177249 | 3300005539 | Bacteria | 1932 |
| 149 | Ga0068853_100179629 | 3300005539 | Bacteria | 1919 |
| 150 | Ga0068853_100529554 | 3300005539 | Bacteria | 1115 |
| 151 | Ga0070672_100006742 | 3300005543 | Bacteria | 7744 |
| 152 | Ga0070672_100105181 | 3300005543 | Bacteria | 2294 |
| 153 | Ga0070686_100116734 | 3300005544 | Unclassified | 1827 |
| 154 | Ga0070695_100027274 | 3300005545 | Bacteria | 3537 |
| 155 | Ga0070696_100027513 | 3300005546 | Bacteria | 3875 |
| 156 | Ga0070693_100031082 | 3300005547 | Bacteria | 2924 |
| 157 | Ga0070665_100063185 | 3300005548 | Bacteria | 3712 |
| 158 | Ga0070665_100065216 | 3300005548 | Plasmid | 3653 |
| 159 | Ga0070665_100071799 | 3300005548 | Bacteria | 3468 |
| 160 | Ga0070665_100080708 | 3300005548 | Bacteria | 3258 |
| 161 | Ga0070665_100105307 | 3300005548 | Bacteria | 2823 |
| 162 | Ga0070665_100172385 | 3300005548 | Bacteria | 2164 |
| 163 | Ga0070665_100203035 | 3300005548 | Bacteria | 1982 |
| 164 | Ga0070665_100265636 | 3300005548 | Bacteria | 1717 |
| 165 | Ga0070665_100380649 | 3300005548 | Bacteria | 1418 |
| 166 | Ga0070665_100428297 | 3300005548 | Bacteria | 1332 |
| 167 | Ga0070704_100025802 | 3300005549 | Bacteria | 3873 |
| 168 | Ga0068855_100018412 | 3300005563 | Bacteria | 8391 |
| 169 | Ga0068855_100019735 | 3300005563 | Bacteria | 8094 |
| 170 | Ga0068855_100112477 | 3300005563 | Bacteria | 3124 |
| 171 | Ga0068855_100125312 | 3300005563 | Bacteria | 2937 |
| 172 | Ga0068855_100259104 | 3300005563 | Bacteria | 1938 |
| 173 | Ga0068855_100261934 | 3300005563 | Bacteria | 1926 |
| 174 | Ga0068855_100262469 | 3300005563 | Bacteria | 1923 |
| 175 | Ga0068855_100410537 | 3300005563 | Bacteria | 1482 |
| 176 | Ga0068855_100432165 | 3300005563 | Unclassified | 1439 |
| 177 | Ga0068855_100454183 | 3300005563 | Bacteria | 1398 |
| 178 | Ga0068855_100495803 | 3300005563 | Bacteria | 1328 |
| 179 | Ga0068855_100739264 | 3300005563 | Bacteria | 1050 |
| 180 | Ga0070664_100047876 | 3300005564 | Bacteria | 3613 |
| 181 | Ga0070664_100069419 | 3300005564 | Bacteria | 3015 |
| 182 | Ga0070664_100238256 | 3300005564 | Bacteria | 1633 |
| 183 | Ga0068857_100003181 | 3300005577 | Bacteria | 13618 |
| 184 | Ga0068857_100096073 | 3300005577 | Bacteria | 2655 |
| 185 | Ga0068857_100681426 | 3300005577 | Bacteria | 976 |
| 186 | Ga0068854_100016856 | 3300005578 | Bacteria | 4878 |
| 187 | Ga0068854_100030721 | 3300005578 | Bacteria | 3729 |
| 188 | Ga0068854_100122052 | 3300005578 | Bacteria | 1980 |
| 189 | Ga0068854_100155813 | 3300005578 | Bacteria | 1765 |
| 190 | Ga0068856_100000781 | 3300005614 | Bacteria | 34483 |
| 191 | Ga0068856_100024188 | 3300005614 | Bacteria | 5909 |
| 192 | Ga0068856_100047838 | 3300005614 | Bacteria | 4214 |
| 193 | Ga0068856_100073843 | 3300005614 | Bacteria | 3377 |
| 194 | Ga0068856_100074006 | 3300005614 | Bacteria | 3372 |
| 195 | Ga0068856_100116233 | 3300005614 | Bacteria | 2675 |
| 196 | Ga0068856_100178360 | 3300005614 | Bacteria | 2137 |
| 197 | Ga0068856_100180758 | 3300005614 | Bacteria | 2122 |
| 198 | Ga0068856_100298360 | 3300005614 | Bacteria | 1629 |
| 199 | Ga0068856_100320920 | 3300005614 | Unclassified | 1566 |
| 200 | Ga0068856_100322290 | 3300005614 | Bacteria | 1563 |
| 201 | Ga0070702_100046391 | 3300005615 | Unclassified | 2463 |
| 202 | Ga0070702_100149746 | 3300005615 | Bacteria | 1496 |
| 203 | Ga0070702_100323136 | 3300005615 | Bacteria | 1076 |
| 204 | Ga0068852_100024735 | 3300005616 | Bacteria | 4858 |
| 205 | Ga0068852_100026321 | 3300005616 | Bacteria | 4727 |
| 206 | Ga0068852_100028959 | 3300005616 | Bacteria | 4542 |
| 207 | Ga0068852_100204250 | 3300005616 | Bacteria | 1871 |
| 208 | Ga0068852_100212283 | 3300005616 | Bacteria | 1837 |
| 209 | Ga0068852_100545435 | 3300005616 | Unclassified | 1159 |
| 210 | Ga0068859_100035913 | 3300005617 | Bacteria | 4973 |
| 211 | Ga0068859_100154399 | 3300005617 | Bacteria | 2372 |
| 212 | Ga0068859_100485774 | 3300005617 | Unclassified | 1330 |
| 213 | Ga0068864_100026533 | 3300005618 | Bacteria | 4885 |
| 214 | Ga0068864_100287017 | 3300005618 | Unclassified | 1537 |
| 215 | Ga0068866_10022841 | 3300005718 | Bacteria | 2900 |
| 216 | Ga0068861_100019676 | 3300005719 | Bacteria | 4823 |
| 217 | Ga0068861_100048184 | 3300005719 | Bacteria | 3220 |
| 218 | Ga0068861_100204537 | 3300005719 | Bacteria | 1659 |
| 219 | Ga0068863_100006825 | 3300005841 | Bacteria | 11196 |
| 220 | Ga0068858_100127566 | 3300005842 | Unclassified | 2384 |
| 221 | Ga0068860_100018432 | 3300005843 | Bacteria | 6790 |
| 222 | Ga0068860_100143296 | 3300005843 | Bacteria | 2298 |
| 223 | Ga0068860_100143725 | 3300005843 | Bacteria | 2294 |
| 224 | Ga0068862_100010222 | 3300005844 | Bacteria | 7743 |
| 225 | Ga0068862_100028055 | 3300005844 | Bacteria | 4741 |
| 226 | Ga0068862_100083389 | 3300005844 | Bacteria | 2775 |
| 227 | Ga0081455_10000200 | 3300005937 | Bacteria | 76013 |
| 228 | Ga0081455_10000768 | 3300005937 | Bacteria | 41613 |
| 229 | Ga0081455_10023827 | 3300005937 | Bacteria | 5687 |
| 230 | Ga0081540_1002136 | 3300005983 | Bacteria | 16449 |
| 231 | Ga0081540_1008268 | 3300005983 | Bacteria | 7287 |
| 232 | Ga0081540_1013689 | 3300005983 | Bacteria | 5258 |
| 233 | Ga0070717_10003779 | 3300006028 | Bacteria | 10878 |
| 234 | Ga0070717_10034264 | 3300006028 | Bacteria | 4104 |
| 235 | Ga0070717_10351343 | 3300006028 | Bacteria | 1318 |
| 236 | Ga0070717_10395519 | 3300006028 | Bacteria | 1241 |
| 237 | Ga0075365_10046636 | 3300006038 | Bacteria | 2847 |
| 238 | Ga0075365_10051949 | 3300006038 | Bacteria | 2709 |
| 239 | Ga0075365_10065320 | 3300006038 | Bacteria | 2438 |
| 240 | Ga0075368_10008811 | 3300006042 | Bacteria | 3612 |
| 241 | Ga0075363_100065887 | 3300006048 | Bacteria | 1959 |
| 242 | Ga0070715_10208276 | 3300006163 | Bacteria | 998 |
| 243 | Ga0070716_100008278 | 3300006173 | Bacteria | 5157 |
| 244 | Ga0070716_100012612 | 3300006173 | Plasmid | 4288 |
| 245 | Ga0070716_100078406 | 3300006173 | Bacteria | 1964 |
| 246 | Ga0070712_100328792 | 3300006175 | Bacteria | 1245 |
| 247 | Ga0075367_10016061 | 3300006178 | Bacteria | 4082 |
| 248 | Ga0075367_10026524 | 3300006178 | Bacteria | 3287 |
| 249 | Ga0075367_10048065 | 3300006178 | Bacteria | 2512 |
| 250 | Ga0075427_10000041 | 3300006194 | Bacteria | 9241 |
| 251 | Ga0097621_100011867 | 3300006237 | Bacteria | 6441 |
| 252 | Ga0097621_100024301 | 3300006237 | Bacteria | 4730 |
| 253 | Ga0075370_10019677 | 3300006353 | Bacteria | 3679 |
| 254 | Ga0068871_100019303 | 3300006358 | Bacteria | 5203 |
| 255 | Ga0068871_100057668 | 3300006358 | Bacteria | 3160 |
| 256 | Ga0068871_100157136 | 3300006358 | Bacteria | 1942 |
| 257 | Ga0068871_100162788 | 3300006358 | Bacteria | 1909 |
| 258 | Ga0068871_100300703 | 3300006358 | Bacteria | 1408 |
| 259 | Ga0075428_100003399 | 3300006844 | Bacteria | 17407 |
| 260 | Ga0075430_100000133 | 3300006846 | Bacteria | 47377 |
| 261 | Ga0075431_100002259 | 3300006847 | Bacteria | 18467 |
| 262 | Ga0075433_10000506 | 3300006852 | Bacteria | 25421 |
| 263 | Ga0075433_10025119 | 3300006852 | Bacteria | 5036 |
| 264 | Ga0075433_10038792 | 3300006852 | Bacteria | 4116 |
| 265 | Ga0075434_100000472 | 3300006871 | Bacteria | 30053 |
| 266 | Ga0075434_100008091 | 3300006871 | Bacteria | 9750 |
| 267 | Ga0075434_100044057 | 3300006871 | Bacteria | 4427 |
| 268 | Ga0075434_100068627 | 3300006871 | Bacteria | 3532 |
| 269 | Ga0075434_100386460 | 3300006871 | Bacteria | 1420 |
| 270 | Ga0075434_100411167 | 3300006871 | Bacteria | 1374 |
| 271 | Ga0075429_100000163 | 3300006880 | Bacteria | 42270 |
| 272 | Ga0068865_100001544 | 3300006881 | Bacteria | 13429 |
| 273 | Ga0068865_100003466 | 3300006881 | Bacteria | 9451 |
| 274 | Ga0068865_100076577 | 3300006881 | Bacteria | 2388 |
| 275 | Ga0068865_100362686 | 3300006881 | Unclassified | 1177 |
| 276 | Ga0097620_100035916 | 3300006931 | Bacteria | 4973 |
| 277 | Ga0097620_100154402 | 3300006931 | Bacteria | 2372 |
| 278 | Ga0097620_100485755 | 3300006931 | Unclassified | 1330 |
| 279 | Ga0099825_1036559 | 3300006941 | Bacteria | 1683 |
| 280 | Ga0099824_1023056 | 3300006942 | Bacteria | 3951 |
| 281 | Ga0099822_1001448 | 3300006943 | Bacteria | 27661 |
| 282 | Ga0099823_1004051 | 3300006944 | Bacteria | 14168 |
| 283 | Ga0075435_100017200 | 3300007076 | Bacteria | 5466 |
| 284 | Ga0075435_100056759 | 3300007076 | Bacteria | 3166 |
| 285 | Ga0099794_10060242 | 3300007265 | Bacteria | 1843 |
| 286 | Ga0099795_10003998 | 3300007788 | Bacteria | 3742 |
| 287 | Ga0099795_10010789 | 3300007788 | Bacteria | 2705 |
| 288 | Ga0099795_10025253 | 3300007788 | Bacteria | 1991 |
| 289 | Ga0099795_10134516 | 3300007788 | Bacteria | 1000 |
| 290 | Ga0105251_10010431 | 3300009011 | Bacteria | 5391 |
| 291 | Ga0105240_10008946 | 3300009093 | Bacteria | 14238 |
| 292 | Ga0105240_10023552 | 3300009093 | Bacteria | 8137 |
| 293 | Ga0105240_10029706 | 3300009093 | Bacteria | 7114 |
| 294 | Ga0105240_10039692 | 3300009093 | Bacteria | 6026 |
| 295 | Ga0105240_10048624 | 3300009093 | Bacteria | 5359 |
| 296 | Ga0105240_10092782 | 3300009093 | Bacteria | 3685 |
| 297 | Ga0105240_10427362 | 3300009093 | Unclassified | 1487 |
| 298 | Ga0111539_10000389 | 3300009094 | Bacteria | 54333 |
| 299 | Ga0111539_10001808 | 3300009094 | Bacteria | 28479 |
| 300 | Ga0105245_10031587 | 3300009098 | Bacteria | 4687 |
| 301 | Ga0105245_10035028 | 3300009098 | Bacteria | 4454 |
| 302 | Ga0105245_10062438 | 3300009098 | Bacteria | 3361 |
| 303 | Ga0105245_10154012 | 3300009098 | Bacteria | 2176 |
| 304 | Ga0105245_10247473 | 3300009098 | Bacteria | 1731 |
| 305 | Ga0105247_10031859 | 3300009101 | Bacteria | 3201 |
| 306 | Ga0105247_10034936 | 3300009101 | Bacteria | 3062 |
| 307 | Ga0105247_10056334 | 3300009101 | Bacteria | 2427 |
| 308 | Ga0114129_10018380 | 3300009147 | Bacteria | 9958 |
| 309 | Ga0114129_10364864 | 3300009147 | Bacteria | 1910 |
| 310 | Ga0114129_10609708 | 3300009147 | Bacteria | 1413 |
| 311 | Ga0105243_10040850 | 3300009148 | Bacteria | 3625 |
| 312 | Ga0105241_10024018 | 3300009174 | Bacteria | 4526 |
| 313 | Ga0105241_10031108 | 3300009174 | Bacteria | 3994 |
| 314 | Ga0105241_10081747 | 3300009174 | Bacteria | 2531 |
| 315 | Ga0105242_10082937 | 3300009176 | Bacteria | 2683 |
| 316 | Ga0105242_10097450 | 3300009176 | Bacteria | 2486 |
| 317 | Ga0105242_10271376 | 3300009176 | Bacteria | 1537 |
| 318 | Ga0105242_10803490 | 3300009176 | Bacteria | 931 |
| 319 | Ga0105248_10011779 | 3300009177 | Bacteria | 9647 |
| 320 | Ga0105248_10046950 | 3300009177 | Bacteria | 4842 |
| 321 | Ga0105248_10237637 | 3300009177 | Bacteria | 2051 |
| 322 | Ga0105248_10261174 | 3300009177 | Bacteria | 1949 |
| 323 | Ga0105237_10004719 | 3300009545 | Bacteria | 15684 |
| 324 | Ga0105237_10007432 | 3300009545 | Bacteria | 11993 |
| 325 | Ga0105237_10019250 | 3300009545 | Bacteria | 7053 |
| 326 | Ga0105237_10045568 | 3300009545 | Bacteria | 4412 |
| 327 | Ga0105237_10381648 | 3300009545 | Bacteria | 1414 |
| 328 | Ga0105237_10410939 | 3300009545 | Unclassified | 1358 |
| 329 | Ga0105237_10470423 | 3300009545 | Bacteria | 1263 |
| 330 | Ga0105238_10031611 | 3300009551 | Bacteria | 5389 |
| 331 | Ga0105238_10040511 | 3300009551 | Bacteria | 4720 |
| 332 | Ga0105238_10045455 | 3300009551 | Plasmid | 4435 |
| 333 | Ga0105238_10064854 | 3300009551 | Bacteria | 3652 |
| 334 | Ga0105238_10110436 | 3300009551 | Bacteria | 2730 |
| 335 | Ga0105238_10292182 | 3300009551 | Bacteria | 1612 |
| 336 | Ga0105238_10374066 | 3300009551 | Bacteria | 1415 |
| 337 | Ga0105249_10019871 | 3300009553 | Bacteria | 5999 |
| 338 | Ga0105249_10067975 | 3300009553 | Bacteria | 3285 |
| 339 | Ga0105249_10094865 | 3300009553 | Bacteria | 2797 |
| 340 | Ga0099796_10043386 | 3300010159 | Bacteria | 1532 |
| 341 | Ga0105239_10043179 | 3300010375 | Bacteria | 4940 |
| 342 | Ga0105239_10053738 | 3300010375 | Bacteria | 4418 |
| 343 | Ga0105239_10064549 | 3300010375 | Bacteria | 4019 |
| 344 | Ga0105239_10079664 | 3300010375 | Bacteria | 3604 |
| 345 | Ga0105239_10168122 | 3300010375 | Bacteria | 2452 |
| 346 | Ga0105239_10282663 | 3300010375 | Bacteria | 1868 |
| 347 | Ga0105239_10316055 | 3300010375 | Bacteria | 1761 |
| 348 | Ga0105239_10322586 | 3300010375 | Bacteria | 1742 |
| 349 | Ga0105239_10323551 | 3300010375 | Bacteria | 1739 |
| 350 | Ga0105239_10330197 | 3300010375 | Bacteria | 1720 |
| 351 | Ga0105239_10826421 | 3300010375 | Bacteria | 1062 |
| 352 | Ga0105246_10012128 | 3300011119 | Bacteria | 5371 |
| 353 | Ga0105246_10054989 | 3300011119 | Bacteria | 2745 |
| 354 | Ga0105246_10332364 | 3300011119 | Bacteria | 1239 |
| 355 | Ga0157326_1008038 | 3300012513 | Unclassified | 1146 |
| 356 | Ga0157373_10010494 | 3300013100 | Bacteria | 6814 |
| 357 | Ga0157373_10024897 | 3300013100 | Bacteria | 4334 |
| 358 | Ga0157373_10204840 | 3300013100 | Bacteria | 1391 |
| 359 | Ga0157371_10007078 | 3300013102 | Bacteria | 9121 |
| 360 | Ga0157371_10036676 | 3300013102 | Bacteria | 3511 |
| 361 | Ga0157371_10128334 | 3300013102 | Bacteria | 1804 |
| 362 | Ga0157371_10158591 | 3300013102 | Bacteria | 1615 |
| 363 | Ga0157370_10041078 | 3300013104 | Bacteria | 4464 |
| 364 | Ga0157370_10181306 | 3300013104 | Bacteria | 1957 |
| 365 | Ga0157370_10238914 | 3300013104 | Bacteria | 1681 |
| 366 | Ga0157369_10008072 | 3300013105 | Bacteria | 12072 |
| 367 | Ga0157369_10033594 | 3300013105 | Bacteria | 5636 |
| 368 | Ga0157369_10236445 | 3300013105 | Unclassified | 1909 |
| 369 | Ga0157369_10386899 | 3300013105 | Bacteria | 1451 |
| 370 | Ga0157369_10522628 | 3300013105 | Bacteria | 1228 |
| 371 | Ga0157369_10777587 | 3300013105 | Bacteria | 984 |
| 372 | Ga0157374_10002692 | 3300013296 | Bacteria | 14940 |
| 373 | Ga0157374_10164515 | 3300013296 | Bacteria | 2162 |
| 374 | Ga0157374_10224597 | 3300013296 | Bacteria | 1844 |
| 375 | Ga0157378_10049119 | 3300013297 | Bacteria | 3753 |
| 376 | Ga0157378_10104776 | 3300013297 | Bacteria | 2586 |
| 377 | Ga0157378_10108129 | 3300013297 | Bacteria | 2546 |
| 378 | Ga0157378_10396452 | 3300013297 | Bacteria | 1359 |
| 379 | Ga0157378_10471250 | 3300013297 | Bacteria | 1249 |
| 380 | Ga0163162_10022106 | 3300013306 | Bacteria | 6268 |
| 381 | Ga0163162_10022234 | 3300013306 | Bacteria | 6250 |
| 382 | Ga0163162_10029020 | 3300013306 | Bacteria | 5475 |
| 383 | Ga0163162_10081453 | 3300013306 | Bacteria | 3307 |
| 384 | Ga0163162_10107677 | 3300013306 | Bacteria | 2883 |
| 385 | Ga0163162_10198425 | 3300013306 | Bacteria | 2135 |
| 386 | Ga0163162_10324040 | 3300013306 | Bacteria | 1673 |
| 387 | Ga0157372_10016582 | 3300013307 | Bacteria | 7904 |
| 388 | Ga0157372_10107362 | 3300013307 | Bacteria | 3194 |
| 389 | Ga0157372_10214288 | 3300013307 | Bacteria | 2232 |
| 390 | Ga0157372_10423344 | 3300013307 | Bacteria | 1552 |
| 391 | Ga0157375_10064892 | 3300013308 | Bacteria | 3637 |
| 392 | Ga0157375_10430055 | 3300013308 | Bacteria | 1486 |
| 393 | Ga0163163_10029384 | 3300014325 | Bacteria | 5287 |
| 394 | Ga0163163_10059092 | 3300014325 | Bacteria | 3791 |
| 395 | Ga0163163_10155656 | 3300014325 | Bacteria | 2330 |
| 396 | Ga0157380_10013506 | 3300014326 | Bacteria | 5957 |
| 397 | Ga0157377_10013798 | 3300014745 | Bacteria | 4096 |
| 398 | Ga0157377_10226916 | 3300014745 | Bacteria | 1199 |
| 399 | Ga0157379_10010153 | 3300014968 | Bacteria | 8207 |
| 400 | Ga0157379_10027560 | 3300014968 | Bacteria | 5058 |
| 401 | Ga0157376_10022095 | 3300014969 | Bacteria | 4952 |
| 402 | Ga0157376_10109705 | 3300014969 | Bacteria | 2426 |
| 403 | Ga0157376_10113532 | 3300014969 | Unclassified | 2389 |
| 404 | Ga0157376_10237036 | 3300014969 | Bacteria | 1698 |
| 405 | Ga0163161_10006229 | 3300017792 | Bacteria | 8265 |
| 406 | Ga0163161_10035277 | 3300017792 | Plasmid | 3580 |
| 407 | Ga0163161_10039404 | 3300017792 | Bacteria | 3392 |
| 408 | Ga0163161_10047578 | 3300017792 | Bacteria | 3097 |
| 409 | Ga0163161_10135289 | 3300017792 | Bacteria | 1863 |
| 410 | Ga0206356_10553992 | 3300020070 | Bacteria | 2161 |
| 411 | Ga0206356_11532789 | 3300020070 | Bacteria | 1374 |
| 412 | Ga0206354_11292144 | 3300020081 | Bacteria | 1356 |
| 413 | Ga0206353_10342907 | 3300020082 | Bacteria | 1126 |
| 414 | Ga0214542_1000156 | 3300021321 | Bacteria | 101631 |
| 415 | Ga0214545_1000078 | 3300021324 | Bacteria | 101631 |
| 416 | Ga0214543_1000136 | 3300021327 | Bacteria | 101629 |
| 417 | Ga0213875_10003786 | 3300021388 | Bacteria | 8505 |
| 418 | Ga0213871_10000896 | 3300021441 | Bacteria | 4553 |
| 419 | Ga0224572_1006509 | 3300024225 | Bacteria | 2114 |
| 420 | Ga0228598_1015888 | 3300024227 | Bacteria | 1485 |
| 421 | Ga0207425_1014237 | 3300025245 | Bacteria | 1811 |
| 422 | Ga0209677_104346 | 3300025253 | Bacteria | 4129 |
| 423 | Ga0209233_1005084 | 3300025261 | Bacteria | 4400 |
| 424 | Ga0207666_1000311 | 3300025271 | Bacteria | 6768 |
| 425 | Ga0209455_1006888 | 3300025272 | Bacteria | 3297 |
| 426 | Ga0209673_1021558 | 3300025273 | Bacteria | 2249 |
| 427 | Ga0209564_1008607 | 3300025295 | Bacteria | 5004 |
| 428 | Ga0209758_1000705 | 3300025297 | Bacteria | 49585 |
| 429 | Ga0209758_1000932 | 3300025297 | Bacteria | 39573 |
| 430 | Ga0209758_1000986 | 3300025297 | Bacteria | 38258 |
| 431 | Ga0209758_1002299 | 3300025297 | Bacteria | 19758 |
| 432 | Ga0209758_1030972 | 3300025297 | Bacteria | 2204 |
| 433 | Ga0207426_1000632 | 3300025302 | Bacteria | 44581 |
| 434 | Ga0207426_1001240 | 3300025302 | Bacteria | 22455 |
| 435 | Ga0207426_1006296 | 3300025302 | Bacteria | 5190 |
| 436 | Ga0207426_1020313 | 3300025302 | Bacteria | 2309 |
| 437 | Ga0209257_1001185 | 3300025304 | Bacteria | 32850 |
| 438 | Ga0209257_1010432 | 3300025304 | Bacteria | 4703 |
| 439 | Ga0207697_10006626 | 3300025315 | Bacteria | 5222 |
| 440 | Ga0207713_1077773 | 3300025735 | Unclassified | 1204 |
| 441 | Ga0207653_10002805 | 3300025885 | Bacteria | 5539 |
| 442 | Ga0207682_10000009 | 3300025893 | Bacteria | 86366 |
| 443 | Ga0207682_10014469 | 3300025893 | Bacteria | 3074 |
| 444 | Ga0207692_10063809 | 3300025898 | Bacteria | 1916 |
| 445 | Ga0207692_10069546 | 3300025898 | Bacteria | 1850 |
| 446 | Ga0207692_10203761 | 3300025898 | Bacteria | 1164 |
| 447 | Ga0207710_10001303 | 3300025900 | Bacteria | 12616 |
| 448 | Ga0207710_10002730 | 3300025900 | Bacteria | 8088 |
| 449 | Ga0207688_10000892 | 3300025901 | Bacteria | 15087 |
| 450 | Ga0207680_10016229 | 3300025903 | Plasmid | 3905 |
| 451 | Ga0207680_10058944 | 3300025903 | Bacteria | 2329 |
| 452 | Ga0207647_10002160 | 3300025904 | Bacteria | 15015 |
| 453 | Ga0207647_10016893 | 3300025904 | Bacteria | 4970 |
| 454 | Ga0207647_10048251 | 3300025904 | Bacteria | 2645 |
| 455 | Ga0207647_10110563 | 3300025904 | Unclassified | 1625 |
| 456 | Ga0207647_10249664 | 3300025904 | Bacteria | 1018 |
| 457 | Ga0207685_10051712 | 3300025905 | Unclassified | 1588 |
| 458 | Ga0207699_10001069 | 3300025906 | Bacteria | 12945 |
| 459 | Ga0207699_10007734 | 3300025906 | Bacteria | 5262 |
| 460 | Ga0207699_10033250 | 3300025906 | Bacteria | 2914 |
| 461 | Ga0207699_10040581 | 3300025906 | Bacteria | 2682 |
| 462 | Ga0207645_10000999 | 3300025907 | Bacteria | 23365 |
| 463 | Ga0207645_10064570 | 3300025907 | Bacteria | 2339 |
| 464 | Ga0207645_10066806 | 3300025907 | Bacteria | 2298 |
| 465 | Ga0207705_10081980 | 3300025909 | Bacteria | 2352 |
| 466 | Ga0207654_10015616 | 3300025911 | Bacteria | 3945 |
| 467 | Ga0207654_10025829 | 3300025911 | Plasmid | 3174 |
| 468 | Ga0207654_10040703 | 3300025911 | Bacteria | 2620 |
| 469 | Ga0207654_10090337 | 3300025911 | Bacteria | 1865 |
| 470 | Ga0207707_10006422 | 3300025912 | Bacteria | 10269 |
| 471 | Ga0207707_10020542 | 3300025912 | Bacteria | 5767 |
| 472 | Ga0207707_10027810 | 3300025912 | Bacteria | 4944 |
| 473 | Ga0207707_10062664 | 3300025912 | Bacteria | 3236 |
| 474 | Ga0207707_10154734 | 3300025912 | Bacteria | 2005 |
| 475 | Ga0207707_10372622 | 3300025912 | Bacteria | 1228 |
| 476 | Ga0207695_10000123 | 3300025913 | Bacteria | 232059 |
| 477 | Ga0207695_10057960 | 3300025913 | Bacteria | 4022 |
| 478 | Ga0207695_10088527 | 3300025913 | Bacteria | 3116 |
| 479 | Ga0207695_10155565 | 3300025913 | Bacteria | 2221 |
| 480 | Ga0207695_10189873 | 3300025913 | Bacteria | 1972 |
| 481 | Ga0207671_10009480 | 3300025914 | Bacteria | 8132 |
| 482 | Ga0207671_10035416 | 3300025914 | Bacteria | 3705 |
| 483 | Ga0207671_10041159 | 3300025914 | Bacteria | 3420 |
| 484 | Ga0207671_10252742 | 3300025914 | Bacteria | 1386 |
| 485 | Ga0207671_10527652 | 3300025914 | Bacteria | 941 |
| 486 | Ga0207693_10000565 | 3300025915 | Bacteria | 33481 |
| 487 | Ga0207693_10006473 | 3300025915 | Bacteria | 9705 |
| 488 | Ga0207693_10007042 | 3300025915 | Bacteria | 9281 |
| 489 | Ga0207693_10076615 | 3300025915 | Bacteria | 2619 |
| 490 | Ga0207693_10091642 | 3300025915 | Unclassified | 2383 |
| 491 | Ga0207693_10327417 | 3300025915 | Bacteria | 1199 |
| 492 | Ga0207663_10000239 | 3300025916 | Bacteria | 24165 |
| 493 | Ga0207663_10212720 | 3300025916 | Unclassified | 1402 |
| 494 | Ga0207660_10001283 | 3300025917 | Bacteria | 16867 |
| 495 | Ga0207660_10030183 | 3300025917 | Bacteria | 3725 |
| 496 | Ga0207660_10042221 | 3300025917 | Bacteria | 3200 |
| 497 | Ga0207660_10178226 | 3300025917 | Bacteria | 1649 |
| 498 | Ga0207662_10000025 | 3300025918 | Bacteria | 70078 |
| 499 | Ga0207662_10010323 | 3300025918 | Bacteria | 5155 |
| 500 | Ga0207657_10006857 | 3300025919 | Bacteria | 11750 |
| 501 | Ga0207657_10012765 | 3300025919 | Bacteria | 8273 |
| 502 | Ga0207657_10018108 | 3300025919 | Bacteria | 6739 |
| 503 | Ga0207657_10148090 | 3300025919 | Bacteria | 1914 |
| 504 | Ga0207657_10161621 | 3300025919 | Unclassified | 1819 |
| 505 | Ga0207657_10166069 | 3300025919 | Bacteria | 1790 |
| 506 | Ga0207657_10231905 | 3300025919 | Bacteria | 1476 |
| 507 | Ga0207649_10002186 | 3300025920 | Bacteria | 11047 |
| 508 | Ga0207649_10025741 | 3300025920 | Bacteria | 3434 |
| 509 | Ga0207649_10303134 | 3300025920 | Unclassified | 1169 |
| 510 | Ga0207649_10318780 | 3300025920 | Unclassified | 1141 |
| 511 | Ga0207652_10073521 | 3300025921 | Bacteria | 2974 |
| 512 | Ga0207652_10075776 | 3300025921 | Bacteria | 2932 |
| 513 | Ga0207652_10144808 | 3300025921 | Bacteria | 2126 |
| 514 | Ga0207652_10179454 | 3300025921 | Bacteria | 1902 |
| 515 | Ga0207652_10322632 | 3300025921 | Bacteria | 1394 |
| 516 | Ga0207652_10345915 | 3300025921 | Bacteria | 1342 |
| 517 | Ga0207646_10112011 | 3300025922 | Bacteria | 2449 |
| 518 | Ga0207646_10118738 | 3300025922 | Bacteria | 2375 |
| 519 | Ga0207681_10007074 | 3300025923 | Bacteria | 6881 |
| 520 | Ga0207681_10156754 | 3300025923 | Bacteria | 1712 |
| 521 | Ga0207694_10039207 | 3300025924 | Bacteria | 3645 |
| 522 | Ga0207694_10045928 | 3300025924 | Bacteria | 3375 |
| 523 | Ga0207694_10104378 | 3300025924 | Bacteria | 2249 |
| 524 | Ga0207694_10434838 | 3300025924 | Bacteria | 1094 |
| 525 | Ga0207694_10461524 | 3300025924 | Bacteria | 1061 |
| 526 | Ga0207650_10357355 | 3300025925 | Bacteria | 1203 |
| 527 | Ga0207659_10169970 | 3300025926 | Bacteria | 1719 |
| 528 | Ga0207659_10177614 | 3300025926 | Unclassified | 1684 |
| 529 | Ga0207659_10216169 | 3300025926 | Bacteria | 1539 |
| 530 | Ga0207687_10003202 | 3300025927 | Bacteria | 11093 |
| 531 | Ga0207687_10030484 | 3300025927 | Bacteria | 3637 |
| 532 | Ga0207687_10208342 | 3300025927 | Bacteria | 1532 |
| 533 | Ga0207687_10221870 | 3300025927 | Bacteria | 1489 |
| 534 | Ga0207687_10509783 | 3300025927 | Bacteria | 1005 |
| 535 | Ga0207700_10004367 | 3300025928 | Bacteria | 8326 |
| 536 | Ga0207700_10005825 | 3300025928 | Bacteria | 7404 |
| 537 | Ga0207700_10076952 | 3300025928 | Bacteria | 2590 |
| 538 | Ga0207664_10022280 | 3300025929 | Bacteria | 4728 |
| 539 | Ga0207664_10032782 | 3300025929 | Bacteria | 3985 |
| 540 | Ga0207664_10130661 | 3300025929 | Bacteria | 2113 |
| 541 | Ga0207644_10032924 | 3300025931 | Bacteria | 3620 |
| 542 | Ga0207644_10036076 | 3300025931 | Bacteria | 3469 |
| 543 | Ga0207644_10055831 | 3300025931 | Bacteria | 2848 |
| 544 | Ga0207644_10061984 | 3300025931 | Bacteria | 2710 |
| 545 | Ga0207644_10127632 | 3300025931 | Bacteria | 1943 |
| 546 | Ga0207690_10011755 | 3300025932 | Bacteria | 5236 |
| 547 | Ga0207690_10064867 | 3300025932 | Bacteria | 2495 |
| 548 | Ga0207690_10088473 | 3300025932 | Unclassified | 2182 |
| 549 | Ga0207690_10253542 | 3300025932 | Bacteria | 1360 |
| 550 | Ga0207706_10005363 | 3300025933 | Bacteria | 11952 |
| 551 | Ga0207706_10040844 | 3300025933 | Bacteria | 4112 |
| 552 | Ga0207706_10085400 | 3300025933 | Bacteria | 2775 |
| 553 | Ga0207706_10129804 | 3300025933 | Bacteria | 2217 |
| 554 | Ga0207686_10014315 | 3300025934 | Bacteria | 4412 |
| 555 | Ga0207686_10187791 | 3300025934 | Bacteria | 1471 |
| 556 | Ga0207709_10006190 | 3300025935 | Bacteria | 6736 |
| 557 | Ga0207709_10012682 | 3300025935 | Bacteria | 4646 |
| 558 | Ga0207709_10024392 | 3300025935 | Bacteria | 3453 |
| 559 | Ga0207670_10013997 | 3300025936 | Bacteria | 4749 |
| 560 | Ga0207670_10078501 | 3300025936 | Unclassified | 2302 |
| 561 | Ga0207670_10375891 | 3300025936 | Unclassified | 1131 |
| 562 | Ga0207669_10001324 | 3300025937 | Bacteria | 10540 |
| 563 | Ga0207669_10084772 | 3300025937 | Bacteria | 2043 |
| 564 | Ga0207704_10003457 | 3300025938 | Bacteria | 7181 |
| 565 | Ga0207665_10000127 | 3300025939 | Bacteria | 50413 |
| 566 | Ga0207665_10002113 | 3300025939 | Bacteria | 13436 |
| 567 | Ga0207665_10108803 | 3300025939 | Bacteria | 1945 |
| 568 | Ga0207665_10196496 | 3300025939 | Bacteria | 1468 |
| 569 | Ga0207665_10267556 | 3300025939 | Bacteria | 1268 |
| 570 | Ga0207691_10002604 | 3300025940 | Bacteria | 17616 |
| 571 | Ga0207691_10113799 | 3300025940 | Bacteria | 2404 |
| 572 | Ga0207691_10116097 | 3300025940 | Bacteria | 2376 |
| 573 | Ga0207691_10365968 | 3300025940 | Unclassified | 1232 |
| 574 | Ga0207711_10001071 | 3300025941 | Bacteria | 26139 |
| 575 | Ga0207711_10072335 | 3300025941 | Bacteria | 2995 |
| 576 | Ga0207711_10106384 | 3300025941 | Bacteria | 2489 |
| 577 | Ga0207711_10252392 | 3300025941 | Bacteria | 1620 |
| 578 | Ga0207689_10001156 | 3300025942 | Bacteria | 25400 |
| 579 | Ga0207689_10031636 | 3300025942 | Bacteria | 4403 |
| 580 | Ga0207689_10081386 | 3300025942 | Bacteria | 2662 |
| 581 | Ga0207661_10002078 | 3300025944 | Bacteria | 13776 |
| 582 | Ga0207661_10007789 | 3300025944 | Bacteria | 7627 |
| 583 | Ga0207661_10062965 | 3300025944 | Bacteria | 3003 |
| 584 | Ga0207679_10003209 | 3300025945 | Bacteria | 10084 |
| 585 | Ga0207679_10267358 | 3300025945 | Bacteria | 1461 |
| 586 | Ga0207679_10417424 | 3300025945 | Unclassified | 1183 |
| 587 | Ga0207667_10013288 | 3300025949 | Bacteria | 9430 |
| 588 | Ga0207667_10028603 | 3300025949 | Bacteria | 6052 |
| 589 | Ga0207667_10064143 | 3300025949 | Bacteria | 3836 |
| 590 | Ga0207667_10077987 | 3300025949 | Bacteria | 3434 |
| 591 | Ga0207667_10095327 | 3300025949 | Bacteria | 3072 |
| 592 | Ga0207667_10103467 | 3300025949 | Bacteria | 2937 |
| 593 | Ga0207667_10115171 | 3300025949 | Bacteria | 2771 |
| 594 | Ga0207667_10122695 | 3300025949 | Bacteria | 2677 |
| 595 | Ga0207667_10123806 | 3300025949 | Bacteria | 2663 |
| 596 | Ga0207667_10128039 | 3300025949 | Bacteria | 2615 |
| 597 | Ga0207667_10188431 | 3300025949 | Bacteria | 2117 |
| 598 | Ga0207667_10219159 | 3300025949 | Bacteria | 1950 |
| 599 | Ga0207667_10607125 | 3300025949 | Bacteria | 1103 |
| 600 | Ga0207651_10008497 | 3300025960 | Bacteria | 5550 |
| 601 | Ga0207651_10151130 | 3300025960 | Bacteria | 1807 |
| 602 | Ga0207651_10327218 | 3300025960 | Bacteria | 1283 |
| 603 | Ga0207712_10000579 | 3300025961 | Bacteria | 29666 |
| 604 | Ga0207668_10001403 | 3300025972 | Bacteria | 14194 |
| 605 | Ga0207668_10085216 | 3300025972 | Bacteria | 2305 |
| 606 | Ga0207640_10003644 | 3300025981 | Bacteria | 8306 |
| 607 | Ga0207640_10066874 | 3300025981 | Bacteria | 2403 |
| 608 | Ga0207640_10075564 | 3300025981 | Bacteria | 2284 |
| 609 | Ga0207640_10558073 | 3300025981 | Bacteria | 963 |
| 610 | Ga0207658_10018420 | 3300025986 | Bacteria | 4821 |
| 611 | Ga0207658_10130939 | 3300025986 | Bacteria | 2015 |
| 612 | Ga0207677_10006044 | 3300026023 | Bacteria | 6604 |
| 613 | Ga0207677_10117181 | 3300026023 | Unclassified | 1996 |
| 614 | Ga0207677_10124489 | 3300026023 | Bacteria | 1945 |
| 615 | Ga0207703_10008872 | 3300026035 | Bacteria | 7922 |
| 616 | Ga0207703_10014416 | 3300026035 | Bacteria | 6164 |
| 617 | Ga0207703_10130992 | 3300026035 | Bacteria | 2166 |
| 618 | Ga0207703_10184537 | 3300026035 | Bacteria | 1843 |
| 619 | Ga0207703_10306384 | 3300026035 | Bacteria | 1450 |
| 620 | Ga0207639_10001866 | 3300026041 | Bacteria | 14170 |
| 621 | Ga0207639_10044315 | 3300026041 | Bacteria | 3345 |
| 622 | Ga0207639_10082222 | 3300026041 | Bacteria | 2553 |
| 623 | Ga0207639_10094435 | 3300026041 | Bacteria | 2401 |
| 624 | Ga0207639_10108911 | 3300026041 | Bacteria | 2253 |
| 625 | Ga0207639_10135429 | 3300026041 | Bacteria | 2045 |
| 626 | Ga0207639_10261036 | 3300026041 | Bacteria | 1515 |
| 627 | Ga0207639_10288492 | 3300026041 | Bacteria | 1446 |
| 628 | Ga0207639_10582894 | 3300026041 | Bacteria | 1030 |
| 629 | Ga0207678_10021488 | 3300026067 | Bacteria | 5659 |
| 630 | Ga0207678_10022823 | 3300026067 | Bacteria | 5479 |
| 631 | Ga0207678_10042596 | 3300026067 | Bacteria | 3932 |
| 632 | Ga0207678_10062786 | 3300026067 | Bacteria | 3193 |
| 633 | Ga0207678_10130307 | 3300026067 | Bacteria | 2145 |
| 634 | Ga0207678_10145100 | 3300026067 | Unclassified | 2026 |
| 635 | Ga0207678_10261116 | 3300026067 | Bacteria | 1484 |
| 636 | Ga0207708_10020931 | 3300026075 | Bacteria | 4935 |
| 637 | Ga0207708_10130549 | 3300026075 | Unclassified | 1964 |
| 638 | Ga0207702_10000758 | 3300026078 | Bacteria | 34312 |
| 639 | Ga0207702_10010946 | 3300026078 | Bacteria | 7566 |
| 640 | Ga0207702_10065779 | 3300026078 | Bacteria | 3106 |
| 641 | Ga0207702_10098432 | 3300026078 | Bacteria | 2576 |
| 642 | Ga0207702_10160482 | 3300026078 | Bacteria | 2053 |
| 643 | Ga0207702_10167929 | 3300026078 | Bacteria | 2009 |
| 644 | Ga0207702_10249986 | 3300026078 | Unclassified | 1665 |
| 645 | Ga0207641_10006404 | 3300026088 | Bacteria | 9923 |
| 646 | Ga0207641_10051015 | 3300026088 | Plasmid | 3502 |
| 647 | Ga0207648_10004627 | 3300026089 | Bacteria | 14090 |
| 648 | Ga0207648_10046915 | 3300026089 | Bacteria | 3787 |
| 649 | Ga0207648_10176768 | 3300026089 | Bacteria | 1888 |
| 650 | Ga0207676_10030863 | 3300026095 | Bacteria | 4026 |
| 651 | Ga0207676_10677293 | 3300026095 | Bacteria | 997 |
| 652 | Ga0207674_10054730 | 3300026116 | Bacteria | 4061 |
| 653 | Ga0207674_10246718 | 3300026116 | Unclassified | 1733 |
| 654 | Ga0207675_100003859 | 3300026118 | Bacteria | 14570 |
| 655 | Ga0207675_100104527 | 3300026118 | Bacteria | 2669 |
| 656 | Ga0207675_100108300 | 3300026118 | Plasmid | 2620 |
| 657 | Ga0207675_100115515 | 3300026118 | Bacteria | 2536 |
| 658 | Ga0207675_100533979 | 3300026118 | Unclassified | 1171 |
| 659 | Ga0207683_10000782 | 3300026121 | Bacteria | 29001 |
| 660 | Ga0207683_10000850 | 3300026121 | Bacteria | 28050 |
| 661 | Ga0207683_10051919 | 3300026121 | Bacteria | 3592 |
| 662 | Ga0207683_10056530 | 3300026121 | Bacteria | 3442 |
| 663 | Ga0207683_10089743 | 3300026121 | Bacteria | 2736 |
| 664 | Ga0207683_10163872 | 3300026121 | Bacteria | 2011 |
| 665 | Ga0207683_10304839 | 3300026121 | Bacteria | 1457 |
| 666 | Ga0207698_10007574 | 3300026142 | Bacteria | 6807 |
| 667 | Ga0207698_10031006 | 3300026142 | Bacteria | 3854 |
| 668 | Ga0207698_10087873 | 3300026142 | Bacteria | 2533 |
| 669 | Ga0207698_10096641 | 3300026142 | Bacteria | 2435 |
| 670 | Ga0207698_10375299 | 3300026142 | Bacteria | 1351 |
| 671 | Ga0209389_1000019 | 3300027296 | Bacteria | 172067 |
| 672 | Ga0209389_1000248 | 3300027296 | Bacteria | 34726 |
| 673 | Ga0209589_1000005 | 3300027357 | Bacteria | 530958 |
| 674 | Ga0209589_1001871 | 3300027357 | Bacteria | 35557 |
| 675 | Ga0209489_100005 | 3300027361 | Bacteria | 530958 |
| 676 | Ga0209489_100033 | 3300027361 | Bacteria | 172166 |
| 677 | Ga0209489_102684 | 3300027361 | Bacteria | 35799 |
| 678 | Ga0209700_100006 | 3300027363 | Bacteria | 530958 |
| 679 | Ga0209700_100012 | 3300027363 | Bacteria | 357892 |
| 680 | Ga0209179_1012095 | 3300027512 | Bacteria | 1544 |
| 681 | Ga0209998_10002588 | 3300027717 | Bacteria | 4111 |
| 682 | Ga0209974_10003747 | 3300027876 | Bacteria | 5444 |
| 683 | Ga0207428_10000164 | 3300027907 | Bacteria | 91968 |
| 684 | Ga0207428_10000391 | 3300027907 | Bacteria | 54825 |
| 685 | Ga0265357_1000580 | 3300028023 | Bacteria | 2230 |
| 686 | Ga0268266_10002016 | 3300028379 | Bacteria | 22644 |
| 687 | Ga0268266_10077802 | 3300028379 | Bacteria | 2885 |
| 688 | Ga0268266_10112988 | 3300028379 | Bacteria | 2408 |
| 689 | Ga0268266_10128151 | 3300028379 | Bacteria | 2267 |
| 690 | Ga0268266_10203354 | 3300028379 | Bacteria | 1813 |
| 691 | Ga0268266_10499031 | 3300028379 | Bacteria | 1162 |
| 692 | Ga0268265_10004025 | 3300028380 | Bacteria | 10352 |
| 693 | Ga0268265_10079812 | 3300028380 | Bacteria | 2578 |
| 694 | Ga0268264_10000174 | 3300028381 | Bacteria | 137254 |
| 695 | Ga0268264_10049152 | 3300028381 | Bacteria | 3508 |
| 696 | Ga0268264_10146243 | 3300028381 | Bacteria | 2114 |
| 697 | Ga0307517_10000859 | 3300028786 | Bacteria | 51881 |
| 698 | Ga0307515_10028873 | 3300028794 | Bacteria | 9406 |
| 699 | Ga0265338_10059137 | 3300028800 | Bacteria | 3378 |
| 700 | Ga0307511_10032093 | 3300030521 | Bacteria | 4676 |
| 701 | Ga0265770_1032542 | 3300030878 | Bacteria | 880 |
| 702 | Ga0265330_10020221 | 3300031235 | Bacteria | 3042 |
| 703 | Ga0265330_10031054 | 3300031235 | Bacteria | 2395 |
| 704 | Ga0265330_10067423 | 3300031235 | Bacteria | 1550 |
| 705 | Ga0265332_10006382 | 3300031238 | Bacteria | 5348 |
| 706 | Ga0265328_10043351 | 3300031239 | Bacteria | 1655 |
| 707 | Ga0265325_10000019 | 3300031241 | Bacteria | 125265 |
| 708 | Ga0265325_10003263 | 3300031241 | Bacteria | 10664 |
| 709 | Ga0265325_10028164 | 3300031241 | Bacteria | 3031 |
| 710 | Ga0265340_10018122 | 3300031247 | Bacteria | 3635 |
| 711 | Ga0265340_10036658 | 3300031247 | Bacteria | 2430 |
| 712 | Ga0265339_10001912 | 3300031249 | Bacteria | 15282 |
| 713 | Ga0265331_10190616 | 3300031250 | Bacteria | 925 |
| 714 | Ga0265316_10067912 | 3300031344 | Bacteria | 2756 |
| 715 | Ga0307509_10006398 | 3300031507 | Bacteria | 15864 |
| 716 | Ga0307509_10274632 | 3300031507 | Bacteria | 1451 |
| 717 | Ga0265313_10019302 | 3300031595 | Bacteria | 3797 |
| 718 | Ga0265313_10022283 | 3300031595 | Bacteria | 3440 |
| 719 | Ga0265313_10024531 | 3300031595 | Bacteria | 3219 |
| 720 | Ga0265313_10112428 | 3300031595 | Bacteria | 1196 |
| 721 | Ga0307508_10000063 | 3300031616 | Bacteria | 122536 |
| 722 | Ga0307508_10056441 | 3300031616 | Bacteria | 3477 |
| 723 | Ga0307508_10175540 | 3300031616 | Bacteria | 1746 |
| 724 | Ga0316579_10019886 | 3300031691 | Bacteria | 2971 |
| 725 | Ga0265314_10003648 | 3300031711 | Bacteria | 14810 |
| 726 | Ga0265314_10039492 | 3300031711 | Bacteria | 3398 |
| 727 | Ga0265314_10176733 | 3300031711 | Bacteria | 1283 |
| 728 | Ga0265342_10001257 | 3300031712 | Bacteria | 23945 |
| 729 | Ga0265342_10005406 | 3300031712 | Bacteria | 9751 |
| 730 | Ga0265342_10122647 | 3300031712 | Bacteria | 1462 |
| 731 | Ga0307516_10043872 | 3300031730 | Bacteria | 4428 |
| 732 | Ga0307413_10038231 | 3300031824 | Bacteria | 2780 |
| 733 | Ga0307410_10143559 | 3300031852 | Bacteria | 1769 |
| 734 | Ga0307406_10132490 | 3300031901 | Bacteria | 1752 |
| 735 | Ga0307507_10125921 | 3300033179 | Bacteria | 2027 |
| 736 | Ga0307507_10150631 | 3300033179 | Bacteria | 1751 |
| 737 | Ga0307510_10126787 | 3300033180 | Bacteria | 2239 |
| 738 | Ga0307510_10152035 | 3300033180 | Bacteria | 1931 |
| 739 | Ga0315911_1000040 | 3300033442 | Bacteria | 50766 |
| 740 | Ga0316213_1002509 | 3300033546 | Bacteria | 1235 |
| 741 | Ga0373930_0008599 | 3300034816 | Bacteria | 1788 |
| 742 | Ga0373959_0012771 | 3300034820 | Bacteria | 1505 |
| 743 | Ga0373959_0023004 | 3300034820 | Unclassified | 1209 |
| 744 | Ga0373938_0006998 | 3300034957 | Bacteria | 1971 |
| 745 | Ga0373926_0000388 | 3300035083 | Bacteria | 11245 |
| 746 | Ga0373926_0011522 | 3300035083 | Bacteria | 2976 |
| 747 | Ga0373929_0004760 | 3300035085 | Unclassified | 2433 |
| 748 | Ga0373934_0047916 | 3300035086 | Bacteria | 1691 |
| 749 | Ga0373934_0053221 | 3300035086 | Bacteria | 1605 |
| 750 | Ga0373934_0084179 | 3300035086 | Unclassified | 1279 |
| 751 | Ga0373940_0027412 | 3300035088 | Bacteria | 1497 |
| 752 | Ga0373944_0002538 | 3300035089 | Bacteria | 4637 |
| 753 | Ga0373949_0006564 | 3300035090 | Plasmid | 2559 |
| 754 | Ga0373949_0022292 | 3300035090 | Bacteria | 1459 |
| 755 | Ga0373951_0031325 | 3300035091 | Bacteria | 1254 |
| 756 | Ga0373952_0000933 | 3300035092 | Bacteria | 5313 |
| 757 | Ga0373923_0003867 | 3300035111 | Bacteria | 4879 |
| 758 | Ga0373923_0043642 | 3300035111 | Bacteria | 1856 |
| 759 | Ga0373923_0049887 | 3300035111 | Bacteria | 1751 |
| 760 | Ga0373932_0003751 | 3300035112 | Bacteria | 3626 |
| 761 | Ga0373932_0020639 | 3300035112 | Unclassified | 1730 |
| 762 | Ga0373936_0006062 | 3300035113 | Bacteria | 4555 |
| 763 | Ga0373936_0053213 | 3300035113 | Bacteria | 1641 |
| 764 | Ga0373936_0054051 | 3300035113 | Bacteria | 1629 |
| 765 | Ga0373936_0104471 | 3300035113 | Bacteria | 1198 |
| 766 | Ga0373939_0002641 | 3300035114 | Bacteria | 4207 |
| 767 | Ga0373939_0003090 | 3300035114 | Bacteria | 3908 |
| 768 | Ga0373939_0062364 | 3300035114 | Bacteria | 1191 |
| 769 | Ga0373939_0069899 | 3300035114 | Bacteria | 1140 |
| 770 | Ga0373941_0014083 | 3300035115 | Unclassified | 2130 |
| 771 | Ga0373945_0007291 | 3300035116 | Bacteria | 3581 |
| 772 | Ga0373945_0011447 | 3300035116 | Plasmid | 2934 |
| 773 | Ga0373953_0012482 | 3300035117 | Bacteria | 3010 |
| 774 | Ga0373953_0018244 | 3300035117 | Plasmid | 2594 |
| 775 | Ga0373953_0051706 | 3300035117 | Bacteria | 1662 |
| 776 | Ga0373954_0001219 | 3300035118 | Bacteria | 10343 |
| 777 | Ga0373954_0008152 | 3300035118 | Bacteria | 4590 |
| 778 | Ga0373954_0031320 | 3300035118 | Bacteria | 2455 |
| 779 | Ga0373956_0004720 | 3300035119 | Bacteria | 5448 |
| 780 | Ga0373956_0025442 | 3300035119 | Plasmid | 2558 |
| 781 | Ga0373957_0003464 | 3300035120 | Bacteria | 4665 |
| 782 | Ga0373957_0010097 | 3300035120 | Bacteria | 3109 |
| 783 | Ga0373957_0053731 | 3300035120 | Bacteria | 1546 |
| 784 | Ga0373957_0103774 | 3300035120 | Bacteria | 1140 |
| 785 | Ga0373943_0001607 | 3300035170 | Bacteria | 10243 |
| 786 | Ga0373943_0028008 | 3300035170 | Bacteria | 2652 |
| 787 | Ga0373943_0033149 | 3300035170 | Bacteria | 2458 |
| 788 | Ga0373943_0101921 | 3300035170 | Bacteria | 1503 |
| 789 | Ga0373943_0165362 | 3300035170 | Bacteria | 1207 |
| 790 | Ga0373943_0214025 | 3300035170 | Bacteria | 1071 |
| 791 | Ga0373946_0020904 | 3300035171 | Bacteria | 2533 |
| 792 | Ga0373946_0027110 | 3300035171 | Bacteria | 2264 |
| 793 | Ga0373946_0075376 | 3300035171 | Bacteria | 1466 |
| 794 | Ga0373946_0101738 | 3300035171 | Bacteria | 1289 |
| 795 | Ga0373955_0002049 | 3300035172 | Bacteria | 8671 |
| 796 | Ga0373955_0005330 | 3300035172 | Bacteria | 5775 |
| 797 | Ga0373955_0012895 | 3300035172 | Plasmid | 4029 |
| 798 | Ga0373955_0323138 | 3300035172 | Bacteria | 932 |
| 799 | Ga0373942_0006671 | 3300035207 | Plasmid | 2666 |
| 800 | Ga0373942_0031660 | 3300035207 | Bacteria | 1400 |
| 801 | Ga0373961_0002775 | 3300035241 | Bacteria | 4466 |
| 802 | Ga0373924_0014698 | 3300035410 | Bacteria | 2961 |
| 803 | Ga0373931_0002611 | 3300035691 | Bacteria | 8014 |
| 804 | Ga0373931_0006487 | 3300035691 | Bacteria | 5467 |
| 805 | Ga0373931_0305503 | 3300035691 | Bacteria | 984 |
| 806 | Ga0373931_0344444 | 3300035691 | Bacteria | 931 |
| 807 | Ga0373935_0000942 | 3300035692 | Bacteria | 15748 |
| 808 | Ga0373935_0027111 | 3300035692 | Bacteria | 3541 |
| 809 | Ga0373935_0042617 | 3300035692 | Plasmid | 2855 |
| 810 | Ga0373935_0051264 | 3300035692 | Bacteria | 2621 |
| 811 | Ga0373935_0057366 | 3300035692 | Bacteria | 2484 |
| 812 | Ga0373935_0057406 | 3300035692 | Unclassified | 2483 |
| 813 | Ga0373935_0121844 | 3300035692 | Bacteria | 1743 |
| 814 | Ga0373935_0196235 | 3300035692 | Bacteria | 1393 |
| 815 | Ga0373935_0439570 | 3300035692 | Bacteria | 941 |
| 816 | Ga0373927_0000528 | 3300035695 | Bacteria | 29016 |
| 817 | Ga0373927_0021674 | 3300035695 | Bacteria | 4210 |
| 818 | Ga0373927_0030902 | 3300035695 | Bacteria | 3494 |
| 819 | Ga0373927_0035067 | 3300035695 | Bacteria | 3262 |
| 820 | Ga0373927_0041261 | 3300035695 | Plasmid | 2993 |
| 821 | Ga0373927_0066975 | 3300035695 | Bacteria | 2323 |
| 822 | Ga0373927_0148674 | 3300035695 | Bacteria | 1534 |
| 823 | Ga0373927_0214174 | 3300035695 | Bacteria | 1265 |
| 824 | Ga0373927_0227121 | 3300035695 | Bacteria | 1226 |
| 825 | Ga0373927_0297623 | 3300035695 | Bacteria | 1062 |
| 826 | Ga0373933_0000204 | 3300035724 | Bacteria | 39417 |
| 827 | Ga0373933_0002658 | 3300035724 | Bacteria | 10013 |
| 828 | Ga0373933_0010853 | 3300035724 | Bacteria | 4999 |
| 829 | Ga0373933_0034817 | 3300035724 | Plasmid | 2937 |
| 830 | Ga0373933_0077067 | 3300035724 | Bacteria | 2037 |
| 831 | Ga0373933_0090111 | 3300035724 | Bacteria | 1891 |
| 832 | Ga0373933_0188029 | 3300035724 | Bacteria | 1319 |
| 833 | Ga0373933_0293051 | 3300035724 | Bacteria | 1052 |
| 834 | Ga0373947_0000455 | 3300035725 | Bacteria | 23308 |
| 835 | Ga0373947_0003382 | 3300035725 | Bacteria | 9440 |
| 836 | Ga0373947_0026670 | 3300035725 | Bacteria | 3379 |
| 837 | Ga0373947_0067145 | 3300035725 | Bacteria | 2190 |
| 838 | Ga0373947_0078436 | 3300035725 | Bacteria | 2039 |
| 839 | Ga0373947_0101412 | 3300035725 | Bacteria | 1809 |
| 840 | Ga0373947_0225609 | 3300035725 | Bacteria | 1233 |
| 841 | Ga0373937_0008188 | 3300036401 | Bacteria | 9080 |
| 842 | Ga0373937_0021334 | 3300036401 | Bacteria | 5814 |
| 843 | Ga0373937_0194847 | 3300036401 | Unclassified | 1904 |
| 844 | Ga0372808_001169 | 3300036459 | Bacteria | 2608 |
| 845 | Ga0316582_0023146 | 3300036647 | Bacteria | 3699 |
| 846 | Ga0373925_0001434 | 3300037068 | Bacteria | 20657 |
| 847 | Ga0373925_0003563 | 3300037068 | Bacteria | 12000 |
| 848 | Ga0373925_0011034 | 3300037068 | Bacteria | 6561 |
| 849 | Ga0373925_0015076 | 3300037068 | Bacteria | 5586 |
| 850 | Ga0373925_0104455 | 3300037068 | Bacteria | 2182 |
| 851 | Ga0373925_0120167 | 3300037068 | Bacteria | 2039 |
| 852 | Ga0373925_0130934 | 3300037068 | Bacteria | 1956 |
| 853 | Ga0373925_0170838 | 3300037068 | Bacteria | 1716 |
| 854 | Ga0373925_0313178 | 3300037068 | Bacteria | 1269 |
| 855 | Ga0395900_0033975 | 3300037418 | Bacteria | 5249 |
| 856 | Ga0395900_0357002 | 3300037418 | Bacteria | 1434 |
| 857 | Ga0395900_0556389 | 3300037418 | Bacteria | 1091 |
| 858 | Ga0395898_0092172 | 3300037466 | Bacteria | 2914 |
| 859 | Ga0395905_0026848 | 3300037471 | Bacteria | 5431 |
| 860 | Ga0436364_0100847 | 3300037853 | Bacteria | 1285 |
| 861 | Ga0436364_1119586 | 3300037853 | Bacteria | 13727 |
| 862 | Ga0395901_0065664 | 3300038443 | Bacteria | 3779 |
| 863 | Ga0395901_0086125 | 3300038443 | Bacteria | 3285 |
| 864 | Ga0395901_0165542 | 3300038443 | Bacteria | 2322 |
| 865 | Ga0395901_0575766 | 3300038443 | Bacteria | 1138 |
| 866 | Ga0436365_1490250 | 3300039437 | Bacteria | 1332 |
| 867 | Ga0436360_0675457 | 3300039438 | Bacteria | 2922 |
| 868 | Ga0436361_0576775 | 3300039447 | Bacteria | 2868 |
| 869 | Ga0436361_0681610 | 3300039447 | Bacteria | 2846 |
| 870 | Ga0436363_1060587 | 3300039450 | Bacteria | 6258 |
| 871 | Ga0436362_0124208 | 3300039453 | Bacteria | 3179 |
| 872 | Ga0466969_0014448 | 3300044656 | Bacteria | 4152 |
| 873 | Ga0466972_0103734 | 3300044658 | Bacteria | 1345 |
| 874 | Ga0466966_0001614 | 3300044684 | Bacteria | 14525 |
| 875 | Ga0466966_0272714 | 3300044684 | Bacteria | 1018 |
| 876 | Ga0466961_0000192 | 3300044693 | Bacteria | 40922 |
| 877 | Ga0466963_0019050 | 3300044694 | Bacteria | 4298 |
| 878 | Ga0466963_0031458 | 3300044694 | Bacteria | 3430 |
| 879 | Ga0466964_0025350 | 3300044706 | Bacteria | 2315 |
| 880 | Ga0466971_0060412 | 3300044719 | Bacteria | 1713 |
| 881 | Ga0466968_0032806 | 3300044735 | Bacteria | 2161 |
| 882 | Ga0466957_0140210 | 3300044842 | Bacteria | 1557 |
| 883 | Ga0466959_0000934 | 3300045049 | Bacteria | 17340 |
| 884 | Ga0466959_0008049 | 3300045049 | Bacteria | 7429 |
| 885 | Ga0466959_0058009 | 3300045049 | Bacteria | 2821 |
| 886 | Ga0466959_0062872 | 3300045049 | Bacteria | 2697 |
| 887 | Ga0466967_0023977 | 3300045976 | Bacteria | 5009 |
| 888 | Ga0466967_0094324 | 3300045976 | Bacteria | 2725 |
| 889 | Ga0466967_0242814 | 3300045976 | Bacteria | 1718 |
| 890 | Ga0466967_0838598 | 3300045976 | Bacteria | 913 |
| 891 | Ga0495592_0021465 | 3300046454 | Bacteria | 4910 |
| 892 | Ga0495592_0032569 | 3300046454 | Bacteria | 3932 |
| 893 | Ga0495592_0038867 | 3300046454 | Bacteria | 3577 |
| 894 | Ga0495592_0087914 | 3300046454 | Bacteria | 2234 |
| 895 | Ga0495603_0000239 | 3300046455 | Bacteria | 28578 |
| 896 | Ga0495603_0015374 | 3300046455 | Bacteria | 4631 |
| 897 | Ga0495603_0017749 | 3300046455 | Bacteria | 4307 |
| 898 | Ga0495603_0072211 | 3300046455 | Bacteria | 2028 |
| 899 | Ga0495590_0116445 | 3300046457 | Bacteria | 956 |
| 900 | Ga0495629_0000139 | 3300046459 | Bacteria | 63649 |
| 901 | Ga0495629_0000457 | 3300046459 | Bacteria | 34088 |
| 902 | Ga0495629_0007972 | 3300046459 | Bacteria | 7791 |
| 903 | Ga0495629_0029920 | 3300046459 | Bacteria | 3860 |
| 904 | Ga0495629_0051611 | 3300046459 | Bacteria | 2878 |
| 905 | Ga0495629_0096371 | 3300046459 | Bacteria | 2064 |
| 906 | Ga0495629_0150450 | 3300046459 | Bacteria | 1618 |
| 907 | Ga0495629_0163427 | 3300046459 | Bacteria | 1546 |
| 908 | Ga0495629_0225033 | 3300046459 | Unclassified | 1293 |
| 909 | Ga0495641_0002157 | 3300046461 | Bacteria | 15774 |
| 910 | Ga0495641_0029301 | 3300046461 | Bacteria | 2653 |
| 911 | Ga0495651_0004984 | 3300046462 | Bacteria | 10144 |
| 912 | Ga0495651_0014000 | 3300046462 | Bacteria | 6203 |
| 913 | Ga0495651_0017171 | 3300046462 | Bacteria | 5607 |
| 914 | Ga0495651_0037984 | 3300046462 | Bacteria | 3749 |
| 915 | Ga0495651_0054995 | 3300046462 | Bacteria | 3058 |
| 916 | Ga0495651_0166592 | 3300046462 | Bacteria | 1573 |
| 917 | Ga0495653_0004257 | 3300046463 | Bacteria | 11596 |
| 918 | Ga0495653_0009797 | 3300046463 | Bacteria | 7835 |
| 919 | Ga0495653_0235853 | 3300046463 | Bacteria | 1222 |
| 920 | Ga0495580_0002960 | 3300046472 | Bacteria | 14585 |
| 921 | Ga0495580_0009072 | 3300046472 | Bacteria | 7845 |
| 922 | Ga0495580_0009091 | 3300046472 | Bacteria | 7837 |
| 923 | Ga0495582_0000077 | 3300046473 | Bacteria | 49112 |
| 924 | Ga0495582_0001850 | 3300046473 | Bacteria | 11944 |
| 925 | Ga0495582_0038297 | 3300046473 | Bacteria | 2638 |
| 926 | Ga0495582_0258275 | 3300046473 | Bacteria | 999 |
| 927 | Ga0495605_0057694 | 3300046474 | Bacteria | 1868 |
| 928 | Ga0495605_0154703 | 3300046474 | Bacteria | 1021 |
| 929 | Ga0495639_0000101 | 3300046475 | Bacteria | 42348 |
| 930 | Ga0495639_0012036 | 3300046475 | Bacteria | 3730 |
| 931 | Ga0495662_0012510 | 3300046476 | Bacteria | 4140 |
| 932 | Ga0495662_0051472 | 3300046476 | Bacteria | 1988 |
| 933 | Ga0495664_0038052 | 3300046477 | Plasmid | 2839 |
| 934 | Ga0495664_0041464 | 3300046477 | Bacteria | 2724 |
| 935 | Ga0495664_0044789 | 3300046477 | Bacteria | 2622 |
| 936 | Ga0495584_0001897 | 3300046491 | Bacteria | 12061 |
| 937 | Ga0495584_0039510 | 3300046491 | Bacteria | 2384 |
| 938 | Ga0495585_0001030 | 3300046492 | Bacteria | 23180 |
| 939 | Ga0495585_0158482 | 3300046492 | Bacteria | 1176 |
| 940 | Ga0495594_0005795 | 3300046499 | Bacteria | 6340 |
| 941 | Ga0495594_0127044 | 3300046499 | Bacteria | 1443 |
| 942 | Ga0495594_0243805 | 3300046499 | Bacteria | 1024 |
| 943 | Ga0495607_0006002 | 3300046501 | Bacteria | 8613 |
| 944 | Ga0495606_0000357 | 3300046507 | Bacteria | 78015 |
| 945 | Ga0495606_0014109 | 3300046507 | Bacteria | 6257 |
| 946 | Ga0495608_0000911 | 3300046511 | Bacteria | 20725 |
| 947 | Ga0495608_0004649 | 3300046511 | Bacteria | 9811 |
| 948 | Ga0495608_0061364 | 3300046511 | Bacteria | 2472 |
| 949 | Ga0495608_0110421 | 3300046511 | Bacteria | 1768 |
| 950 | Ga0495608_0188827 | 3300046511 | Bacteria | 1302 |
| 951 | Ga0495618_0003586 | 3300046514 | Bacteria | 9613 |
| 952 | Ga0495618_0014258 | 3300046514 | Bacteria | 4840 |
| 953 | Ga0495618_0021739 | 3300046514 | Bacteria | 3955 |
| 954 | Ga0495618_0089816 | 3300046514 | Bacteria | 1965 |
| 955 | Ga0495618_0119090 | 3300046514 | Bacteria | 1691 |
| 956 | Ga0495618_0136315 | 3300046514 | Bacteria | 1570 |
| 957 | Ga0495620_0071983 | 3300046515 | Bacteria | 1412 |
| 958 | Ga0495620_0078633 | 3300046515 | Bacteria | 1337 |
| 959 | Ga0495628_0005614 | 3300046516 | Bacteria | 10985 |
| 960 | Ga0495628_0105477 | 3300046516 | Bacteria | 2171 |
| 961 | Ga0495628_0157361 | 3300046516 | Unclassified | 1728 |
| 962 | Ga0495628_0282913 | 3300046516 | Bacteria | 1231 |
| 963 | Ga0495630_0012819 | 3300046517 | Bacteria | 6092 |
| 964 | Ga0495630_0047522 | 3300046517 | Bacteria | 3210 |
| 965 | Ga0495630_0281866 | 3300046517 | Bacteria | 1270 |
| 966 | Ga0495631_0126651 | 3300046518 | Bacteria | 1098 |
| 967 | Ga0495643_0028502 | 3300046522 | Bacteria | 3129 |
| 968 | Ga0495644_0000513 | 3300046523 | Bacteria | 16576 |
| 969 | Ga0495644_0050156 | 3300046523 | Bacteria | 1567 |
| 970 | Ga0495648_0000897 | 3300046524 | Bacteria | 31152 |
| 971 | Ga0495648_0007226 | 3300046524 | Bacteria | 8920 |
| 972 | Ga0495648_0012169 | 3300046524 | Bacteria | 6436 |
| 973 | Ga0495648_0092889 | 3300046524 | Bacteria | 1684 |
| 974 | Ga0495648_0109736 | 3300046524 | Bacteria | 1504 |
| 975 | Ga0495663_0002372 | 3300046525 | Bacteria | 5672 |
| 976 | Ga0495666_0168340 | 3300046526 | Unclassified | 1014 |
| 977 | Ga0495652_0021917 | 3300046529 | Bacteria | 5680 |
| 978 | Ga0495652_0028137 | 3300046529 | Bacteria | 4950 |
| 979 | Ga0495652_0046433 | 3300046529 | Bacteria | 3729 |
| 980 | Ga0495652_0070477 | 3300046529 | Bacteria | 2921 |
| 981 | Ga0495652_0076180 | 3300046529 | Bacteria | 2783 |
| 982 | Ga0495652_0270423 | 3300046529 | Bacteria | 1249 |
| 983 | Ga0495665_0000055 | 3300046531 | Bacteria | 45208 |
| 984 | Ga0495665_0026195 | 3300046531 | Bacteria | 3132 |
| 985 | Ga0495640_0011661 | 3300046533 | Bacteria | 6748 |
| 986 | Ga0495640_0024673 | 3300046533 | Bacteria | 4371 |
| 987 | Ga0495640_0043321 | 3300046533 | Bacteria | 3135 |
| 988 | Ga0495640_0046767 | 3300046533 | Bacteria | 2996 |
| 989 | Ga0495640_0053786 | 3300046533 | Plasmid | 2759 |
| 990 | Ga0495640_0092694 | 3300046533 | Bacteria | 1992 |
| 991 | Ga0495586_0046428 | 3300046535 | Bacteria | 2342 |
| 992 | Ga0495587_0005897 | 3300046536 | Bacteria | 7984 |
| 993 | Ga0495587_0015897 | 3300046536 | Bacteria | 4687 |
| 994 | Ga0495587_0094947 | 3300046536 | Unclassified | 1721 |
| 995 | Ga0495587_0134777 | 3300046536 | Bacteria | 1411 |
| 996 | Ga0495587_0301376 | 3300046536 | Bacteria | 896 |
| 997 | Ga0495598_0045979 | 3300046537 | Bacteria | 1296 |
| 998 | Ga0495609_0017406 | 3300046538 | Bacteria | 3337 |
| 999 | Ga0495609_0085365 | 3300046538 | Bacteria | 1377 |
| 1000 | Ga0495609_0137657 | 3300046538 | Bacteria | 1043 |
| 1001 | Ga0495597_0028153 | 3300046542 | Bacteria | 2573 |
| 1002 | Ga0495645_0011340 | 3300046543 | Bacteria | 6268 |
| 1003 | Ga0495645_0061920 | 3300046543 | Bacteria | 2711 |
| 1004 | Ga0495645_0115470 | 3300046543 | Bacteria | 1896 |
| 1005 | Ga0495645_0120887 | 3300046543 | Bacteria | 1844 |
| 1006 | Ga0495622_0002233 | 3300046557 | Bacteria | 9422 |
| 1007 | Ga0495622_0033493 | 3300046557 | Bacteria | 2397 |
| 1008 | Ga0495622_0055262 | 3300046557 | Bacteria | 1841 |
| 1009 | Ga0495622_0057388 | 3300046557 | Bacteria | 1805 |
| 1010 | Ga0495622_0078894 | 3300046557 | Bacteria | 1516 |
| 1011 | Ga0495622_0101465 | 3300046557 | Bacteria | 1319 |
| 1012 | Ga0495633_0024926 | 3300046558 | Bacteria | 2950 |
| 1013 | Ga0495667_0010518 | 3300046559 | Bacteria | 6261 |
| 1014 | Ga0495667_0021423 | 3300046559 | Bacteria | 4361 |
| 1015 | Ga0495667_0023279 | 3300046559 | Bacteria | 4173 |
| 1016 | Ga0495667_0038378 | 3300046559 | Bacteria | 3189 |
| 1017 | Ga0495667_0048600 | 3300046559 | Bacteria | 2801 |
| 1018 | Ga0495667_0096798 | 3300046559 | Unclassified | 1910 |
| 1019 | Ga0495656_0000091 | 3300046615 | Bacteria | 38995 |
| 1020 | Ga0495656_0006841 | 3300046615 | Bacteria | 4008 |
| 1021 | Ga0495668_0083718 | 3300046616 | Bacteria | 1749 |
| 1022 | Ga0495634_0001036 | 3300046642 | Bacteria | 26033 |
| 1023 | Ga0495634_0063846 | 3300046642 | Bacteria | 2443 |
| 1024 | Ga0495634_0069546 | 3300046642 | Bacteria | 2322 |
| 1025 | Ga0495634_0084757 | 3300046642 | Bacteria | 2066 |
| 1026 | Ga0495634_0110477 | 3300046642 | Bacteria | 1768 |
| 1027 | Ga0495611_0007030 | 3300046648 | Bacteria | 4781 |
| 1028 | Ga0495611_0087470 | 3300046648 | Bacteria | 1438 |
| 1029 | Ga0495625_0030051 | 3300046660 | Bacteria | 4057 |
| 1030 | Ga0495625_0066315 | 3300046660 | Bacteria | 2543 |
| 1031 | Ga0495635_0000815 | 3300046663 | Bacteria | 20434 |
| 1032 | Ga0495635_0004810 | 3300046663 | Bacteria | 9387 |
| 1033 | Ga0495635_0011194 | 3300046663 | Bacteria | 6289 |
| 1034 | Ga0495635_0029736 | 3300046663 | Bacteria | 3799 |
| 1035 | Ga0495635_0093114 | 3300046663 | Bacteria | 2060 |
| 1036 | Ga0495659_0000632 | 3300046664 | Bacteria | 12804 |
| 1037 | Ga0495659_0122405 | 3300046664 | Bacteria | 1025 |
| 1038 | Ga0495661_0010120 | 3300046665 | Bacteria | 6448 |
| 1039 | Ga0495661_0048855 | 3300046665 | Bacteria | 2569 |
| 1040 | Ga0495588_0005058 | 3300046674 | Bacteria | 5855 |
| 1041 | Ga0495588_0005077 | 3300046674 | Bacteria | 5848 |
| 1042 | Ga0495588_0015996 | 3300046674 | Bacteria | 3620 |
| 1043 | Ga0495657_0003079 | 3300046675 | Bacteria | 13781 |
| 1044 | Ga0495657_0004591 | 3300046675 | Bacteria | 11023 |
| 1045 | Ga0495657_0019481 | 3300046675 | Bacteria | 4894 |
| 1046 | Ga0495657_0034720 | 3300046675 | Bacteria | 3500 |
| 1047 | Ga0495657_0194463 | 3300046675 | Bacteria | 1238 |
| 1048 | Ga0495599_0001945 | 3300046678 | Bacteria | 11972 |
| 1049 | Ga0495599_0028704 | 3300046678 | Bacteria | 3486 |
| 1050 | Ga0495599_0053717 | 3300046678 | Bacteria | 2524 |
| 1051 | Ga0495623_0002783 | 3300046679 | Bacteria | 11540 |
| 1052 | Ga0495623_0020870 | 3300046679 | Bacteria | 4233 |
| 1053 | Ga0495623_0233769 | 3300046679 | Bacteria | 1041 |
| 1054 | Ga0495646_0001642 | 3300046680 | Bacteria | 13342 |
| 1055 | Ga0495646_0014188 | 3300046680 | Bacteria | 5065 |
| 1056 | Ga0495646_0022610 | 3300046680 | Bacteria | 3965 |
| 1057 | Ga0495646_0060647 | 3300046680 | Bacteria | 2255 |
| 1058 | Ga0495646_0119405 | 3300046680 | Bacteria | 1493 |
| 1059 | Ga0495647_0002436 | 3300046681 | Bacteria | 5863 |
| 1060 | Ga0495647_0010626 | 3300046681 | Bacteria | 3138 |
| 1061 | Ga0495647_0019267 | 3300046681 | Bacteria | 2438 |
| 1062 | Ga0495647_0074495 | 3300046681 | Bacteria | 1365 |
| 1063 | Ga0495647_0081217 | 3300046681 | Bacteria | 1315 |
| 1064 | Ga0495658_0000065 | 3300046683 | Bacteria | 52835 |
| 1065 | Ga0495658_0008416 | 3300046683 | Bacteria | 5112 |
| 1066 | Ga0495658_0066140 | 3300046683 | Bacteria | 2087 |
| 1067 | Ga0495658_0365868 | 3300046683 | Bacteria | 917 |
| 1068 | Ga0495613_0003480 | 3300046689 | Bacteria | 11777 |
| 1069 | Ga0495613_0010328 | 3300046689 | Bacteria | 6934 |
| 1070 | Ga0495613_0078788 | 3300046689 | Unclassified | 2396 |
| 1071 | Ga0495613_0092005 | 3300046689 | Bacteria | 2196 |
| 1072 | Ga0495613_0284765 | 3300046689 | Bacteria | 1147 |
| 1073 | Ga0495624_0000235 | 3300046690 | Bacteria | 43165 |
| 1074 | Ga0495624_0050807 | 3300046690 | Plasmid | 2625 |
| 1075 | Ga0495624_0136811 | 3300046690 | Bacteria | 1501 |
| 1076 | Ga0495670_0000199 | 3300046691 | Bacteria | 26898 |
| 1077 | Ga0495670_0090418 | 3300046691 | Bacteria | 1566 |
| 1078 | Ga0495671_0092637 | 3300046692 | Bacteria | 1479 |
| 1079 | Ga0495671_0202048 | 3300046692 | Bacteria | 964 |
| 1080 | Ga0495649_0015557 | 3300046694 | Bacteria | 4328 |
| 1081 | Ga0495649_0152989 | 3300046694 | Bacteria | 1211 |
| 1082 | Ga0495589_0021779 | 3300046794 | Bacteria | 3275 |
| 1083 | Ga0495600_0012719 | 3300046809 | Bacteria | 5268 |
| 1084 | Ga0495600_0015147 | 3300046809 | Bacteria | 4871 |
| 1085 | Ga0495600_0030346 | 3300046809 | Bacteria | 3502 |
| 1086 | Ga0495581_0000041 | 3300047315 | Bacteria | 46518 |
| 1087 | Ga0495581_0022819 | 3300047315 | Bacteria | 3625 |
| 1088 | Ga0495581_0024475 | 3300047315 | Plasmid | 3499 |
| 1089 | Ga0495604_0007221 | 3300047317 | Bacteria | 8800 |
| 1090 | Ga0495604_0056249 | 3300047317 | Bacteria | 3029 |
| 1091 | Ga0495604_0070109 | 3300047317 | Bacteria | 2655 |
| 1092 | Ga0495604_0086405 | 3300047317 | Bacteria | 2338 |
| 1093 | Ga0495604_0106288 | 3300047317 | Bacteria | 2053 |
| 1094 | Ga0495604_0203136 | 3300047317 | Bacteria | 1373 |
| 1095 | Ga0495636_0046361 | 3300047318 | Unclassified | 1813 |
| 1096 | Ga0495674_0001192 | 3300047319 | Bacteria | 25126 |
| 1097 | Ga0495674_0028002 | 3300047319 | Bacteria | 5145 |
| 1098 | Ga0495674_0047281 | 3300047319 | Bacteria | 3816 |
| 1099 | Ga0495674_0051263 | 3300047319 | Bacteria | 3638 |
| 1100 | Ga0495674_0320433 | 3300047319 | Bacteria | 1263 |
| 1101 | Ga0495674_0326857 | 3300047319 | Bacteria | 1248 |
| 1102 | Ga0495672_0037589 | 3300047320 | Bacteria | 2960 |
| 1103 | Ga0495676_0018550 | 3300047321 | Bacteria | 6135 |
| 1104 | Ga0495676_0100156 | 3300047321 | Bacteria | 2146 |
| 1105 | Ga0495676_0403146 | 3300047321 | Bacteria | 907 |
| 1106 | Ga0495680_0012071 | 3300047322 | Bacteria | 7622 |
| 1107 | Ga0495680_0017326 | 3300047322 | Bacteria | 6156 |
| 1108 | Ga0495680_0017765 | 3300047322 | Bacteria | 6056 |
| 1109 | Ga0495680_0043618 | 3300047322 | Bacteria | 3549 |
| 1110 | Ga0495687_050067 | 3300047443 | Bacteria | 1782 |
| 1111 | Ga0495675_0040948 | 3300047444 | Bacteria | 2952 |
| 1112 | Ga0495675_0152222 | 3300047444 | Unclassified | 1428 |
| 1113 | Ga0495679_028585 | 3300047446 | Unclassified | 1828 |
| 1114 | Ga0495673_0010425 | 3300047469 | Bacteria | 5053 |
| 1115 | Ga0495673_0025589 | 3300047469 | Bacteria | 2830 |
| 1116 | Ga0495684_0001073 | 3300047471 | Bacteria | 22129 |
| 1117 | Ga0495684_0001399 | 3300047471 | Bacteria | 19329 |
| 1118 | Ga0495684_0039273 | 3300047471 | Bacteria | 3628 |
| 1119 | Ga0495684_0052644 | 3300047471 | Bacteria | 3106 |
| 1120 | Ga0495684_0075698 | 3300047471 | Bacteria | 2557 |
| 1121 | Ga0495684_0116868 | 3300047471 | Unclassified | 2011 |
| 1122 | Ga0495686_0060885 | 3300047472 | Bacteria | 2346 |
| 1123 | Ga0495686_0062790 | 3300047472 | Bacteria | 2303 |
| 1124 | Ga0495686_0085485 | 3300047472 | Bacteria | 1921 |
| 1125 | Ga0495686_0136095 | 3300047472 | Bacteria | 1453 |
| 1126 | Ga0495686_0237214 | 3300047472 | Bacteria | 1030 |
| 1127 | Ga0495593_0000024 | 3300047673 | Bacteria | 65718 |
| 1128 | Ga0495593_0002018 | 3300047673 | Bacteria | 12102 |
| 1129 | Ga0495593_0003557 | 3300047673 | Bacteria | 9320 |
| 1130 | Ga0495593_0004938 | 3300047673 | Bacteria | 7905 |
| 1131 | Ga0495593_0052823 | 3300047673 | Bacteria | 2146 |
| 1132 | Ga0495593_0055700 | 3300047673 | Bacteria | 2080 |
| 1133 | Ga0495602_0019419 | 3300048088 | Bacteria | 6748 |
| 1134 | Ga0495602_0027637 | 3300048088 | Bacteria | 5449 |
| 1135 | Ga0495602_0035012 | 3300048088 | Bacteria | 4687 |
| 1136 | Ga0495602_0085186 | 3300048088 | Bacteria | 2642 |
| 1137 | Ga0495614_0059008 | 3300048089 | Bacteria | 1648 |
| 1138 | Ga0495615_0051171 | 3300048090 | Bacteria | 1064 |
| 1139 | Ga0496100_0071720 | 3300048903 | Bacteria | 2313 |
| 1140 | Ga0496101_0005706 | 3300048904 | Bacteria | 7948 |
| 1141 | Ga0496101_0017665 | 3300048904 | Bacteria | 4839 |
| 1142 | Ga0496101_0046113 | 3300048904 | Plasmid | 3125 |
| 1143 | Ga0496101_0106497 | 3300048904 | Bacteria | 2105 |
| 1144 | Ga0496101_0173978 | 3300048904 | Bacteria | 1655 |
| 1145 | Ga0496101_0417516 | 3300048904 | Bacteria | 1057 |
| 1146 | Ga0496102_0014041 | 3300048905 | Bacteria | 6955 |
| 1147 | Ga0496102_0017084 | 3300048905 | Bacteria | 6351 |
| 1148 | Ga0496102_0022366 | 3300048905 | Bacteria | 5601 |
| 1149 | Ga0496102_0067126 | 3300048905 | Bacteria | 3289 |
| 1150 | Ga0496102_0244050 | 3300048905 | Bacteria | 1694 |
| 1151 | Ga0496103_0013626 | 3300048906 | Bacteria | 4823 |
| 1152 | Ga0496103_0037032 | 3300048906 | Bacteria | 2989 |
| 1153 | Ga0496103_0155467 | 3300048906 | Bacteria | 1466 |
| 1154 | Ga0496103_0176854 | 3300048906 | Bacteria | 1371 |
| 1155 | Ga0496103_0199908 | 3300048906 | Bacteria | 1285 |
| 1156 | Ga0496104_0007787 | 3300048907 | Bacteria | 9493 |
| 1157 | Ga0496104_0037009 | 3300048907 | Bacteria | 4563 |
| 1158 | Ga0496104_0065417 | 3300048907 | Bacteria | 3450 |
| 1159 | Ga0496104_0088068 | 3300048907 | Bacteria | 2965 |
| 1160 | Ga0496104_0182742 | 3300048907 | Bacteria | 2007 |
| 1161 | Ga0496104_0186109 | 3300048907 | Bacteria | 1987 |
| 1162 | Ga0496104_0187277 | 3300048907 | Bacteria | 1980 |
| 1163 | Ga0496104_0303283 | 3300048907 | Bacteria | 1509 |
| 1164 | Ga0496104_0322350 | 3300048907 | Bacteria | 1458 |
| 1165 | Ga0496104_0362524 | 3300048907 | Bacteria | 1362 |
| 1166 | Ga0496105_0011205 | 3300048908 | Bacteria | 7074 |
| 1167 | Ga0496105_0013422 | 3300048908 | Bacteria | 6502 |
| 1168 | Ga0496105_0015800 | 3300048908 | Bacteria | 6022 |
| 1169 | Ga0496105_0019532 | 3300048908 | Bacteria | 5467 |
| 1170 | Ga0496105_0034013 | 3300048908 | Bacteria | 4190 |
| 1171 | Ga0496105_0062282 | 3300048908 | Bacteria | 3078 |
| 1172 | Ga0496105_0175327 | 3300048908 | Bacteria | 1756 |
| 1173 | Ga0496105_0291129 | 3300048908 | Unclassified | 1314 |
| 1174 | Ga0496106_0003446 | 3300048909 | Bacteria | 11782 |
| 1175 | Ga0496106_0006865 | 3300048909 | Bacteria | 8425 |
| 1176 | Ga0496106_0007383 | 3300048909 | Bacteria | 8123 |
| 1177 | Ga0496106_0017314 | 3300048909 | Bacteria | 5335 |
| 1178 | Ga0496106_0031297 | 3300048909 | Bacteria | 3964 |
| 1179 | Ga0496106_0058706 | 3300048909 | Bacteria | 2913 |
| 1180 | Ga0496106_0094631 | 3300048909 | Bacteria | 2310 |
| 1181 | Ga0496106_0130932 | 3300048909 | Bacteria | 1967 |
| 1182 | Ga0496106_0158517 | 3300048909 | Bacteria | 1789 |
| 1183 | Ga0496107_0000509 | 3300048910 | Bacteria | 21565 |
| 1184 | Ga0496107_0034178 | 3300048910 | Bacteria | 3640 |
| 1185 | Ga0496107_0037811 | 3300048910 | Bacteria | 3464 |
| 1186 | Ga0496107_0037820 | 3300048910 | Bacteria | 3464 |
| 1187 | Ga0496108_0039234 | 3300048911 | Bacteria | 3948 |
| 1188 | Ga0496108_0070491 | 3300048911 | Bacteria | 2950 |
| 1189 | Ga0496108_0101833 | 3300048911 | Bacteria | 2450 |
| 1190 | Ga0496108_0141329 | 3300048911 | Bacteria | 2074 |
| 1191 | Ga0496108_0159941 | 3300048911 | Bacteria | 1946 |
| 1192 | Ga0496109_0020639 | 3300048912 | Bacteria | 5820 |
| 1193 | Ga0496109_0051292 | 3300048912 | Bacteria | 3758 |
| 1194 | Ga0496109_0074608 | 3300048912 | Bacteria | 3118 |
| 1195 | Ga0496109_0082674 | 3300048912 | Bacteria | 2960 |
| 1196 | Ga0496109_0086401 | 3300048912 | Plasmid | 2896 |
| 1197 | Ga0496109_0327342 | 3300048912 | Bacteria | 1446 |
| 1198 | Ga0496110_0003123 | 3300048913 | Bacteria | 12580 |
| 1199 | Ga0496110_0005741 | 3300048913 | Bacteria | 9749 |
| 1200 | Ga0496110_0091790 | 3300048913 | Bacteria | 2717 |
| 1201 | Ga0496110_0159652 | 3300048913 | Bacteria | 2043 |
| 1202 | Ga0496110_0321195 | 3300048913 | Bacteria | 1410 |
| 1203 | Ga0496110_0337214 | 3300048913 | Bacteria | 1373 |
| 1204 | Ga0496111_0034236 | 3300048914 | Bacteria | 3626 |
| 1205 | Ga0496111_0039373 | 3300048914 | Plasmid | 3388 |
| 1206 | Ga0496111_0042463 | 3300048914 | Bacteria | 3265 |
| 1207 | Ga0496111_0173154 | 3300048914 | Bacteria | 1604 |
| 1208 | Ga0496111_0256530 | 3300048914 | Bacteria | 1297 |
| 1209 | Ga0496112_0012582 | 3300048915 | Bacteria | 7776 |
| 1210 | Ga0496112_0024108 | 3300048915 | Bacteria | 5823 |
| 1211 | Ga0496112_0064719 | 3300048915 | Bacteria | 3608 |
| 1212 | Ga0496112_0126632 | 3300048915 | Bacteria | 2525 |
| 1213 | Ga0496112_0178060 | 3300048915 | Bacteria | 2090 |
| 1214 | Ga0496112_0186684 | 3300048915 | Bacteria | 2036 |
| 1215 | Ga0496112_0188030 | 3300048915 | Bacteria | 2028 |
| 1216 | Ga0496112_0287838 | 3300048915 | Bacteria | 1589 |
| 1217 | Ga0496112_0417522 | 3300048915 | Bacteria | 1281 |
| 1218 | Ga0496113_0041662 | 3300048916 | Bacteria | 3389 |
| 1219 | Ga0496113_0055757 | 3300048916 | Bacteria | 2964 |
| 1220 | Ga0496113_0066166 | 3300048916 | Bacteria | 2736 |
| 1221 | Ga0496113_0102680 | 3300048916 | Bacteria | 2217 |
| 1222 | Ga0496113_0156050 | 3300048916 | Bacteria | 1802 |
| 1223 | Ga0496113_0222184 | 3300048916 | Bacteria | 1505 |
| 1224 | Ga0496113_0316048 | 3300048916 | Unclassified | 1251 |
| 1225 | Ga0496114_0001306 | 3300048917 | Bacteria | 18867 |
| 1226 | Ga0496114_0022402 | 3300048917 | Bacteria | 5149 |
| 1227 | Ga0496114_0084963 | 3300048917 | Bacteria | 2680 |
| 1228 | Ga0496114_0198573 | 3300048917 | Bacteria | 1756 |
| 1229 | Ga0496114_0371093 | 3300048917 | Bacteria | 1266 |
| 1230 | Ga0496115_0001250 | 3300048918 | Bacteria | 18240 |
| 1231 | Ga0496115_0023466 | 3300048918 | Bacteria | 4788 |
| 1232 | Ga0496115_0056055 | 3300048918 | Bacteria | 3167 |
| 1233 | Ga0496115_0098174 | 3300048918 | Unclassified | 2398 |
| 1234 | Ga0496115_0116508 | 3300048918 | Bacteria | 2197 |
| 1235 | Ga0496115_0146012 | 3300048918 | Bacteria | 1952 |
| 1236 | Ga0496115_0179206 | 3300048918 | Bacteria | 1752 |
| 1237 | Ga0496117_0017488 | 3300048920 | Bacteria | 5986 |
| 1238 | Ga0496117_0062933 | 3300048920 | Bacteria | 2539 |
| 1239 | Ga0496118_0020990 | 3300048921 | Bacteria | 5768 |
| 1240 | Ga0496118_0039136 | 3300048921 | Bacteria | 3788 |
| 1241 | Ga0496118_0077455 | 3300048921 | Bacteria | 2358 |
| 1242 | Ga0496118_0251433 | 3300048921 | Bacteria | 1004 |
| 1243 | Ga0496119_0040669 | 3300048922 | Bacteria | 2970 |
| 1244 | Ga0496119_0042593 | 3300048922 | Bacteria | 2877 |
| 1245 | Ga0496119_0057347 | 3300048922 | Bacteria | 2353 |
| 1246 | Ga0496119_0099423 | 3300048922 | Bacteria | 1636 |
| 1247 | Ga0496119_0138407 | 3300048922 | Unclassified | 1318 |
| 1248 | Ga0496120_0013345 | 3300048923 | Bacteria | 5538 |
| 1249 | Ga0496121_0000927 | 3300048924 | Bacteria | 53016 |
| 1250 | Ga0496121_0007064 | 3300048924 | Bacteria | 13633 |
| 1251 | Ga0496121_0010667 | 3300048924 | Bacteria | 10315 |
| 1252 | Ga0496121_0015737 | 3300048924 | Bacteria | 7882 |
| 1253 | Ga0496121_0061566 | 3300048924 | Bacteria | 3079 |
| 1254 | Ga0496121_0155804 | 3300048924 | Bacteria | 1676 |
| 1255 | Ga0496121_0205975 | 3300048924 | Bacteria | 1397 |
| 1256 | Ga0496121_0209073 | 3300048924 | Bacteria | 1384 |
| 1257 | Ga0496121_0256326 | 3300048924 | Bacteria | 1210 |
| 1258 | Ga0496124_0049273 | 3300048927 | Bacteria | 3594 |
| 1259 | Ga0496124_0058635 | 3300048927 | Bacteria | 3237 |
| 1260 | Ga0496124_0061641 | 3300048927 | Bacteria | 3143 |
| 1261 | Ga0496124_0240865 | 3300048927 | Bacteria | 1345 |
| 1262 | Ga0496125_0042169 | 3300048928 | Bacteria | 3891 |
| 1263 | Ga0496125_0063623 | 3300048928 | Bacteria | 2940 |
| 1264 | Ga0496125_0121414 | 3300048928 | Bacteria | 1863 |
| 1265 | Ga0496125_0304141 | 3300048928 | Bacteria | 975 |
| 1266 | Ga0496126_0022004 | 3300048929 | Bacteria | 6214 |
| 1267 | Ga0496126_0027336 | 3300048929 | Bacteria | 5451 |
| 1268 | Ga0496126_0035592 | 3300048929 | Bacteria | 4665 |
| 1269 | Ga0496126_0103819 | 3300048929 | Bacteria | 2483 |
| 1270 | Ga0496126_0135129 | 3300048929 | Bacteria | 2128 |
| 1271 | Ga0496126_0135967 | 3300048929 | Bacteria | 2120 |
| 1272 | Ga0496126_0202331 | 3300048929 | Bacteria | 1676 |
| 1273 | Ga0496126_0232203 | 3300048929 | Bacteria | 1545 |
| 1274 | Ga0496126_0234965 | 3300048929 | Bacteria | 1534 |
| 1275 | Ga0496126_0350508 | 3300048929 | Bacteria | 1207 |
| 1276 | Ga0496126_0398398 | 3300048929 | Bacteria | 1117 |
| 1277 | Ga0495682_0019019 | 3300049460 | Bacteria | 2585 |
| 1278 | Ga0495682_0052153 | 3300049460 | Bacteria | 1487 |
| 1279 | Ga0501031_0000398 | 3300049568 | Bacteria | 25392 |
| 1280 | Ga0501031_0006934 | 3300049568 | Bacteria | 7396 |
| 1281 | Ga0501031_0031248 | 3300049568 | Bacteria | 3473 |
| 1282 | Ga0501032_0066313 | 3300049569 | Bacteria | 2412 |
| 1283 | Ga0501032_0073505 | 3300049569 | Bacteria | 2277 |
| 1284 | Ga0501032_0098657 | 3300049569 | Bacteria | 1935 |
| 1285 | Ga0501033_0001316 | 3300049570 | Bacteria | 22076 |
| 1286 | Ga0501033_0001463 | 3300049570 | Bacteria | 20932 |
| 1287 | Ga0501033_0016180 | 3300049570 | Bacteria | 5648 |
| 1288 | Ga0501033_0026599 | 3300049570 | Bacteria | 4352 |
| 1289 | Ga0501033_0027952 | 3300049570 | Bacteria | 4239 |
| 1290 | Ga0501033_0178464 | 3300049570 | Bacteria | 1523 |
| 1291 | Ga0501033_0209494 | 3300049570 | Bacteria | 1390 |
| 1292 | Ga0501034_0000072 | 3300049571 | Bacteria | 179824 |
| 1293 | Ga0501034_0186662 | 3300049571 | Bacteria | 2036 |
| 1294 | Ga0501034_0199578 | 3300049571 | Bacteria | 1959 |
| 1295 | Ga0501034_0214716 | 3300049571 | Bacteria | 1878 |
| 1296 | Ga0501034_0254182 | 3300049571 | Bacteria | 1701 |
| 1297 | Ga0501034_0631845 | 3300049571 | Bacteria | 974 |
| 1298 | Ga0501036_0000050 | 3300049572 | Bacteria | 75340 |
| 1299 | Ga0501036_0023850 | 3300049572 | Bacteria | 5155 |
| 1300 | Ga0501036_0027119 | 3300049572 | Bacteria | 4839 |
| 1301 | Ga0501036_0109654 | 3300049572 | Bacteria | 2332 |
| 1302 | Ga0501036_0220338 | 3300049572 | Bacteria | 1593 |
| 1303 | Ga0501036_0253779 | 3300049572 | Bacteria | 1473 |
| 1304 | Ga0501037_0000030 | 3300049573 | Bacteria | 136148 |
| 1305 | Ga0501037_0019157 | 3300049573 | Bacteria | 5043 |
| 1306 | Ga0501037_0040958 | 3300049573 | Bacteria | 3408 |
| 1307 | Ga0501037_0067050 | 3300049573 | Bacteria | 2613 |
| 1308 | Ga0501037_0158463 | 3300049573 | Bacteria | 1615 |
| 1309 | Ga0501037_0196762 | 3300049573 | Bacteria | 1425 |
| 1310 | Ga0501038_0000039 | 3300049574 | Bacteria | 122904 |
| 1311 | Ga0501038_0003573 | 3300049574 | Bacteria | 14467 |
| 1312 | Ga0501038_0003903 | 3300049574 | Bacteria | 13865 |
| 1313 | Ga0501038_0019522 | 3300049574 | Bacteria | 6108 |
| 1314 | Ga0501038_0064610 | 3300049574 | Bacteria | 3120 |
| 1315 | Ga0501038_0087612 | 3300049574 | Bacteria | 2614 |
| 1316 | Ga0501038_0120846 | 3300049574 | Bacteria | 2160 |
| 1317 | Ga0501038_0179009 | 3300049574 | Bacteria | 1712 |
| 1318 | Ga0501039_0000060 | 3300049575 | Bacteria | 85528 |
| 1319 | Ga0501039_0003437 | 3300049575 | Bacteria | 11824 |
| 1320 | Ga0501039_0006389 | 3300049575 | Bacteria | 8954 |
| 1321 | Ga0501039_0049810 | 3300049575 | Bacteria | 3239 |
| 1322 | Ga0501039_0069222 | 3300049575 | Bacteria | 2740 |
| 1323 | Ga0501039_0120324 | 3300049575 | Bacteria | 2057 |
| 1324 | Ga0501039_0170764 | 3300049575 | Bacteria | 1709 |
| 1325 | Ga0501042_0008343 | 3300049578 | Bacteria | 6831 |
| 1326 | Ga0501042_0040413 | 3300049578 | Bacteria | 3316 |
| 1327 | Ga0501043_0000980 | 3300049579 | Bacteria | 25248 |
| 1328 | Ga0501043_0003512 | 3300049579 | Bacteria | 12893 |
| 1329 | Ga0501043_0015596 | 3300049579 | Bacteria | 5955 |
| 1330 | Ga0501043_0112845 | 3300049579 | Bacteria | 2134 |
| 1331 | Ga0501046_0000419 | 3300049580 | Bacteria | 42326 |
| 1332 | Ga0501046_0002900 | 3300049580 | Bacteria | 15897 |
| 1333 | Ga0501046_0022009 | 3300049580 | Bacteria | 5254 |
| 1334 | Ga0501047_0000174 | 3300049581 | Bacteria | 79021 |
| 1335 | Ga0501047_0012410 | 3300049581 | Bacteria | 8065 |
| 1336 | Ga0501047_0019117 | 3300049581 | Bacteria | 6573 |
| 1337 | Ga0501047_0031187 | 3300049581 | Bacteria | 5141 |
| 1338 | Ga0501047_0172472 | 3300049581 | Bacteria | 2031 |
| 1339 | Ga0501047_0181618 | 3300049581 | Bacteria | 1970 |
| 1340 | Ga0501047_0316665 | 3300049581 | Bacteria | 1400 |
| 1341 | Ga0501048_0000068 | 3300049582 | Bacteria | 53016 |
| 1342 | Ga0501048_0017640 | 3300049582 | Bacteria | 5254 |
| 1343 | Ga0501048_0323580 | 3300049582 | Bacteria | 1098 |
| 1344 | Ga0501067_0000068 | 3300049583 | Bacteria | 59338 |
| 1345 | Ga0501067_0003637 | 3300049583 | Bacteria | 8493 |
| 1346 | Ga0501067_0007709 | 3300049583 | Bacteria | 5987 |
| 1347 | Ga0501067_0111382 | 3300049583 | Bacteria | 1522 |
| 1348 | Ga0501067_0131537 | 3300049583 | Bacteria | 1393 |
| 1349 | Ga0501068_0000949 | 3300049584 | Bacteria | 15209 |
| 1350 | Ga0501068_0002589 | 3300049584 | Bacteria | 9588 |
| 1351 | Ga0501068_0003549 | 3300049584 | Bacteria | 8427 |
| 1352 | Ga0501069_0035352 | 3300049585 | Bacteria | 2752 |
| 1353 | Ga0501070_0025353 | 3300049586 | Bacteria | 4973 |
| 1354 | Ga0501070_0039676 | 3300049586 | Bacteria | 3925 |
| 1355 | Ga0501070_0256961 | 3300049586 | Bacteria | 1428 |
| 1356 | Ga0501071_0131428 | 3300049587 | Bacteria | 1860 |
| 1357 | Ga0501072_0035557 | 3300049588 | Bacteria | 3902 |
| 1358 | Ga0501072_0221508 | 3300049588 | Bacteria | 1508 |
| 1359 | Ga0501073_0000009 | 3300049589 | Bacteria | 195649 |
| 1360 | Ga0501073_0010592 | 3300049589 | Bacteria | 6745 |
| 1361 | Ga0501073_0162995 | 3300049589 | Bacteria | 1544 |
| 1362 | Ga0501073_0450101 | 3300049589 | Bacteria | 890 |
| 1363 | Ga0501074_0001057 | 3300049590 | Bacteria | 17986 |
| 1364 | Ga0501074_0003293 | 3300049590 | Bacteria | 11426 |
| 1365 | Ga0501074_0055835 | 3300049590 | Bacteria | 2845 |
| 1366 | Ga0501077_0028394 | 3300049593 | Bacteria | 3556 |
| 1367 | Ga0501079_0012968 | 3300049741 | Bacteria | 6357 |
| 1368 | Ga0501079_0017176 | 3300049741 | Bacteria | 5525 |
| 1369 | Ga0501079_0040305 | 3300049741 | Bacteria | 3602 |
| 1370 | Ga0501080_0006205 | 3300049742 | Bacteria | 10727 |
| 1371 | Ga0501080_0032682 | 3300049742 | Bacteria | 4854 |
| 1372 | Ga0501080_0037424 | 3300049742 | Bacteria | 4532 |
| 1373 | Ga0501080_0245242 | 3300049742 | Bacteria | 1634 |
| 1374 | Ga0501080_0245636 | 3300049742 | Bacteria | 1633 |
| 1375 | Ga0501083_0005994 | 3300049744 | Bacteria | 8609 |
| 1376 | Ga0501083_0021673 | 3300049744 | Bacteria | 4462 |
| 1377 | Ga0501083_0058662 | 3300049744 | Bacteria | 2575 |
| 1378 | Ga0501035_0000067 | 3300049822 | Bacteria | 129204 |
| 1379 | Ga0501035_0006796 | 3300049822 | Bacteria | 10687 |
| 1380 | Ga0501035_0031489 | 3300049822 | Bacteria | 4830 |
| 1381 | Ga0501035_0054807 | 3300049822 | Bacteria | 3561 |
| 1382 | Ga0501035_0072940 | 3300049822 | Bacteria | 3037 |
| 1383 | Ga0501035_0074309 | 3300049822 | Bacteria | 3007 |
| 1384 | Ga0501035_0106024 | 3300049822 | Bacteria | 2464 |
| 1385 | Ga0501035_0212386 | 3300049822 | Bacteria | 1655 |
| 1386 | Ga0501035_0452169 | 3300049822 | Bacteria | 1062 |
| 1387 | Ga0501044_0000258 | 3300049823 | Bacteria | 67161 |
| 1388 | Ga0501044_0003604 | 3300049823 | Bacteria | 17424 |
| 1389 | Ga0501044_0007503 | 3300049823 | Bacteria | 11997 |
| 1390 | Ga0501044_0009609 | 3300049823 | Bacteria | 10525 |
| 1391 | Ga0501044_0032713 | 3300049823 | Bacteria | 5466 |
| 1392 | Ga0501044_0066602 | 3300049823 | Bacteria | 3671 |
| 1393 | Ga0501044_0119538 | 3300049823 | Bacteria | 2637 |
| 1394 | Ga0501044_0141974 | 3300049823 | Bacteria | 2390 |
| 1395 | Ga0501044_0274006 | 3300049823 | Bacteria | 1622 |
| 1396 | Ga0501044_0293875 | 3300049823 | Bacteria | 1555 |
| 1397 | Ga0501044_0620766 | 3300049823 | Bacteria | 972 |
| 1398 | Ga0501045_0012008 | 3300049824 | Bacteria | 6088 |
| 1399 | Ga0501045_0043356 | 3300049824 | Bacteria | 3276 |
| 1400 | nmdc:mga03n38_71327_c1 | 3300050490 | Bacteria | 1608 |
| 1401 | nmdc:mga00v17_50262_c1 | 3300050491 | Bacteria | 2532 |
| 1402 | nmdc:mga00v17_59291_c1 | 3300050491 | Bacteria | 2348 |
| 1403 | nmdc:mga0yw44_100540_c1 | 3300050492 | Bacteria | 1842 |
| 1404 | nmdc:mga0yw44_31880_c1 | 3300050492 | Bacteria | 3068 |
| 1405 | nmdc:mga0yw44_47176_c1 | 3300050492 | Bacteria | 2591 |
| 1406 | nmdc:mga0yw44_87286_c1 | 3300050492 | Bacteria | 1966 |
| 1407 | nmdc:mga0k408_41185_c1 | 3300050493 | Bacteria | 2659 |
| 1408 | nmdc:mga06z11_33296_c1 | 3300050494 | Bacteria | 2520 |
| 1409 | nmdc:mga04h51_105902_c1 | 3300050495 | Bacteria | 1031 |
| 1410 | nmdc:mga07m45_16224_c2 | 3300050496 | Bacteria | 3562 |
| 1411 | nmdc:mga05p37_151_c1 | 3300050507 | Bacteria | 65585 |
| 1412 | nmdc:mga05p37_296846_c1 | 3300050507 | Bacteria | 1921 |
| 1413 | nmdc:mga05p37_563132_c1 | 3300050507 | Bacteria | 1294 |
| 1414 | nmdc:mga05p37_7272_c1 | 3300050507 | Bacteria | 13063 |
| 1415 | nmdc:mga0qj67_9689_c1 | 3300050509 | Bacteria | 7175 |
| 1416 | nmdc:mga06r32_755_c1 | 3300050510 | Bacteria | 28474 |
| 1417 | nmdc:mga08y16_108_c1 | 3300050511 | Bacteria | 69804 |
| 1418 | nmdc:mga08y16_2951_c1 | 3300050511 | Bacteria | 17524 |
| 1419 | nmdc:mga0n895_24865_c1 | 3300050512 | Bacteria | 5650 |
| 1420 | nmdc:mga0n895_25991_c1 | 3300050512 | Bacteria | 5538 |
| 1421 | nmdc:mga0n895_265_c1 | 3300050512 | Bacteria | 34107 |
| 1422 | nmdc:mga0n895_37633_c1 | 3300050512 | Bacteria | 4682 |
| 1423 | nmdc:mga0rr50_12610_c1 | 3300050513 | Bacteria | 5471 |
| 1424 | nmdc:mga0rr50_19659_c1 | 3300050513 | Bacteria | 4565 |
| 1425 | nmdc:mga0rr50_642_c1 | 3300050513 | Bacteria | 18790 |
| 1426 | nmdc:mga0a205_1049_c1 | 3300050515 | Bacteria | 23004 |
| 1427 | nmdc:mga0a205_146_c1 | 3300050515 | Bacteria | 45616 |
| 1428 | nmdc:mga0a205_21581_c1 | 3300050515 | Bacteria | 6090 |
| 1429 | nmdc:mga0sz30_34108_c1 | 3300050516 | Bacteria | 2118 |
| 1430 | nmdc:mga0sz30_40712_c2 | 3300050516 | Bacteria | 1239 |
| 1431 | Ga0495601_0000355 | 3300053077 | Bacteria | 24059 |
| 1432 | Ga0495601_0009169 | 3300053077 | Bacteria | 5846 |
| 1433 | Ga0495601_0017539 | 3300053077 | Bacteria | 4347 |
| 1434 | Ga0495601_0033848 | 3300053077 | Bacteria | 3184 |
| 1435 | Ga0495601_0050959 | 3300053077 | Bacteria | 2612 |
| 1436 | Ga0495601_0083171 | 3300053077 | Bacteria | 2055 |
| 1437 | Ga0495601_0107560 | 3300053077 | Bacteria | 1804 |
| 1438 | Ga0495601_0163327 | 3300053077 | Bacteria | 1455 |
| 1439 | Ga0495601_0188965 | 3300053077 | Bacteria | 1346 |
| 1440 | Ga0495601_0199885 | 3300053077 | Bacteria | 1306 |
| 1441 | Ga0495612_0001097 | 3300053078 | Bacteria | 11083 |
| 1442 | Ga0495612_0007774 | 3300053078 | Bacteria | 4376 |
| 1443 | Ga0495612_0040958 | 3300053078 | Unclassified | 1888 |
| 1444 | Ga0495612_0078568 | 3300053078 | Bacteria | 1384 |
| 1445 | Ga0500635_0001974 | 3300053080 | Bacteria | 5009 |
| 1446 | Ga0500635_0002613 | 3300053080 | Bacteria | 4479 |
| 1447 | Ga0495655_0009734 | 3300053083 | Bacteria | 1874 |
| 1448 | Ga0495595_0000554 | 3300053084 | Bacteria | 14279 |
| 1449 | Ga0495595_0000637 | 3300053084 | Bacteria | 13319 |
| 1450 | Ga0495595_0001043 | 3300053084 | Bacteria | 10675 |
| 1451 | Ga0495595_0002582 | 3300053084 | Bacteria | 7104 |
| 1452 | Ga0495595_0064823 | 3300053084 | Bacteria | 1717 |
| 1453 | Ga0495619_0000048 | 3300053085 | Bacteria | 102117 |
| 1454 | Ga0495619_0000256 | 3300053085 | Bacteria | 38697 |
| 1455 | Ga0495619_0001080 | 3300053085 | Bacteria | 17897 |
| 1456 | Ga0495619_0001353 | 3300053085 | Bacteria | 16080 |
| 1457 | Ga0495619_0005007 | 3300053085 | Bacteria | 8415 |
| 1458 | Ga0495619_0014512 | 3300053085 | Bacteria | 4976 |
| 1459 | Ga0495619_0197915 | 3300053085 | Bacteria | 1391 |
| 1460 | Ga0495619_0219931 | 3300053085 | Bacteria | 1315 |
| 1461 | Ga0500578_0065579 | 3300053086 | Bacteria | 2316 |
| 1462 | Ga0500643_000013 | 3300053087 | Bacteria | 324296 |
| 1463 | Ga0500583_0056480 | 3300053092 | Bacteria | 1839 |
| 1464 | Ga0500651_0038749 | 3300053093 | Bacteria | 3002 |
| 1465 | Ga0500566_0001419 | 3300053094 | Bacteria | 14035 |
| 1466 | Ga0500566_0012672 | 3300053094 | Bacteria | 4960 |
| 1467 | Ga0500640_000253 | 3300053095 | Bacteria | 11745 |
| 1468 | Ga0500641_0031622 | 3300053096 | Bacteria | 2088 |
| 1469 | Ga0500554_003440 | 3300053102 | Bacteria | 3242 |
| 1470 | Ga0500555_006750 | 3300053103 | Bacteria | 3260 |
| 1471 | Ga0500572_000199 | 3300053111 | Bacteria | 21285 |
| 1472 | Ga0500595_000842 | 3300053119 | Bacteria | 17493 |
| 1473 | Ga0500595_007617 | 3300053119 | Bacteria | 4482 |
| 1474 | Ga0500595_033593 | 3300053119 | Bacteria | 1701 |
| 1475 | Ga0500607_076874 | 3300053121 | Bacteria | 1710 |
| 1476 | Ga0500608_103967 | 3300053122 | Bacteria | 1312 |
| 1477 | Ga0500614_000715 | 3300053123 | Bacteria | 8481 |
| 1478 | Ga0500642_0020937 | 3300053130 | Bacteria | 2580 |
| 1479 | Ga0500658_0011386 | 3300053134 | Bacteria | 3278 |
| 1480 | Ga0500559_0001308 | 3300053136 | Bacteria | 14372 |
| 1481 | Ga0500568_0014785 | 3300053139 | Bacteria | 3512 |
| 1482 | Ga0500573_0008543 | 3300053140 | Bacteria | 5644 |
| 1483 | Ga0500577_0109173 | 3300053142 | Unclassified | 1140 |
| 1484 | Ga0500603_000226 | 3300053150 | Bacteria | 14827 |
| 1485 | Ga0500604_0018512 | 3300053151 | Bacteria | 1941 |
| 1486 | Ga0500616_0000028 | 3300053153 | Bacteria | 435722 |
| 1487 | Ga0500619_072092 | 3300053154 | Bacteria | 1151 |
| 1488 | Ga0500620_032573 | 3300053155 | Bacteria | 1660 |
| 1489 | Ga0500627_0162643 | 3300053158 | Bacteria | 1007 |
| 1490 | Ga0500630_000573 | 3300053159 | Bacteria | 16713 |
| 1491 | Ga0500638_001609 | 3300053162 | Bacteria | 7251 |
| 1492 | Ga0500639_000006 | 3300053163 | Bacteria | 165068 |
| 1493 | Ga0500636_0000762 | 3300053177 | Bacteria | 17368 |
| 1494 | Ga0500636_0013138 | 3300053177 | Bacteria | 4858 |
| 1495 | Ga0500636_0030340 | 3300053177 | Bacteria | 3197 |
| 1496 | Ga0500637_0000251 | 3300053178 | Bacteria | 19903 |
| 1497 | Ga0500637_0003349 | 3300053178 | Bacteria | 7387 |
| 1498 | Ga0500637_0187265 | 3300053178 | Bacteria | 1183 |
| 1499 | Ga0500576_083610 | 3300053725 | Bacteria | 1342 |
| 1500 | Ga0500657_054402 | 3300053728 | Unclassified | 1813 |
| 1501 | Ga0500596_000603 | 3300053735 | Bacteria | 6894 |
| 1502 | Ga0500596_011896 | 3300053735 | Bacteria | 1326 |
| 1503 | Ga0500599_003944 | 3300053736 | Bacteria | 1823 |
| 1504 | Ga0500601_000371 | 3300053737 | Bacteria | 8090 |
| 1505 | Ga0501084_0006839 | 3300054114 | Bacteria | 9387 |
| 1506 | Ga0501084_0007774 | 3300054114 | Bacteria | 8822 |
| 1507 | Ga0501084_0034119 | 3300054114 | Bacteria | 4255 |
| 1508 | Ga0501084_0354426 | 3300054114 | Bacteria | 1239 |
| 1509 | Ga0500661_001477 | 3300055283 | Bacteria | 4413 |
| 1510 | Ga0501082_0001593 | 3300060353 | Bacteria | 20008 |
| 1511 | Ga0501082_0018224 | 3300060353 | Bacteria | 6044 |
| 1512 | Ga0501082_0050188 | 3300060353 | Bacteria | 3598 |
| 1513 | Ga0501082_0107881 | 3300060353 | Bacteria | 2409 |
| 1514 | Ga0501082_0344249 | 3300060353 | Bacteria | 1299 |
| 1515 | 2507511877 | 2507262055 | Bacteria | 8048963 |
| 1516 | 2508545541 | 2508501009 | Bacteria | 7784016 |
| 1517 | 2508694359 | 2508501042 | Bacteria | 8719808 |
| 1518 | 2509146623 | 2508501128 | Bacteria | 8613869 |
| 1519 | 2513627760 | 2513237092 | Bacteria | 8341956 |
| 1520 | 2513643305 | 2513237094 | Bacteria | 8789602 |
| 1521 | 2513651094 | 2513237095 | Bacteria | 8976980 |
| 1522 | 2513659238 | 2513237096 | Bacteria | 8722461 |
| 1523 | 2513717791 | 2513237104 | Bacteria | 10034502 |
| 1524 | 2513859041 | 2513237137 | Bacteria | 9558895 |
| 1525 | 2513875299 | 2513237139 | Bacteria | 8737671 |
| 1526 | 2513887729 | 2513237141 | Bacteria | 8496279 |
| 1527 | 2513921882 | 2513237145 | Bacteria | 8979722 |
| 1528 | 2514014405 | 2513237161 | Bacteria | 8871253 |
| 1529 | 2515624710 | 2515154112 | Bacteria | 8294334 |
| 1530 | 2517895963 | 2517572143 | Bacteria | 9484767 |
| 1531 | 2528854956 | 2528768022 | Bacteria | 10457665 |
| 1532 | 2617349629 | 2617270735 | Bacteria | 9163226 |
| 1533 | 2617376815 | 2617270741 | Bacteria | 8201522 |
| 1534 | 2644289771 | 2643221651 | Bacteria | 4798932 |
| 1535 | 2671122757 | 2667528175 | Bacteria | 7532676 |
| 1536 | 2745078535 | 2744054633 | Bacteria | 8678936 |
| 1537 | 2793059632 | 2791355196 | Bacteria | 7323613 |
| 1538 | 2793069607 | 2791355197 | Bacteria | 8420563 |
| 1539 | 2793080290 | |||
| 1540 | 2805921874 | 2802429603 | Bacteria | 8777136 |
| 1541 | 2818242190 | 2816332527 | Bacteria | 8933356 |
| 1542 | 2824608016 | 2824600985 | Bacteria | 8488197 |
| 1543 | 2824615056 | 2824609381 | Bacteria | 8672835 |
| 1544 | 2824624849 | 2824617872 | Bacteria | 8814715 |
| 1545 | 2824633745 | 2824626560 | Bacteria | 8813858 |
| 1546 | 2824642308 | 2824635225 | Bacteria | 8785348 |
| 1547 | 2824649646 | 2824644064 | Bacteria | 8743947 |
| 1548 | 2824659530 | 2824653114 | Bacteria | 8493680 |
| 1549 | 2824670058 | 2824661429 | Bacteria | 9877870 |
| 1550 | 2824676704 | 2824671348 | Bacteria | 8369588 |
| 1551 | 2824692995 | 2824687955 | Bacteria | 8360029 |
| 1552 | 2824702578 | 2824696289 | Bacteria | 8335049 |
| 1553 | 2824712400 | 2824704595 | Bacteria | 9667483 |
| 1554 | 2824730051 | 2824723954 | Bacteria | 8758240 |
| 1555 | 2824738292 | 2824732956 | Bacteria | 7810675 |
| 1556 | 2824751731 | 2824746037 | Bacteria | 7911610 |
| 1557 | 2824762426 | 2824753945 | Bacteria | 9787441 |
| 1558 | 2824772739 | 2824763712 | Bacteria | 9792355 |
| 1559 | 2824776990 | 2824773399 | Bacteria | 8360218 |
| 1560 | 2838128391 | 2838122688 | Bacteria | 8803140 |
| 1561 | 2841942251 | 2841941048 | Bacteria | 8688029 |
| 1562 | 2841955619 | 2841949485 | Bacteria | 8680857 |
| 1563 | 2841960960 | 2841957949 | Bacteria | 8652217 |
| 1564 | 2841971228 | 2841966195 | Bacteria | 8673214 |
| 1565 | 2841982348 | 2841974524 | Bacteria | 8931498 |
| 1566 | 2841984265 | 2841983080 | Bacteria | 8395090 |
| 1567 | 2842042003 | 2842038055 | Bacteria | 8002051 |
| 1568 | 2842050046 | 2842045827 | Bacteria | 8006841 |
| 1569 | 2844321094 | 2844315083 | Bacteria | 8138177 |
| 1570 | 2847932305 | 2847930680 | Bacteria | 9342022 |
| 1571 | 2847943540 | 2847939898 | Bacteria | 8606328 |
| 1572 | 2849077263 | 2849076700 | Bacteria | 7039503 |
| 1573 | 2874592257 | 2874590934 | Bacteria | 8299676 |
| 1574 | 2874618720 | 2874612657 | Bacteria | 8252029 |
| 1575 | 2874624010 | 2874620515 | Bacteria | 8290088 |
| 1576 | 2874630982 | 2874628541 | Bacteria | 8630250 |
| 1577 | 2874647373 | 2874645413 | Bacteria | 8214782 |
| 1578 | 2876767415 | 2876761206 | Bacteria | 10111113 |
| 1579 | 2876774784 | 2876771140 | Bacteria | 8287509 |
| 1580 | 2876819737 | 2876818435 | Bacteria | 8274608 |
| 1581 | 2879079352 | 2879074833 | Bacteria | 8279565 |
| 1582 | 2879091530 | 2879083081 | Bacteria | 8587928 |
| 1583 | 2879101398 | 2879099564 | Bacteria | 10442239 |
| 1584 | 2879129086 | 2879127579 | Bacteria | 8294491 |
| 1585 | 2879144759 | 2879142872 | Bacteria | 8267021 |
| 1586 | 2881371130 | 2881364244 | Bacteria | 7710352 |
| 1587 | 2881673238 | 2881665667 | Bacteria | 8175609 |
| 1588 | 2885374060 | 2885366525 | Bacteria | 8326213 |
| 1589 | 2885382990 | 2885374607 | Bacteria | 8927485 |
| 1590 | 2888387387 | 2888378607 | Bacteria | 9652610 |
| 1591 | 2888391816 | 2888388044 | Bacteria | 7304136 |
| 1592 | 2888426608 | 2888419890 | Bacteria | 7857137 |
| 1593 | 2903728517 | 2903727486 | Bacteria | 8281579 |
| 1594 | 2903756067 | 2903748898 | Bacteria | 9972761 |
| 1595 | 2904670721 | 2904666416 | Bacteria | 8226587 |
| 1596 | 2904699115 | 2904690495 | Bacteria | 9412302 |
| 1597 | 2904707118 | |||
| 1598 | 2904713672 | 2904711408 | Bacteria | 9771557 |
| 1599 | 2906607709 | 2906602504 | Bacteria | 8295279 |
| 1600 | 2906615567 | |||
| 1601 | 2906627114 | 2906626472 | Bacteria | 8826946 |
| 1602 | 2906642015 | 2906635258 | Bacteria | 8601019 |
| 1603 | 2906645374 | 2906643746 | Bacteria | 8722424 |
| 1604 | 2906665001 | 2906660503 | Bacteria | 8595048 |
| 1605 | 2908745612 | 2908739725 | Bacteria | 8628932 |
| 1606 | 2908763684 | 2908756301 | Bacteria | 8864324 |
| 1607 | 2908782713 | 2908775508 | Bacteria | 8092255 |
| 1608 | 2922367287 | 2922361189 | Bacteria | 7436256 |
| 1609 | 2922370558 | |||
| 1610 | 2922432439 | |||
| 1611 | 2929620134 | 2929615660 | Bacteria | 9193770 |
| 1612 | 2929629447 | 2929624759 | Bacteria | 9339455 |
| 1613 | 2932791489 | 2932784394 | Bacteria | 9704911 |
| 1614 | 2932796892 | 2932794094 | Bacteria | 7915132 |
| 1615 | 2932802330 | 2932801729 | Bacteria | 7987968 |
| 1616 | 2932816745 | 2932809354 | Bacteria | 9135765 |
| 1617 | 2932824073 | 2932818245 | Bacteria | 9955613 |
| 1618 | 2932835391 | 2932828146 | Bacteria | 9745859 |
| 1619 | 2933582051 | 2933577622 | Bacteria | 9116884 |
| 1620 | 2935613480 | 2935608549 | Bacteria | 8203142 |
| 1621 | 2935621134 | 2935616580 | Bacteria | 9032984 |
| 1622 | 2935643559 | 2935638405 | Bacteria | 10015038 |
| 1623 | 2935650476 | 2935648319 | Bacteria | 8801166 |
| 1624 | 2935662918 | 2935656913 | Bacteria | 8965014 |
| 1625 | 2935671131 | 2935665750 | Bacteria | 9571747 |
| 1626 | 2935681263 | 2935675223 | Bacteria | 9928132 |
| 1627 | 2935689394 | 2935684952 | Bacteria | 9590419 |
| 1628 | 2935699969 | 2935694250 | Bacteria | 9291695 |
| 1629 | 2935712100 | 2935703347 | Bacteria | 10242284 |
| 1630 | 2935720340 | 2935713505 | Bacteria | 9608509 |
| 1631 | 2935728043 | 2935722832 | Bacteria | 9608746 |
| 1632 | 2935737360 | 2935732158 | Bacteria | 9706831 |
| 1633 | 2935746579 | 2935741537 | Bacteria | 9707219 |
| 1634 | 2935757546 | 2935750917 | Bacteria | 9590372 |
| 1635 | 2935763923 | 2935760218 | Bacteria | 9817913 |
| 1636 | 2935807900 | 2935801545 | Bacteria | 9301974 |
| 1637 | 2935818766 | 2935810662 | Bacteria | 9401221 |
| 1638 | 2935824667 | 2935819856 | Bacteria | 8261050 |
| 1639 | 2935833076 | 2935827899 | Bacteria | 10038562 |
| 1640 | 2935844268 | 2935837841 | Bacteria | 9454360 |
| 1641 | 2935851887 | 2935847175 | Bacteria | 8228321 |
| 1642 | 2935859673 | 2935855204 | Bacteria | 9035059 |
| 1643 | 2935872071 | 2935864058 | Bacteria | 9784707 |
| 1644 | 2935879005 | 2935873716 | Bacteria | 9632195 |
| 1645 | 2935887230 | 2935883170 | Bacteria | 7964738 |
| 1646 | 2935911237 | 2935908558 | Bacteria | 8568796 |
| 1647 | 2935920769 | 2935916978 | Bacteria | 9113783 |
| 1648 | 2935928266 | 2935926038 | Bacteria | 8601059 |
| 1649 | 2935937911 | 2935934488 | Bacteria | 8602579 |
| 1650 | 2935945193 | 2935942939 | Bacteria | 8599779 |
| 1651 | 2935954301 | 2935951376 | Bacteria | 8602333 |
| 1652 | 2935965620 | 2935959822 | Bacteria | 7869783 |
| 1653 | 2935971431 | 2935967501 | Bacteria | 8603075 |
| 1654 | 2935982051 | 2935975950 | Bacteria | 8347125 |
| 1655 | 2935990610 | 2935984226 | Bacteria | 8302647 |
| 1656 | 2936000352 | 2935992306 | Bacteria | 9802711 |
| 1657 | 2936008510 | 2936002035 | Bacteria | 9362176 |
| 1658 | 2936017168 | 2936011229 | Bacteria | 8801034 |
| 1659 | 2936026697 | 2936019824 | Bacteria | 8804134 |
| 1660 | 2936035440 | 2936028420 | Bacteria | 8965941 |
| 1661 | 2936045576 | 2936037263 | Bacteria | 9446081 |
| 1662 | 2936053589 | 2936046547 | Bacteria | 8903709 |
| 1663 | 2936062667 | 2936055302 | Bacteria | 8785755 |
| 1664 | 2940563632 | 2940556831 | Bacteria | 9590747 |
| 1665 | 2941537270 | 2941531003 | Bacteria | 7653939 |
| 1666 | 2941542600 | 2941538514 | Bacteria | 9402094 |
| 1667 | 3005476600 | 3005474847 | Bacteria | 9259049 |
| 1668 | 3005506906 | 3005506211 | Bacteria | 6943378 |
| 1669 | 3005591713 | 3005587118 | Bacteria | 7794411 |
| 1670 | 3005601434 | 3005594810 | Bacteria | 8716512 |
| 1671 | 3005724125 | 3005718088 | Bacteria | 8283608 |
| 1672 | 8006929468 | 8006926726 | Bacteria | 6749210 |
| 1673 | 8006934886 | 8006933436 | Bacteria | 10410654 |
| 1674 | 8006974854 | 8006973647 | Bacteria | 10679141 |
| 1675 | 8016519488 | 8016511872 | Bacteria | 9921665 |
| 1676 | 8016588685 | 8016583857 | Bacteria | 10421953 |
| 1677 | 8016637185 | 8016630954 | Bacteria | 9217207 |
| 1678 | 8017066034 | 8017057580 | Bacteria | 10023680 |
| 1679 | 8019563773 | 8019555841 | Bacteria | 9642137 |
| 1680 | 8019573838 | 8019565922 | Bacteria | 9639779 |
| 1681 | 8019624150 | 8019619141 | Bacteria | 9218857 |
| 1682 | 8019653671 | 8019648815 | Bacteria | 10014479 |
| 1683 | 8019665806 | 8019659431 | Bacteria | 8577854 |
| 1684 | 8019675332 | 8019668869 | Bacteria | 8791617 |
| 1685 | 8019680772 | 8019678201 | Bacteria | 8863603 |
| 1686 | 8019694995 | 8019687851 | Bacteria | 8712826 |
| 1687 | 8055750113 | 8055742211 | Bacteria | 9226248 |
| 1688 | 8056696200 | 8056689827 | Bacteria | 6712655 |
| 1689 | 8056975892 | 8056967851 | Bacteria | 9038162 |
| 1690 | Ga0307405_10022939 | |||
| 1691 | JGI24739J22299_10000871 | |||
| 1692 | JGI24739J22299_10008928 | |||
| 1693 | JGI24739J22299_10025017 | |||
| 1694 | JGI24743J22301_10013185 | |||
| 1695 | JGI24750J21931_1000457 | |||
| 1696 | JGI24035J26624_1000248 | |||
| 1697 | JGI25153J46596_10004620 | |||
| 1698 | JGI25153J46596_10005210 | |||
| 1699 | JGI25153J46596_10010025 | |||
| 1700 | JGI25153J46596_10031215 | |||
| 1701 | rootL2_10335649 | |||
| 1702 | JGI25160J50197_1003286 | |||
| 1703 | JGI25160J50197_1007225 | |||
| 1704 | Ga0055531_10010351 | |||
| 1705 | Ga0055531_10010606 | |||
| 1706 | Ga0055543_1008336 | |||
| 1707 | Ga0065165_1002476 | |||
| 1708 | Ga0065165_1002846 | |||
| 1709 | Ga0065165_1025765 | |||
| 1710 | Ga0065715_10243240 | |||
| 1711 | Ga0070658_10029391 | |||
| 1712 | Ga0070658_10044726 | |||
| 1713 | Ga0070658_10142354 | |||
| 1714 | Ga0070658_10349485 | |||
| 1715 | Ga0070658_10461582 | |||
| 1716 | Ga0070676_10020837 | |||
| 1717 | Ga0070676_10086242 | |||
| 1718 | Ga0070676_10165191 | |||
| 1719 | Ga0070683_100031309 | |||
| 1720 | Ga0070683_100041896 | |||
| 1721 | Ga0070683_100045265 | |||
| 1722 | Ga0070690_100017313 | |||
| 1723 | Ga0070670_100126553 | |||
| 1724 | Ga0070670_100316986 | |||
| 1725 | Ga0070677_10005521 | |||
| 1726 | Ga0068869_100059222 | |||
| 1727 | Ga0070666_10103477 | |||
| 1728 | Ga0070680_100003647 | |||
| 1729 | Ga0070680_100123326 | |||
| 1730 | Ga0070682_100007969 | |||
| 1731 | Ga0070682_100028580 | |||
| 1732 | Ga0070682_100030805 | |||
| 1733 | Ga0068868_100018112 | |||
| 1734 | Ga0068868_100208673 | |||
| 1735 | Ga0070660_100003870 | |||
| 1736 | Ga0070660_100019473 | |||
| 1737 | Ga0070660_100022278 | |||
| 1738 | Ga0070660_100026453 | |||
| 1739 | Ga0070660_100277754 | |||
| 1740 | Ga0070689_100031062 | |||
| 1741 | Ga0070689_100258241 | |||
| 1742 | Ga0070691_10004859 | |||
| 1743 | Ga0070691_10089795 | |||
| 1744 | Ga0070661_100009866 | |||
| 1745 | Ga0070661_100048625 | |||
| 1746 | Ga0070661_100063664 | |||
| 1747 | Ga0070661_100116508 | |||
| 1748 | Ga0070661_100156226 | |||
| 1749 | Ga0070668_100013726 | |||
| 1750 | Ga0070669_100014406 | |||
| 1751 | Ga0070669_100414063 | |||
| 1752 | Ga0070675_100018170 | |||
| 1753 | Ga0070675_100276160 | |||
| 1754 | Ga0070671_100016514 | |||
| 1755 | Ga0070671_100024253 | |||
| 1756 | Ga0070671_100034258 | |||
| 1757 | Ga0070671_100048918 | |||
| 1758 | Ga0070671_100170292 | |||
| 1759 | Ga0070674_100005693 | |||
| 1760 | Ga0070674_100558009 | |||
| 1761 | Ga0070673_100040424 | |||
| 1762 | Ga0070673_100045977 | |||
| 1763 | Ga0070673_100055936 | |||
| 1764 | Ga0070659_100058630 | |||
| 1765 | Ga0070659_100144527 | |||
| 1766 | Ga0070659_100281140 | |||
| 1767 | Ga0070667_100014138 | |||
| 1768 | Ga0070667_100024258 | |||
| 1769 | Ga0070703_10003201 | |||
| 1770 | Ga0070709_10002262 | |||
| 1771 | Ga0070709_10010070 | |||
| 1772 | Ga0070709_10013419 | |||
| 1773 | Ga0070709_10018177 | |||
| 1774 | Ga0070714_100022361 | |||
| 1775 | Ga0070714_100054927 | |||
| 1776 | Ga0070714_100152613 | |||
| 1777 | Ga0070714_100181091 | |||
| 1778 | Ga0070714_100269818 | |||
| 1779 | Ga0070714_100452677 | |||
| 1780 | Ga0070713_100003057 | |||
| 1781 | Ga0070713_100043687 | |||
| 1782 | Ga0070713_100055202 | |||
| 1783 | Ga0070713_100055241 | |||
| 1784 | Ga0070713_100055279 | |||
| 1785 | Ga0070713_100194352 | |||
| 1786 | Ga0070710_10002325 | |||
| 1787 | Ga0070710_10072646 | |||
| 1788 | Ga0070710_10119431 | |||
| 1789 | Ga0070701_10004348 | |||
| 1790 | Ga0070711_100002208 | |||
| 1791 | Ga0070711_100011944 | |||
| 1792 | Ga0070711_100013080 | |||
| 1793 | Ga0070711_100130120 | |||
| 1794 | Ga0070711_100187418 | |||
| 1795 | Ga0070711_100237930 | |||
| 1796 | Ga0070705_100023373 | |||
| 1797 | Ga0070700_100199792 | |||
| 1798 | Ga0070694_100019693 | |||
| 1799 | Ga0070708_100120926 | |||
| 1800 | Ga0070708_100130012 | |||
| 1801 | Ga0070663_100011845 | |||
| 1802 | Ga0070663_100027341 | |||
| 1803 | Ga0070678_100022020 | |||
| 1804 | Ga0070678_100066613 | |||
| 1805 | Ga0070678_100189994 | |||
| 1806 | Ga0070678_100408231 | |||
| 1807 | Ga0070662_100033312 | |||
| 1808 | Ga0070662_100164122 | |||
| 1809 | Ga0070681_10023502 | |||
| 1810 | Ga0070681_10032947 | |||
| 1811 | Ga0070681_10059728 | |||
| 1812 | Ga0070681_10076670 | |||
| 1813 | Ga0070681_10112479 | |||
| 1814 | Ga0068867_100021271 | |||
| 1815 | Ga0068867_100128322 | |||
| 1816 | Ga0068867_100185270 | |||
| 1817 | Ga0070685_10074353 | |||
| 1818 | Ga0070707_100055777 | |||
| 1819 | Ga0070698_100028359 | |||
| 1820 | Ga0070699_100143856 | |||
| 1821 | Ga0070679_100009249 | |||
| 1822 | Ga0070679_100009709 | |||
| 1823 | Ga0070679_100051732 | |||
| 1824 | Ga0070679_100098832 | |||
| 1825 | Ga0070679_100173681 | |||
| 1826 | Ga0070679_100342777 | |||
| 1827 | Ga0070684_100008556 | |||
| 1828 | Ga0070684_100022473 | |||
| 1829 | Ga0070684_100063130 | |||
| 1830 | Ga0070684_100092000 | |||
| 1831 | Ga0070684_100271447 | |||
| 1832 | Ga0070697_100079996 | |||
| 1833 | Ga0068853_100003634 | |||
| 1834 | Ga0068853_100045254 | |||
| 1835 | Ga0068853_100097553 | |||
| 1836 | Ga0068853_100175843 | |||
| 1837 | Ga0068853_100177249 | |||
| 1838 | Ga0068853_100179629 | |||
| 1839 | Ga0068853_100529554 | |||
| 1840 | Ga0070672_100006742 | |||
| 1841 | Ga0070672_100105181 | |||
| 1842 | Ga0070686_100116734 | |||
| 1843 | Ga0070695_100027274 | |||
| 1844 | Ga0070696_100027513 | |||
| 1845 | Ga0070693_100031082 | |||
| 1846 | Ga0070665_100063185 | |||
| 1847 | Ga0070665_100065216 | |||
| 1848 | Ga0070665_100071799 | |||
| 1849 | Ga0070665_100080708 | |||
| 1850 | Ga0070665_100105307 | |||
| 1851 | Ga0070665_100172385 | |||
| 1852 | Ga0070665_100203035 | |||
| 1853 | Ga0070665_100265636 | |||
| 1854 | Ga0070665_100380649 | |||
| 1855 | Ga0070665_100428297 | |||
| 1856 | Ga0070704_100025802 | |||
| 1857 | Ga0068855_100018412 | |||
| 1858 | Ga0068855_100019735 | |||
| 1859 | Ga0068855_100112477 | |||
| 1860 | Ga0068855_100125312 | |||
| 1861 | Ga0068855_100259104 | |||
| 1862 | Ga0068855_100261934 | |||
| 1863 | Ga0068855_100262469 | |||
| 1864 | Ga0068855_100410537 | |||
| 1865 | Ga0068855_100432165 | |||
| 1866 | Ga0068855_100454183 | |||
| 1867 | Ga0068855_100495803 | |||
| 1868 | Ga0068855_100739264 | |||
| 1869 | Ga0070664_100047876 | |||
| 1870 | Ga0070664_100069419 | |||
| 1871 | Ga0070664_100238256 | |||
| 1872 | Ga0068857_100003181 | |||
| 1873 | Ga0068857_100096073 | |||
| 1874 | Ga0068857_100681426 | |||
| 1875 | Ga0068854_100016856 | |||
| 1876 | Ga0068854_100030721 | |||
| 1877 | Ga0068854_100122052 | |||
| 1878 | Ga0068854_100155813 | |||
| 1879 | Ga0068856_100000781 | |||
| 1880 | Ga0068856_100024188 | |||
| 1881 | Ga0068856_100047838 | |||
| 1882 | Ga0068856_100073843 | |||
| 1883 | Ga0068856_100074006 | |||
| 1884 | Ga0068856_100116233 | |||
| 1885 | Ga0068856_100178360 | |||
| 1886 | Ga0068856_100180758 | |||
| 1887 | Ga0068856_100298360 | |||
| 1888 | Ga0068856_100320920 | |||
| 1889 | Ga0068856_100322290 | |||
| 1890 | Ga0070702_100046391 | |||
| 1891 | Ga0070702_100149746 | |||
| 1892 | Ga0070702_100323136 | |||
| 1893 | Ga0068852_100024735 | |||
| 1894 | Ga0068852_100026321 | |||
| 1895 | Ga0068852_100028959 | |||
| 1896 | Ga0068852_100204250 | |||
| 1897 | Ga0068852_100212283 | |||
| 1898 | Ga0068852_100545435 | |||
| 1899 | Ga0068859_100035913 | |||
| 1900 | Ga0068859_100154399 | |||
| 1901 | Ga0068859_100485774 | |||
| 1902 | Ga0068864_100026533 | |||
| 1903 | Ga0068864_100287017 | |||
| 1904 | Ga0068866_10022841 | |||
| 1905 | Ga0068861_100019676 | |||
| 1906 | Ga0068861_100048184 | |||
| 1907 | Ga0068861_100204537 | |||
| 1908 | Ga0068863_100006825 | |||
| 1909 | Ga0068858_100127566 | |||
| 1910 | Ga0068860_100018432 | |||
| 1911 | Ga0068860_100143296 | |||
| 1912 | Ga0068860_100143725 | |||
| 1913 | Ga0068862_100010222 | |||
| 1914 | Ga0068862_100028055 | |||
| 1915 | Ga0068862_100083389 | |||
| 1916 | Ga0081455_10000200 | |||
| 1917 | Ga0081455_10000768 | |||
| 1918 | Ga0081455_10023827 | |||
| 1919 | Ga0081540_1002136 | |||
| 1920 | Ga0081540_1008268 | |||
| 1921 | Ga0081540_1013689 | |||
| 1922 | Ga0070717_10003779 | |||
| 1923 | Ga0070717_10034264 | |||
| 1924 | Ga0070717_10351343 | |||
| 1925 | Ga0070717_10395519 | |||
| 1926 | Ga0075365_10046636 | |||
| 1927 | Ga0075365_10051949 | |||
| 1928 | Ga0075365_10065320 | |||
| 1929 | Ga0075368_10008811 | |||
| 1930 | Ga0075363_100065887 | |||
| 1931 | Ga0070715_10208276 | |||
| 1932 | Ga0070716_100008278 | |||
| 1933 | Ga0070716_100012612 | |||
| 1934 | Ga0070716_100078406 | |||
| 1935 | Ga0070712_100328792 | |||
| 1936 | Ga0075367_10016061 | |||
| 1937 | Ga0075367_10026524 | |||
| 1938 | Ga0075367_10048065 | |||
| 1939 | Ga0075427_10000041 | |||
| 1940 | Ga0097621_100011867 | |||
| 1941 | Ga0097621_100024301 | |||
| 1942 | Ga0075370_10019677 | |||
| 1943 | Ga0068871_100019303 | |||
| 1944 | Ga0068871_100057668 | |||
| 1945 | Ga0068871_100157136 | |||
| 1946 | Ga0068871_100162788 | |||
| 1947 | Ga0068871_100300703 | |||
| 1948 | Ga0075428_100003399 | |||
| 1949 | Ga0075430_100000133 | |||
| 1950 | Ga0075431_100002259 | |||
| 1951 | Ga0075433_10000506 | |||
| 1952 | Ga0075433_10025119 | |||
| 1953 | Ga0075433_10038792 | |||
| 1954 | Ga0075434_100000472 | |||
| 1955 | Ga0075434_100008091 | |||
| 1956 | Ga0075434_100044057 | |||
| 1957 | Ga0075434_100068627 | |||
| 1958 | Ga0075434_100386460 | |||
| 1959 | Ga0075434_100411167 | |||
| 1960 | Ga0075429_100000163 | |||
| 1961 | Ga0068865_100001544 | |||
| 1962 | Ga0068865_100003466 | |||
| 1963 | Ga0068865_100076577 | |||
| 1964 | Ga0068865_100362686 | |||
| 1965 | Ga0097620_100035916 | |||
| 1966 | Ga0097620_100154402 | |||
| 1967 | Ga0097620_100485755 | |||
| 1968 | Ga0099825_1036559 | |||
| 1969 | Ga0099824_1023056 | |||
| 1970 | Ga0099822_1001448 | |||
| 1971 | Ga0099823_1004051 | |||
| 1972 | Ga0075435_100017200 | |||
| 1973 | Ga0075435_100056759 | |||
| 1974 | Ga0099794_10060242 | |||
| 1975 | Ga0099795_10003998 | |||
| 1976 | Ga0099795_10010789 | |||
| 1977 | Ga0099795_10025253 | |||
| 1978 | Ga0099795_10134516 | |||
| 1979 | Ga0105251_10010431 | |||
| 1980 | Ga0105240_10008946 | |||
| 1981 | Ga0105240_10023552 | |||
| 1982 | Ga0105240_10029706 | |||
| 1983 | Ga0105240_10039692 | |||
| 1984 | Ga0105240_10048624 | |||
| 1985 | Ga0105240_10092782 | |||
| 1986 | Ga0105240_10427362 | |||
| 1987 | Ga0111539_10000389 | |||
| 1988 | Ga0111539_10001808 | |||
| 1989 | Ga0105245_10031587 | |||
| 1990 | Ga0105245_10035028 | |||
| 1991 | Ga0105245_10062438 | |||
| 1992 | Ga0105245_10154012 | |||
| 1993 | Ga0105245_10247473 | |||
| 1994 | Ga0105247_10031859 | |||
| 1995 | Ga0105247_10034936 | |||
| 1996 | Ga0105247_10056334 | |||
| 1997 | Ga0114129_10018380 | |||
| 1998 | Ga0114129_10364864 | |||
| 1999 | Ga0114129_10609708 | |||
| 2000 | Ga0105243_10040850 | |||
| 2001 | Ga0105241_10024018 | |||
| 2002 | Ga0105241_10031108 | |||
| 2003 | Ga0105241_10081747 | |||
| 2004 | Ga0105242_10082937 | |||
| 2005 | Ga0105242_10097450 | |||
| 2006 | Ga0105242_10271376 | |||
| 2007 | Ga0105242_10803490 | |||
| 2008 | Ga0105248_10011779 | |||
| 2009 | Ga0105248_10046950 | |||
| 2010 | Ga0105248_10237637 | |||
| 2011 | Ga0105248_10261174 | |||
| 2012 | Ga0105237_10004719 | |||
| 2013 | Ga0105237_10007432 | |||
| 2014 | Ga0105237_10019250 | |||
| 2015 | Ga0105237_10045568 | |||
| 2016 | Ga0105237_10381648 | |||
| 2017 | Ga0105237_10410939 | |||
| 2018 | Ga0105237_10470423 | |||
| 2019 | Ga0105238_10031611 | |||
| 2020 | Ga0105238_10040511 | |||
| 2021 | Ga0105238_10045455 | |||
| 2022 | Ga0105238_10064854 | |||
| 2023 | Ga0105238_10110436 | |||
| 2024 | Ga0105238_10292182 | |||
| 2025 | Ga0105238_10374066 | |||
| 2026 | Ga0105249_10019871 | |||
| 2027 | Ga0105249_10067975 | |||
| 2028 | Ga0105249_10094865 | |||
| 2029 | Ga0099796_10043386 | |||
| 2030 | Ga0105239_10043179 | |||
| 2031 | Ga0105239_10053738 | |||
| 2032 | Ga0105239_10064549 | |||
| 2033 | Ga0105239_10079664 | |||
| 2034 | Ga0105239_10168122 | |||
| 2035 | Ga0105239_10282663 | |||
| 2036 | Ga0105239_10316055 | |||
| 2037 | Ga0105239_10322586 | |||
| 2038 | Ga0105239_10323551 | |||
| 2039 | Ga0105239_10330197 | |||
| 2040 | Ga0105239_10826421 | |||
| 2041 | Ga0105246_10012128 | |||
| 2042 | Ga0105246_10054989 | |||
| 2043 | Ga0105246_10332364 | |||
| 2044 | Ga0157326_1008038 | |||
| 2045 | Ga0157373_10010494 | |||
| 2046 | Ga0157373_10024897 | |||
| 2047 | Ga0157373_10204840 | |||
| 2048 | Ga0157371_10007078 | |||
| 2049 | Ga0157371_10036676 | |||
| 2050 | Ga0157371_10128334 | |||
| 2051 | Ga0157371_10158591 | |||
| 2052 | Ga0157370_10041078 | |||
| 2053 | Ga0157370_10181306 | |||
| 2054 | Ga0157370_10238914 | |||
| 2055 | Ga0157369_10008072 | |||
| 2056 | Ga0157369_10033594 | |||
| 2057 | Ga0157369_10236445 | |||
| 2058 | Ga0157369_10386899 | |||
| 2059 | Ga0157369_10522628 | |||
| 2060 | Ga0157369_10777587 | |||
| 2061 | Ga0157374_10002692 | |||
| 2062 | Ga0157374_10164515 | |||
| 2063 | Ga0157374_10224597 | |||
| 2064 | Ga0157378_10049119 | |||
| 2065 | Ga0157378_10104776 | |||
| 2066 | Ga0157378_10108129 | |||
| 2067 | Ga0157378_10396452 | |||
| 2068 | Ga0157378_10471250 | |||
| 2069 | Ga0163162_10022106 | |||
| 2070 | Ga0163162_10022234 | |||
| 2071 | Ga0163162_10029020 | |||
| 2072 | Ga0163162_10081453 | |||
| 2073 | Ga0163162_10107677 | |||
| 2074 | Ga0163162_10198425 | |||
| 2075 | Ga0163162_10324040 | |||
| 2076 | Ga0157372_10016582 | |||
| 2077 | Ga0157372_10107362 | |||
| 2078 | Ga0157372_10214288 | |||
| 2079 | Ga0157372_10423344 | |||
| 2080 | Ga0157375_10064892 | |||
| 2081 | Ga0157375_10430055 | |||
| 2082 | Ga0163163_10029384 | |||
| 2083 | Ga0163163_10059092 | |||
| 2084 | Ga0163163_10155656 | |||
| 2085 | Ga0157380_10013506 | |||
| 2086 | Ga0157377_10013798 | |||
| 2087 | Ga0157377_10226916 | |||
| 2088 | Ga0157379_10010153 | |||
| 2089 | Ga0157379_10027560 | |||
| 2090 | Ga0157376_10022095 | |||
| 2091 | Ga0157376_10109705 | |||
| 2092 | Ga0157376_10113532 | |||
| 2093 | Ga0157376_10237036 | |||
| 2094 | Ga0163161_10006229 | |||
| 2095 | Ga0163161_10035277 | |||
| 2096 | Ga0163161_10039404 | |||
| 2097 | Ga0163161_10047578 | |||
| 2098 | Ga0163161_10135289 | |||
| 2099 | Ga0206356_10553992 | |||
| 2100 | Ga0206356_11532789 | |||
| 2101 | Ga0206354_11292144 | |||
| 2102 | Ga0206353_10342907 | |||
| 2103 | Ga0214542_1000156 | |||
| 2104 | Ga0214545_1000078 | |||
| 2105 | Ga0214543_1000136 | |||
| 2106 | Ga0213875_10003786 | |||
| 2107 | Ga0213871_10000896 | |||
| 2108 | Ga0224572_1006509 | |||
| 2109 | Ga0228598_1015888 | |||
| 2110 | Ga0207425_1014237 | |||
| 2111 | Ga0209677_104346 | |||
| 2112 | Ga0209233_1005084 | |||
| 2113 | Ga0207666_1000311 | |||
| 2114 | Ga0209455_1006888 | |||
| 2115 | Ga0209673_1021558 | |||
| 2116 | Ga0209564_1008607 | |||
| 2117 | Ga0209758_1000705 | |||
| 2118 | Ga0209758_1000932 | |||
| 2119 | Ga0209758_1000986 | |||
| 2120 | Ga0209758_1002299 | |||
| 2121 | Ga0209758_1030972 | |||
| 2122 | Ga0207426_1000632 | |||
| 2123 | Ga0207426_1001240 | |||
| 2124 | Ga0207426_1006296 | |||
| 2125 | Ga0207426_1020313 | |||
| 2126 | Ga0209257_1001185 | |||
| 2127 | Ga0209257_1010432 | |||
| 2128 | Ga0207697_10006626 | |||
| 2129 | Ga0207713_1077773 | |||
| 2130 | Ga0207653_10002805 | |||
| 2131 | Ga0207682_10000009 | |||
| 2132 | Ga0207682_10014469 | |||
| 2133 | Ga0207692_10063809 | |||
| 2134 | Ga0207692_10069546 | |||
| 2135 | Ga0207692_10203761 | |||
| 2136 | Ga0207710_10001303 | |||
| 2137 | Ga0207710_10002730 | |||
| 2138 | Ga0207688_10000892 | |||
| 2139 | Ga0207680_10016229 | |||
| 2140 | Ga0207680_10058944 | |||
| 2141 | Ga0207647_10002160 | |||
| 2142 | Ga0207647_10016893 | |||
| 2143 | Ga0207647_10048251 | |||
| 2144 | Ga0207647_10110563 | |||
| 2145 | Ga0207647_10249664 | |||
| 2146 | Ga0207685_10051712 | |||
| 2147 | Ga0207699_10001069 | |||
| 2148 | Ga0207699_10007734 | |||
| 2149 | Ga0207699_10033250 | |||
| 2150 | Ga0207699_10040581 | |||
| 2151 | Ga0207645_10000999 | |||
| 2152 | Ga0207645_10064570 | |||
| 2153 | Ga0207645_10066806 | |||
| 2154 | Ga0207705_10081980 | |||
| 2155 | Ga0207654_10015616 | |||
| 2156 | Ga0207654_10025829 | |||
| 2157 | Ga0207654_10040703 | |||
| 2158 | Ga0207654_10090337 | |||
| 2159 | Ga0207707_10006422 | |||
| 2160 | Ga0207707_10020542 | |||
| 2161 | Ga0207707_10027810 | |||
| 2162 | Ga0207707_10062664 | |||
| 2163 | Ga0207707_10154734 | |||
| 2164 | Ga0207707_10372622 | |||
| 2165 | Ga0207695_10000123 | |||
| 2166 | Ga0207695_10057960 | |||
| 2167 | Ga0207695_10088527 | |||
| 2168 | Ga0207695_10155565 | |||
| 2169 | Ga0207695_10189873 | |||
| 2170 | Ga0207671_10009480 | |||
| 2171 | Ga0207671_10035416 | |||
| 2172 | Ga0207671_10041159 | |||
| 2173 | Ga0207671_10252742 | |||
| 2174 | Ga0207671_10527652 | |||
| 2175 | Ga0207693_10000565 | |||
| 2176 | Ga0207693_10006473 | |||
| 2177 | Ga0207693_10007042 | |||
| 2178 | Ga0207693_10076615 | |||
| 2179 | Ga0207693_10091642 | |||
| 2180 | Ga0207693_10327417 | |||
| 2181 | Ga0207663_10000239 | |||
| 2182 | Ga0207663_10212720 | |||
| 2183 | Ga0207660_10001283 | |||
| 2184 | Ga0207660_10030183 | |||
| 2185 | Ga0207660_10042221 | |||
| 2186 | Ga0207660_10178226 | |||
| 2187 | Ga0207662_10000025 | |||
| 2188 | Ga0207662_10010323 | |||
| 2189 | Ga0207657_10006857 | |||
| 2190 | Ga0207657_10012765 | |||
| 2191 | Ga0207657_10018108 | |||
| 2192 | Ga0207657_10148090 | |||
| 2193 | Ga0207657_10161621 | |||
| 2194 | Ga0207657_10166069 | |||
| 2195 | Ga0207657_10231905 | |||
| 2196 | Ga0207649_10002186 | |||
| 2197 | Ga0207649_10025741 | |||
| 2198 | Ga0207649_10303134 | |||
| 2199 | Ga0207649_10318780 | |||
| 2200 | Ga0207652_10073521 | |||
| 2201 | Ga0207652_10075776 | |||
| 2202 | Ga0207652_10144808 | |||
| 2203 | Ga0207652_10179454 | |||
| 2204 | Ga0207652_10322632 | |||
| 2205 | Ga0207652_10345915 | |||
| 2206 | Ga0207646_10112011 | |||
| 2207 | Ga0207646_10118738 | |||
| 2208 | Ga0207681_10007074 | |||
| 2209 | Ga0207681_10156754 | |||
| 2210 | Ga0207694_10039207 | |||
| 2211 | Ga0207694_10045928 | |||
| 2212 | Ga0207694_10104378 | |||
| 2213 | Ga0207694_10434838 | |||
| 2214 | Ga0207694_10461524 | |||
| 2215 | Ga0207650_10357355 | |||
| 2216 | Ga0207659_10169970 | |||
| 2217 | Ga0207659_10177614 | |||
| 2218 | Ga0207659_10216169 | |||
| 2219 | Ga0207687_10003202 | |||
| 2220 | Ga0207687_10030484 | |||
| 2221 | Ga0207687_10208342 | |||
| 2222 | Ga0207687_10221870 | |||
| 2223 | Ga0207687_10509783 | |||
| 2224 | Ga0207700_10004367 | |||
| 2225 | Ga0207700_10005825 | |||
| 2226 | Ga0207700_10076952 | |||
| 2227 | Ga0207664_10022280 | |||
| 2228 | Ga0207664_10032782 | |||
| 2229 | Ga0207664_10130661 | |||
| 2230 | Ga0207644_10032924 | |||
| 2231 | Ga0207644_10036076 | |||
| 2232 | Ga0207644_10055831 | |||
| 2233 | Ga0207644_10061984 | |||
| 2234 | Ga0207644_10127632 | |||
| 2235 | Ga0207690_10011755 | |||
| 2236 | Ga0207690_10064867 | |||
| 2237 | Ga0207690_10088473 | |||
| 2238 | Ga0207690_10253542 | |||
| 2239 | Ga0207706_10005363 | |||
| 2240 | Ga0207706_10040844 | |||
| 2241 | Ga0207706_10085400 | |||
| 2242 | Ga0207706_10129804 | |||
| 2243 | Ga0207686_10014315 | |||
| 2244 | Ga0207686_10187791 | |||
| 2245 | Ga0207709_10006190 | |||
| 2246 | Ga0207709_10012682 | |||
| 2247 | Ga0207709_10024392 | |||
| 2248 | Ga0207670_10013997 | |||
| 2249 | Ga0207670_10078501 | |||
| 2250 | Ga0207670_10375891 | |||
| 2251 | Ga0207669_10001324 | |||
| 2252 | Ga0207669_10084772 | |||
| 2253 | Ga0207704_10003457 | |||
| 2254 | Ga0207665_10000127 | |||
| 2255 | Ga0207665_10002113 | |||
| 2256 | Ga0207665_10108803 | |||
| 2257 | Ga0207665_10196496 | |||
| 2258 | Ga0207665_10267556 | |||
| 2259 | Ga0207691_10002604 | |||
| 2260 | Ga0207691_10113799 | |||
| 2261 | Ga0207691_10116097 | |||
| 2262 | Ga0207691_10365968 | |||
| 2263 | Ga0207711_10001071 | |||
| 2264 | Ga0207711_10072335 | |||
| 2265 | Ga0207711_10106384 | |||
| 2266 | Ga0207711_10252392 | |||
| 2267 | Ga0207689_10001156 | |||
| 2268 | Ga0207689_10031636 | |||
| 2269 | Ga0207689_10081386 | |||
| 2270 | Ga0207661_10002078 | |||
| 2271 | Ga0207661_10007789 | |||
| 2272 | Ga0207661_10062965 | |||
| 2273 | Ga0207679_10003209 | |||
| 2274 | Ga0207679_10267358 | |||
| 2275 | Ga0207679_10417424 | |||
| 2276 | Ga0207667_10013288 | |||
| 2277 | Ga0207667_10028603 | |||
| 2278 | Ga0207667_10064143 | |||
| 2279 | Ga0207667_10077987 | |||
| 2280 | Ga0207667_10095327 | |||
| 2281 | Ga0207667_10103467 | |||
| 2282 | Ga0207667_10115171 | |||
| 2283 | Ga0207667_10122695 | |||
| 2284 | Ga0207667_10123806 | |||
| 2285 | Ga0207667_10128039 | |||
| 2286 | Ga0207667_10188431 | |||
| 2287 | Ga0207667_10219159 | |||
| 2288 | Ga0207667_10607125 | |||
| 2289 | Ga0207651_10008497 | |||
| 2290 | Ga0207651_10151130 | |||
| 2291 | Ga0207651_10327218 | |||
| 2292 | Ga0207712_10000579 | |||
| 2293 | Ga0207668_10001403 | |||
| 2294 | Ga0207668_10085216 | |||
| 2295 | Ga0207640_10003644 | |||
| 2296 | Ga0207640_10066874 | |||
| 2297 | Ga0207640_10075564 | |||
| 2298 | Ga0207640_10558073 | |||
| 2299 | Ga0207658_10018420 | |||
| 2300 | Ga0207658_10130939 | |||
| 2301 | Ga0207677_10006044 | |||
| 2302 | Ga0207677_10117181 | |||
| 2303 | Ga0207677_10124489 | |||
| 2304 | Ga0207703_10008872 | |||
| 2305 | Ga0207703_10014416 | |||
| 2306 | Ga0207703_10130992 | |||
| 2307 | Ga0207703_10184537 | |||
| 2308 | Ga0207703_10306384 | |||
| 2309 | Ga0207639_10001866 | |||
| 2310 | Ga0207639_10044315 | |||
| 2311 | Ga0207639_10082222 | |||
| 2312 | Ga0207639_10094435 | |||
| 2313 | Ga0207639_10108911 | |||
| 2314 | Ga0207639_10135429 | |||
| 2315 | Ga0207639_10261036 | |||
| 2316 | Ga0207639_10288492 | |||
| 2317 | Ga0207639_10582894 | |||
| 2318 | Ga0207678_10021488 | |||
| 2319 | Ga0207678_10022823 | |||
| 2320 | Ga0207678_10042596 | |||
| 2321 | Ga0207678_10062786 | |||
| 2322 | Ga0207678_10130307 | |||
| 2323 | Ga0207678_10145100 | |||
| 2324 | Ga0207678_10261116 | |||
| 2325 | Ga0207708_10020931 | |||
| 2326 | Ga0207708_10130549 | |||
| 2327 | Ga0207702_10000758 | |||
| 2328 | Ga0207702_10010946 | |||
| 2329 | Ga0207702_10065779 | |||
| 2330 | Ga0207702_10098432 | |||
| 2331 | Ga0207702_10160482 | |||
| 2332 | Ga0207702_10167929 | |||
| 2333 | Ga0207702_10249986 | |||
| 2334 | Ga0207641_10006404 | |||
| 2335 | Ga0207641_10051015 | |||
| 2336 | Ga0207648_10004627 | |||
| 2337 | Ga0207648_10046915 | |||
| 2338 | Ga0207648_10176768 | |||
| 2339 | Ga0207676_10030863 | |||
| 2340 | Ga0207676_10677293 | |||
| 2341 | Ga0207674_10054730 | |||
| 2342 | Ga0207674_10246718 | |||
| 2343 | Ga0207675_100003859 | |||
| 2344 | Ga0207675_100104527 | |||
| 2345 | Ga0207675_100108300 | |||
| 2346 | Ga0207675_100115515 | |||
| 2347 | Ga0207675_100533979 | |||
| 2348 | Ga0207683_10000782 | |||
| 2349 | Ga0207683_10000850 | |||
| 2350 | Ga0207683_10051919 | |||
| 2351 | Ga0207683_10056530 | |||
| 2352 | Ga0207683_10089743 | |||
| 2353 | Ga0207683_10163872 | |||
| 2354 | Ga0207683_10304839 | |||
| 2355 | Ga0207698_10007574 | |||
| 2356 | Ga0207698_10031006 | |||
| 2357 | Ga0207698_10087873 | |||
| 2358 | Ga0207698_10096641 | |||
| 2359 | Ga0207698_10375299 | |||
| 2360 | Ga0209389_1000019 | |||
| 2361 | Ga0209389_1000248 | |||
| 2362 | Ga0209589_1000005 | |||
| 2363 | Ga0209589_1001871 | |||
| 2364 | Ga0209489_100005 | |||
| 2365 | Ga0209489_100033 | |||
| 2366 | Ga0209489_102684 | |||
| 2367 | Ga0209700_100006 | |||
| 2368 | Ga0209700_100012 | |||
| 2369 | Ga0209179_1012095 | |||
| 2370 | Ga0209998_10002588 | |||
| 2371 | Ga0209974_10003747 | |||
| 2372 | Ga0207428_10000164 | |||
| 2373 | Ga0207428_10000391 | |||
| 2374 | Ga0265357_1000580 | |||
| 2375 | Ga0268266_10002016 | |||
| 2376 | Ga0268266_10077802 | |||
| 2377 | Ga0268266_10112988 | |||
| 2378 | Ga0268266_10128151 | |||
| 2379 | Ga0268266_10203354 | |||
| 2380 | Ga0268266_10499031 | |||
| 2381 | Ga0268265_10004025 | |||
| 2382 | Ga0268265_10079812 | |||
| 2383 | Ga0268264_10000174 | |||
| 2384 | Ga0268264_10049152 | |||
| 2385 | Ga0268264_10146243 | |||
| 2386 | Ga0307517_10000859 | |||
| 2387 | Ga0307515_10028873 | |||
| 2388 | Ga0265338_10059137 | |||
| 2389 | Ga0307511_10032093 | |||
| 2390 | Ga0265770_1032542 | |||
| 2391 | Ga0265330_10020221 | |||
| 2392 | Ga0265330_10031054 | |||
| 2393 | Ga0265330_10067423 | |||
| 2394 | Ga0265332_10006382 | |||
| 2395 | Ga0265328_10043351 | |||
| 2396 | Ga0265325_10000019 | |||
| 2397 | Ga0265325_10003263 | |||
| 2398 | Ga0265325_10028164 | |||
| 2399 | Ga0265340_10018122 | |||
| 2400 | Ga0265340_10036658 | |||
| 2401 | Ga0265339_10001912 | |||
| 2402 | Ga0265331_10190616 | |||
| 2403 | Ga0265316_10067912 | |||
| 2404 | Ga0307509_10006398 | |||
| 2405 | Ga0307509_10274632 | |||
| 2406 | Ga0265313_10019302 | |||
| 2407 | Ga0265313_10022283 | |||
| 2408 | Ga0265313_10024531 | |||
| 2409 | Ga0265313_10112428 | |||
| 2410 | Ga0307508_10000063 | |||
| 2411 | Ga0307508_10056441 | |||
| 2412 | Ga0307508_10175540 | |||
| 2413 | Ga0316579_10019886 | |||
| 2414 | Ga0265314_10003648 | |||
| 2415 | Ga0265314_10039492 | |||
| 2416 | Ga0265314_10176733 | |||
| 2417 | Ga0265342_10001257 | |||
| 2418 | Ga0265342_10005406 | |||
| 2419 | Ga0265342_10122647 | |||
| 2420 | Ga0307516_10043872 | |||
| 2421 | Ga0307413_10038231 | |||
| 2422 | Ga0307410_10143559 | |||
| 2423 | Ga0307406_10132490 | |||
| 2424 | Ga0307507_10125921 | |||
| 2425 | Ga0307507_10150631 | |||
| 2426 | Ga0307510_10126787 | |||
| 2427 | Ga0307510_10152035 | |||
| 2428 | Ga0315911_1000040 | |||
| 2429 | Ga0316213_1002509 | |||
| 2430 | Ga0373930_0008599 | |||
| 2431 | Ga0373959_0012771 | |||
| 2432 | Ga0373959_0023004 | |||
| 2433 | Ga0373938_0006998 | |||
| 2434 | Ga0373926_0000388 | |||
| 2435 | Ga0373926_0011522 | |||
| 2436 | Ga0373929_0004760 | |||
| 2437 | Ga0373934_0047916 | |||
| 2438 | Ga0373934_0053221 | |||
| 2439 | Ga0373934_0084179 | |||
| 2440 | Ga0373940_0027412 | |||
| 2441 | Ga0373944_0002538 | |||
| 2442 | Ga0373949_0006564 | |||
| 2443 | Ga0373949_0022292 | |||
| 2444 | Ga0373951_0031325 | |||
| 2445 | Ga0373952_0000933 | |||
| 2446 | Ga0373923_0003867 | |||
| 2447 | Ga0373923_0043642 | |||
| 2448 | Ga0373923_0049887 | |||
| 2449 | Ga0373932_0003751 | |||
| 2450 | Ga0373932_0020639 | |||
| 2451 | Ga0373936_0006062 | |||
| 2452 | Ga0373936_0053213 | |||
| 2453 | Ga0373936_0054051 | |||
| 2454 | Ga0373936_0104471 | |||
| 2455 | Ga0373939_0002641 | |||
| 2456 | Ga0373939_0003090 | |||
| 2457 | Ga0373939_0062364 | |||
| 2458 | Ga0373939_0069899 | |||
| 2459 | Ga0373941_0014083 | |||
| 2460 | Ga0373945_0007291 | |||
| 2461 | Ga0373945_0011447 | |||
| 2462 | Ga0373953_0012482 | |||
| 2463 | Ga0373953_0018244 | |||
| 2464 | Ga0373953_0051706 | |||
| 2465 | Ga0373954_0001219 | |||
| 2466 | Ga0373954_0008152 | |||
| 2467 | Ga0373954_0031320 | |||
| 2468 | Ga0373956_0004720 | |||
| 2469 | Ga0373956_0025442 | |||
| 2470 | Ga0373957_0003464 | |||
| 2471 | Ga0373957_0010097 | |||
| 2472 | Ga0373957_0053731 | |||
| 2473 | Ga0373957_0103774 | |||
| 2474 | Ga0373943_0001607 | |||
| 2475 | Ga0373943_0028008 | |||
| 2476 | Ga0373943_0033149 | |||
| 2477 | Ga0373943_0101921 | |||
| 2478 | Ga0373943_0165362 | |||
| 2479 | Ga0373943_0214025 | |||
| 2480 | Ga0373946_0020904 | |||
| 2481 | Ga0373946_0027110 | |||
| 2482 | Ga0373946_0075376 | |||
| 2483 | Ga0373946_0101738 | |||
| 2484 | Ga0373955_0002049 | |||
| 2485 | Ga0373955_0005330 | |||
| 2486 | Ga0373955_0012895 | |||
| 2487 | Ga0373955_0323138 | |||
| 2488 | Ga0373942_0006671 | |||
| 2489 | Ga0373942_0031660 | |||
| 2490 | Ga0373961_0002775 | |||
| 2491 | Ga0373924_0014698 | |||
| 2492 | Ga0373931_0002611 | |||
| 2493 | Ga0373931_0006487 | |||
| 2494 | Ga0373931_0305503 | |||
| 2495 | Ga0373931_0344444 | |||
| 2496 | Ga0373935_0000942 | |||
| 2497 | Ga0373935_0027111 | |||
| 2498 | Ga0373935_0042617 | |||
| 2499 | Ga0373935_0051264 | |||
| 2500 | Ga0373935_0057366 | |||
| 2501 | Ga0373935_0057406 | |||
| 2502 | Ga0373935_0121844 | |||
| 2503 | Ga0373935_0196235 | |||
| 2504 | Ga0373935_0439570 | |||
| 2505 | Ga0373927_0000528 | |||
| 2506 | Ga0373927_0021674 | |||
| 2507 | Ga0373927_0030902 | |||
| 2508 | Ga0373927_0035067 | |||
| 2509 | Ga0373927_0041261 | |||
| 2510 | Ga0373927_0066975 | |||
| 2511 | Ga0373927_0148674 | |||
| 2512 | Ga0373927_0214174 | |||
| 2513 | Ga0373927_0227121 | |||
| 2514 | Ga0373927_0297623 | |||
| 2515 | Ga0373933_0000204 | |||
| 2516 | Ga0373933_0002658 | |||
| 2517 | Ga0373933_0010853 | |||
| 2518 | Ga0373933_0034817 | |||
| 2519 | Ga0373933_0077067 | |||
| 2520 | Ga0373933_0090111 | |||
| 2521 | Ga0373933_0188029 | |||
| 2522 | Ga0373933_0293051 | |||
| 2523 | Ga0373947_0000455 | |||
| 2524 | Ga0373947_0003382 | |||
| 2525 | Ga0373947_0026670 | |||
| 2526 | Ga0373947_0067145 | |||
| 2527 | Ga0373947_0078436 | |||
| 2528 | Ga0373947_0101412 | |||
| 2529 | Ga0373947_0225609 | |||
| 2530 | Ga0373937_0008188 | |||
| 2531 | Ga0373937_0021334 | |||
| 2532 | Ga0373937_0194847 | |||
| 2533 | Ga0372808_001169 | |||
| 2534 | Ga0316582_0023146 | |||
| 2535 | Ga0373925_0001434 | |||
| 2536 | Ga0373925_0003563 | |||
| 2537 | Ga0373925_0011034 | |||
| 2538 | Ga0373925_0015076 | |||
| 2539 | Ga0373925_0104455 | |||
| 2540 | Ga0373925_0120167 | |||
| 2541 | Ga0373925_0130934 | |||
| 2542 | Ga0373925_0170838 | |||
| 2543 | Ga0373925_0313178 | |||
| 2544 | Ga0395900_0033975 | |||
| 2545 | Ga0395900_0357002 | |||
| 2546 | Ga0395900_0556389 | |||
| 2547 | Ga0395898_0092172 | |||
| 2548 | Ga0395905_0026848 | |||
| 2549 | Ga0436364_0100847 | |||
| 2550 | Ga0436364_1119586 | |||
| 2551 | Ga0395901_0065664 | |||
| 2552 | Ga0395901_0086125 | |||
| 2553 | Ga0395901_0165542 | |||
| 2554 | Ga0395901_0575766 | |||
| 2555 | Ga0436365_1490250 | |||
| 2556 | Ga0436360_0675457 | |||
| 2557 | Ga0436361_0576775 | |||
| 2558 | Ga0436361_0681610 | |||
| 2559 | Ga0436363_1060587 | |||
| 2560 | Ga0436362_0124208 | |||
| 2561 | Ga0466969_0014448 | |||
| 2562 | Ga0466972_0103734 | |||
| 2563 | Ga0466966_0001614 | |||
| 2564 | Ga0466966_0272714 | |||
| 2565 | Ga0466961_0000192 | |||
| 2566 | Ga0466963_0019050 | |||
| 2567 | Ga0466963_0031458 | |||
| 2568 | Ga0466964_0025350 | |||
| 2569 | Ga0466971_0060412 | |||
| 2570 | Ga0466968_0032806 | |||
| 2571 | Ga0466957_0140210 | |||
| 2572 | Ga0466959_0000934 | |||
| 2573 | Ga0466959_0008049 | |||
| 2574 | Ga0466959_0058009 | |||
| 2575 | Ga0466959_0062872 | |||
| 2576 | Ga0466967_0023977 | |||
| 2577 | Ga0466967_0094324 | |||
| 2578 | Ga0466967_0242814 | |||
| 2579 | Ga0466967_0838598 | |||
| 2580 | Ga0495592_0021465 | |||
| 2581 | Ga0495592_0032569 | |||
| 2582 | Ga0495592_0038867 | |||
| 2583 | Ga0495592_0087914 | |||
| 2584 | Ga0495603_0000239 | |||
| 2585 | Ga0495603_0015374 | |||
| 2586 | Ga0495603_0017749 | |||
| 2587 | Ga0495603_0072211 | |||
| 2588 | Ga0495590_0116445 | |||
| 2589 | Ga0495629_0000139 | |||
| 2590 | Ga0495629_0000457 | |||
| 2591 | Ga0495629_0007972 | |||
| 2592 | Ga0495629_0029920 | |||
| 2593 | Ga0495629_0051611 | |||
| 2594 | Ga0495629_0096371 | |||
| 2595 | Ga0495629_0150450 | |||
| 2596 | Ga0495629_0163427 | |||
| 2597 | Ga0495629_0225033 | |||
| 2598 | Ga0495641_0002157 | |||
| 2599 | Ga0495641_0029301 | |||
| 2600 | Ga0495651_0004984 | |||
| 2601 | Ga0495651_0014000 | |||
| 2602 | Ga0495651_0017171 | |||
| 2603 | Ga0495651_0037984 | |||
| 2604 | Ga0495651_0054995 | |||
| 2605 | Ga0495651_0166592 | |||
| 2606 | Ga0495653_0004257 | |||
| 2607 | Ga0495653_0009797 | |||
| 2608 | Ga0495653_0235853 | |||
| 2609 | Ga0495580_0002960 | |||
| 2610 | Ga0495580_0009072 | |||
| 2611 | Ga0495580_0009091 | |||
| 2612 | Ga0495582_0000077 | |||
| 2613 | Ga0495582_0001850 | |||
| 2614 | Ga0495582_0038297 | |||
| 2615 | Ga0495582_0258275 | |||
| 2616 | Ga0495605_0057694 | |||
| 2617 | Ga0495605_0154703 | |||
| 2618 | Ga0495639_0000101 | |||
| 2619 | Ga0495639_0012036 | |||
| 2620 | Ga0495662_0012510 | |||
| 2621 | Ga0495662_0051472 | |||
| 2622 | Ga0495664_0038052 | |||
| 2623 | Ga0495664_0041464 | |||
| 2624 | Ga0495664_0044789 | |||
| 2625 | Ga0495584_0001897 | |||
| 2626 | Ga0495584_0039510 | |||
| 2627 | Ga0495585_0001030 | |||
| 2628 | Ga0495585_0158482 | |||
| 2629 | Ga0495594_0005795 | |||
| 2630 | Ga0495594_0127044 | |||
| 2631 | Ga0495594_0243805 | |||
| 2632 | Ga0495607_0006002 | |||
| 2633 | Ga0495606_0000357 | |||
| 2634 | Ga0495606_0014109 | |||
| 2635 | Ga0495608_0000911 | |||
| 2636 | Ga0495608_0004649 | |||
| 2637 | Ga0495608_0061364 | |||
| 2638 | Ga0495608_0110421 | |||
| 2639 | Ga0495608_0188827 | |||
| 2640 | Ga0495618_0003586 | |||
| 2641 | Ga0495618_0014258 | |||
| 2642 | Ga0495618_0021739 | |||
| 2643 | Ga0495618_0089816 | |||
| 2644 | Ga0495618_0119090 | |||
| 2645 | Ga0495618_0136315 | |||
| 2646 | Ga0495620_0071983 | |||
| 2647 | Ga0495620_0078633 | |||
| 2648 | Ga0495628_0005614 | |||
| 2649 | Ga0495628_0105477 | |||
| 2650 | Ga0495628_0157361 | |||
| 2651 | Ga0495628_0282913 | |||
| 2652 | Ga0495630_0012819 | |||
| 2653 | Ga0495630_0047522 | |||
| 2654 | Ga0495630_0281866 | |||
| 2655 | Ga0495631_0126651 | |||
| 2656 | Ga0495643_0028502 | |||
| 2657 | Ga0495644_0000513 | |||
| 2658 | Ga0495644_0050156 | |||
| 2659 | Ga0495648_0000897 | |||
| 2660 | Ga0495648_0007226 | |||
| 2661 | Ga0495648_0012169 | |||
| 2662 | Ga0495648_0092889 | |||
| 2663 | Ga0495648_0109736 | |||
| 2664 | Ga0495663_0002372 | |||
| 2665 | Ga0495666_0168340 | |||
| 2666 | Ga0495652_0021917 | |||
| 2667 | Ga0495652_0028137 | |||
| 2668 | Ga0495652_0046433 | |||
| 2669 | Ga0495652_0070477 | |||
| 2670 | Ga0495652_0076180 | |||
| 2671 | Ga0495652_0270423 | |||
| 2672 | Ga0495665_0000055 | |||
| 2673 | Ga0495665_0026195 | |||
| 2674 | Ga0495640_0011661 | |||
| 2675 | Ga0495640_0024673 | |||
| 2676 | Ga0495640_0043321 | |||
| 2677 | Ga0495640_0046767 | |||
| 2678 | Ga0495640_0053786 | |||
| 2679 | Ga0495640_0092694 | |||
| 2680 | Ga0495586_0046428 | |||
| 2681 | Ga0495587_0005897 | |||
| 2682 | Ga0495587_0015897 | |||
| 2683 | Ga0495587_0094947 | |||
| 2684 | Ga0495587_0134777 | |||
| 2685 | Ga0495587_0301376 | |||
| 2686 | Ga0495598_0045979 | |||
| 2687 | Ga0495609_0017406 | |||
| 2688 | Ga0495609_0085365 | |||
| 2689 | Ga0495609_0137657 | |||
| 2690 | Ga0495597_0028153 | |||
| 2691 | Ga0495645_0011340 | |||
| 2692 | Ga0495645_0061920 | |||
| 2693 | Ga0495645_0115470 | |||
| 2694 | Ga0495645_0120887 | |||
| 2695 | Ga0495622_0002233 | |||
| 2696 | Ga0495622_0033493 | |||
| 2697 | Ga0495622_0055262 | |||
| 2698 | Ga0495622_0057388 | |||
| 2699 | Ga0495622_0078894 | |||
| 2700 | Ga0495622_0101465 | |||
| 2701 | Ga0495633_0024926 | |||
| 2702 | Ga0495667_0010518 | |||
| 2703 | Ga0495667_0021423 | |||
| 2704 | Ga0495667_0023279 | |||
| 2705 | Ga0495667_0038378 | |||
| 2706 | Ga0495667_0048600 | |||
| 2707 | Ga0495667_0096798 | |||
| 2708 | Ga0495656_0000091 | |||
| 2709 | Ga0495656_0006841 | |||
| 2710 | Ga0495668_0083718 | |||
| 2711 | Ga0495634_0001036 | |||
| 2712 | Ga0495634_0063846 | |||
| 2713 | Ga0495634_0069546 | |||
| 2714 | Ga0495634_0084757 | |||
| 2715 | Ga0495634_0110477 | |||
| 2716 | Ga0495611_0007030 | |||
| 2717 | Ga0495611_0087470 | |||
| 2718 | Ga0495625_0030051 | |||
| 2719 | Ga0495625_0066315 | |||
| 2720 | Ga0495635_0000815 | |||
| 2721 | Ga0495635_0004810 | |||
| 2722 | Ga0495635_0011194 | |||
| 2723 | Ga0495635_0029736 | |||
| 2724 | Ga0495635_0093114 | |||
| 2725 | Ga0495659_0000632 | |||
| 2726 | Ga0495659_0122405 | |||
| 2727 | Ga0495661_0010120 | |||
| 2728 | Ga0495661_0048855 | |||
| 2729 | Ga0495588_0005058 | |||
| 2730 | Ga0495588_0005077 | |||
| 2731 | Ga0495588_0015996 | |||
| 2732 | Ga0495657_0003079 | |||
| 2733 | Ga0495657_0004591 | |||
| 2734 | Ga0495657_0019481 | |||
| 2735 | Ga0495657_0034720 | |||
| 2736 | Ga0495657_0194463 | |||
| 2737 | Ga0495599_0001945 | |||
| 2738 | Ga0495599_0028704 | |||
| 2739 | Ga0495599_0053717 | |||
| 2740 | Ga0495623_0002783 | |||
| 2741 | Ga0495623_0020870 | |||
| 2742 | Ga0495623_0233769 | |||
| 2743 | Ga0495646_0001642 | |||
| 2744 | Ga0495646_0014188 | |||
| 2745 | Ga0495646_0022610 | |||
| 2746 | Ga0495646_0060647 | |||
| 2747 | Ga0495646_0119405 | |||
| 2748 | Ga0495647_0002436 | |||
| 2749 | Ga0495647_0010626 | |||
| 2750 | Ga0495647_0019267 | |||
| 2751 | Ga0495647_0074495 | |||
| 2752 | Ga0495647_0081217 | |||
| 2753 | Ga0495658_0000065 | |||
| 2754 | Ga0495658_0008416 | |||
| 2755 | Ga0495658_0066140 | |||
| 2756 | Ga0495658_0365868 | |||
| 2757 | Ga0495613_0003480 | |||
| 2758 | Ga0495613_0010328 | |||
| 2759 | Ga0495613_0078788 | |||
| 2760 | Ga0495613_0092005 | |||
| 2761 | Ga0495613_0284765 | |||
| 2762 | Ga0495624_0000235 | |||
| 2763 | Ga0495624_0050807 | |||
| 2764 | Ga0495624_0136811 | |||
| 2765 | Ga0495670_0000199 | |||
| 2766 | Ga0495670_0090418 | |||
| 2767 | Ga0495671_0092637 | |||
| 2768 | Ga0495671_0202048 | |||
| 2769 | Ga0495649_0015557 | |||
| 2770 | Ga0495649_0152989 | |||
| 2771 | Ga0495589_0021779 | |||
| 2772 | Ga0495600_0012719 | |||
| 2773 | Ga0495600_0015147 | |||
| 2774 | Ga0495600_0030346 | |||
| 2775 | Ga0495581_0000041 | |||
| 2776 | Ga0495581_0022819 | |||
| 2777 | Ga0495581_0024475 | |||
| 2778 | Ga0495604_0007221 | |||
| 2779 | Ga0495604_0056249 | |||
| 2780 | Ga0495604_0070109 | |||
| 2781 | Ga0495604_0086405 | |||
| 2782 | Ga0495604_0106288 | |||
| 2783 | Ga0495604_0203136 | |||
| 2784 | Ga0495636_0046361 | |||
| 2785 | Ga0495674_0001192 | |||
| 2786 | Ga0495674_0028002 | |||
| 2787 | Ga0495674_0047281 | |||
| 2788 | Ga0495674_0051263 | |||
| 2789 | Ga0495674_0320433 | |||
| 2790 | Ga0495674_0326857 | |||
| 2791 | Ga0495672_0037589 | |||
| 2792 | Ga0495676_0018550 | |||
| 2793 | Ga0495676_0100156 | |||
| 2794 | Ga0495676_0403146 | |||
| 2795 | Ga0495680_0012071 | |||
| 2796 | Ga0495680_0017326 | |||
| 2797 | Ga0495680_0017765 | |||
| 2798 | Ga0495680_0043618 | |||
| 2799 | Ga0495687_050067 | |||
| 2800 | Ga0495675_0040948 | |||
| 2801 | Ga0495675_0152222 | |||
| 2802 | Ga0495679_028585 | |||
| 2803 | Ga0495673_0010425 | |||
| 2804 | Ga0495673_0025589 | |||
| 2805 | Ga0495684_0001073 | |||
| 2806 | Ga0495684_0001399 | |||
| 2807 | Ga0495684_0039273 | |||
| 2808 | Ga0495684_0052644 | |||
| 2809 | Ga0495684_0075698 | |||
| 2810 | Ga0495684_0116868 | |||
| 2811 | Ga0495686_0060885 | |||
| 2812 | Ga0495686_0062790 | |||
| 2813 | Ga0495686_0085485 | |||
| 2814 | Ga0495686_0136095 | |||
| 2815 | Ga0495686_0237214 | |||
| 2816 | Ga0495593_0000024 | |||
| 2817 | Ga0495593_0002018 | |||
| 2818 | Ga0495593_0003557 | |||
| 2819 | Ga0495593_0004938 | |||
| 2820 | Ga0495593_0052823 | |||
| 2821 | Ga0495593_0055700 | |||
| 2822 | Ga0495602_0019419 | |||
| 2823 | Ga0495602_0027637 | |||
| 2824 | Ga0495602_0035012 | |||
| 2825 | Ga0495602_0085186 | |||
| 2826 | Ga0495614_0059008 | |||
| 2827 | Ga0495615_0051171 | |||
| 2828 | Ga0496100_0071720 | |||
| 2829 | Ga0496101_0005706 | |||
| 2830 | Ga0496101_0017665 | |||
| 2831 | Ga0496101_0046113 | |||
| 2832 | Ga0496101_0106497 | |||
| 2833 | Ga0496101_0173978 | |||
| 2834 | Ga0496101_0417516 | |||
| 2835 | Ga0496102_0014041 | |||
| 2836 | Ga0496102_0017084 | |||
| 2837 | Ga0496102_0022366 | |||
| 2838 | Ga0496102_0067126 | |||
| 2839 | Ga0496102_0244050 | |||
| 2840 | Ga0496103_0013626 | |||
| 2841 | Ga0496103_0037032 | |||
| 2842 | Ga0496103_0155467 | |||
| 2843 | Ga0496103_0176854 | |||
| 2844 | Ga0496103_0199908 | |||
| 2845 | Ga0496104_0007787 | |||
| 2846 | Ga0496104_0037009 | |||
| 2847 | Ga0496104_0065417 | |||
| 2848 | Ga0496104_0088068 | |||
| 2849 | Ga0496104_0182742 | |||
| 2850 | Ga0496104_0186109 | |||
| 2851 | Ga0496104_0187277 | |||
| 2852 | Ga0496104_0303283 | |||
| 2853 | Ga0496104_0322350 | |||
| 2854 | Ga0496104_0362524 | |||
| 2855 | Ga0496105_0011205 | |||
| 2856 | Ga0496105_0013422 | |||
| 2857 | Ga0496105_0015800 | |||
| 2858 | Ga0496105_0019532 | |||
| 2859 | Ga0496105_0034013 | |||
| 2860 | Ga0496105_0062282 | |||
| 2861 | Ga0496105_0175327 | |||
| 2862 | Ga0496105_0291129 | |||
| 2863 | Ga0496106_0003446 | |||
| 2864 | Ga0496106_0006865 | |||
| 2865 | Ga0496106_0007383 | |||
| 2866 | Ga0496106_0017314 | |||
| 2867 | Ga0496106_0031297 | |||
| 2868 | Ga0496106_0058706 | |||
| 2869 | Ga0496106_0094631 | |||
| 2870 | Ga0496106_0130932 | |||
| 2871 | Ga0496106_0158517 | |||
| 2872 | Ga0496107_0000509 | |||
| 2873 | Ga0496107_0034178 | |||
| 2874 | Ga0496107_0037811 | |||
| 2875 | Ga0496107_0037820 | |||
| 2876 | Ga0496108_0039234 | |||
| 2877 | Ga0496108_0070491 | |||
| 2878 | Ga0496108_0101833 | |||
| 2879 | Ga0496108_0141329 | |||
| 2880 | Ga0496108_0159941 | |||
| 2881 | Ga0496109_0020639 | |||
| 2882 | Ga0496109_0051292 | |||
| 2883 | Ga0496109_0074608 | |||
| 2884 | Ga0496109_0082674 | |||
| 2885 | Ga0496109_0086401 | |||
| 2886 | Ga0496109_0327342 | |||
| 2887 | Ga0496110_0003123 | |||
| 2888 | Ga0496110_0005741 | |||
| 2889 | Ga0496110_0091790 | |||
| 2890 | Ga0496110_0159652 | |||
| 2891 | Ga0496110_0321195 | |||
| 2892 | Ga0496110_0337214 | |||
| 2893 | Ga0496111_0034236 | |||
| 2894 | Ga0496111_0039373 | |||
| 2895 | Ga0496111_0042463 | |||
| 2896 | Ga0496111_0173154 | |||
| 2897 | Ga0496111_0256530 | |||
| 2898 | Ga0496112_0012582 | |||
| 2899 | Ga0496112_0024108 | |||
| 2900 | Ga0496112_0064719 | |||
| 2901 | Ga0496112_0126632 | |||
| 2902 | Ga0496112_0178060 | |||
| 2903 | Ga0496112_0186684 | |||
| 2904 | Ga0496112_0188030 | |||
| 2905 | Ga0496112_0287838 | |||
| 2906 | Ga0496112_0417522 | |||
| 2907 | Ga0496113_0041662 | |||
| 2908 | Ga0496113_0055757 | |||
| 2909 | Ga0496113_0066166 | |||
| 2910 | Ga0496113_0102680 | |||
| 2911 | Ga0496113_0156050 | |||
| 2912 | Ga0496113_0222184 | |||
| 2913 | Ga0496113_0316048 | |||
| 2914 | Ga0496114_0001306 | |||
| 2915 | Ga0496114_0022402 | |||
| 2916 | Ga0496114_0084963 | |||
| 2917 | Ga0496114_0198573 | |||
| 2918 | Ga0496114_0371093 | |||
| 2919 | Ga0496115_0001250 | |||
| 2920 | Ga0496115_0023466 | |||
| 2921 | Ga0496115_0056055 | |||
| 2922 | Ga0496115_0098174 | |||
| 2923 | Ga0496115_0116508 | |||
| 2924 | Ga0496115_0146012 | |||
| 2925 | Ga0496115_0179206 | |||
| 2926 | Ga0496117_0017488 | |||
| 2927 | Ga0496117_0062933 | |||
| 2928 | Ga0496118_0020990 | |||
| 2929 | Ga0496118_0039136 | |||
| 2930 | Ga0496118_0077455 | |||
| 2931 | Ga0496118_0251433 | |||
| 2932 | Ga0496119_0040669 | |||
| 2933 | Ga0496119_0042593 | |||
| 2934 | Ga0496119_0057347 | |||
| 2935 | Ga0496119_0099423 | |||
| 2936 | Ga0496119_0138407 | |||
| 2937 | Ga0496120_0013345 | |||
| 2938 | Ga0496121_0000927 | |||
| 2939 | Ga0496121_0007064 | |||
| 2940 | Ga0496121_0010667 | |||
| 2941 | Ga0496121_0015737 | |||
| 2942 | Ga0496121_0061566 | |||
| 2943 | Ga0496121_0155804 | |||
| 2944 | Ga0496121_0205975 | |||
| 2945 | Ga0496121_0209073 | |||
| 2946 | Ga0496121_0256326 | |||
| 2947 | Ga0496124_0049273 | |||
| 2948 | Ga0496124_0058635 | |||
| 2949 | Ga0496124_0061641 | |||
| 2950 | Ga0496124_0240865 | |||
| 2951 | Ga0496125_0042169 | |||
| 2952 | Ga0496125_0063623 | |||
| 2953 | Ga0496125_0121414 | |||
| 2954 | Ga0496125_0304141 | |||
| 2955 | Ga0496126_0022004 | |||
| 2956 | Ga0496126_0027336 | |||
| 2957 | Ga0496126_0035592 | |||
| 2958 | Ga0496126_0103819 | |||
| 2959 | Ga0496126_0135129 | |||
| 2960 | Ga0496126_0135967 | |||
| 2961 | Ga0496126_0202331 | |||
| 2962 | Ga0496126_0232203 | |||
| 2963 | Ga0496126_0234965 | |||
| 2964 | Ga0496126_0350508 | |||
| 2965 | Ga0496126_0398398 | |||
| 2966 | Ga0495682_0019019 | |||
| 2967 | Ga0495682_0052153 | |||
| 2968 | Ga0501031_0000398 | |||
| 2969 | Ga0501031_0006934 | |||
| 2970 | Ga0501031_0031248 | |||
| 2971 | Ga0501032_0066313 | |||
| 2972 | Ga0501032_0073505 | |||
| 2973 | Ga0501032_0098657 | |||
| 2974 | Ga0501033_0001316 | |||
| 2975 | Ga0501033_0001463 | |||
| 2976 | Ga0501033_0016180 | |||
| 2977 | Ga0501033_0026599 | |||
| 2978 | Ga0501033_0027952 | |||
| 2979 | Ga0501033_0178464 | |||
| 2980 | Ga0501033_0209494 | |||
| 2981 | Ga0501034_0000072 | |||
| 2982 | Ga0501034_0186662 | |||
| 2983 | Ga0501034_0199578 | |||
| 2984 | Ga0501034_0214716 | |||
| 2985 | Ga0501034_0254182 | |||
| 2986 | Ga0501034_0631845 | |||
| 2987 | Ga0501036_0000050 | |||
| 2988 | Ga0501036_0023850 | |||
| 2989 | Ga0501036_0027119 | |||
| 2990 | Ga0501036_0109654 | |||
| 2991 | Ga0501036_0220338 | |||
| 2992 | Ga0501036_0253779 | |||
| 2993 | Ga0501037_0000030 | |||
| 2994 | Ga0501037_0019157 | |||
| 2995 | Ga0501037_0040958 | |||
| 2996 | Ga0501037_0067050 | |||
| 2997 | Ga0501037_0158463 | |||
| 2998 | Ga0501037_0196762 | |||
| 2999 | Ga0501038_0000039 | |||
| 3000 | Ga0501038_0003573 | |||
| 3001 | Ga0501038_0003903 | |||
| 3002 | Ga0501038_0019522 | |||
| 3003 | Ga0501038_0064610 | |||
| 3004 | Ga0501038_0087612 | |||
| 3005 | Ga0501038_0120846 | |||
| 3006 | Ga0501038_0179009 | |||
| 3007 | Ga0501039_0000060 | |||
| 3008 | Ga0501039_0003437 | |||
| 3009 | Ga0501039_0006389 | |||
| 3010 | Ga0501039_0049810 | |||
| 3011 | Ga0501039_0069222 | |||
| 3012 | Ga0501039_0120324 | |||
| 3013 | Ga0501039_0170764 | |||
| 3014 | Ga0501042_0008343 | |||
| 3015 | Ga0501042_0040413 | |||
| 3016 | Ga0501043_0000980 | |||
| 3017 | Ga0501043_0003512 | |||
| 3018 | Ga0501043_0015596 | |||
| 3019 | Ga0501043_0112845 | |||
| 3020 | Ga0501046_0000419 | |||
| 3021 | Ga0501046_0002900 | |||
| 3022 | Ga0501046_0022009 | |||
| 3023 | Ga0501047_0000174 | |||
| 3024 | Ga0501047_0012410 | |||
| 3025 | Ga0501047_0019117 | |||
| 3026 | Ga0501047_0031187 | |||
| 3027 | Ga0501047_0172472 | |||
| 3028 | Ga0501047_0181618 | |||
| 3029 | Ga0501047_0316665 | |||
| 3030 | Ga0501048_0000068 | |||
| 3031 | Ga0501048_0017640 | |||
| 3032 | Ga0501048_0323580 | |||
| 3033 | Ga0501067_0000068 | |||
| 3034 | Ga0501067_0003637 | |||
| 3035 | Ga0501067_0007709 | |||
| 3036 | Ga0501067_0111382 | |||
| 3037 | Ga0501067_0131537 | |||
| 3038 | Ga0501068_0000949 | |||
| 3039 | Ga0501068_0002589 | |||
| 3040 | Ga0501068_0003549 | |||
| 3041 | Ga0501069_0035352 | |||
| 3042 | Ga0501070_0025353 | |||
| 3043 | Ga0501070_0039676 | |||
| 3044 | Ga0501070_0256961 | |||
| 3045 | Ga0501071_0131428 | |||
| 3046 | Ga0501072_0035557 | |||
| 3047 | Ga0501072_0221508 | |||
| 3048 | Ga0501073_0000009 | |||
| 3049 | Ga0501073_0010592 | |||
| 3050 | Ga0501073_0162995 | |||
| 3051 | Ga0501073_0450101 | |||
| 3052 | Ga0501074_0001057 | |||
| 3053 | Ga0501074_0003293 | |||
| 3054 | Ga0501074_0055835 | |||
| 3055 | Ga0501077_0028394 | |||
| 3056 | Ga0501079_0012968 | |||
| 3057 | Ga0501079_0017176 | |||
| 3058 | Ga0501079_0040305 | |||
| 3059 | Ga0501080_0006205 | |||
| 3060 | Ga0501080_0032682 | |||
| 3061 | Ga0501080_0037424 | |||
| 3062 | Ga0501080_0245242 | |||
| 3063 | Ga0501080_0245636 | |||
| 3064 | Ga0501083_0005994 | |||
| 3065 | Ga0501083_0021673 | |||
| 3066 | Ga0501083_0058662 | |||
| 3067 | Ga0501035_0000067 | |||
| 3068 | Ga0501035_0006796 | |||
| 3069 | Ga0501035_0031489 | |||
| 3070 | Ga0501035_0054807 | |||
| 3071 | Ga0501035_0072940 | |||
| 3072 | Ga0501035_0074309 | |||
| 3073 | Ga0501035_0106024 | |||
| 3074 | Ga0501035_0212386 | |||
| 3075 | Ga0501035_0452169 | |||
| 3076 | Ga0501044_0000258 | |||
| 3077 | Ga0501044_0003604 | |||
| 3078 | Ga0501044_0007503 | |||
| 3079 | Ga0501044_0009609 | |||
| 3080 | Ga0501044_0032713 | |||
| 3081 | Ga0501044_0066602 | |||
| 3082 | Ga0501044_0119538 | |||
| 3083 | Ga0501044_0141974 | |||
| 3084 | Ga0501044_0274006 | |||
| 3085 | Ga0501044_0293875 | |||
| 3086 | Ga0501044_0620766 | |||
| 3087 | Ga0501045_0012008 | |||
| 3088 | Ga0501045_0043356 | |||
| 3089 | nmdc:mga03n38_71327_c1 | |||
| 3090 | nmdc:mga00v17_50262_c1 | |||
| 3091 | nmdc:mga00v17_59291_c1 | |||
| 3092 | nmdc:mga0yw44_100540_c1 | |||
| 3093 | nmdc:mga0yw44_31880_c1 | |||
| 3094 | nmdc:mga0yw44_47176_c1 | |||
| 3095 | nmdc:mga0yw44_87286_c1 | |||
| 3096 | nmdc:mga0k408_41185_c1 | |||
| 3097 | nmdc:mga06z11_33296_c1 | |||
| 3098 | nmdc:mga04h51_105902_c1 | |||
| 3099 | nmdc:mga07m45_16224_c2 | |||
| 3100 | nmdc:mga05p37_151_c1 | |||
| 3101 | nmdc:mga05p37_296846_c1 | |||
| 3102 | nmdc:mga05p37_563132_c1 | |||
| 3103 | nmdc:mga05p37_7272_c1 | |||
| 3104 | nmdc:mga0qj67_9689_c1 | |||
| 3105 | nmdc:mga06r32_755_c1 | |||
| 3106 | nmdc:mga08y16_108_c1 | |||
| 3107 | nmdc:mga08y16_2951_c1 | |||
| 3108 | nmdc:mga0n895_24865_c1 | |||
| 3109 | nmdc:mga0n895_25991_c1 | |||
| 3110 | nmdc:mga0n895_265_c1 | |||
| 3111 | nmdc:mga0n895_37633_c1 | |||
| 3112 | nmdc:mga0rr50_12610_c1 | |||
| 3113 | nmdc:mga0rr50_19659_c1 | |||
| 3114 | nmdc:mga0rr50_642_c1 | |||
| 3115 | nmdc:mga0a205_1049_c1 | |||
| 3116 | nmdc:mga0a205_146_c1 | |||
| 3117 | nmdc:mga0a205_21581_c1 | |||
| 3118 | nmdc:mga0sz30_34108_c1 | |||
| 3119 | nmdc:mga0sz30_40712_c2 | |||
| 3120 | Ga0495601_0000355 | |||
| 3121 | Ga0495601_0009169 | |||
| 3122 | Ga0495601_0017539 | |||
| 3123 | Ga0495601_0033848 | |||
| 3124 | Ga0495601_0050959 | |||
| 3125 | Ga0495601_0083171 | |||
| 3126 | Ga0495601_0107560 | |||
| 3127 | Ga0495601_0163327 | |||
| 3128 | Ga0495601_0188965 | |||
| 3129 | Ga0495601_0199885 | |||
| 3130 | Ga0495612_0001097 | |||
| 3131 | Ga0495612_0007774 | |||
| 3132 | Ga0495612_0040958 | |||
| 3133 | Ga0495612_0078568 | |||
| 3134 | Ga0500635_0001974 | |||
| 3135 | Ga0500635_0002613 | |||
| 3136 | Ga0495655_0009734 | |||
| 3137 | Ga0495595_0000554 | |||
| 3138 | Ga0495595_0000637 | |||
| 3139 | Ga0495595_0001043 | |||
| 3140 | Ga0495595_0002582 | |||
| 3141 | Ga0495595_0064823 | |||
| 3142 | Ga0495619_0000048 | |||
| 3143 | Ga0495619_0000256 | |||
| 3144 | Ga0495619_0001080 | |||
| 3145 | Ga0495619_0001353 | |||
| 3146 | Ga0495619_0005007 | |||
| 3147 | Ga0495619_0014512 | |||
| 3148 | Ga0495619_0197915 | |||
| 3149 | Ga0495619_0219931 | |||
| 3150 | Ga0500578_0065579 | |||
| 3151 | Ga0500643_000013 | |||
| 3152 | Ga0500583_0056480 | |||
| 3153 | Ga0500651_0038749 | |||
| 3154 | Ga0500566_0001419 | |||
| 3155 | Ga0500566_0012672 | |||
| 3156 | Ga0500640_000253 | |||
| 3157 | Ga0500641_0031622 | |||
| 3158 | Ga0500554_003440 | |||
| 3159 | Ga0500555_006750 | |||
| 3160 | Ga0500572_000199 | |||
| 3161 | Ga0500595_000842 | |||
| 3162 | Ga0500595_007617 | |||
| 3163 | Ga0500595_033593 | |||
| 3164 | Ga0500607_076874 | |||
| 3165 | Ga0500608_103967 | |||
| 3166 | Ga0500614_000715 | |||
| 3167 | Ga0500642_0020937 | |||
| 3168 | Ga0500658_0011386 | |||
| 3169 | Ga0500559_0001308 | |||
| 3170 | Ga0500568_0014785 | |||
| 3171 | Ga0500573_0008543 | |||
| 3172 | Ga0500577_0109173 | |||
| 3173 | Ga0500603_000226 | |||
| 3174 | Ga0500604_0018512 | |||
| 3175 | Ga0500616_0000028 | |||
| 3176 | Ga0500619_072092 | |||
| 3177 | Ga0500620_032573 | |||
| 3178 | Ga0500627_0162643 | |||
| 3179 | Ga0500630_000573 | |||
| 3180 | Ga0500638_001609 | |||
| 3181 | Ga0500639_000006 | |||
| 3182 | Ga0500636_0000762 | |||
| 3183 | Ga0500636_0013138 | |||
| 3184 | Ga0500636_0030340 | |||
| 3185 | Ga0500637_0000251 | |||
| 3186 | Ga0500637_0003349 | |||
| 3187 | Ga0500637_0187265 | |||
| 3188 | Ga0500576_083610 | |||
| 3189 | Ga0500657_054402 | |||
| 3190 | Ga0500596_000603 | |||
| 3191 | Ga0500596_011896 | |||
| 3192 | Ga0500599_003944 | |||
| 3193 | Ga0500601_000371 | |||
| 3194 | Ga0501084_0006839 | |||
| 3195 | Ga0501084_0007774 | |||
| 3196 | Ga0501084_0034119 | |||
| 3197 | Ga0501084_0354426 | |||
| 3198 | Ga0500661_001477 | |||
| 3199 | Ga0501082_0001593 | |||
| 3200 | Ga0501082_0018224 | |||
| 3201 | Ga0501082_0050188 | |||
| 3202 | Ga0501082_0107881 | |||
| 3203 | Ga0501082_0344249 | |||
| 3204 | 2507511877 | |||
| 3205 | 2508545541 | |||
| 3206 | 2508694359 | |||
| 3207 | 2509146623 | |||
| 3208 | 2513627760 | |||
| 3209 | 2513643305 | |||
| 3210 | 2513651094 | |||
| 3211 | 2513659238 | |||
| 3212 | 2513717791 | |||
| 3213 | 2513859041 | |||
| 3214 | 2513875299 | |||
| 3215 | 2513887729 | |||
| 3216 | 2513921882 | |||
| 3217 | 2514014405 | |||
| 3218 | 2515624710 | |||
| 3219 | 2517895963 | |||
| 3220 | 2528854956 | |||
| 3221 | 2617349629 | |||
| 3222 | 2617376815 | |||
| 3223 | 2644289771 | |||
| 3224 | 2671122757 | |||
| 3225 | 2745078535 | |||
| 3226 | 2793059632 | |||
| 3227 | 2793069607 | |||
| 3228 | 2793080290 | |||
| 3229 | 2805921874 | |||
| 3230 | 2818242190 | |||
| 3231 | 2824608016 | |||
| 3232 | 2824615056 | |||
| 3233 | 2824624849 | |||
| 3234 | 2824633745 | |||
| 3235 | 2824642308 | |||
| 3236 | 2824649646 | |||
| 3237 | 2824659530 | |||
| 3238 | 2824670058 | |||
| 3239 | 2824676704 | |||
| 3240 | 2824692995 | |||
| 3241 | 2824702578 | |||
| 3242 | 2824712400 | |||
| 3243 | 2824730051 | |||
| 3244 | 2824738292 | |||
| 3245 | 2824751731 | |||
| 3246 | 2824762426 | |||
| 3247 | 2824772739 | |||
| 3248 | 2824776990 | |||
| 3249 | 2838128391 | |||
| 3250 | 2841942251 | |||
| 3251 | 2841955619 | |||
| 3252 | 2841960960 | |||
| 3253 | 2841971228 | |||
| 3254 | 2841982348 | |||
| 3255 | 2841984265 | |||
| 3256 | 2842042003 | |||
| 3257 | 2842050046 | |||
| 3258 | 2844321094 | |||
| 3259 | 2847932305 | |||
| 3260 | 2847943540 | |||
| 3261 | 2849077263 | |||
| 3262 | 2874592257 | |||
| 3263 | 2874618720 | |||
| 3264 | 2874624010 | |||
| 3265 | 2874630982 | |||
| 3266 | 2874647373 | |||
| 3267 | 2876767415 | |||
| 3268 | 2876774784 | |||
| 3269 | 2876819737 | |||
| 3270 | 2879079352 | |||
| 3271 | 2879091530 | |||
| 3272 | 2879101398 | |||
| 3273 | 2879129086 | |||
| 3274 | 2879144759 | |||
| 3275 | 2881371130 | |||
| 3276 | 2881673238 | |||
| 3277 | 2885374060 | |||
| 3278 | 2885382990 | |||
| 3279 | 2888387387 | |||
| 3280 | 2888391816 | |||
| 3281 | 2888426608 | |||
| 3282 | 2903728517 | |||
| 3283 | 2903756067 | |||
| 3284 | 2904670721 | |||
| 3285 | 2904699115 | |||
| 3286 | 2904707118 | |||
| 3287 | 2904713672 | |||
| 3288 | 2906607709 | |||
| 3289 | 2906615567 | |||
| 3290 | 2906627114 | |||
| 3291 | 2906642015 | |||
| 3292 | 2906645374 | |||
| 3293 | 2906665001 | |||
| 3294 | 2908745612 | |||
| 3295 | 2908763684 | |||
| 3296 | 2908782713 | |||
| 3297 | 2922367287 | |||
| 3298 | 2922370558 | |||
| 3299 | 2922432439 | |||
| 3300 | 2929620134 | |||
| 3301 | 2929629447 | |||
| 3302 | 2932791489 | |||
| 3303 | 2932796892 | |||
| 3304 | 2932802330 | |||
| 3305 | 2932816745 | |||
| 3306 | 2932824073 | |||
| 3307 | 2932835391 | |||
| 3308 | 2933582051 | |||
| 3309 | 2935613480 | |||
| 3310 | 2935621134 | |||
| 3311 | 2935643559 | |||
| 3312 | 2935650476 | |||
| 3313 | 2935662918 | |||
| 3314 | 2935671131 | |||
| 3315 | 2935681263 | |||
| 3316 | 2935689394 | |||
| 3317 | 2935699969 | |||
| 3318 | 2935712100 | |||
| 3319 | 2935720340 | |||
| 3320 | 2935728043 | |||
| 3321 | 2935737360 | |||
| 3322 | 2935746579 | |||
| 3323 | 2935757546 | |||
| 3324 | 2935763923 | |||
| 3325 | 2935807900 | |||
| 3326 | 2935818766 | |||
| 3327 | 2935824667 | |||
| 3328 | 2935833076 | |||
| 3329 | 2935844268 | |||
| 3330 | 2935851887 | |||
| 3331 | 2935859673 | |||
| 3332 | 2935872071 | |||
| 3333 | 2935879005 | |||
| 3334 | 2935887230 | |||
| 3335 | 2935911237 | |||
| 3336 | 2935920769 | |||
| 3337 | 2935928266 | |||
| 3338 | 2935937911 | |||
| 3339 | 2935945193 | |||
| 3340 | 2935954301 | |||
| 3341 | 2935965620 | |||
| 3342 | 2935971431 | |||
| 3343 | 2935982051 | |||
| 3344 | 2935990610 | |||
| 3345 | 2936000352 | |||
| 3346 | 2936008510 | |||
| 3347 | 2936017168 | |||
| 3348 | 2936026697 | |||
| 3349 | 2936035440 | |||
| 3350 | 2936045576 | |||
| 3351 | 2936053589 | |||
| 3352 | 2936062667 | |||
| 3353 | 2940563632 | |||
| 3354 | 2941537270 | |||
| 3355 | 2941542600 | |||
| 3356 | 3005476600 | |||
| 3357 | 3005506906 | |||
| 3358 | 3005591713 | |||
| 3359 | 3005601434 | |||
| 3360 | 3005724125 | |||
| 3361 | 8006929468 | |||
| 3362 | 8006934886 | |||
| 3363 | 8006974854 | |||
| 3364 | 8016519488 | |||
| 3365 | 8016588685 | |||
| 3366 | 8016637185 | |||
| 3367 | 8017066034 | |||
| 3368 | 8019563773 | |||
| 3369 | 8019573838 | |||
| 3370 | 8019624150 | |||
| 3371 | 8019653671 | |||
| 3372 | 8019665806 | |||
| 3373 | 8019675332 | |||
| 3374 | 8019680772 | |||
| 3375 | 8019694995 | |||
| 3376 | 8055750113 | |||
| 3377 | 8056696200 | |||
| 3378 | 8056975892 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2egg-assembly1.cif.gz_A | crystal structure of shikimate 5-dehydrogenase (aroe) from geobacillus kaustophilus | 0.9171 | 2 | 273 |
| 3sef-assembly2.cif.gz_C | 2.4 angstrom resolution crystal structure of shikimate 5-dehydrogenase (aroe) from vibrio cholerae o1 biovar eltor str. n16961 in complex with shikimate and nadph | 0.909 | 6 | 275 |
| 3jyo-assembly1.cif.gz_A | quinate dehydrogenase from corynebacterium glutamicum in complex with nad | 0.9062 | 6 | 273 |
| 3sef-assembly2.cif.gz_C | 2.4 angstrom resolution crystal structure of shikimate 5-dehydrogenase (aroe) from vibrio cholerae o1 biovar eltor str. n16961 in complex with shikimate and nadph | 0.8984 | 6 | 275 |
| 2cy0-assembly1.cif.gz_B | crystal structure of shikimate 5-dehydrogenase (aroe) from thermus thermophilus hb8 in complex with nadp | 0.8962 | 6 | 276 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FXY1_2_97_3.40.50.10860 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 | 0.9412 | 8 | 100 | 3.40.50.10860 |
| af_P0A6D5_8_104_1.10.560.10 | Mainly Alpha;Orthogonal Bundle;GROEL; domain 1;GroEL-like equatorial domain | 0.9398 | 6 | 100 | 1.10.560.10 |
| af_P15770_4_98_2.40.10.10 | Mainly Beta;Beta Barrel;Thrombin, subunit H;Trypsin-like serine proteases | 0.9372 | 9 | 99 | 2.40.10.10 |
| af_I6Y120_6_102_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9303 | 6 | 100 | 3.40.50.150 |
| af_P0A6D5_3_112_3.40.50.10860 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 | 0.9275 | 1 | 108 | 3.40.50.10860 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-I5BWP7-F1-model_v4 | Shikimate dehydrogenase (NADP(+)) (SDH) (EC 1.1.1.25) | 0.9744 | 2 | 278 |
GO:0004764
GO:0005829 GO:0008652 GO:0009073 GO:0009117 GO:0009423 GO:0019632 GO:0047429 GO:0050661 |
| AF-A0A2D5TG25-F1-model_v4 | Shikimate dehydrogenase (NADP(+)) (SDH) (EC 1.1.1.25) | 0.9733 | 6 | 271 |
GO:0004764
GO:0005829 GO:0008652 GO:0009073 GO:0009423 GO:0019632 GO:0050661 |
| AF-A0A1M7E2Q4-F1-model_v4 | Shikimate dehydrogenase (NADP(+)) (SDH) (EC 1.1.1.25) | 0.9703 | 8 | 271 |
GO:0004764
GO:0005829 GO:0008652 GO:0009073 GO:0009423 GO:0019632 GO:0050661 |
| AF-A0A520NVJ4-F1-model_v4 | Shikimate dehydrogenase (NADP(+)) (SDH) (EC 1.1.1.25) | 0.9686 | 2 | 274 |
GO:0004764
GO:0005829 GO:0008652 GO:0009073 GO:0009423 GO:0019632 GO:0050661 |
| AF-A0A5C8SJ88-F1-model_v4 | deleted | 0.9685 | 1 | 278 |
|