F495345

General Info

Members Datasets Scaffolds Average Seq Length
1689 691 3378 281

Family's Representative Sequence

Representative Sequence 3300031731|Ga0307405_10022939|Ga0307405_100229392
Length 324
Sequence MPGSLGQSRRDLVGHGGDRVGLKPLSSPPHPGIDTAAGLAELTAMTTGTRPPAACLIGWPAAHSRSPLIHHYWLRTLGIEGGYVIEAVPPDEFQDFVFRLSLRGFVGANVTLPHKERALALSKPDERARAVGAANTLWFEQGELCSTNTDVEGFINNLDACAPGWDRAEDALVLGAGGSSRAVLFGLIERGIKRVHLANRTMERARALADQFGASVLPVEWEAFGELLPRAGLLVNTTSLGMHGQPALELDIGRLPHHAVVADLVYAPLETPLLAAARAHGLRTADGLGMLLHQAVRGFELWFGKRPEVTSELRALIEADLKKV

Samples

Sample ID Description Type Environment
1 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
5 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
9 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
10 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
11 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
37 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
38 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
39 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
40 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
41 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
42 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
43 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
44 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
45 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
46 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
47 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
48 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
49 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
50 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
51 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
52 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
53 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
54 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
55 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
56 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
57 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
58 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
59 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
60 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
61 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
62 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
63 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
64 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
65 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
66 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
67 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
68 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
69 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
70 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
71 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
72 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
73 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
74 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
75 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
76 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
77 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
78 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
79 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
80 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
81 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
82 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
83 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
84 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
85 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
86 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
87 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
88 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
89 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
90 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
91 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
92 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
93 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
95 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
96 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
97 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
98 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
99 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
100 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
101 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
102 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
103 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
104 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
105 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
106 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
107 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
108 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
109 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
110 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
111 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
112 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
113 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
114 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
115 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
116 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
117 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
118 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
119 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
120 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
121 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
122 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
123 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
124 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
125 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
126 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
127 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
128 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
129 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
130 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
131 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
132 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
133 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
134 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
135 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
136 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
137 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
138 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
139 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
140 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
141 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
142 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
143 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
144 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
145 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
146 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
147 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
148 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
149 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
150 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
151 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
152 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
153 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
154 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
156 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
159 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
160 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
161 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
162 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
163 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
229 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
230 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
231 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
232 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
234 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
235 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
236 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
237 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
241 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
242 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
243 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
244 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
245 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
246 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
247 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
248 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
249 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
250 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
251 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
252 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
253 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
254 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
255 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
256 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
257 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
258 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
259 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
260 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
261 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
262 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
263 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
264 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
265 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
266 3300033546 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE2 Metagenome Unclassified
267 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
268 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
269 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
270 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
271 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
272 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
273 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
274 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
275 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
276 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
277 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
278 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
279 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
280 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
281 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
282 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
283 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
284 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
285 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
286 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
287 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
288 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
289 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
290 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
291 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
292 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
293 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
294 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
295 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
296 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
297 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
298 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
299 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
300 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
301 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
302 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
303 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
304 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
305 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
306 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
307 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
308 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
309 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
310 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
311 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
312 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
313 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
314 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
315 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
316 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
317 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
318 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
319 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
320 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
321 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
322 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
323 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
324 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
325 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
326 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
327 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
328 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
329 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
330 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
331 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
332 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
333 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
334 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
335 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
336 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
337 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
338 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
339 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
340 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
341 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
342 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
343 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
344 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
345 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
346 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
347 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
348 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
349 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
350 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
351 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
352 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
353 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
354 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
355 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
356 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
357 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
358 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
359 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
360 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
361 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
362 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
363 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
364 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
365 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
366 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
367 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
368 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
369 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
370 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
371 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
372 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
373 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
374 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
375 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
376 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
377 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
378 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
379 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
380 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
381 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
382 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
383 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
384 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
385 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
386 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
387 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
388 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
389 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
390 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
391 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
392 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
393 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
394 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
395 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
396 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
397 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
398 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
399 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
400 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
401 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
402 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
403 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
404 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
405 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
406 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
407 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
408 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
409 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
410 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
411 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
412 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
413 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
414 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
415 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
416 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
417 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
418 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
419 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
420 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
421 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
422 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
423 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
424 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
425 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
426 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
427 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
428 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
429 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
430 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
431 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
432 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
433 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
434 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
435 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
436 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
437 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
438 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
439 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
440 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
441 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
442 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
443 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
444 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
445 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
446 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
447 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
448 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
449 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
450 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
451 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
452 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
453 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
454 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
455 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
456 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
457 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
458 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
459 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
460 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
461 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
462 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
463 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
464 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
465 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
466 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
467 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
468 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
469 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
470 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
471 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
472 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
473 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
474 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
475 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
476 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
477 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
478 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
479 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
480 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
481 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
482 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
483 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
484 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
485 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
486 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
487 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
488 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
489 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
490 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
491 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
492 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
493 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
494 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
495 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
496 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
497 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
498 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
499 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
500 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
501 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
502 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
503 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
504 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
505 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
506 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
507 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
508 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
509 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
510 3300053728 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere Metagenome Endosphere
511 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
512 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
513 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
514 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
515 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
516 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
517 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
518 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
519 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
520 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
521 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
522 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
523 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
524 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
525 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
526 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
527 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
528 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
529 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
530 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
531 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
532 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
533 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
534 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
535 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
536 2643221651 Afipia sp. Root123D2 Isolate Unclassified
537 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
538 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
539 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
540 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
541 2791355199
542 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
543 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
544 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
545 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
546 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
547 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
548 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
549 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
550 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
551 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
552 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
553 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
554 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
555 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
556 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
557 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
558 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
559 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
560 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
561 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
562 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
563 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
564 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
565 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
566 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
567 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
568 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
569 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
570 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
571 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
572 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
573 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
574 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
575 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
576 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
577 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
578 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
579 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
580 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
581 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
582 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
583 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
584 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
585 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
586 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
587 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
588 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
589 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
590 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
591 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
592 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
593 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
594 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
595 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
596 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
597 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
598 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
599 2904699407
600 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
601 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
602 2906610324
603 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
604 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
605 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
606 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
607 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
608 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
609 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
610 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
611 2922368715
612 2922425934
613 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
614 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
615 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
616 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
617 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
618 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
619 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
620 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
621 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
622 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
623 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
624 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
625 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
626 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
627 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
628 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
629 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
630 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
631 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
632 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
633 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
634 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
635 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
636 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
637 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
638 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
639 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
640 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
641 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
642 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
643 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
644 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
645 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
646 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
647 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
648 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
649 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
650 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
651 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
652 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
653 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
654 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
655 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
656 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
657 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
658 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
659 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
660 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
661 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
662 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
663 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
664 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
665 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
666 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
667 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
668 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
669 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
670 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
671 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
672 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
673 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
674 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
675 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
676 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
677 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
678 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
679 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
680 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
681 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
682 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
683 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
684 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
685 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
686 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
687 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
688 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
689 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
690 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
691 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 89.55
Metatranscriptomes 0.36
Isolates 10.1

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.8
Nodule 8.29
Rhizoplane 5.86
Rhizosphere 73.42
Stem 0
Stem Tuber 0
Unclassified 4.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307405_10022939 3300031731 Bacteria 3538
2 JGI24739J22299_10000871 3300001989 Bacteria 11154
3 JGI24739J22299_10008928 3300001989 Bacteria 3739
4 JGI24739J22299_10025017 3300001989 Bacteria 2101
5 JGI24743J22301_10013185 3300001991 Bacteria 1512
6 JGI24750J21931_1000457 3300002070 Bacteria 6532
7 JGI24035J26624_1000248 3300002126 Bacteria 4965
8 JGI25153J46596_10004620 3300003215 Bacteria 7372
9 JGI25153J46596_10005210 3300003215 Bacteria 6841
10 JGI25153J46596_10010025 3300003215 Bacteria 4327
11 JGI25153J46596_10031215 3300003215 Bacteria 1797
12 rootL2_10335649 3300003322 Bacteria 1925
13 JGI25160J50197_1003286 3300003354 Bacteria 7284
14 JGI25160J50197_1007225 3300003354 Bacteria 4369
15 Ga0055531_10010351 3300003794 Bacteria 4645
16 Ga0055531_10010606 3300003794 Bacteria 4554
17 Ga0055543_1008336 3300004625 Bacteria 2301
18 Ga0065165_1002476 3300005262 Bacteria 15530
19 Ga0065165_1002846 3300005262 Bacteria 13437
20 Ga0065165_1025765 3300005262 Bacteria 1948
21 Ga0065715_10243240 3300005293 Bacteria 1172
22 Ga0070658_10029391 3300005327 Bacteria 4415
23 Ga0070658_10044726 3300005327 Bacteria 3579
24 Ga0070658_10142354 3300005327 Bacteria 2004
25 Ga0070658_10349485 3300005327 Bacteria 1265
26 Ga0070658_10461582 3300005327 Bacteria 1095
27 Ga0070676_10020837 3300005328 Bacteria 3665
28 Ga0070676_10086242 3300005328 Bacteria 1915
29 Ga0070676_10165191 3300005328 Bacteria 1428
30 Ga0070683_100031309 3300005329 Bacteria 4836
31 Ga0070683_100041896 3300005329 Bacteria 4215
32 Ga0070683_100045265 3300005329 Bacteria 4061
33 Ga0070690_100017313 3300005330 Plasmid 4331
34 Ga0070670_100126553 3300005331 Unclassified 2205
35 Ga0070670_100316986 3300005331 Bacteria 1366
36 Ga0070677_10005521 3300005333 Bacteria 4168
37 Ga0068869_100059222 3300005334 Bacteria 2803
38 Ga0070666_10103477 3300005335 Unclassified 1964
39 Ga0070680_100003647 3300005336 Bacteria 11501
40 Ga0070680_100123326 3300005336 Bacteria 2164
41 Ga0070682_100007969 3300005337 Bacteria 5962
42 Ga0070682_100028580 3300005337 Bacteria 3355
43 Ga0070682_100030805 3300005337 Plasmid 3241
44 Ga0068868_100018112 3300005338 Bacteria 5258
45 Ga0068868_100208673 3300005338 Bacteria 1632
46 Ga0070660_100003870 3300005339 Bacteria 10336
47 Ga0070660_100019473 3300005339 Bacteria 4974
48 Ga0070660_100022278 3300005339 Bacteria 4682
49 Ga0070660_100026453 3300005339 Bacteria 4319
50 Ga0070660_100277754 3300005339 Bacteria 1370
51 Ga0070689_100031062 3300005340 Bacteria 4058
52 Ga0070689_100258241 3300005340 Unclassified 1439
53 Ga0070691_10004859 3300005341 Bacteria 6121
54 Ga0070691_10089795 3300005341 Bacteria 1514
55 Ga0070661_100009866 3300005344 Bacteria 6624
56 Ga0070661_100048625 3300005344 Bacteria 3105
57 Ga0070661_100063664 3300005344 Plasmid 2709
58 Ga0070661_100116508 3300005344 Bacteria 1998
59 Ga0070661_100156226 3300005344 Bacteria 1726
60 Ga0070668_100013726 3300005347 Bacteria 6051
61 Ga0070669_100014406 3300005353 Bacteria 5628
62 Ga0070669_100414063 3300005353 Bacteria 1105
63 Ga0070675_100018170 3300005354 Bacteria 5596
64 Ga0070675_100276160 3300005354 Bacteria 1476
65 Ga0070671_100016514 3300005355 Bacteria 5967
66 Ga0070671_100024253 3300005355 Bacteria 4965
67 Ga0070671_100034258 3300005355 Bacteria 4203
68 Ga0070671_100048918 3300005355 Bacteria 3518
69 Ga0070671_100170292 3300005355 Bacteria 1842
70 Ga0070674_100005693 3300005356 Bacteria 7227
71 Ga0070674_100558009 3300005356 Bacteria 962
72 Ga0070673_100040424 3300005364 Bacteria 3578
73 Ga0070673_100045977 3300005364 Plasmid 3389
74 Ga0070673_100055936 3300005364 Bacteria 3110
75 Ga0070659_100058630 3300005366 Bacteria 3039
76 Ga0070659_100144527 3300005366 Unclassified 1937
77 Ga0070659_100281140 3300005366 Bacteria 1384
78 Ga0070667_100014138 3300005367 Bacteria 6595
79 Ga0070667_100024258 3300005367 Bacteria 5037
80 Ga0070703_10003201 3300005406 Bacteria 4676
81 Ga0070709_10002262 3300005434 Bacteria 10432
82 Ga0070709_10010070 3300005434 Bacteria 5225
83 Ga0070709_10013419 3300005434 Bacteria 4606
84 Ga0070709_10018177 3300005434 Plasmid 4044
85 Ga0070714_100022361 3300005435 Bacteria 5185
86 Ga0070714_100054927 3300005435 Plasmid 3403
87 Ga0070714_100152613 3300005435 Bacteria 2083
88 Ga0070714_100181091 3300005435 Bacteria 1917
89 Ga0070714_100269818 3300005435 Bacteria 1578
90 Ga0070714_100452677 3300005435 Bacteria 1220
91 Ga0070713_100003057 3300005436 Bacteria 10992
92 Ga0070713_100043687 3300005436 Plasmid 3665
93 Ga0070713_100055202 3300005436 Bacteria 3300
94 Ga0070713_100055241 3300005436 Bacteria 3299
95 Ga0070713_100055279 3300005436 Bacteria 3297
96 Ga0070713_100194352 3300005436 Bacteria 1830
97 Ga0070710_10002325 3300005437 Bacteria 8998
98 Ga0070710_10072646 3300005437 Bacteria 1987
99 Ga0070710_10119431 3300005437 Bacteria 1594
100 Ga0070701_10004348 3300005438 Bacteria 5724
101 Ga0070711_100002208 3300005439 Bacteria 11048
102 Ga0070711_100011944 3300005439 Bacteria 5407
103 Ga0070711_100013080 3300005439 Bacteria 5204
104 Ga0070711_100130120 3300005439 Bacteria 1873
105 Ga0070711_100187418 3300005439 Bacteria 1587
106 Ga0070711_100237930 3300005439 Unclassified 1422
107 Ga0070705_100023373 3300005440 Bacteria 3318
108 Ga0070700_100199792 3300005441 Unclassified 1404
109 Ga0070694_100019693 3300005444 Bacteria 4294
110 Ga0070708_100120926 3300005445 Bacteria 2416
111 Ga0070708_100130012 3300005445 Bacteria 2330
112 Ga0070663_100011845 3300005455 Bacteria 5495
113 Ga0070663_100027341 3300005455 Bacteria 3873
114 Ga0070678_100022020 3300005456 Bacteria 4213
115 Ga0070678_100066613 3300005456 Bacteria 2677
116 Ga0070678_100189994 3300005456 Bacteria 1688
117 Ga0070678_100408231 3300005456 Bacteria 1181
118 Ga0070662_100033312 3300005457 Bacteria 3626
119 Ga0070662_100164122 3300005457 Unclassified 1739
120 Ga0070681_10023502 3300005458 Bacteria 6200
121 Ga0070681_10032947 3300005458 Bacteria 5201
122 Ga0070681_10059728 3300005458 Bacteria 3792
123 Ga0070681_10076670 3300005458 Bacteria 3301
124 Ga0070681_10112479 3300005458 Bacteria 2662
125 Ga0068867_100021271 3300005459 Bacteria 4629
126 Ga0068867_100128322 3300005459 Unclassified 1968
127 Ga0068867_100185270 3300005459 Bacteria 1657
128 Ga0070685_10074353 3300005466 Unclassified 2022
129 Ga0070707_100055777 3300005468 Bacteria 3788
130 Ga0070698_100028359 3300005471 Bacteria 5815
131 Ga0070699_100143856 3300005518 Bacteria 2107
132 Ga0070679_100009249 3300005530 Bacteria 9313
133 Ga0070679_100009709 3300005530 Bacteria 9103
134 Ga0070679_100051732 3300005530 Bacteria 4091
135 Ga0070679_100098832 3300005530 Bacteria 2906
136 Ga0070679_100173681 3300005530 Bacteria 2128
137 Ga0070679_100342777 3300005530 Bacteria 1442
138 Ga0070684_100008556 3300005535 Bacteria 8010
139 Ga0070684_100022473 3300005535 Bacteria 5261
140 Ga0070684_100063130 3300005535 Bacteria 3246
141 Ga0070684_100092000 3300005535 Bacteria 2699
142 Ga0070684_100271447 3300005535 Bacteria 1553
143 Ga0070697_100079996 3300005536 Bacteria 2692
144 Ga0068853_100003634 3300005539 Bacteria 11828
145 Ga0068853_100045254 3300005539 Bacteria 3769
146 Ga0068853_100097553 3300005539 Bacteria 2595
147 Ga0068853_100175843 3300005539 Bacteria 1939
148 Ga0068853_100177249 3300005539 Bacteria 1932
149 Ga0068853_100179629 3300005539 Bacteria 1919
150 Ga0068853_100529554 3300005539 Bacteria 1115
151 Ga0070672_100006742 3300005543 Bacteria 7744
152 Ga0070672_100105181 3300005543 Bacteria 2294
153 Ga0070686_100116734 3300005544 Unclassified 1827
154 Ga0070695_100027274 3300005545 Bacteria 3537
155 Ga0070696_100027513 3300005546 Bacteria 3875
156 Ga0070693_100031082 3300005547 Bacteria 2924
157 Ga0070665_100063185 3300005548 Bacteria 3712
158 Ga0070665_100065216 3300005548 Plasmid 3653
159 Ga0070665_100071799 3300005548 Bacteria 3468
160 Ga0070665_100080708 3300005548 Bacteria 3258
161 Ga0070665_100105307 3300005548 Bacteria 2823
162 Ga0070665_100172385 3300005548 Bacteria 2164
163 Ga0070665_100203035 3300005548 Bacteria 1982
164 Ga0070665_100265636 3300005548 Bacteria 1717
165 Ga0070665_100380649 3300005548 Bacteria 1418
166 Ga0070665_100428297 3300005548 Bacteria 1332
167 Ga0070704_100025802 3300005549 Bacteria 3873
168 Ga0068855_100018412 3300005563 Bacteria 8391
169 Ga0068855_100019735 3300005563 Bacteria 8094
170 Ga0068855_100112477 3300005563 Bacteria 3124
171 Ga0068855_100125312 3300005563 Bacteria 2937
172 Ga0068855_100259104 3300005563 Bacteria 1938
173 Ga0068855_100261934 3300005563 Bacteria 1926
174 Ga0068855_100262469 3300005563 Bacteria 1923
175 Ga0068855_100410537 3300005563 Bacteria 1482
176 Ga0068855_100432165 3300005563 Unclassified 1439
177 Ga0068855_100454183 3300005563 Bacteria 1398
178 Ga0068855_100495803 3300005563 Bacteria 1328
179 Ga0068855_100739264 3300005563 Bacteria 1050
180 Ga0070664_100047876 3300005564 Bacteria 3613
181 Ga0070664_100069419 3300005564 Bacteria 3015
182 Ga0070664_100238256 3300005564 Bacteria 1633
183 Ga0068857_100003181 3300005577 Bacteria 13618
184 Ga0068857_100096073 3300005577 Bacteria 2655
185 Ga0068857_100681426 3300005577 Bacteria 976
186 Ga0068854_100016856 3300005578 Bacteria 4878
187 Ga0068854_100030721 3300005578 Bacteria 3729
188 Ga0068854_100122052 3300005578 Bacteria 1980
189 Ga0068854_100155813 3300005578 Bacteria 1765
190 Ga0068856_100000781 3300005614 Bacteria 34483
191 Ga0068856_100024188 3300005614 Bacteria 5909
192 Ga0068856_100047838 3300005614 Bacteria 4214
193 Ga0068856_100073843 3300005614 Bacteria 3377
194 Ga0068856_100074006 3300005614 Bacteria 3372
195 Ga0068856_100116233 3300005614 Bacteria 2675
196 Ga0068856_100178360 3300005614 Bacteria 2137
197 Ga0068856_100180758 3300005614 Bacteria 2122
198 Ga0068856_100298360 3300005614 Bacteria 1629
199 Ga0068856_100320920 3300005614 Unclassified 1566
200 Ga0068856_100322290 3300005614 Bacteria 1563
201 Ga0070702_100046391 3300005615 Unclassified 2463
202 Ga0070702_100149746 3300005615 Bacteria 1496
203 Ga0070702_100323136 3300005615 Bacteria 1076
204 Ga0068852_100024735 3300005616 Bacteria 4858
205 Ga0068852_100026321 3300005616 Bacteria 4727
206 Ga0068852_100028959 3300005616 Bacteria 4542
207 Ga0068852_100204250 3300005616 Bacteria 1871
208 Ga0068852_100212283 3300005616 Bacteria 1837
209 Ga0068852_100545435 3300005616 Unclassified 1159
210 Ga0068859_100035913 3300005617 Bacteria 4973
211 Ga0068859_100154399 3300005617 Bacteria 2372
212 Ga0068859_100485774 3300005617 Unclassified 1330
213 Ga0068864_100026533 3300005618 Bacteria 4885
214 Ga0068864_100287017 3300005618 Unclassified 1537
215 Ga0068866_10022841 3300005718 Bacteria 2900
216 Ga0068861_100019676 3300005719 Bacteria 4823
217 Ga0068861_100048184 3300005719 Bacteria 3220
218 Ga0068861_100204537 3300005719 Bacteria 1659
219 Ga0068863_100006825 3300005841 Bacteria 11196
220 Ga0068858_100127566 3300005842 Unclassified 2384
221 Ga0068860_100018432 3300005843 Bacteria 6790
222 Ga0068860_100143296 3300005843 Bacteria 2298
223 Ga0068860_100143725 3300005843 Bacteria 2294
224 Ga0068862_100010222 3300005844 Bacteria 7743
225 Ga0068862_100028055 3300005844 Bacteria 4741
226 Ga0068862_100083389 3300005844 Bacteria 2775
227 Ga0081455_10000200 3300005937 Bacteria 76013
228 Ga0081455_10000768 3300005937 Bacteria 41613
229 Ga0081455_10023827 3300005937 Bacteria 5687
230 Ga0081540_1002136 3300005983 Bacteria 16449
231 Ga0081540_1008268 3300005983 Bacteria 7287
232 Ga0081540_1013689 3300005983 Bacteria 5258
233 Ga0070717_10003779 3300006028 Bacteria 10878
234 Ga0070717_10034264 3300006028 Bacteria 4104
235 Ga0070717_10351343 3300006028 Bacteria 1318
236 Ga0070717_10395519 3300006028 Bacteria 1241
237 Ga0075365_10046636 3300006038 Bacteria 2847
238 Ga0075365_10051949 3300006038 Bacteria 2709
239 Ga0075365_10065320 3300006038 Bacteria 2438
240 Ga0075368_10008811 3300006042 Bacteria 3612
241 Ga0075363_100065887 3300006048 Bacteria 1959
242 Ga0070715_10208276 3300006163 Bacteria 998
243 Ga0070716_100008278 3300006173 Bacteria 5157
244 Ga0070716_100012612 3300006173 Plasmid 4288
245 Ga0070716_100078406 3300006173 Bacteria 1964
246 Ga0070712_100328792 3300006175 Bacteria 1245
247 Ga0075367_10016061 3300006178 Bacteria 4082
248 Ga0075367_10026524 3300006178 Bacteria 3287
249 Ga0075367_10048065 3300006178 Bacteria 2512
250 Ga0075427_10000041 3300006194 Bacteria 9241
251 Ga0097621_100011867 3300006237 Bacteria 6441
252 Ga0097621_100024301 3300006237 Bacteria 4730
253 Ga0075370_10019677 3300006353 Bacteria 3679
254 Ga0068871_100019303 3300006358 Bacteria 5203
255 Ga0068871_100057668 3300006358 Bacteria 3160
256 Ga0068871_100157136 3300006358 Bacteria 1942
257 Ga0068871_100162788 3300006358 Bacteria 1909
258 Ga0068871_100300703 3300006358 Bacteria 1408
259 Ga0075428_100003399 3300006844 Bacteria 17407
260 Ga0075430_100000133 3300006846 Bacteria 47377
261 Ga0075431_100002259 3300006847 Bacteria 18467
262 Ga0075433_10000506 3300006852 Bacteria 25421
263 Ga0075433_10025119 3300006852 Bacteria 5036
264 Ga0075433_10038792 3300006852 Bacteria 4116
265 Ga0075434_100000472 3300006871 Bacteria 30053
266 Ga0075434_100008091 3300006871 Bacteria 9750
267 Ga0075434_100044057 3300006871 Bacteria 4427
268 Ga0075434_100068627 3300006871 Bacteria 3532
269 Ga0075434_100386460 3300006871 Bacteria 1420
270 Ga0075434_100411167 3300006871 Bacteria 1374
271 Ga0075429_100000163 3300006880 Bacteria 42270
272 Ga0068865_100001544 3300006881 Bacteria 13429
273 Ga0068865_100003466 3300006881 Bacteria 9451
274 Ga0068865_100076577 3300006881 Bacteria 2388
275 Ga0068865_100362686 3300006881 Unclassified 1177
276 Ga0097620_100035916 3300006931 Bacteria 4973
277 Ga0097620_100154402 3300006931 Bacteria 2372
278 Ga0097620_100485755 3300006931 Unclassified 1330
279 Ga0099825_1036559 3300006941 Bacteria 1683
280 Ga0099824_1023056 3300006942 Bacteria 3951
281 Ga0099822_1001448 3300006943 Bacteria 27661
282 Ga0099823_1004051 3300006944 Bacteria 14168
283 Ga0075435_100017200 3300007076 Bacteria 5466
284 Ga0075435_100056759 3300007076 Bacteria 3166
285 Ga0099794_10060242 3300007265 Bacteria 1843
286 Ga0099795_10003998 3300007788 Bacteria 3742
287 Ga0099795_10010789 3300007788 Bacteria 2705
288 Ga0099795_10025253 3300007788 Bacteria 1991
289 Ga0099795_10134516 3300007788 Bacteria 1000
290 Ga0105251_10010431 3300009011 Bacteria 5391
291 Ga0105240_10008946 3300009093 Bacteria 14238
292 Ga0105240_10023552 3300009093 Bacteria 8137
293 Ga0105240_10029706 3300009093 Bacteria 7114
294 Ga0105240_10039692 3300009093 Bacteria 6026
295 Ga0105240_10048624 3300009093 Bacteria 5359
296 Ga0105240_10092782 3300009093 Bacteria 3685
297 Ga0105240_10427362 3300009093 Unclassified 1487
298 Ga0111539_10000389 3300009094 Bacteria 54333
299 Ga0111539_10001808 3300009094 Bacteria 28479
300 Ga0105245_10031587 3300009098 Bacteria 4687
301 Ga0105245_10035028 3300009098 Bacteria 4454
302 Ga0105245_10062438 3300009098 Bacteria 3361
303 Ga0105245_10154012 3300009098 Bacteria 2176
304 Ga0105245_10247473 3300009098 Bacteria 1731
305 Ga0105247_10031859 3300009101 Bacteria 3201
306 Ga0105247_10034936 3300009101 Bacteria 3062
307 Ga0105247_10056334 3300009101 Bacteria 2427
308 Ga0114129_10018380 3300009147 Bacteria 9958
309 Ga0114129_10364864 3300009147 Bacteria 1910
310 Ga0114129_10609708 3300009147 Bacteria 1413
311 Ga0105243_10040850 3300009148 Bacteria 3625
312 Ga0105241_10024018 3300009174 Bacteria 4526
313 Ga0105241_10031108 3300009174 Bacteria 3994
314 Ga0105241_10081747 3300009174 Bacteria 2531
315 Ga0105242_10082937 3300009176 Bacteria 2683
316 Ga0105242_10097450 3300009176 Bacteria 2486
317 Ga0105242_10271376 3300009176 Bacteria 1537
318 Ga0105242_10803490 3300009176 Bacteria 931
319 Ga0105248_10011779 3300009177 Bacteria 9647
320 Ga0105248_10046950 3300009177 Bacteria 4842
321 Ga0105248_10237637 3300009177 Bacteria 2051
322 Ga0105248_10261174 3300009177 Bacteria 1949
323 Ga0105237_10004719 3300009545 Bacteria 15684
324 Ga0105237_10007432 3300009545 Bacteria 11993
325 Ga0105237_10019250 3300009545 Bacteria 7053
326 Ga0105237_10045568 3300009545 Bacteria 4412
327 Ga0105237_10381648 3300009545 Bacteria 1414
328 Ga0105237_10410939 3300009545 Unclassified 1358
329 Ga0105237_10470423 3300009545 Bacteria 1263
330 Ga0105238_10031611 3300009551 Bacteria 5389
331 Ga0105238_10040511 3300009551 Bacteria 4720
332 Ga0105238_10045455 3300009551 Plasmid 4435
333 Ga0105238_10064854 3300009551 Bacteria 3652
334 Ga0105238_10110436 3300009551 Bacteria 2730
335 Ga0105238_10292182 3300009551 Bacteria 1612
336 Ga0105238_10374066 3300009551 Bacteria 1415
337 Ga0105249_10019871 3300009553 Bacteria 5999
338 Ga0105249_10067975 3300009553 Bacteria 3285
339 Ga0105249_10094865 3300009553 Bacteria 2797
340 Ga0099796_10043386 3300010159 Bacteria 1532
341 Ga0105239_10043179 3300010375 Bacteria 4940
342 Ga0105239_10053738 3300010375 Bacteria 4418
343 Ga0105239_10064549 3300010375 Bacteria 4019
344 Ga0105239_10079664 3300010375 Bacteria 3604
345 Ga0105239_10168122 3300010375 Bacteria 2452
346 Ga0105239_10282663 3300010375 Bacteria 1868
347 Ga0105239_10316055 3300010375 Bacteria 1761
348 Ga0105239_10322586 3300010375 Bacteria 1742
349 Ga0105239_10323551 3300010375 Bacteria 1739
350 Ga0105239_10330197 3300010375 Bacteria 1720
351 Ga0105239_10826421 3300010375 Bacteria 1062
352 Ga0105246_10012128 3300011119 Bacteria 5371
353 Ga0105246_10054989 3300011119 Bacteria 2745
354 Ga0105246_10332364 3300011119 Bacteria 1239
355 Ga0157326_1008038 3300012513 Unclassified 1146
356 Ga0157373_10010494 3300013100 Bacteria 6814
357 Ga0157373_10024897 3300013100 Bacteria 4334
358 Ga0157373_10204840 3300013100 Bacteria 1391
359 Ga0157371_10007078 3300013102 Bacteria 9121
360 Ga0157371_10036676 3300013102 Bacteria 3511
361 Ga0157371_10128334 3300013102 Bacteria 1804
362 Ga0157371_10158591 3300013102 Bacteria 1615
363 Ga0157370_10041078 3300013104 Bacteria 4464
364 Ga0157370_10181306 3300013104 Bacteria 1957
365 Ga0157370_10238914 3300013104 Bacteria 1681
366 Ga0157369_10008072 3300013105 Bacteria 12072
367 Ga0157369_10033594 3300013105 Bacteria 5636
368 Ga0157369_10236445 3300013105 Unclassified 1909
369 Ga0157369_10386899 3300013105 Bacteria 1451
370 Ga0157369_10522628 3300013105 Bacteria 1228
371 Ga0157369_10777587 3300013105 Bacteria 984
372 Ga0157374_10002692 3300013296 Bacteria 14940
373 Ga0157374_10164515 3300013296 Bacteria 2162
374 Ga0157374_10224597 3300013296 Bacteria 1844
375 Ga0157378_10049119 3300013297 Bacteria 3753
376 Ga0157378_10104776 3300013297 Bacteria 2586
377 Ga0157378_10108129 3300013297 Bacteria 2546
378 Ga0157378_10396452 3300013297 Bacteria 1359
379 Ga0157378_10471250 3300013297 Bacteria 1249
380 Ga0163162_10022106 3300013306 Bacteria 6268
381 Ga0163162_10022234 3300013306 Bacteria 6250
382 Ga0163162_10029020 3300013306 Bacteria 5475
383 Ga0163162_10081453 3300013306 Bacteria 3307
384 Ga0163162_10107677 3300013306 Bacteria 2883
385 Ga0163162_10198425 3300013306 Bacteria 2135
386 Ga0163162_10324040 3300013306 Bacteria 1673
387 Ga0157372_10016582 3300013307 Bacteria 7904
388 Ga0157372_10107362 3300013307 Bacteria 3194
389 Ga0157372_10214288 3300013307 Bacteria 2232
390 Ga0157372_10423344 3300013307 Bacteria 1552
391 Ga0157375_10064892 3300013308 Bacteria 3637
392 Ga0157375_10430055 3300013308 Bacteria 1486
393 Ga0163163_10029384 3300014325 Bacteria 5287
394 Ga0163163_10059092 3300014325 Bacteria 3791
395 Ga0163163_10155656 3300014325 Bacteria 2330
396 Ga0157380_10013506 3300014326 Bacteria 5957
397 Ga0157377_10013798 3300014745 Bacteria 4096
398 Ga0157377_10226916 3300014745 Bacteria 1199
399 Ga0157379_10010153 3300014968 Bacteria 8207
400 Ga0157379_10027560 3300014968 Bacteria 5058
401 Ga0157376_10022095 3300014969 Bacteria 4952
402 Ga0157376_10109705 3300014969 Bacteria 2426
403 Ga0157376_10113532 3300014969 Unclassified 2389
404 Ga0157376_10237036 3300014969 Bacteria 1698
405 Ga0163161_10006229 3300017792 Bacteria 8265
406 Ga0163161_10035277 3300017792 Plasmid 3580
407 Ga0163161_10039404 3300017792 Bacteria 3392
408 Ga0163161_10047578 3300017792 Bacteria 3097
409 Ga0163161_10135289 3300017792 Bacteria 1863
410 Ga0206356_10553992 3300020070 Bacteria 2161
411 Ga0206356_11532789 3300020070 Bacteria 1374
412 Ga0206354_11292144 3300020081 Bacteria 1356
413 Ga0206353_10342907 3300020082 Bacteria 1126
414 Ga0214542_1000156 3300021321 Bacteria 101631
415 Ga0214545_1000078 3300021324 Bacteria 101631
416 Ga0214543_1000136 3300021327 Bacteria 101629
417 Ga0213875_10003786 3300021388 Bacteria 8505
418 Ga0213871_10000896 3300021441 Bacteria 4553
419 Ga0224572_1006509 3300024225 Bacteria 2114
420 Ga0228598_1015888 3300024227 Bacteria 1485
421 Ga0207425_1014237 3300025245 Bacteria 1811
422 Ga0209677_104346 3300025253 Bacteria 4129
423 Ga0209233_1005084 3300025261 Bacteria 4400
424 Ga0207666_1000311 3300025271 Bacteria 6768
425 Ga0209455_1006888 3300025272 Bacteria 3297
426 Ga0209673_1021558 3300025273 Bacteria 2249
427 Ga0209564_1008607 3300025295 Bacteria 5004
428 Ga0209758_1000705 3300025297 Bacteria 49585
429 Ga0209758_1000932 3300025297 Bacteria 39573
430 Ga0209758_1000986 3300025297 Bacteria 38258
431 Ga0209758_1002299 3300025297 Bacteria 19758
432 Ga0209758_1030972 3300025297 Bacteria 2204
433 Ga0207426_1000632 3300025302 Bacteria 44581
434 Ga0207426_1001240 3300025302 Bacteria 22455
435 Ga0207426_1006296 3300025302 Bacteria 5190
436 Ga0207426_1020313 3300025302 Bacteria 2309
437 Ga0209257_1001185 3300025304 Bacteria 32850
438 Ga0209257_1010432 3300025304 Bacteria 4703
439 Ga0207697_10006626 3300025315 Bacteria 5222
440 Ga0207713_1077773 3300025735 Unclassified 1204
441 Ga0207653_10002805 3300025885 Bacteria 5539
442 Ga0207682_10000009 3300025893 Bacteria 86366
443 Ga0207682_10014469 3300025893 Bacteria 3074
444 Ga0207692_10063809 3300025898 Bacteria 1916
445 Ga0207692_10069546 3300025898 Bacteria 1850
446 Ga0207692_10203761 3300025898 Bacteria 1164
447 Ga0207710_10001303 3300025900 Bacteria 12616
448 Ga0207710_10002730 3300025900 Bacteria 8088
449 Ga0207688_10000892 3300025901 Bacteria 15087
450 Ga0207680_10016229 3300025903 Plasmid 3905
451 Ga0207680_10058944 3300025903 Bacteria 2329
452 Ga0207647_10002160 3300025904 Bacteria 15015
453 Ga0207647_10016893 3300025904 Bacteria 4970
454 Ga0207647_10048251 3300025904 Bacteria 2645
455 Ga0207647_10110563 3300025904 Unclassified 1625
456 Ga0207647_10249664 3300025904 Bacteria 1018
457 Ga0207685_10051712 3300025905 Unclassified 1588
458 Ga0207699_10001069 3300025906 Bacteria 12945
459 Ga0207699_10007734 3300025906 Bacteria 5262
460 Ga0207699_10033250 3300025906 Bacteria 2914
461 Ga0207699_10040581 3300025906 Bacteria 2682
462 Ga0207645_10000999 3300025907 Bacteria 23365
463 Ga0207645_10064570 3300025907 Bacteria 2339
464 Ga0207645_10066806 3300025907 Bacteria 2298
465 Ga0207705_10081980 3300025909 Bacteria 2352
466 Ga0207654_10015616 3300025911 Bacteria 3945
467 Ga0207654_10025829 3300025911 Plasmid 3174
468 Ga0207654_10040703 3300025911 Bacteria 2620
469 Ga0207654_10090337 3300025911 Bacteria 1865
470 Ga0207707_10006422 3300025912 Bacteria 10269
471 Ga0207707_10020542 3300025912 Bacteria 5767
472 Ga0207707_10027810 3300025912 Bacteria 4944
473 Ga0207707_10062664 3300025912 Bacteria 3236
474 Ga0207707_10154734 3300025912 Bacteria 2005
475 Ga0207707_10372622 3300025912 Bacteria 1228
476 Ga0207695_10000123 3300025913 Bacteria 232059
477 Ga0207695_10057960 3300025913 Bacteria 4022
478 Ga0207695_10088527 3300025913 Bacteria 3116
479 Ga0207695_10155565 3300025913 Bacteria 2221
480 Ga0207695_10189873 3300025913 Bacteria 1972
481 Ga0207671_10009480 3300025914 Bacteria 8132
482 Ga0207671_10035416 3300025914 Bacteria 3705
483 Ga0207671_10041159 3300025914 Bacteria 3420
484 Ga0207671_10252742 3300025914 Bacteria 1386
485 Ga0207671_10527652 3300025914 Bacteria 941
486 Ga0207693_10000565 3300025915 Bacteria 33481
487 Ga0207693_10006473 3300025915 Bacteria 9705
488 Ga0207693_10007042 3300025915 Bacteria 9281
489 Ga0207693_10076615 3300025915 Bacteria 2619
490 Ga0207693_10091642 3300025915 Unclassified 2383
491 Ga0207693_10327417 3300025915 Bacteria 1199
492 Ga0207663_10000239 3300025916 Bacteria 24165
493 Ga0207663_10212720 3300025916 Unclassified 1402
494 Ga0207660_10001283 3300025917 Bacteria 16867
495 Ga0207660_10030183 3300025917 Bacteria 3725
496 Ga0207660_10042221 3300025917 Bacteria 3200
497 Ga0207660_10178226 3300025917 Bacteria 1649
498 Ga0207662_10000025 3300025918 Bacteria 70078
499 Ga0207662_10010323 3300025918 Bacteria 5155
500 Ga0207657_10006857 3300025919 Bacteria 11750
501 Ga0207657_10012765 3300025919 Bacteria 8273
502 Ga0207657_10018108 3300025919 Bacteria 6739
503 Ga0207657_10148090 3300025919 Bacteria 1914
504 Ga0207657_10161621 3300025919 Unclassified 1819
505 Ga0207657_10166069 3300025919 Bacteria 1790
506 Ga0207657_10231905 3300025919 Bacteria 1476
507 Ga0207649_10002186 3300025920 Bacteria 11047
508 Ga0207649_10025741 3300025920 Bacteria 3434
509 Ga0207649_10303134 3300025920 Unclassified 1169
510 Ga0207649_10318780 3300025920 Unclassified 1141
511 Ga0207652_10073521 3300025921 Bacteria 2974
512 Ga0207652_10075776 3300025921 Bacteria 2932
513 Ga0207652_10144808 3300025921 Bacteria 2126
514 Ga0207652_10179454 3300025921 Bacteria 1902
515 Ga0207652_10322632 3300025921 Bacteria 1394
516 Ga0207652_10345915 3300025921 Bacteria 1342
517 Ga0207646_10112011 3300025922 Bacteria 2449
518 Ga0207646_10118738 3300025922 Bacteria 2375
519 Ga0207681_10007074 3300025923 Bacteria 6881
520 Ga0207681_10156754 3300025923 Bacteria 1712
521 Ga0207694_10039207 3300025924 Bacteria 3645
522 Ga0207694_10045928 3300025924 Bacteria 3375
523 Ga0207694_10104378 3300025924 Bacteria 2249
524 Ga0207694_10434838 3300025924 Bacteria 1094
525 Ga0207694_10461524 3300025924 Bacteria 1061
526 Ga0207650_10357355 3300025925 Bacteria 1203
527 Ga0207659_10169970 3300025926 Bacteria 1719
528 Ga0207659_10177614 3300025926 Unclassified 1684
529 Ga0207659_10216169 3300025926 Bacteria 1539
530 Ga0207687_10003202 3300025927 Bacteria 11093
531 Ga0207687_10030484 3300025927 Bacteria 3637
532 Ga0207687_10208342 3300025927 Bacteria 1532
533 Ga0207687_10221870 3300025927 Bacteria 1489
534 Ga0207687_10509783 3300025927 Bacteria 1005
535 Ga0207700_10004367 3300025928 Bacteria 8326
536 Ga0207700_10005825 3300025928 Bacteria 7404
537 Ga0207700_10076952 3300025928 Bacteria 2590
538 Ga0207664_10022280 3300025929 Bacteria 4728
539 Ga0207664_10032782 3300025929 Bacteria 3985
540 Ga0207664_10130661 3300025929 Bacteria 2113
541 Ga0207644_10032924 3300025931 Bacteria 3620
542 Ga0207644_10036076 3300025931 Bacteria 3469
543 Ga0207644_10055831 3300025931 Bacteria 2848
544 Ga0207644_10061984 3300025931 Bacteria 2710
545 Ga0207644_10127632 3300025931 Bacteria 1943
546 Ga0207690_10011755 3300025932 Bacteria 5236
547 Ga0207690_10064867 3300025932 Bacteria 2495
548 Ga0207690_10088473 3300025932 Unclassified 2182
549 Ga0207690_10253542 3300025932 Bacteria 1360
550 Ga0207706_10005363 3300025933 Bacteria 11952
551 Ga0207706_10040844 3300025933 Bacteria 4112
552 Ga0207706_10085400 3300025933 Bacteria 2775
553 Ga0207706_10129804 3300025933 Bacteria 2217
554 Ga0207686_10014315 3300025934 Bacteria 4412
555 Ga0207686_10187791 3300025934 Bacteria 1471
556 Ga0207709_10006190 3300025935 Bacteria 6736
557 Ga0207709_10012682 3300025935 Bacteria 4646
558 Ga0207709_10024392 3300025935 Bacteria 3453
559 Ga0207670_10013997 3300025936 Bacteria 4749
560 Ga0207670_10078501 3300025936 Unclassified 2302
561 Ga0207670_10375891 3300025936 Unclassified 1131
562 Ga0207669_10001324 3300025937 Bacteria 10540
563 Ga0207669_10084772 3300025937 Bacteria 2043
564 Ga0207704_10003457 3300025938 Bacteria 7181
565 Ga0207665_10000127 3300025939 Bacteria 50413
566 Ga0207665_10002113 3300025939 Bacteria 13436
567 Ga0207665_10108803 3300025939 Bacteria 1945
568 Ga0207665_10196496 3300025939 Bacteria 1468
569 Ga0207665_10267556 3300025939 Bacteria 1268
570 Ga0207691_10002604 3300025940 Bacteria 17616
571 Ga0207691_10113799 3300025940 Bacteria 2404
572 Ga0207691_10116097 3300025940 Bacteria 2376
573 Ga0207691_10365968 3300025940 Unclassified 1232
574 Ga0207711_10001071 3300025941 Bacteria 26139
575 Ga0207711_10072335 3300025941 Bacteria 2995
576 Ga0207711_10106384 3300025941 Bacteria 2489
577 Ga0207711_10252392 3300025941 Bacteria 1620
578 Ga0207689_10001156 3300025942 Bacteria 25400
579 Ga0207689_10031636 3300025942 Bacteria 4403
580 Ga0207689_10081386 3300025942 Bacteria 2662
581 Ga0207661_10002078 3300025944 Bacteria 13776
582 Ga0207661_10007789 3300025944 Bacteria 7627
583 Ga0207661_10062965 3300025944 Bacteria 3003
584 Ga0207679_10003209 3300025945 Bacteria 10084
585 Ga0207679_10267358 3300025945 Bacteria 1461
586 Ga0207679_10417424 3300025945 Unclassified 1183
587 Ga0207667_10013288 3300025949 Bacteria 9430
588 Ga0207667_10028603 3300025949 Bacteria 6052
589 Ga0207667_10064143 3300025949 Bacteria 3836
590 Ga0207667_10077987 3300025949 Bacteria 3434
591 Ga0207667_10095327 3300025949 Bacteria 3072
592 Ga0207667_10103467 3300025949 Bacteria 2937
593 Ga0207667_10115171 3300025949 Bacteria 2771
594 Ga0207667_10122695 3300025949 Bacteria 2677
595 Ga0207667_10123806 3300025949 Bacteria 2663
596 Ga0207667_10128039 3300025949 Bacteria 2615
597 Ga0207667_10188431 3300025949 Bacteria 2117
598 Ga0207667_10219159 3300025949 Bacteria 1950
599 Ga0207667_10607125 3300025949 Bacteria 1103
600 Ga0207651_10008497 3300025960 Bacteria 5550
601 Ga0207651_10151130 3300025960 Bacteria 1807
602 Ga0207651_10327218 3300025960 Bacteria 1283
603 Ga0207712_10000579 3300025961 Bacteria 29666
604 Ga0207668_10001403 3300025972 Bacteria 14194
605 Ga0207668_10085216 3300025972 Bacteria 2305
606 Ga0207640_10003644 3300025981 Bacteria 8306
607 Ga0207640_10066874 3300025981 Bacteria 2403
608 Ga0207640_10075564 3300025981 Bacteria 2284
609 Ga0207640_10558073 3300025981 Bacteria 963
610 Ga0207658_10018420 3300025986 Bacteria 4821
611 Ga0207658_10130939 3300025986 Bacteria 2015
612 Ga0207677_10006044 3300026023 Bacteria 6604
613 Ga0207677_10117181 3300026023 Unclassified 1996
614 Ga0207677_10124489 3300026023 Bacteria 1945
615 Ga0207703_10008872 3300026035 Bacteria 7922
616 Ga0207703_10014416 3300026035 Bacteria 6164
617 Ga0207703_10130992 3300026035 Bacteria 2166
618 Ga0207703_10184537 3300026035 Bacteria 1843
619 Ga0207703_10306384 3300026035 Bacteria 1450
620 Ga0207639_10001866 3300026041 Bacteria 14170
621 Ga0207639_10044315 3300026041 Bacteria 3345
622 Ga0207639_10082222 3300026041 Bacteria 2553
623 Ga0207639_10094435 3300026041 Bacteria 2401
624 Ga0207639_10108911 3300026041 Bacteria 2253
625 Ga0207639_10135429 3300026041 Bacteria 2045
626 Ga0207639_10261036 3300026041 Bacteria 1515
627 Ga0207639_10288492 3300026041 Bacteria 1446
628 Ga0207639_10582894 3300026041 Bacteria 1030
629 Ga0207678_10021488 3300026067 Bacteria 5659
630 Ga0207678_10022823 3300026067 Bacteria 5479
631 Ga0207678_10042596 3300026067 Bacteria 3932
632 Ga0207678_10062786 3300026067 Bacteria 3193
633 Ga0207678_10130307 3300026067 Bacteria 2145
634 Ga0207678_10145100 3300026067 Unclassified 2026
635 Ga0207678_10261116 3300026067 Bacteria 1484
636 Ga0207708_10020931 3300026075 Bacteria 4935
637 Ga0207708_10130549 3300026075 Unclassified 1964
638 Ga0207702_10000758 3300026078 Bacteria 34312
639 Ga0207702_10010946 3300026078 Bacteria 7566
640 Ga0207702_10065779 3300026078 Bacteria 3106
641 Ga0207702_10098432 3300026078 Bacteria 2576
642 Ga0207702_10160482 3300026078 Bacteria 2053
643 Ga0207702_10167929 3300026078 Bacteria 2009
644 Ga0207702_10249986 3300026078 Unclassified 1665
645 Ga0207641_10006404 3300026088 Bacteria 9923
646 Ga0207641_10051015 3300026088 Plasmid 3502
647 Ga0207648_10004627 3300026089 Bacteria 14090
648 Ga0207648_10046915 3300026089 Bacteria 3787
649 Ga0207648_10176768 3300026089 Bacteria 1888
650 Ga0207676_10030863 3300026095 Bacteria 4026
651 Ga0207676_10677293 3300026095 Bacteria 997
652 Ga0207674_10054730 3300026116 Bacteria 4061
653 Ga0207674_10246718 3300026116 Unclassified 1733
654 Ga0207675_100003859 3300026118 Bacteria 14570
655 Ga0207675_100104527 3300026118 Bacteria 2669
656 Ga0207675_100108300 3300026118 Plasmid 2620
657 Ga0207675_100115515 3300026118 Bacteria 2536
658 Ga0207675_100533979 3300026118 Unclassified 1171
659 Ga0207683_10000782 3300026121 Bacteria 29001
660 Ga0207683_10000850 3300026121 Bacteria 28050
661 Ga0207683_10051919 3300026121 Bacteria 3592
662 Ga0207683_10056530 3300026121 Bacteria 3442
663 Ga0207683_10089743 3300026121 Bacteria 2736
664 Ga0207683_10163872 3300026121 Bacteria 2011
665 Ga0207683_10304839 3300026121 Bacteria 1457
666 Ga0207698_10007574 3300026142 Bacteria 6807
667 Ga0207698_10031006 3300026142 Bacteria 3854
668 Ga0207698_10087873 3300026142 Bacteria 2533
669 Ga0207698_10096641 3300026142 Bacteria 2435
670 Ga0207698_10375299 3300026142 Bacteria 1351
671 Ga0209389_1000019 3300027296 Bacteria 172067
672 Ga0209389_1000248 3300027296 Bacteria 34726
673 Ga0209589_1000005 3300027357 Bacteria 530958
674 Ga0209589_1001871 3300027357 Bacteria 35557
675 Ga0209489_100005 3300027361 Bacteria 530958
676 Ga0209489_100033 3300027361 Bacteria 172166
677 Ga0209489_102684 3300027361 Bacteria 35799
678 Ga0209700_100006 3300027363 Bacteria 530958
679 Ga0209700_100012 3300027363 Bacteria 357892
680 Ga0209179_1012095 3300027512 Bacteria 1544
681 Ga0209998_10002588 3300027717 Bacteria 4111
682 Ga0209974_10003747 3300027876 Bacteria 5444
683 Ga0207428_10000164 3300027907 Bacteria 91968
684 Ga0207428_10000391 3300027907 Bacteria 54825
685 Ga0265357_1000580 3300028023 Bacteria 2230
686 Ga0268266_10002016 3300028379 Bacteria 22644
687 Ga0268266_10077802 3300028379 Bacteria 2885
688 Ga0268266_10112988 3300028379 Bacteria 2408
689 Ga0268266_10128151 3300028379 Bacteria 2267
690 Ga0268266_10203354 3300028379 Bacteria 1813
691 Ga0268266_10499031 3300028379 Bacteria 1162
692 Ga0268265_10004025 3300028380 Bacteria 10352
693 Ga0268265_10079812 3300028380 Bacteria 2578
694 Ga0268264_10000174 3300028381 Bacteria 137254
695 Ga0268264_10049152 3300028381 Bacteria 3508
696 Ga0268264_10146243 3300028381 Bacteria 2114
697 Ga0307517_10000859 3300028786 Bacteria 51881
698 Ga0307515_10028873 3300028794 Bacteria 9406
699 Ga0265338_10059137 3300028800 Bacteria 3378
700 Ga0307511_10032093 3300030521 Bacteria 4676
701 Ga0265770_1032542 3300030878 Bacteria 880
702 Ga0265330_10020221 3300031235 Bacteria 3042
703 Ga0265330_10031054 3300031235 Bacteria 2395
704 Ga0265330_10067423 3300031235 Bacteria 1550
705 Ga0265332_10006382 3300031238 Bacteria 5348
706 Ga0265328_10043351 3300031239 Bacteria 1655
707 Ga0265325_10000019 3300031241 Bacteria 125265
708 Ga0265325_10003263 3300031241 Bacteria 10664
709 Ga0265325_10028164 3300031241 Bacteria 3031
710 Ga0265340_10018122 3300031247 Bacteria 3635
711 Ga0265340_10036658 3300031247 Bacteria 2430
712 Ga0265339_10001912 3300031249 Bacteria 15282
713 Ga0265331_10190616 3300031250 Bacteria 925
714 Ga0265316_10067912 3300031344 Bacteria 2756
715 Ga0307509_10006398 3300031507 Bacteria 15864
716 Ga0307509_10274632 3300031507 Bacteria 1451
717 Ga0265313_10019302 3300031595 Bacteria 3797
718 Ga0265313_10022283 3300031595 Bacteria 3440
719 Ga0265313_10024531 3300031595 Bacteria 3219
720 Ga0265313_10112428 3300031595 Bacteria 1196
721 Ga0307508_10000063 3300031616 Bacteria 122536
722 Ga0307508_10056441 3300031616 Bacteria 3477
723 Ga0307508_10175540 3300031616 Bacteria 1746
724 Ga0316579_10019886 3300031691 Bacteria 2971
725 Ga0265314_10003648 3300031711 Bacteria 14810
726 Ga0265314_10039492 3300031711 Bacteria 3398
727 Ga0265314_10176733 3300031711 Bacteria 1283
728 Ga0265342_10001257 3300031712 Bacteria 23945
729 Ga0265342_10005406 3300031712 Bacteria 9751
730 Ga0265342_10122647 3300031712 Bacteria 1462
731 Ga0307516_10043872 3300031730 Bacteria 4428
732 Ga0307413_10038231 3300031824 Bacteria 2780
733 Ga0307410_10143559 3300031852 Bacteria 1769
734 Ga0307406_10132490 3300031901 Bacteria 1752
735 Ga0307507_10125921 3300033179 Bacteria 2027
736 Ga0307507_10150631 3300033179 Bacteria 1751
737 Ga0307510_10126787 3300033180 Bacteria 2239
738 Ga0307510_10152035 3300033180 Bacteria 1931
739 Ga0315911_1000040 3300033442 Bacteria 50766
740 Ga0316213_1002509 3300033546 Bacteria 1235
741 Ga0373930_0008599 3300034816 Bacteria 1788
742 Ga0373959_0012771 3300034820 Bacteria 1505
743 Ga0373959_0023004 3300034820 Unclassified 1209
744 Ga0373938_0006998 3300034957 Bacteria 1971
745 Ga0373926_0000388 3300035083 Bacteria 11245
746 Ga0373926_0011522 3300035083 Bacteria 2976
747 Ga0373929_0004760 3300035085 Unclassified 2433
748 Ga0373934_0047916 3300035086 Bacteria 1691
749 Ga0373934_0053221 3300035086 Bacteria 1605
750 Ga0373934_0084179 3300035086 Unclassified 1279
751 Ga0373940_0027412 3300035088 Bacteria 1497
752 Ga0373944_0002538 3300035089 Bacteria 4637
753 Ga0373949_0006564 3300035090 Plasmid 2559
754 Ga0373949_0022292 3300035090 Bacteria 1459
755 Ga0373951_0031325 3300035091 Bacteria 1254
756 Ga0373952_0000933 3300035092 Bacteria 5313
757 Ga0373923_0003867 3300035111 Bacteria 4879
758 Ga0373923_0043642 3300035111 Bacteria 1856
759 Ga0373923_0049887 3300035111 Bacteria 1751
760 Ga0373932_0003751 3300035112 Bacteria 3626
761 Ga0373932_0020639 3300035112 Unclassified 1730
762 Ga0373936_0006062 3300035113 Bacteria 4555
763 Ga0373936_0053213 3300035113 Bacteria 1641
764 Ga0373936_0054051 3300035113 Bacteria 1629
765 Ga0373936_0104471 3300035113 Bacteria 1198
766 Ga0373939_0002641 3300035114 Bacteria 4207
767 Ga0373939_0003090 3300035114 Bacteria 3908
768 Ga0373939_0062364 3300035114 Bacteria 1191
769 Ga0373939_0069899 3300035114 Bacteria 1140
770 Ga0373941_0014083 3300035115 Unclassified 2130
771 Ga0373945_0007291 3300035116 Bacteria 3581
772 Ga0373945_0011447 3300035116 Plasmid 2934
773 Ga0373953_0012482 3300035117 Bacteria 3010
774 Ga0373953_0018244 3300035117 Plasmid 2594
775 Ga0373953_0051706 3300035117 Bacteria 1662
776 Ga0373954_0001219 3300035118 Bacteria 10343
777 Ga0373954_0008152 3300035118 Bacteria 4590
778 Ga0373954_0031320 3300035118 Bacteria 2455
779 Ga0373956_0004720 3300035119 Bacteria 5448
780 Ga0373956_0025442 3300035119 Plasmid 2558
781 Ga0373957_0003464 3300035120 Bacteria 4665
782 Ga0373957_0010097 3300035120 Bacteria 3109
783 Ga0373957_0053731 3300035120 Bacteria 1546
784 Ga0373957_0103774 3300035120 Bacteria 1140
785 Ga0373943_0001607 3300035170 Bacteria 10243
786 Ga0373943_0028008 3300035170 Bacteria 2652
787 Ga0373943_0033149 3300035170 Bacteria 2458
788 Ga0373943_0101921 3300035170 Bacteria 1503
789 Ga0373943_0165362 3300035170 Bacteria 1207
790 Ga0373943_0214025 3300035170 Bacteria 1071
791 Ga0373946_0020904 3300035171 Bacteria 2533
792 Ga0373946_0027110 3300035171 Bacteria 2264
793 Ga0373946_0075376 3300035171 Bacteria 1466
794 Ga0373946_0101738 3300035171 Bacteria 1289
795 Ga0373955_0002049 3300035172 Bacteria 8671
796 Ga0373955_0005330 3300035172 Bacteria 5775
797 Ga0373955_0012895 3300035172 Plasmid 4029
798 Ga0373955_0323138 3300035172 Bacteria 932
799 Ga0373942_0006671 3300035207 Plasmid 2666
800 Ga0373942_0031660 3300035207 Bacteria 1400
801 Ga0373961_0002775 3300035241 Bacteria 4466
802 Ga0373924_0014698 3300035410 Bacteria 2961
803 Ga0373931_0002611 3300035691 Bacteria 8014
804 Ga0373931_0006487 3300035691 Bacteria 5467
805 Ga0373931_0305503 3300035691 Bacteria 984
806 Ga0373931_0344444 3300035691 Bacteria 931
807 Ga0373935_0000942 3300035692 Bacteria 15748
808 Ga0373935_0027111 3300035692 Bacteria 3541
809 Ga0373935_0042617 3300035692 Plasmid 2855
810 Ga0373935_0051264 3300035692 Bacteria 2621
811 Ga0373935_0057366 3300035692 Bacteria 2484
812 Ga0373935_0057406 3300035692 Unclassified 2483
813 Ga0373935_0121844 3300035692 Bacteria 1743
814 Ga0373935_0196235 3300035692 Bacteria 1393
815 Ga0373935_0439570 3300035692 Bacteria 941
816 Ga0373927_0000528 3300035695 Bacteria 29016
817 Ga0373927_0021674 3300035695 Bacteria 4210
818 Ga0373927_0030902 3300035695 Bacteria 3494
819 Ga0373927_0035067 3300035695 Bacteria 3262
820 Ga0373927_0041261 3300035695 Plasmid 2993
821 Ga0373927_0066975 3300035695 Bacteria 2323
822 Ga0373927_0148674 3300035695 Bacteria 1534
823 Ga0373927_0214174 3300035695 Bacteria 1265
824 Ga0373927_0227121 3300035695 Bacteria 1226
825 Ga0373927_0297623 3300035695 Bacteria 1062
826 Ga0373933_0000204 3300035724 Bacteria 39417
827 Ga0373933_0002658 3300035724 Bacteria 10013
828 Ga0373933_0010853 3300035724 Bacteria 4999
829 Ga0373933_0034817 3300035724 Plasmid 2937
830 Ga0373933_0077067 3300035724 Bacteria 2037
831 Ga0373933_0090111 3300035724 Bacteria 1891
832 Ga0373933_0188029 3300035724 Bacteria 1319
833 Ga0373933_0293051 3300035724 Bacteria 1052
834 Ga0373947_0000455 3300035725 Bacteria 23308
835 Ga0373947_0003382 3300035725 Bacteria 9440
836 Ga0373947_0026670 3300035725 Bacteria 3379
837 Ga0373947_0067145 3300035725 Bacteria 2190
838 Ga0373947_0078436 3300035725 Bacteria 2039
839 Ga0373947_0101412 3300035725 Bacteria 1809
840 Ga0373947_0225609 3300035725 Bacteria 1233
841 Ga0373937_0008188 3300036401 Bacteria 9080
842 Ga0373937_0021334 3300036401 Bacteria 5814
843 Ga0373937_0194847 3300036401 Unclassified 1904
844 Ga0372808_001169 3300036459 Bacteria 2608
845 Ga0316582_0023146 3300036647 Bacteria 3699
846 Ga0373925_0001434 3300037068 Bacteria 20657
847 Ga0373925_0003563 3300037068 Bacteria 12000
848 Ga0373925_0011034 3300037068 Bacteria 6561
849 Ga0373925_0015076 3300037068 Bacteria 5586
850 Ga0373925_0104455 3300037068 Bacteria 2182
851 Ga0373925_0120167 3300037068 Bacteria 2039
852 Ga0373925_0130934 3300037068 Bacteria 1956
853 Ga0373925_0170838 3300037068 Bacteria 1716
854 Ga0373925_0313178 3300037068 Bacteria 1269
855 Ga0395900_0033975 3300037418 Bacteria 5249
856 Ga0395900_0357002 3300037418 Bacteria 1434
857 Ga0395900_0556389 3300037418 Bacteria 1091
858 Ga0395898_0092172 3300037466 Bacteria 2914
859 Ga0395905_0026848 3300037471 Bacteria 5431
860 Ga0436364_0100847 3300037853 Bacteria 1285
861 Ga0436364_1119586 3300037853 Bacteria 13727
862 Ga0395901_0065664 3300038443 Bacteria 3779
863 Ga0395901_0086125 3300038443 Bacteria 3285
864 Ga0395901_0165542 3300038443 Bacteria 2322
865 Ga0395901_0575766 3300038443 Bacteria 1138
866 Ga0436365_1490250 3300039437 Bacteria 1332
867 Ga0436360_0675457 3300039438 Bacteria 2922
868 Ga0436361_0576775 3300039447 Bacteria 2868
869 Ga0436361_0681610 3300039447 Bacteria 2846
870 Ga0436363_1060587 3300039450 Bacteria 6258
871 Ga0436362_0124208 3300039453 Bacteria 3179
872 Ga0466969_0014448 3300044656 Bacteria 4152
873 Ga0466972_0103734 3300044658 Bacteria 1345
874 Ga0466966_0001614 3300044684 Bacteria 14525
875 Ga0466966_0272714 3300044684 Bacteria 1018
876 Ga0466961_0000192 3300044693 Bacteria 40922
877 Ga0466963_0019050 3300044694 Bacteria 4298
878 Ga0466963_0031458 3300044694 Bacteria 3430
879 Ga0466964_0025350 3300044706 Bacteria 2315
880 Ga0466971_0060412 3300044719 Bacteria 1713
881 Ga0466968_0032806 3300044735 Bacteria 2161
882 Ga0466957_0140210 3300044842 Bacteria 1557
883 Ga0466959_0000934 3300045049 Bacteria 17340
884 Ga0466959_0008049 3300045049 Bacteria 7429
885 Ga0466959_0058009 3300045049 Bacteria 2821
886 Ga0466959_0062872 3300045049 Bacteria 2697
887 Ga0466967_0023977 3300045976 Bacteria 5009
888 Ga0466967_0094324 3300045976 Bacteria 2725
889 Ga0466967_0242814 3300045976 Bacteria 1718
890 Ga0466967_0838598 3300045976 Bacteria 913
891 Ga0495592_0021465 3300046454 Bacteria 4910
892 Ga0495592_0032569 3300046454 Bacteria 3932
893 Ga0495592_0038867 3300046454 Bacteria 3577
894 Ga0495592_0087914 3300046454 Bacteria 2234
895 Ga0495603_0000239 3300046455 Bacteria 28578
896 Ga0495603_0015374 3300046455 Bacteria 4631
897 Ga0495603_0017749 3300046455 Bacteria 4307
898 Ga0495603_0072211 3300046455 Bacteria 2028
899 Ga0495590_0116445 3300046457 Bacteria 956
900 Ga0495629_0000139 3300046459 Bacteria 63649
901 Ga0495629_0000457 3300046459 Bacteria 34088
902 Ga0495629_0007972 3300046459 Bacteria 7791
903 Ga0495629_0029920 3300046459 Bacteria 3860
904 Ga0495629_0051611 3300046459 Bacteria 2878
905 Ga0495629_0096371 3300046459 Bacteria 2064
906 Ga0495629_0150450 3300046459 Bacteria 1618
907 Ga0495629_0163427 3300046459 Bacteria 1546
908 Ga0495629_0225033 3300046459 Unclassified 1293
909 Ga0495641_0002157 3300046461 Bacteria 15774
910 Ga0495641_0029301 3300046461 Bacteria 2653
911 Ga0495651_0004984 3300046462 Bacteria 10144
912 Ga0495651_0014000 3300046462 Bacteria 6203
913 Ga0495651_0017171 3300046462 Bacteria 5607
914 Ga0495651_0037984 3300046462 Bacteria 3749
915 Ga0495651_0054995 3300046462 Bacteria 3058
916 Ga0495651_0166592 3300046462 Bacteria 1573
917 Ga0495653_0004257 3300046463 Bacteria 11596
918 Ga0495653_0009797 3300046463 Bacteria 7835
919 Ga0495653_0235853 3300046463 Bacteria 1222
920 Ga0495580_0002960 3300046472 Bacteria 14585
921 Ga0495580_0009072 3300046472 Bacteria 7845
922 Ga0495580_0009091 3300046472 Bacteria 7837
923 Ga0495582_0000077 3300046473 Bacteria 49112
924 Ga0495582_0001850 3300046473 Bacteria 11944
925 Ga0495582_0038297 3300046473 Bacteria 2638
926 Ga0495582_0258275 3300046473 Bacteria 999
927 Ga0495605_0057694 3300046474 Bacteria 1868
928 Ga0495605_0154703 3300046474 Bacteria 1021
929 Ga0495639_0000101 3300046475 Bacteria 42348
930 Ga0495639_0012036 3300046475 Bacteria 3730
931 Ga0495662_0012510 3300046476 Bacteria 4140
932 Ga0495662_0051472 3300046476 Bacteria 1988
933 Ga0495664_0038052 3300046477 Plasmid 2839
934 Ga0495664_0041464 3300046477 Bacteria 2724
935 Ga0495664_0044789 3300046477 Bacteria 2622
936 Ga0495584_0001897 3300046491 Bacteria 12061
937 Ga0495584_0039510 3300046491 Bacteria 2384
938 Ga0495585_0001030 3300046492 Bacteria 23180
939 Ga0495585_0158482 3300046492 Bacteria 1176
940 Ga0495594_0005795 3300046499 Bacteria 6340
941 Ga0495594_0127044 3300046499 Bacteria 1443
942 Ga0495594_0243805 3300046499 Bacteria 1024
943 Ga0495607_0006002 3300046501 Bacteria 8613
944 Ga0495606_0000357 3300046507 Bacteria 78015
945 Ga0495606_0014109 3300046507 Bacteria 6257
946 Ga0495608_0000911 3300046511 Bacteria 20725
947 Ga0495608_0004649 3300046511 Bacteria 9811
948 Ga0495608_0061364 3300046511 Bacteria 2472
949 Ga0495608_0110421 3300046511 Bacteria 1768
950 Ga0495608_0188827 3300046511 Bacteria 1302
951 Ga0495618_0003586 3300046514 Bacteria 9613
952 Ga0495618_0014258 3300046514 Bacteria 4840
953 Ga0495618_0021739 3300046514 Bacteria 3955
954 Ga0495618_0089816 3300046514 Bacteria 1965
955 Ga0495618_0119090 3300046514 Bacteria 1691
956 Ga0495618_0136315 3300046514 Bacteria 1570
957 Ga0495620_0071983 3300046515 Bacteria 1412
958 Ga0495620_0078633 3300046515 Bacteria 1337
959 Ga0495628_0005614 3300046516 Bacteria 10985
960 Ga0495628_0105477 3300046516 Bacteria 2171
961 Ga0495628_0157361 3300046516 Unclassified 1728
962 Ga0495628_0282913 3300046516 Bacteria 1231
963 Ga0495630_0012819 3300046517 Bacteria 6092
964 Ga0495630_0047522 3300046517 Bacteria 3210
965 Ga0495630_0281866 3300046517 Bacteria 1270
966 Ga0495631_0126651 3300046518 Bacteria 1098
967 Ga0495643_0028502 3300046522 Bacteria 3129
968 Ga0495644_0000513 3300046523 Bacteria 16576
969 Ga0495644_0050156 3300046523 Bacteria 1567
970 Ga0495648_0000897 3300046524 Bacteria 31152
971 Ga0495648_0007226 3300046524 Bacteria 8920
972 Ga0495648_0012169 3300046524 Bacteria 6436
973 Ga0495648_0092889 3300046524 Bacteria 1684
974 Ga0495648_0109736 3300046524 Bacteria 1504
975 Ga0495663_0002372 3300046525 Bacteria 5672
976 Ga0495666_0168340 3300046526 Unclassified 1014
977 Ga0495652_0021917 3300046529 Bacteria 5680
978 Ga0495652_0028137 3300046529 Bacteria 4950
979 Ga0495652_0046433 3300046529 Bacteria 3729
980 Ga0495652_0070477 3300046529 Bacteria 2921
981 Ga0495652_0076180 3300046529 Bacteria 2783
982 Ga0495652_0270423 3300046529 Bacteria 1249
983 Ga0495665_0000055 3300046531 Bacteria 45208
984 Ga0495665_0026195 3300046531 Bacteria 3132
985 Ga0495640_0011661 3300046533 Bacteria 6748
986 Ga0495640_0024673 3300046533 Bacteria 4371
987 Ga0495640_0043321 3300046533 Bacteria 3135
988 Ga0495640_0046767 3300046533 Bacteria 2996
989 Ga0495640_0053786 3300046533 Plasmid 2759
990 Ga0495640_0092694 3300046533 Bacteria 1992
991 Ga0495586_0046428 3300046535 Bacteria 2342
992 Ga0495587_0005897 3300046536 Bacteria 7984
993 Ga0495587_0015897 3300046536 Bacteria 4687
994 Ga0495587_0094947 3300046536 Unclassified 1721
995 Ga0495587_0134777 3300046536 Bacteria 1411
996 Ga0495587_0301376 3300046536 Bacteria 896
997 Ga0495598_0045979 3300046537 Bacteria 1296
998 Ga0495609_0017406 3300046538 Bacteria 3337
999 Ga0495609_0085365 3300046538 Bacteria 1377
1000 Ga0495609_0137657 3300046538 Bacteria 1043
1001 Ga0495597_0028153 3300046542 Bacteria 2573
1002 Ga0495645_0011340 3300046543 Bacteria 6268
1003 Ga0495645_0061920 3300046543 Bacteria 2711
1004 Ga0495645_0115470 3300046543 Bacteria 1896
1005 Ga0495645_0120887 3300046543 Bacteria 1844
1006 Ga0495622_0002233 3300046557 Bacteria 9422
1007 Ga0495622_0033493 3300046557 Bacteria 2397
1008 Ga0495622_0055262 3300046557 Bacteria 1841
1009 Ga0495622_0057388 3300046557 Bacteria 1805
1010 Ga0495622_0078894 3300046557 Bacteria 1516
1011 Ga0495622_0101465 3300046557 Bacteria 1319
1012 Ga0495633_0024926 3300046558 Bacteria 2950
1013 Ga0495667_0010518 3300046559 Bacteria 6261
1014 Ga0495667_0021423 3300046559 Bacteria 4361
1015 Ga0495667_0023279 3300046559 Bacteria 4173
1016 Ga0495667_0038378 3300046559 Bacteria 3189
1017 Ga0495667_0048600 3300046559 Bacteria 2801
1018 Ga0495667_0096798 3300046559 Unclassified 1910
1019 Ga0495656_0000091 3300046615 Bacteria 38995
1020 Ga0495656_0006841 3300046615 Bacteria 4008
1021 Ga0495668_0083718 3300046616 Bacteria 1749
1022 Ga0495634_0001036 3300046642 Bacteria 26033
1023 Ga0495634_0063846 3300046642 Bacteria 2443
1024 Ga0495634_0069546 3300046642 Bacteria 2322
1025 Ga0495634_0084757 3300046642 Bacteria 2066
1026 Ga0495634_0110477 3300046642 Bacteria 1768
1027 Ga0495611_0007030 3300046648 Bacteria 4781
1028 Ga0495611_0087470 3300046648 Bacteria 1438
1029 Ga0495625_0030051 3300046660 Bacteria 4057
1030 Ga0495625_0066315 3300046660 Bacteria 2543
1031 Ga0495635_0000815 3300046663 Bacteria 20434
1032 Ga0495635_0004810 3300046663 Bacteria 9387
1033 Ga0495635_0011194 3300046663 Bacteria 6289
1034 Ga0495635_0029736 3300046663 Bacteria 3799
1035 Ga0495635_0093114 3300046663 Bacteria 2060
1036 Ga0495659_0000632 3300046664 Bacteria 12804
1037 Ga0495659_0122405 3300046664 Bacteria 1025
1038 Ga0495661_0010120 3300046665 Bacteria 6448
1039 Ga0495661_0048855 3300046665 Bacteria 2569
1040 Ga0495588_0005058 3300046674 Bacteria 5855
1041 Ga0495588_0005077 3300046674 Bacteria 5848
1042 Ga0495588_0015996 3300046674 Bacteria 3620
1043 Ga0495657_0003079 3300046675 Bacteria 13781
1044 Ga0495657_0004591 3300046675 Bacteria 11023
1045 Ga0495657_0019481 3300046675 Bacteria 4894
1046 Ga0495657_0034720 3300046675 Bacteria 3500
1047 Ga0495657_0194463 3300046675 Bacteria 1238
1048 Ga0495599_0001945 3300046678 Bacteria 11972
1049 Ga0495599_0028704 3300046678 Bacteria 3486
1050 Ga0495599_0053717 3300046678 Bacteria 2524
1051 Ga0495623_0002783 3300046679 Bacteria 11540
1052 Ga0495623_0020870 3300046679 Bacteria 4233
1053 Ga0495623_0233769 3300046679 Bacteria 1041
1054 Ga0495646_0001642 3300046680 Bacteria 13342
1055 Ga0495646_0014188 3300046680 Bacteria 5065
1056 Ga0495646_0022610 3300046680 Bacteria 3965
1057 Ga0495646_0060647 3300046680 Bacteria 2255
1058 Ga0495646_0119405 3300046680 Bacteria 1493
1059 Ga0495647_0002436 3300046681 Bacteria 5863
1060 Ga0495647_0010626 3300046681 Bacteria 3138
1061 Ga0495647_0019267 3300046681 Bacteria 2438
1062 Ga0495647_0074495 3300046681 Bacteria 1365
1063 Ga0495647_0081217 3300046681 Bacteria 1315
1064 Ga0495658_0000065 3300046683 Bacteria 52835
1065 Ga0495658_0008416 3300046683 Bacteria 5112
1066 Ga0495658_0066140 3300046683 Bacteria 2087
1067 Ga0495658_0365868 3300046683 Bacteria 917
1068 Ga0495613_0003480 3300046689 Bacteria 11777
1069 Ga0495613_0010328 3300046689 Bacteria 6934
1070 Ga0495613_0078788 3300046689 Unclassified 2396
1071 Ga0495613_0092005 3300046689 Bacteria 2196
1072 Ga0495613_0284765 3300046689 Bacteria 1147
1073 Ga0495624_0000235 3300046690 Bacteria 43165
1074 Ga0495624_0050807 3300046690 Plasmid 2625
1075 Ga0495624_0136811 3300046690 Bacteria 1501
1076 Ga0495670_0000199 3300046691 Bacteria 26898
1077 Ga0495670_0090418 3300046691 Bacteria 1566
1078 Ga0495671_0092637 3300046692 Bacteria 1479
1079 Ga0495671_0202048 3300046692 Bacteria 964
1080 Ga0495649_0015557 3300046694 Bacteria 4328
1081 Ga0495649_0152989 3300046694 Bacteria 1211
1082 Ga0495589_0021779 3300046794 Bacteria 3275
1083 Ga0495600_0012719 3300046809 Bacteria 5268
1084 Ga0495600_0015147 3300046809 Bacteria 4871
1085 Ga0495600_0030346 3300046809 Bacteria 3502
1086 Ga0495581_0000041 3300047315 Bacteria 46518
1087 Ga0495581_0022819 3300047315 Bacteria 3625
1088 Ga0495581_0024475 3300047315 Plasmid 3499
1089 Ga0495604_0007221 3300047317 Bacteria 8800
1090 Ga0495604_0056249 3300047317 Bacteria 3029
1091 Ga0495604_0070109 3300047317 Bacteria 2655
1092 Ga0495604_0086405 3300047317 Bacteria 2338
1093 Ga0495604_0106288 3300047317 Bacteria 2053
1094 Ga0495604_0203136 3300047317 Bacteria 1373
1095 Ga0495636_0046361 3300047318 Unclassified 1813
1096 Ga0495674_0001192 3300047319 Bacteria 25126
1097 Ga0495674_0028002 3300047319 Bacteria 5145
1098 Ga0495674_0047281 3300047319 Bacteria 3816
1099 Ga0495674_0051263 3300047319 Bacteria 3638
1100 Ga0495674_0320433 3300047319 Bacteria 1263
1101 Ga0495674_0326857 3300047319 Bacteria 1248
1102 Ga0495672_0037589 3300047320 Bacteria 2960
1103 Ga0495676_0018550 3300047321 Bacteria 6135
1104 Ga0495676_0100156 3300047321 Bacteria 2146
1105 Ga0495676_0403146 3300047321 Bacteria 907
1106 Ga0495680_0012071 3300047322 Bacteria 7622
1107 Ga0495680_0017326 3300047322 Bacteria 6156
1108 Ga0495680_0017765 3300047322 Bacteria 6056
1109 Ga0495680_0043618 3300047322 Bacteria 3549
1110 Ga0495687_050067 3300047443 Bacteria 1782
1111 Ga0495675_0040948 3300047444 Bacteria 2952
1112 Ga0495675_0152222 3300047444 Unclassified 1428
1113 Ga0495679_028585 3300047446 Unclassified 1828
1114 Ga0495673_0010425 3300047469 Bacteria 5053
1115 Ga0495673_0025589 3300047469 Bacteria 2830
1116 Ga0495684_0001073 3300047471 Bacteria 22129
1117 Ga0495684_0001399 3300047471 Bacteria 19329
1118 Ga0495684_0039273 3300047471 Bacteria 3628
1119 Ga0495684_0052644 3300047471 Bacteria 3106
1120 Ga0495684_0075698 3300047471 Bacteria 2557
1121 Ga0495684_0116868 3300047471 Unclassified 2011
1122 Ga0495686_0060885 3300047472 Bacteria 2346
1123 Ga0495686_0062790 3300047472 Bacteria 2303
1124 Ga0495686_0085485 3300047472 Bacteria 1921
1125 Ga0495686_0136095 3300047472 Bacteria 1453
1126 Ga0495686_0237214 3300047472 Bacteria 1030
1127 Ga0495593_0000024 3300047673 Bacteria 65718
1128 Ga0495593_0002018 3300047673 Bacteria 12102
1129 Ga0495593_0003557 3300047673 Bacteria 9320
1130 Ga0495593_0004938 3300047673 Bacteria 7905
1131 Ga0495593_0052823 3300047673 Bacteria 2146
1132 Ga0495593_0055700 3300047673 Bacteria 2080
1133 Ga0495602_0019419 3300048088 Bacteria 6748
1134 Ga0495602_0027637 3300048088 Bacteria 5449
1135 Ga0495602_0035012 3300048088 Bacteria 4687
1136 Ga0495602_0085186 3300048088 Bacteria 2642
1137 Ga0495614_0059008 3300048089 Bacteria 1648
1138 Ga0495615_0051171 3300048090 Bacteria 1064
1139 Ga0496100_0071720 3300048903 Bacteria 2313
1140 Ga0496101_0005706 3300048904 Bacteria 7948
1141 Ga0496101_0017665 3300048904 Bacteria 4839
1142 Ga0496101_0046113 3300048904 Plasmid 3125
1143 Ga0496101_0106497 3300048904 Bacteria 2105
1144 Ga0496101_0173978 3300048904 Bacteria 1655
1145 Ga0496101_0417516 3300048904 Bacteria 1057
1146 Ga0496102_0014041 3300048905 Bacteria 6955
1147 Ga0496102_0017084 3300048905 Bacteria 6351
1148 Ga0496102_0022366 3300048905 Bacteria 5601
1149 Ga0496102_0067126 3300048905 Bacteria 3289
1150 Ga0496102_0244050 3300048905 Bacteria 1694
1151 Ga0496103_0013626 3300048906 Bacteria 4823
1152 Ga0496103_0037032 3300048906 Bacteria 2989
1153 Ga0496103_0155467 3300048906 Bacteria 1466
1154 Ga0496103_0176854 3300048906 Bacteria 1371
1155 Ga0496103_0199908 3300048906 Bacteria 1285
1156 Ga0496104_0007787 3300048907 Bacteria 9493
1157 Ga0496104_0037009 3300048907 Bacteria 4563
1158 Ga0496104_0065417 3300048907 Bacteria 3450
1159 Ga0496104_0088068 3300048907 Bacteria 2965
1160 Ga0496104_0182742 3300048907 Bacteria 2007
1161 Ga0496104_0186109 3300048907 Bacteria 1987
1162 Ga0496104_0187277 3300048907 Bacteria 1980
1163 Ga0496104_0303283 3300048907 Bacteria 1509
1164 Ga0496104_0322350 3300048907 Bacteria 1458
1165 Ga0496104_0362524 3300048907 Bacteria 1362
1166 Ga0496105_0011205 3300048908 Bacteria 7074
1167 Ga0496105_0013422 3300048908 Bacteria 6502
1168 Ga0496105_0015800 3300048908 Bacteria 6022
1169 Ga0496105_0019532 3300048908 Bacteria 5467
1170 Ga0496105_0034013 3300048908 Bacteria 4190
1171 Ga0496105_0062282 3300048908 Bacteria 3078
1172 Ga0496105_0175327 3300048908 Bacteria 1756
1173 Ga0496105_0291129 3300048908 Unclassified 1314
1174 Ga0496106_0003446 3300048909 Bacteria 11782
1175 Ga0496106_0006865 3300048909 Bacteria 8425
1176 Ga0496106_0007383 3300048909 Bacteria 8123
1177 Ga0496106_0017314 3300048909 Bacteria 5335
1178 Ga0496106_0031297 3300048909 Bacteria 3964
1179 Ga0496106_0058706 3300048909 Bacteria 2913
1180 Ga0496106_0094631 3300048909 Bacteria 2310
1181 Ga0496106_0130932 3300048909 Bacteria 1967
1182 Ga0496106_0158517 3300048909 Bacteria 1789
1183 Ga0496107_0000509 3300048910 Bacteria 21565
1184 Ga0496107_0034178 3300048910 Bacteria 3640
1185 Ga0496107_0037811 3300048910 Bacteria 3464
1186 Ga0496107_0037820 3300048910 Bacteria 3464
1187 Ga0496108_0039234 3300048911 Bacteria 3948
1188 Ga0496108_0070491 3300048911 Bacteria 2950
1189 Ga0496108_0101833 3300048911 Bacteria 2450
1190 Ga0496108_0141329 3300048911 Bacteria 2074
1191 Ga0496108_0159941 3300048911 Bacteria 1946
1192 Ga0496109_0020639 3300048912 Bacteria 5820
1193 Ga0496109_0051292 3300048912 Bacteria 3758
1194 Ga0496109_0074608 3300048912 Bacteria 3118
1195 Ga0496109_0082674 3300048912 Bacteria 2960
1196 Ga0496109_0086401 3300048912 Plasmid 2896
1197 Ga0496109_0327342 3300048912 Bacteria 1446
1198 Ga0496110_0003123 3300048913 Bacteria 12580
1199 Ga0496110_0005741 3300048913 Bacteria 9749
1200 Ga0496110_0091790 3300048913 Bacteria 2717
1201 Ga0496110_0159652 3300048913 Bacteria 2043
1202 Ga0496110_0321195 3300048913 Bacteria 1410
1203 Ga0496110_0337214 3300048913 Bacteria 1373
1204 Ga0496111_0034236 3300048914 Bacteria 3626
1205 Ga0496111_0039373 3300048914 Plasmid 3388
1206 Ga0496111_0042463 3300048914 Bacteria 3265
1207 Ga0496111_0173154 3300048914 Bacteria 1604
1208 Ga0496111_0256530 3300048914 Bacteria 1297
1209 Ga0496112_0012582 3300048915 Bacteria 7776
1210 Ga0496112_0024108 3300048915 Bacteria 5823
1211 Ga0496112_0064719 3300048915 Bacteria 3608
1212 Ga0496112_0126632 3300048915 Bacteria 2525
1213 Ga0496112_0178060 3300048915 Bacteria 2090
1214 Ga0496112_0186684 3300048915 Bacteria 2036
1215 Ga0496112_0188030 3300048915 Bacteria 2028
1216 Ga0496112_0287838 3300048915 Bacteria 1589
1217 Ga0496112_0417522 3300048915 Bacteria 1281
1218 Ga0496113_0041662 3300048916 Bacteria 3389
1219 Ga0496113_0055757 3300048916 Bacteria 2964
1220 Ga0496113_0066166 3300048916 Bacteria 2736
1221 Ga0496113_0102680 3300048916 Bacteria 2217
1222 Ga0496113_0156050 3300048916 Bacteria 1802
1223 Ga0496113_0222184 3300048916 Bacteria 1505
1224 Ga0496113_0316048 3300048916 Unclassified 1251
1225 Ga0496114_0001306 3300048917 Bacteria 18867
1226 Ga0496114_0022402 3300048917 Bacteria 5149
1227 Ga0496114_0084963 3300048917 Bacteria 2680
1228 Ga0496114_0198573 3300048917 Bacteria 1756
1229 Ga0496114_0371093 3300048917 Bacteria 1266
1230 Ga0496115_0001250 3300048918 Bacteria 18240
1231 Ga0496115_0023466 3300048918 Bacteria 4788
1232 Ga0496115_0056055 3300048918 Bacteria 3167
1233 Ga0496115_0098174 3300048918 Unclassified 2398
1234 Ga0496115_0116508 3300048918 Bacteria 2197
1235 Ga0496115_0146012 3300048918 Bacteria 1952
1236 Ga0496115_0179206 3300048918 Bacteria 1752
1237 Ga0496117_0017488 3300048920 Bacteria 5986
1238 Ga0496117_0062933 3300048920 Bacteria 2539
1239 Ga0496118_0020990 3300048921 Bacteria 5768
1240 Ga0496118_0039136 3300048921 Bacteria 3788
1241 Ga0496118_0077455 3300048921 Bacteria 2358
1242 Ga0496118_0251433 3300048921 Bacteria 1004
1243 Ga0496119_0040669 3300048922 Bacteria 2970
1244 Ga0496119_0042593 3300048922 Bacteria 2877
1245 Ga0496119_0057347 3300048922 Bacteria 2353
1246 Ga0496119_0099423 3300048922 Bacteria 1636
1247 Ga0496119_0138407 3300048922 Unclassified 1318
1248 Ga0496120_0013345 3300048923 Bacteria 5538
1249 Ga0496121_0000927 3300048924 Bacteria 53016
1250 Ga0496121_0007064 3300048924 Bacteria 13633
1251 Ga0496121_0010667 3300048924 Bacteria 10315
1252 Ga0496121_0015737 3300048924 Bacteria 7882
1253 Ga0496121_0061566 3300048924 Bacteria 3079
1254 Ga0496121_0155804 3300048924 Bacteria 1676
1255 Ga0496121_0205975 3300048924 Bacteria 1397
1256 Ga0496121_0209073 3300048924 Bacteria 1384
1257 Ga0496121_0256326 3300048924 Bacteria 1210
1258 Ga0496124_0049273 3300048927 Bacteria 3594
1259 Ga0496124_0058635 3300048927 Bacteria 3237
1260 Ga0496124_0061641 3300048927 Bacteria 3143
1261 Ga0496124_0240865 3300048927 Bacteria 1345
1262 Ga0496125_0042169 3300048928 Bacteria 3891
1263 Ga0496125_0063623 3300048928 Bacteria 2940
1264 Ga0496125_0121414 3300048928 Bacteria 1863
1265 Ga0496125_0304141 3300048928 Bacteria 975
1266 Ga0496126_0022004 3300048929 Bacteria 6214
1267 Ga0496126_0027336 3300048929 Bacteria 5451
1268 Ga0496126_0035592 3300048929 Bacteria 4665
1269 Ga0496126_0103819 3300048929 Bacteria 2483
1270 Ga0496126_0135129 3300048929 Bacteria 2128
1271 Ga0496126_0135967 3300048929 Bacteria 2120
1272 Ga0496126_0202331 3300048929 Bacteria 1676
1273 Ga0496126_0232203 3300048929 Bacteria 1545
1274 Ga0496126_0234965 3300048929 Bacteria 1534
1275 Ga0496126_0350508 3300048929 Bacteria 1207
1276 Ga0496126_0398398 3300048929 Bacteria 1117
1277 Ga0495682_0019019 3300049460 Bacteria 2585
1278 Ga0495682_0052153 3300049460 Bacteria 1487
1279 Ga0501031_0000398 3300049568 Bacteria 25392
1280 Ga0501031_0006934 3300049568 Bacteria 7396
1281 Ga0501031_0031248 3300049568 Bacteria 3473
1282 Ga0501032_0066313 3300049569 Bacteria 2412
1283 Ga0501032_0073505 3300049569 Bacteria 2277
1284 Ga0501032_0098657 3300049569 Bacteria 1935
1285 Ga0501033_0001316 3300049570 Bacteria 22076
1286 Ga0501033_0001463 3300049570 Bacteria 20932
1287 Ga0501033_0016180 3300049570 Bacteria 5648
1288 Ga0501033_0026599 3300049570 Bacteria 4352
1289 Ga0501033_0027952 3300049570 Bacteria 4239
1290 Ga0501033_0178464 3300049570 Bacteria 1523
1291 Ga0501033_0209494 3300049570 Bacteria 1390
1292 Ga0501034_0000072 3300049571 Bacteria 179824
1293 Ga0501034_0186662 3300049571 Bacteria 2036
1294 Ga0501034_0199578 3300049571 Bacteria 1959
1295 Ga0501034_0214716 3300049571 Bacteria 1878
1296 Ga0501034_0254182 3300049571 Bacteria 1701
1297 Ga0501034_0631845 3300049571 Bacteria 974
1298 Ga0501036_0000050 3300049572 Bacteria 75340
1299 Ga0501036_0023850 3300049572 Bacteria 5155
1300 Ga0501036_0027119 3300049572 Bacteria 4839
1301 Ga0501036_0109654 3300049572 Bacteria 2332
1302 Ga0501036_0220338 3300049572 Bacteria 1593
1303 Ga0501036_0253779 3300049572 Bacteria 1473
1304 Ga0501037_0000030 3300049573 Bacteria 136148
1305 Ga0501037_0019157 3300049573 Bacteria 5043
1306 Ga0501037_0040958 3300049573 Bacteria 3408
1307 Ga0501037_0067050 3300049573 Bacteria 2613
1308 Ga0501037_0158463 3300049573 Bacteria 1615
1309 Ga0501037_0196762 3300049573 Bacteria 1425
1310 Ga0501038_0000039 3300049574 Bacteria 122904
1311 Ga0501038_0003573 3300049574 Bacteria 14467
1312 Ga0501038_0003903 3300049574 Bacteria 13865
1313 Ga0501038_0019522 3300049574 Bacteria 6108
1314 Ga0501038_0064610 3300049574 Bacteria 3120
1315 Ga0501038_0087612 3300049574 Bacteria 2614
1316 Ga0501038_0120846 3300049574 Bacteria 2160
1317 Ga0501038_0179009 3300049574 Bacteria 1712
1318 Ga0501039_0000060 3300049575 Bacteria 85528
1319 Ga0501039_0003437 3300049575 Bacteria 11824
1320 Ga0501039_0006389 3300049575 Bacteria 8954
1321 Ga0501039_0049810 3300049575 Bacteria 3239
1322 Ga0501039_0069222 3300049575 Bacteria 2740
1323 Ga0501039_0120324 3300049575 Bacteria 2057
1324 Ga0501039_0170764 3300049575 Bacteria 1709
1325 Ga0501042_0008343 3300049578 Bacteria 6831
1326 Ga0501042_0040413 3300049578 Bacteria 3316
1327 Ga0501043_0000980 3300049579 Bacteria 25248
1328 Ga0501043_0003512 3300049579 Bacteria 12893
1329 Ga0501043_0015596 3300049579 Bacteria 5955
1330 Ga0501043_0112845 3300049579 Bacteria 2134
1331 Ga0501046_0000419 3300049580 Bacteria 42326
1332 Ga0501046_0002900 3300049580 Bacteria 15897
1333 Ga0501046_0022009 3300049580 Bacteria 5254
1334 Ga0501047_0000174 3300049581 Bacteria 79021
1335 Ga0501047_0012410 3300049581 Bacteria 8065
1336 Ga0501047_0019117 3300049581 Bacteria 6573
1337 Ga0501047_0031187 3300049581 Bacteria 5141
1338 Ga0501047_0172472 3300049581 Bacteria 2031
1339 Ga0501047_0181618 3300049581 Bacteria 1970
1340 Ga0501047_0316665 3300049581 Bacteria 1400
1341 Ga0501048_0000068 3300049582 Bacteria 53016
1342 Ga0501048_0017640 3300049582 Bacteria 5254
1343 Ga0501048_0323580 3300049582 Bacteria 1098
1344 Ga0501067_0000068 3300049583 Bacteria 59338
1345 Ga0501067_0003637 3300049583 Bacteria 8493
1346 Ga0501067_0007709 3300049583 Bacteria 5987
1347 Ga0501067_0111382 3300049583 Bacteria 1522
1348 Ga0501067_0131537 3300049583 Bacteria 1393
1349 Ga0501068_0000949 3300049584 Bacteria 15209
1350 Ga0501068_0002589 3300049584 Bacteria 9588
1351 Ga0501068_0003549 3300049584 Bacteria 8427
1352 Ga0501069_0035352 3300049585 Bacteria 2752
1353 Ga0501070_0025353 3300049586 Bacteria 4973
1354 Ga0501070_0039676 3300049586 Bacteria 3925
1355 Ga0501070_0256961 3300049586 Bacteria 1428
1356 Ga0501071_0131428 3300049587 Bacteria 1860
1357 Ga0501072_0035557 3300049588 Bacteria 3902
1358 Ga0501072_0221508 3300049588 Bacteria 1508
1359 Ga0501073_0000009 3300049589 Bacteria 195649
1360 Ga0501073_0010592 3300049589 Bacteria 6745
1361 Ga0501073_0162995 3300049589 Bacteria 1544
1362 Ga0501073_0450101 3300049589 Bacteria 890
1363 Ga0501074_0001057 3300049590 Bacteria 17986
1364 Ga0501074_0003293 3300049590 Bacteria 11426
1365 Ga0501074_0055835 3300049590 Bacteria 2845
1366 Ga0501077_0028394 3300049593 Bacteria 3556
1367 Ga0501079_0012968 3300049741 Bacteria 6357
1368 Ga0501079_0017176 3300049741 Bacteria 5525
1369 Ga0501079_0040305 3300049741 Bacteria 3602
1370 Ga0501080_0006205 3300049742 Bacteria 10727
1371 Ga0501080_0032682 3300049742 Bacteria 4854
1372 Ga0501080_0037424 3300049742 Bacteria 4532
1373 Ga0501080_0245242 3300049742 Bacteria 1634
1374 Ga0501080_0245636 3300049742 Bacteria 1633
1375 Ga0501083_0005994 3300049744 Bacteria 8609
1376 Ga0501083_0021673 3300049744 Bacteria 4462
1377 Ga0501083_0058662 3300049744 Bacteria 2575
1378 Ga0501035_0000067 3300049822 Bacteria 129204
1379 Ga0501035_0006796 3300049822 Bacteria 10687
1380 Ga0501035_0031489 3300049822 Bacteria 4830
1381 Ga0501035_0054807 3300049822 Bacteria 3561
1382 Ga0501035_0072940 3300049822 Bacteria 3037
1383 Ga0501035_0074309 3300049822 Bacteria 3007
1384 Ga0501035_0106024 3300049822 Bacteria 2464
1385 Ga0501035_0212386 3300049822 Bacteria 1655
1386 Ga0501035_0452169 3300049822 Bacteria 1062
1387 Ga0501044_0000258 3300049823 Bacteria 67161
1388 Ga0501044_0003604 3300049823 Bacteria 17424
1389 Ga0501044_0007503 3300049823 Bacteria 11997
1390 Ga0501044_0009609 3300049823 Bacteria 10525
1391 Ga0501044_0032713 3300049823 Bacteria 5466
1392 Ga0501044_0066602 3300049823 Bacteria 3671
1393 Ga0501044_0119538 3300049823 Bacteria 2637
1394 Ga0501044_0141974 3300049823 Bacteria 2390
1395 Ga0501044_0274006 3300049823 Bacteria 1622
1396 Ga0501044_0293875 3300049823 Bacteria 1555
1397 Ga0501044_0620766 3300049823 Bacteria 972
1398 Ga0501045_0012008 3300049824 Bacteria 6088
1399 Ga0501045_0043356 3300049824 Bacteria 3276
1400 nmdc:mga03n38_71327_c1 3300050490 Bacteria 1608
1401 nmdc:mga00v17_50262_c1 3300050491 Bacteria 2532
1402 nmdc:mga00v17_59291_c1 3300050491 Bacteria 2348
1403 nmdc:mga0yw44_100540_c1 3300050492 Bacteria 1842
1404 nmdc:mga0yw44_31880_c1 3300050492 Bacteria 3068
1405 nmdc:mga0yw44_47176_c1 3300050492 Bacteria 2591
1406 nmdc:mga0yw44_87286_c1 3300050492 Bacteria 1966
1407 nmdc:mga0k408_41185_c1 3300050493 Bacteria 2659
1408 nmdc:mga06z11_33296_c1 3300050494 Bacteria 2520
1409 nmdc:mga04h51_105902_c1 3300050495 Bacteria 1031
1410 nmdc:mga07m45_16224_c2 3300050496 Bacteria 3562
1411 nmdc:mga05p37_151_c1 3300050507 Bacteria 65585
1412 nmdc:mga05p37_296846_c1 3300050507 Bacteria 1921
1413 nmdc:mga05p37_563132_c1 3300050507 Bacteria 1294
1414 nmdc:mga05p37_7272_c1 3300050507 Bacteria 13063
1415 nmdc:mga0qj67_9689_c1 3300050509 Bacteria 7175
1416 nmdc:mga06r32_755_c1 3300050510 Bacteria 28474
1417 nmdc:mga08y16_108_c1 3300050511 Bacteria 69804
1418 nmdc:mga08y16_2951_c1 3300050511 Bacteria 17524
1419 nmdc:mga0n895_24865_c1 3300050512 Bacteria 5650
1420 nmdc:mga0n895_25991_c1 3300050512 Bacteria 5538
1421 nmdc:mga0n895_265_c1 3300050512 Bacteria 34107
1422 nmdc:mga0n895_37633_c1 3300050512 Bacteria 4682
1423 nmdc:mga0rr50_12610_c1 3300050513 Bacteria 5471
1424 nmdc:mga0rr50_19659_c1 3300050513 Bacteria 4565
1425 nmdc:mga0rr50_642_c1 3300050513 Bacteria 18790
1426 nmdc:mga0a205_1049_c1 3300050515 Bacteria 23004
1427 nmdc:mga0a205_146_c1 3300050515 Bacteria 45616
1428 nmdc:mga0a205_21581_c1 3300050515 Bacteria 6090
1429 nmdc:mga0sz30_34108_c1 3300050516 Bacteria 2118
1430 nmdc:mga0sz30_40712_c2 3300050516 Bacteria 1239
1431 Ga0495601_0000355 3300053077 Bacteria 24059
1432 Ga0495601_0009169 3300053077 Bacteria 5846
1433 Ga0495601_0017539 3300053077 Bacteria 4347
1434 Ga0495601_0033848 3300053077 Bacteria 3184
1435 Ga0495601_0050959 3300053077 Bacteria 2612
1436 Ga0495601_0083171 3300053077 Bacteria 2055
1437 Ga0495601_0107560 3300053077 Bacteria 1804
1438 Ga0495601_0163327 3300053077 Bacteria 1455
1439 Ga0495601_0188965 3300053077 Bacteria 1346
1440 Ga0495601_0199885 3300053077 Bacteria 1306
1441 Ga0495612_0001097 3300053078 Bacteria 11083
1442 Ga0495612_0007774 3300053078 Bacteria 4376
1443 Ga0495612_0040958 3300053078 Unclassified 1888
1444 Ga0495612_0078568 3300053078 Bacteria 1384
1445 Ga0500635_0001974 3300053080 Bacteria 5009
1446 Ga0500635_0002613 3300053080 Bacteria 4479
1447 Ga0495655_0009734 3300053083 Bacteria 1874
1448 Ga0495595_0000554 3300053084 Bacteria 14279
1449 Ga0495595_0000637 3300053084 Bacteria 13319
1450 Ga0495595_0001043 3300053084 Bacteria 10675
1451 Ga0495595_0002582 3300053084 Bacteria 7104
1452 Ga0495595_0064823 3300053084 Bacteria 1717
1453 Ga0495619_0000048 3300053085 Bacteria 102117
1454 Ga0495619_0000256 3300053085 Bacteria 38697
1455 Ga0495619_0001080 3300053085 Bacteria 17897
1456 Ga0495619_0001353 3300053085 Bacteria 16080
1457 Ga0495619_0005007 3300053085 Bacteria 8415
1458 Ga0495619_0014512 3300053085 Bacteria 4976
1459 Ga0495619_0197915 3300053085 Bacteria 1391
1460 Ga0495619_0219931 3300053085 Bacteria 1315
1461 Ga0500578_0065579 3300053086 Bacteria 2316
1462 Ga0500643_000013 3300053087 Bacteria 324296
1463 Ga0500583_0056480 3300053092 Bacteria 1839
1464 Ga0500651_0038749 3300053093 Bacteria 3002
1465 Ga0500566_0001419 3300053094 Bacteria 14035
1466 Ga0500566_0012672 3300053094 Bacteria 4960
1467 Ga0500640_000253 3300053095 Bacteria 11745
1468 Ga0500641_0031622 3300053096 Bacteria 2088
1469 Ga0500554_003440 3300053102 Bacteria 3242
1470 Ga0500555_006750 3300053103 Bacteria 3260
1471 Ga0500572_000199 3300053111 Bacteria 21285
1472 Ga0500595_000842 3300053119 Bacteria 17493
1473 Ga0500595_007617 3300053119 Bacteria 4482
1474 Ga0500595_033593 3300053119 Bacteria 1701
1475 Ga0500607_076874 3300053121 Bacteria 1710
1476 Ga0500608_103967 3300053122 Bacteria 1312
1477 Ga0500614_000715 3300053123 Bacteria 8481
1478 Ga0500642_0020937 3300053130 Bacteria 2580
1479 Ga0500658_0011386 3300053134 Bacteria 3278
1480 Ga0500559_0001308 3300053136 Bacteria 14372
1481 Ga0500568_0014785 3300053139 Bacteria 3512
1482 Ga0500573_0008543 3300053140 Bacteria 5644
1483 Ga0500577_0109173 3300053142 Unclassified 1140
1484 Ga0500603_000226 3300053150 Bacteria 14827
1485 Ga0500604_0018512 3300053151 Bacteria 1941
1486 Ga0500616_0000028 3300053153 Bacteria 435722
1487 Ga0500619_072092 3300053154 Bacteria 1151
1488 Ga0500620_032573 3300053155 Bacteria 1660
1489 Ga0500627_0162643 3300053158 Bacteria 1007
1490 Ga0500630_000573 3300053159 Bacteria 16713
1491 Ga0500638_001609 3300053162 Bacteria 7251
1492 Ga0500639_000006 3300053163 Bacteria 165068
1493 Ga0500636_0000762 3300053177 Bacteria 17368
1494 Ga0500636_0013138 3300053177 Bacteria 4858
1495 Ga0500636_0030340 3300053177 Bacteria 3197
1496 Ga0500637_0000251 3300053178 Bacteria 19903
1497 Ga0500637_0003349 3300053178 Bacteria 7387
1498 Ga0500637_0187265 3300053178 Bacteria 1183
1499 Ga0500576_083610 3300053725 Bacteria 1342
1500 Ga0500657_054402 3300053728 Unclassified 1813
1501 Ga0500596_000603 3300053735 Bacteria 6894
1502 Ga0500596_011896 3300053735 Bacteria 1326
1503 Ga0500599_003944 3300053736 Bacteria 1823
1504 Ga0500601_000371 3300053737 Bacteria 8090
1505 Ga0501084_0006839 3300054114 Bacteria 9387
1506 Ga0501084_0007774 3300054114 Bacteria 8822
1507 Ga0501084_0034119 3300054114 Bacteria 4255
1508 Ga0501084_0354426 3300054114 Bacteria 1239
1509 Ga0500661_001477 3300055283 Bacteria 4413
1510 Ga0501082_0001593 3300060353 Bacteria 20008
1511 Ga0501082_0018224 3300060353 Bacteria 6044
1512 Ga0501082_0050188 3300060353 Bacteria 3598
1513 Ga0501082_0107881 3300060353 Bacteria 2409
1514 Ga0501082_0344249 3300060353 Bacteria 1299
1515 2507511877 2507262055 Bacteria 8048963
1516 2508545541 2508501009 Bacteria 7784016
1517 2508694359 2508501042 Bacteria 8719808
1518 2509146623 2508501128 Bacteria 8613869
1519 2513627760 2513237092 Bacteria 8341956
1520 2513643305 2513237094 Bacteria 8789602
1521 2513651094 2513237095 Bacteria 8976980
1522 2513659238 2513237096 Bacteria 8722461
1523 2513717791 2513237104 Bacteria 10034502
1524 2513859041 2513237137 Bacteria 9558895
1525 2513875299 2513237139 Bacteria 8737671
1526 2513887729 2513237141 Bacteria 8496279
1527 2513921882 2513237145 Bacteria 8979722
1528 2514014405 2513237161 Bacteria 8871253
1529 2515624710 2515154112 Bacteria 8294334
1530 2517895963 2517572143 Bacteria 9484767
1531 2528854956 2528768022 Bacteria 10457665
1532 2617349629 2617270735 Bacteria 9163226
1533 2617376815 2617270741 Bacteria 8201522
1534 2644289771 2643221651 Bacteria 4798932
1535 2671122757 2667528175 Bacteria 7532676
1536 2745078535 2744054633 Bacteria 8678936
1537 2793059632 2791355196 Bacteria 7323613
1538 2793069607 2791355197 Bacteria 8420563
1539 2793080290
1540 2805921874 2802429603 Bacteria 8777136
1541 2818242190 2816332527 Bacteria 8933356
1542 2824608016 2824600985 Bacteria 8488197
1543 2824615056 2824609381 Bacteria 8672835
1544 2824624849 2824617872 Bacteria 8814715
1545 2824633745 2824626560 Bacteria 8813858
1546 2824642308 2824635225 Bacteria 8785348
1547 2824649646 2824644064 Bacteria 8743947
1548 2824659530 2824653114 Bacteria 8493680
1549 2824670058 2824661429 Bacteria 9877870
1550 2824676704 2824671348 Bacteria 8369588
1551 2824692995 2824687955 Bacteria 8360029
1552 2824702578 2824696289 Bacteria 8335049
1553 2824712400 2824704595 Bacteria 9667483
1554 2824730051 2824723954 Bacteria 8758240
1555 2824738292 2824732956 Bacteria 7810675
1556 2824751731 2824746037 Bacteria 7911610
1557 2824762426 2824753945 Bacteria 9787441
1558 2824772739 2824763712 Bacteria 9792355
1559 2824776990 2824773399 Bacteria 8360218
1560 2838128391 2838122688 Bacteria 8803140
1561 2841942251 2841941048 Bacteria 8688029
1562 2841955619 2841949485 Bacteria 8680857
1563 2841960960 2841957949 Bacteria 8652217
1564 2841971228 2841966195 Bacteria 8673214
1565 2841982348 2841974524 Bacteria 8931498
1566 2841984265 2841983080 Bacteria 8395090
1567 2842042003 2842038055 Bacteria 8002051
1568 2842050046 2842045827 Bacteria 8006841
1569 2844321094 2844315083 Bacteria 8138177
1570 2847932305 2847930680 Bacteria 9342022
1571 2847943540 2847939898 Bacteria 8606328
1572 2849077263 2849076700 Bacteria 7039503
1573 2874592257 2874590934 Bacteria 8299676
1574 2874618720 2874612657 Bacteria 8252029
1575 2874624010 2874620515 Bacteria 8290088
1576 2874630982 2874628541 Bacteria 8630250
1577 2874647373 2874645413 Bacteria 8214782
1578 2876767415 2876761206 Bacteria 10111113
1579 2876774784 2876771140 Bacteria 8287509
1580 2876819737 2876818435 Bacteria 8274608
1581 2879079352 2879074833 Bacteria 8279565
1582 2879091530 2879083081 Bacteria 8587928
1583 2879101398 2879099564 Bacteria 10442239
1584 2879129086 2879127579 Bacteria 8294491
1585 2879144759 2879142872 Bacteria 8267021
1586 2881371130 2881364244 Bacteria 7710352
1587 2881673238 2881665667 Bacteria 8175609
1588 2885374060 2885366525 Bacteria 8326213
1589 2885382990 2885374607 Bacteria 8927485
1590 2888387387 2888378607 Bacteria 9652610
1591 2888391816 2888388044 Bacteria 7304136
1592 2888426608 2888419890 Bacteria 7857137
1593 2903728517 2903727486 Bacteria 8281579
1594 2903756067 2903748898 Bacteria 9972761
1595 2904670721 2904666416 Bacteria 8226587
1596 2904699115 2904690495 Bacteria 9412302
1597 2904707118
1598 2904713672 2904711408 Bacteria 9771557
1599 2906607709 2906602504 Bacteria 8295279
1600 2906615567
1601 2906627114 2906626472 Bacteria 8826946
1602 2906642015 2906635258 Bacteria 8601019
1603 2906645374 2906643746 Bacteria 8722424
1604 2906665001 2906660503 Bacteria 8595048
1605 2908745612 2908739725 Bacteria 8628932
1606 2908763684 2908756301 Bacteria 8864324
1607 2908782713 2908775508 Bacteria 8092255
1608 2922367287 2922361189 Bacteria 7436256
1609 2922370558
1610 2922432439
1611 2929620134 2929615660 Bacteria 9193770
1612 2929629447 2929624759 Bacteria 9339455
1613 2932791489 2932784394 Bacteria 9704911
1614 2932796892 2932794094 Bacteria 7915132
1615 2932802330 2932801729 Bacteria 7987968
1616 2932816745 2932809354 Bacteria 9135765
1617 2932824073 2932818245 Bacteria 9955613
1618 2932835391 2932828146 Bacteria 9745859
1619 2933582051 2933577622 Bacteria 9116884
1620 2935613480 2935608549 Bacteria 8203142
1621 2935621134 2935616580 Bacteria 9032984
1622 2935643559 2935638405 Bacteria 10015038
1623 2935650476 2935648319 Bacteria 8801166
1624 2935662918 2935656913 Bacteria 8965014
1625 2935671131 2935665750 Bacteria 9571747
1626 2935681263 2935675223 Bacteria 9928132
1627 2935689394 2935684952 Bacteria 9590419
1628 2935699969 2935694250 Bacteria 9291695
1629 2935712100 2935703347 Bacteria 10242284
1630 2935720340 2935713505 Bacteria 9608509
1631 2935728043 2935722832 Bacteria 9608746
1632 2935737360 2935732158 Bacteria 9706831
1633 2935746579 2935741537 Bacteria 9707219
1634 2935757546 2935750917 Bacteria 9590372
1635 2935763923 2935760218 Bacteria 9817913
1636 2935807900 2935801545 Bacteria 9301974
1637 2935818766 2935810662 Bacteria 9401221
1638 2935824667 2935819856 Bacteria 8261050
1639 2935833076 2935827899 Bacteria 10038562
1640 2935844268 2935837841 Bacteria 9454360
1641 2935851887 2935847175 Bacteria 8228321
1642 2935859673 2935855204 Bacteria 9035059
1643 2935872071 2935864058 Bacteria 9784707
1644 2935879005 2935873716 Bacteria 9632195
1645 2935887230 2935883170 Bacteria 7964738
1646 2935911237 2935908558 Bacteria 8568796
1647 2935920769 2935916978 Bacteria 9113783
1648 2935928266 2935926038 Bacteria 8601059
1649 2935937911 2935934488 Bacteria 8602579
1650 2935945193 2935942939 Bacteria 8599779
1651 2935954301 2935951376 Bacteria 8602333
1652 2935965620 2935959822 Bacteria 7869783
1653 2935971431 2935967501 Bacteria 8603075
1654 2935982051 2935975950 Bacteria 8347125
1655 2935990610 2935984226 Bacteria 8302647
1656 2936000352 2935992306 Bacteria 9802711
1657 2936008510 2936002035 Bacteria 9362176
1658 2936017168 2936011229 Bacteria 8801034
1659 2936026697 2936019824 Bacteria 8804134
1660 2936035440 2936028420 Bacteria 8965941
1661 2936045576 2936037263 Bacteria 9446081
1662 2936053589 2936046547 Bacteria 8903709
1663 2936062667 2936055302 Bacteria 8785755
1664 2940563632 2940556831 Bacteria 9590747
1665 2941537270 2941531003 Bacteria 7653939
1666 2941542600 2941538514 Bacteria 9402094
1667 3005476600 3005474847 Bacteria 9259049
1668 3005506906 3005506211 Bacteria 6943378
1669 3005591713 3005587118 Bacteria 7794411
1670 3005601434 3005594810 Bacteria 8716512
1671 3005724125 3005718088 Bacteria 8283608
1672 8006929468 8006926726 Bacteria 6749210
1673 8006934886 8006933436 Bacteria 10410654
1674 8006974854 8006973647 Bacteria 10679141
1675 8016519488 8016511872 Bacteria 9921665
1676 8016588685 8016583857 Bacteria 10421953
1677 8016637185 8016630954 Bacteria 9217207
1678 8017066034 8017057580 Bacteria 10023680
1679 8019563773 8019555841 Bacteria 9642137
1680 8019573838 8019565922 Bacteria 9639779
1681 8019624150 8019619141 Bacteria 9218857
1682 8019653671 8019648815 Bacteria 10014479
1683 8019665806 8019659431 Bacteria 8577854
1684 8019675332 8019668869 Bacteria 8791617
1685 8019680772 8019678201 Bacteria 8863603
1686 8019694995 8019687851 Bacteria 8712826
1687 8055750113 8055742211 Bacteria 9226248
1688 8056696200 8056689827 Bacteria 6712655
1689 8056975892 8056967851 Bacteria 9038162
1690 Ga0307405_10022939
1691 JGI24739J22299_10000871
1692 JGI24739J22299_10008928
1693 JGI24739J22299_10025017
1694 JGI24743J22301_10013185
1695 JGI24750J21931_1000457
1696 JGI24035J26624_1000248
1697 JGI25153J46596_10004620
1698 JGI25153J46596_10005210
1699 JGI25153J46596_10010025
1700 JGI25153J46596_10031215
1701 rootL2_10335649
1702 JGI25160J50197_1003286
1703 JGI25160J50197_1007225
1704 Ga0055531_10010351
1705 Ga0055531_10010606
1706 Ga0055543_1008336
1707 Ga0065165_1002476
1708 Ga0065165_1002846
1709 Ga0065165_1025765
1710 Ga0065715_10243240
1711 Ga0070658_10029391
1712 Ga0070658_10044726
1713 Ga0070658_10142354
1714 Ga0070658_10349485
1715 Ga0070658_10461582
1716 Ga0070676_10020837
1717 Ga0070676_10086242
1718 Ga0070676_10165191
1719 Ga0070683_100031309
1720 Ga0070683_100041896
1721 Ga0070683_100045265
1722 Ga0070690_100017313
1723 Ga0070670_100126553
1724 Ga0070670_100316986
1725 Ga0070677_10005521
1726 Ga0068869_100059222
1727 Ga0070666_10103477
1728 Ga0070680_100003647
1729 Ga0070680_100123326
1730 Ga0070682_100007969
1731 Ga0070682_100028580
1732 Ga0070682_100030805
1733 Ga0068868_100018112
1734 Ga0068868_100208673
1735 Ga0070660_100003870
1736 Ga0070660_100019473
1737 Ga0070660_100022278
1738 Ga0070660_100026453
1739 Ga0070660_100277754
1740 Ga0070689_100031062
1741 Ga0070689_100258241
1742 Ga0070691_10004859
1743 Ga0070691_10089795
1744 Ga0070661_100009866
1745 Ga0070661_100048625
1746 Ga0070661_100063664
1747 Ga0070661_100116508
1748 Ga0070661_100156226
1749 Ga0070668_100013726
1750 Ga0070669_100014406
1751 Ga0070669_100414063
1752 Ga0070675_100018170
1753 Ga0070675_100276160
1754 Ga0070671_100016514
1755 Ga0070671_100024253
1756 Ga0070671_100034258
1757 Ga0070671_100048918
1758 Ga0070671_100170292
1759 Ga0070674_100005693
1760 Ga0070674_100558009
1761 Ga0070673_100040424
1762 Ga0070673_100045977
1763 Ga0070673_100055936
1764 Ga0070659_100058630
1765 Ga0070659_100144527
1766 Ga0070659_100281140
1767 Ga0070667_100014138
1768 Ga0070667_100024258
1769 Ga0070703_10003201
1770 Ga0070709_10002262
1771 Ga0070709_10010070
1772 Ga0070709_10013419
1773 Ga0070709_10018177
1774 Ga0070714_100022361
1775 Ga0070714_100054927
1776 Ga0070714_100152613
1777 Ga0070714_100181091
1778 Ga0070714_100269818
1779 Ga0070714_100452677
1780 Ga0070713_100003057
1781 Ga0070713_100043687
1782 Ga0070713_100055202
1783 Ga0070713_100055241
1784 Ga0070713_100055279
1785 Ga0070713_100194352
1786 Ga0070710_10002325
1787 Ga0070710_10072646
1788 Ga0070710_10119431
1789 Ga0070701_10004348
1790 Ga0070711_100002208
1791 Ga0070711_100011944
1792 Ga0070711_100013080
1793 Ga0070711_100130120
1794 Ga0070711_100187418
1795 Ga0070711_100237930
1796 Ga0070705_100023373
1797 Ga0070700_100199792
1798 Ga0070694_100019693
1799 Ga0070708_100120926
1800 Ga0070708_100130012
1801 Ga0070663_100011845
1802 Ga0070663_100027341
1803 Ga0070678_100022020
1804 Ga0070678_100066613
1805 Ga0070678_100189994
1806 Ga0070678_100408231
1807 Ga0070662_100033312
1808 Ga0070662_100164122
1809 Ga0070681_10023502
1810 Ga0070681_10032947
1811 Ga0070681_10059728
1812 Ga0070681_10076670
1813 Ga0070681_10112479
1814 Ga0068867_100021271
1815 Ga0068867_100128322
1816 Ga0068867_100185270
1817 Ga0070685_10074353
1818 Ga0070707_100055777
1819 Ga0070698_100028359
1820 Ga0070699_100143856
1821 Ga0070679_100009249
1822 Ga0070679_100009709
1823 Ga0070679_100051732
1824 Ga0070679_100098832
1825 Ga0070679_100173681
1826 Ga0070679_100342777
1827 Ga0070684_100008556
1828 Ga0070684_100022473
1829 Ga0070684_100063130
1830 Ga0070684_100092000
1831 Ga0070684_100271447
1832 Ga0070697_100079996
1833 Ga0068853_100003634
1834 Ga0068853_100045254
1835 Ga0068853_100097553
1836 Ga0068853_100175843
1837 Ga0068853_100177249
1838 Ga0068853_100179629
1839 Ga0068853_100529554
1840 Ga0070672_100006742
1841 Ga0070672_100105181
1842 Ga0070686_100116734
1843 Ga0070695_100027274
1844 Ga0070696_100027513
1845 Ga0070693_100031082
1846 Ga0070665_100063185
1847 Ga0070665_100065216
1848 Ga0070665_100071799
1849 Ga0070665_100080708
1850 Ga0070665_100105307
1851 Ga0070665_100172385
1852 Ga0070665_100203035
1853 Ga0070665_100265636
1854 Ga0070665_100380649
1855 Ga0070665_100428297
1856 Ga0070704_100025802
1857 Ga0068855_100018412
1858 Ga0068855_100019735
1859 Ga0068855_100112477
1860 Ga0068855_100125312
1861 Ga0068855_100259104
1862 Ga0068855_100261934
1863 Ga0068855_100262469
1864 Ga0068855_100410537
1865 Ga0068855_100432165
1866 Ga0068855_100454183
1867 Ga0068855_100495803
1868 Ga0068855_100739264
1869 Ga0070664_100047876
1870 Ga0070664_100069419
1871 Ga0070664_100238256
1872 Ga0068857_100003181
1873 Ga0068857_100096073
1874 Ga0068857_100681426
1875 Ga0068854_100016856
1876 Ga0068854_100030721
1877 Ga0068854_100122052
1878 Ga0068854_100155813
1879 Ga0068856_100000781
1880 Ga0068856_100024188
1881 Ga0068856_100047838
1882 Ga0068856_100073843
1883 Ga0068856_100074006
1884 Ga0068856_100116233
1885 Ga0068856_100178360
1886 Ga0068856_100180758
1887 Ga0068856_100298360
1888 Ga0068856_100320920
1889 Ga0068856_100322290
1890 Ga0070702_100046391
1891 Ga0070702_100149746
1892 Ga0070702_100323136
1893 Ga0068852_100024735
1894 Ga0068852_100026321
1895 Ga0068852_100028959
1896 Ga0068852_100204250
1897 Ga0068852_100212283
1898 Ga0068852_100545435
1899 Ga0068859_100035913
1900 Ga0068859_100154399
1901 Ga0068859_100485774
1902 Ga0068864_100026533
1903 Ga0068864_100287017
1904 Ga0068866_10022841
1905 Ga0068861_100019676
1906 Ga0068861_100048184
1907 Ga0068861_100204537
1908 Ga0068863_100006825
1909 Ga0068858_100127566
1910 Ga0068860_100018432
1911 Ga0068860_100143296
1912 Ga0068860_100143725
1913 Ga0068862_100010222
1914 Ga0068862_100028055
1915 Ga0068862_100083389
1916 Ga0081455_10000200
1917 Ga0081455_10000768
1918 Ga0081455_10023827
1919 Ga0081540_1002136
1920 Ga0081540_1008268
1921 Ga0081540_1013689
1922 Ga0070717_10003779
1923 Ga0070717_10034264
1924 Ga0070717_10351343
1925 Ga0070717_10395519
1926 Ga0075365_10046636
1927 Ga0075365_10051949
1928 Ga0075365_10065320
1929 Ga0075368_10008811
1930 Ga0075363_100065887
1931 Ga0070715_10208276
1932 Ga0070716_100008278
1933 Ga0070716_100012612
1934 Ga0070716_100078406
1935 Ga0070712_100328792
1936 Ga0075367_10016061
1937 Ga0075367_10026524
1938 Ga0075367_10048065
1939 Ga0075427_10000041
1940 Ga0097621_100011867
1941 Ga0097621_100024301
1942 Ga0075370_10019677
1943 Ga0068871_100019303
1944 Ga0068871_100057668
1945 Ga0068871_100157136
1946 Ga0068871_100162788
1947 Ga0068871_100300703
1948 Ga0075428_100003399
1949 Ga0075430_100000133
1950 Ga0075431_100002259
1951 Ga0075433_10000506
1952 Ga0075433_10025119
1953 Ga0075433_10038792
1954 Ga0075434_100000472
1955 Ga0075434_100008091
1956 Ga0075434_100044057
1957 Ga0075434_100068627
1958 Ga0075434_100386460
1959 Ga0075434_100411167
1960 Ga0075429_100000163
1961 Ga0068865_100001544
1962 Ga0068865_100003466
1963 Ga0068865_100076577
1964 Ga0068865_100362686
1965 Ga0097620_100035916
1966 Ga0097620_100154402
1967 Ga0097620_100485755
1968 Ga0099825_1036559
1969 Ga0099824_1023056
1970 Ga0099822_1001448
1971 Ga0099823_1004051
1972 Ga0075435_100017200
1973 Ga0075435_100056759
1974 Ga0099794_10060242
1975 Ga0099795_10003998
1976 Ga0099795_10010789
1977 Ga0099795_10025253
1978 Ga0099795_10134516
1979 Ga0105251_10010431
1980 Ga0105240_10008946
1981 Ga0105240_10023552
1982 Ga0105240_10029706
1983 Ga0105240_10039692
1984 Ga0105240_10048624
1985 Ga0105240_10092782
1986 Ga0105240_10427362
1987 Ga0111539_10000389
1988 Ga0111539_10001808
1989 Ga0105245_10031587
1990 Ga0105245_10035028
1991 Ga0105245_10062438
1992 Ga0105245_10154012
1993 Ga0105245_10247473
1994 Ga0105247_10031859
1995 Ga0105247_10034936
1996 Ga0105247_10056334
1997 Ga0114129_10018380
1998 Ga0114129_10364864
1999 Ga0114129_10609708
2000 Ga0105243_10040850
2001 Ga0105241_10024018
2002 Ga0105241_10031108
2003 Ga0105241_10081747
2004 Ga0105242_10082937
2005 Ga0105242_10097450
2006 Ga0105242_10271376
2007 Ga0105242_10803490
2008 Ga0105248_10011779
2009 Ga0105248_10046950
2010 Ga0105248_10237637
2011 Ga0105248_10261174
2012 Ga0105237_10004719
2013 Ga0105237_10007432
2014 Ga0105237_10019250
2015 Ga0105237_10045568
2016 Ga0105237_10381648
2017 Ga0105237_10410939
2018 Ga0105237_10470423
2019 Ga0105238_10031611
2020 Ga0105238_10040511
2021 Ga0105238_10045455
2022 Ga0105238_10064854
2023 Ga0105238_10110436
2024 Ga0105238_10292182
2025 Ga0105238_10374066
2026 Ga0105249_10019871
2027 Ga0105249_10067975
2028 Ga0105249_10094865
2029 Ga0099796_10043386
2030 Ga0105239_10043179
2031 Ga0105239_10053738
2032 Ga0105239_10064549
2033 Ga0105239_10079664
2034 Ga0105239_10168122
2035 Ga0105239_10282663
2036 Ga0105239_10316055
2037 Ga0105239_10322586
2038 Ga0105239_10323551
2039 Ga0105239_10330197
2040 Ga0105239_10826421
2041 Ga0105246_10012128
2042 Ga0105246_10054989
2043 Ga0105246_10332364
2044 Ga0157326_1008038
2045 Ga0157373_10010494
2046 Ga0157373_10024897
2047 Ga0157373_10204840
2048 Ga0157371_10007078
2049 Ga0157371_10036676
2050 Ga0157371_10128334
2051 Ga0157371_10158591
2052 Ga0157370_10041078
2053 Ga0157370_10181306
2054 Ga0157370_10238914
2055 Ga0157369_10008072
2056 Ga0157369_10033594
2057 Ga0157369_10236445
2058 Ga0157369_10386899
2059 Ga0157369_10522628
2060 Ga0157369_10777587
2061 Ga0157374_10002692
2062 Ga0157374_10164515
2063 Ga0157374_10224597
2064 Ga0157378_10049119
2065 Ga0157378_10104776
2066 Ga0157378_10108129
2067 Ga0157378_10396452
2068 Ga0157378_10471250
2069 Ga0163162_10022106
2070 Ga0163162_10022234
2071 Ga0163162_10029020
2072 Ga0163162_10081453
2073 Ga0163162_10107677
2074 Ga0163162_10198425
2075 Ga0163162_10324040
2076 Ga0157372_10016582
2077 Ga0157372_10107362
2078 Ga0157372_10214288
2079 Ga0157372_10423344
2080 Ga0157375_10064892
2081 Ga0157375_10430055
2082 Ga0163163_10029384
2083 Ga0163163_10059092
2084 Ga0163163_10155656
2085 Ga0157380_10013506
2086 Ga0157377_10013798
2087 Ga0157377_10226916
2088 Ga0157379_10010153
2089 Ga0157379_10027560
2090 Ga0157376_10022095
2091 Ga0157376_10109705
2092 Ga0157376_10113532
2093 Ga0157376_10237036
2094 Ga0163161_10006229
2095 Ga0163161_10035277
2096 Ga0163161_10039404
2097 Ga0163161_10047578
2098 Ga0163161_10135289
2099 Ga0206356_10553992
2100 Ga0206356_11532789
2101 Ga0206354_11292144
2102 Ga0206353_10342907
2103 Ga0214542_1000156
2104 Ga0214545_1000078
2105 Ga0214543_1000136
2106 Ga0213875_10003786
2107 Ga0213871_10000896
2108 Ga0224572_1006509
2109 Ga0228598_1015888
2110 Ga0207425_1014237
2111 Ga0209677_104346
2112 Ga0209233_1005084
2113 Ga0207666_1000311
2114 Ga0209455_1006888
2115 Ga0209673_1021558
2116 Ga0209564_1008607
2117 Ga0209758_1000705
2118 Ga0209758_1000932
2119 Ga0209758_1000986
2120 Ga0209758_1002299
2121 Ga0209758_1030972
2122 Ga0207426_1000632
2123 Ga0207426_1001240
2124 Ga0207426_1006296
2125 Ga0207426_1020313
2126 Ga0209257_1001185
2127 Ga0209257_1010432
2128 Ga0207697_10006626
2129 Ga0207713_1077773
2130 Ga0207653_10002805
2131 Ga0207682_10000009
2132 Ga0207682_10014469
2133 Ga0207692_10063809
2134 Ga0207692_10069546
2135 Ga0207692_10203761
2136 Ga0207710_10001303
2137 Ga0207710_10002730
2138 Ga0207688_10000892
2139 Ga0207680_10016229
2140 Ga0207680_10058944
2141 Ga0207647_10002160
2142 Ga0207647_10016893
2143 Ga0207647_10048251
2144 Ga0207647_10110563
2145 Ga0207647_10249664
2146 Ga0207685_10051712
2147 Ga0207699_10001069
2148 Ga0207699_10007734
2149 Ga0207699_10033250
2150 Ga0207699_10040581
2151 Ga0207645_10000999
2152 Ga0207645_10064570
2153 Ga0207645_10066806
2154 Ga0207705_10081980
2155 Ga0207654_10015616
2156 Ga0207654_10025829
2157 Ga0207654_10040703
2158 Ga0207654_10090337
2159 Ga0207707_10006422
2160 Ga0207707_10020542
2161 Ga0207707_10027810
2162 Ga0207707_10062664
2163 Ga0207707_10154734
2164 Ga0207707_10372622
2165 Ga0207695_10000123
2166 Ga0207695_10057960
2167 Ga0207695_10088527
2168 Ga0207695_10155565
2169 Ga0207695_10189873
2170 Ga0207671_10009480
2171 Ga0207671_10035416
2172 Ga0207671_10041159
2173 Ga0207671_10252742
2174 Ga0207671_10527652
2175 Ga0207693_10000565
2176 Ga0207693_10006473
2177 Ga0207693_10007042
2178 Ga0207693_10076615
2179 Ga0207693_10091642
2180 Ga0207693_10327417
2181 Ga0207663_10000239
2182 Ga0207663_10212720
2183 Ga0207660_10001283
2184 Ga0207660_10030183
2185 Ga0207660_10042221
2186 Ga0207660_10178226
2187 Ga0207662_10000025
2188 Ga0207662_10010323
2189 Ga0207657_10006857
2190 Ga0207657_10012765
2191 Ga0207657_10018108
2192 Ga0207657_10148090
2193 Ga0207657_10161621
2194 Ga0207657_10166069
2195 Ga0207657_10231905
2196 Ga0207649_10002186
2197 Ga0207649_10025741
2198 Ga0207649_10303134
2199 Ga0207649_10318780
2200 Ga0207652_10073521
2201 Ga0207652_10075776
2202 Ga0207652_10144808
2203 Ga0207652_10179454
2204 Ga0207652_10322632
2205 Ga0207652_10345915
2206 Ga0207646_10112011
2207 Ga0207646_10118738
2208 Ga0207681_10007074
2209 Ga0207681_10156754
2210 Ga0207694_10039207
2211 Ga0207694_10045928
2212 Ga0207694_10104378
2213 Ga0207694_10434838
2214 Ga0207694_10461524
2215 Ga0207650_10357355
2216 Ga0207659_10169970
2217 Ga0207659_10177614
2218 Ga0207659_10216169
2219 Ga0207687_10003202
2220 Ga0207687_10030484
2221 Ga0207687_10208342
2222 Ga0207687_10221870
2223 Ga0207687_10509783
2224 Ga0207700_10004367
2225 Ga0207700_10005825
2226 Ga0207700_10076952
2227 Ga0207664_10022280
2228 Ga0207664_10032782
2229 Ga0207664_10130661
2230 Ga0207644_10032924
2231 Ga0207644_10036076
2232 Ga0207644_10055831
2233 Ga0207644_10061984
2234 Ga0207644_10127632
2235 Ga0207690_10011755
2236 Ga0207690_10064867
2237 Ga0207690_10088473
2238 Ga0207690_10253542
2239 Ga0207706_10005363
2240 Ga0207706_10040844
2241 Ga0207706_10085400
2242 Ga0207706_10129804
2243 Ga0207686_10014315
2244 Ga0207686_10187791
2245 Ga0207709_10006190
2246 Ga0207709_10012682
2247 Ga0207709_10024392
2248 Ga0207670_10013997
2249 Ga0207670_10078501
2250 Ga0207670_10375891
2251 Ga0207669_10001324
2252 Ga0207669_10084772
2253 Ga0207704_10003457
2254 Ga0207665_10000127
2255 Ga0207665_10002113
2256 Ga0207665_10108803
2257 Ga0207665_10196496
2258 Ga0207665_10267556
2259 Ga0207691_10002604
2260 Ga0207691_10113799
2261 Ga0207691_10116097
2262 Ga0207691_10365968
2263 Ga0207711_10001071
2264 Ga0207711_10072335
2265 Ga0207711_10106384
2266 Ga0207711_10252392
2267 Ga0207689_10001156
2268 Ga0207689_10031636
2269 Ga0207689_10081386
2270 Ga0207661_10002078
2271 Ga0207661_10007789
2272 Ga0207661_10062965
2273 Ga0207679_10003209
2274 Ga0207679_10267358
2275 Ga0207679_10417424
2276 Ga0207667_10013288
2277 Ga0207667_10028603
2278 Ga0207667_10064143
2279 Ga0207667_10077987
2280 Ga0207667_10095327
2281 Ga0207667_10103467
2282 Ga0207667_10115171
2283 Ga0207667_10122695
2284 Ga0207667_10123806
2285 Ga0207667_10128039
2286 Ga0207667_10188431
2287 Ga0207667_10219159
2288 Ga0207667_10607125
2289 Ga0207651_10008497
2290 Ga0207651_10151130
2291 Ga0207651_10327218
2292 Ga0207712_10000579
2293 Ga0207668_10001403
2294 Ga0207668_10085216
2295 Ga0207640_10003644
2296 Ga0207640_10066874
2297 Ga0207640_10075564
2298 Ga0207640_10558073
2299 Ga0207658_10018420
2300 Ga0207658_10130939
2301 Ga0207677_10006044
2302 Ga0207677_10117181
2303 Ga0207677_10124489
2304 Ga0207703_10008872
2305 Ga0207703_10014416
2306 Ga0207703_10130992
2307 Ga0207703_10184537
2308 Ga0207703_10306384
2309 Ga0207639_10001866
2310 Ga0207639_10044315
2311 Ga0207639_10082222
2312 Ga0207639_10094435
2313 Ga0207639_10108911
2314 Ga0207639_10135429
2315 Ga0207639_10261036
2316 Ga0207639_10288492
2317 Ga0207639_10582894
2318 Ga0207678_10021488
2319 Ga0207678_10022823
2320 Ga0207678_10042596
2321 Ga0207678_10062786
2322 Ga0207678_10130307
2323 Ga0207678_10145100
2324 Ga0207678_10261116
2325 Ga0207708_10020931
2326 Ga0207708_10130549
2327 Ga0207702_10000758
2328 Ga0207702_10010946
2329 Ga0207702_10065779
2330 Ga0207702_10098432
2331 Ga0207702_10160482
2332 Ga0207702_10167929
2333 Ga0207702_10249986
2334 Ga0207641_10006404
2335 Ga0207641_10051015
2336 Ga0207648_10004627
2337 Ga0207648_10046915
2338 Ga0207648_10176768
2339 Ga0207676_10030863
2340 Ga0207676_10677293
2341 Ga0207674_10054730
2342 Ga0207674_10246718
2343 Ga0207675_100003859
2344 Ga0207675_100104527
2345 Ga0207675_100108300
2346 Ga0207675_100115515
2347 Ga0207675_100533979
2348 Ga0207683_10000782
2349 Ga0207683_10000850
2350 Ga0207683_10051919
2351 Ga0207683_10056530
2352 Ga0207683_10089743
2353 Ga0207683_10163872
2354 Ga0207683_10304839
2355 Ga0207698_10007574
2356 Ga0207698_10031006
2357 Ga0207698_10087873
2358 Ga0207698_10096641
2359 Ga0207698_10375299
2360 Ga0209389_1000019
2361 Ga0209389_1000248
2362 Ga0209589_1000005
2363 Ga0209589_1001871
2364 Ga0209489_100005
2365 Ga0209489_100033
2366 Ga0209489_102684
2367 Ga0209700_100006
2368 Ga0209700_100012
2369 Ga0209179_1012095
2370 Ga0209998_10002588
2371 Ga0209974_10003747
2372 Ga0207428_10000164
2373 Ga0207428_10000391
2374 Ga0265357_1000580
2375 Ga0268266_10002016
2376 Ga0268266_10077802
2377 Ga0268266_10112988
2378 Ga0268266_10128151
2379 Ga0268266_10203354
2380 Ga0268266_10499031
2381 Ga0268265_10004025
2382 Ga0268265_10079812
2383 Ga0268264_10000174
2384 Ga0268264_10049152
2385 Ga0268264_10146243
2386 Ga0307517_10000859
2387 Ga0307515_10028873
2388 Ga0265338_10059137
2389 Ga0307511_10032093
2390 Ga0265770_1032542
2391 Ga0265330_10020221
2392 Ga0265330_10031054
2393 Ga0265330_10067423
2394 Ga0265332_10006382
2395 Ga0265328_10043351
2396 Ga0265325_10000019
2397 Ga0265325_10003263
2398 Ga0265325_10028164
2399 Ga0265340_10018122
2400 Ga0265340_10036658
2401 Ga0265339_10001912
2402 Ga0265331_10190616
2403 Ga0265316_10067912
2404 Ga0307509_10006398
2405 Ga0307509_10274632
2406 Ga0265313_10019302
2407 Ga0265313_10022283
2408 Ga0265313_10024531
2409 Ga0265313_10112428
2410 Ga0307508_10000063
2411 Ga0307508_10056441
2412 Ga0307508_10175540
2413 Ga0316579_10019886
2414 Ga0265314_10003648
2415 Ga0265314_10039492
2416 Ga0265314_10176733
2417 Ga0265342_10001257
2418 Ga0265342_10005406
2419 Ga0265342_10122647
2420 Ga0307516_10043872
2421 Ga0307413_10038231
2422 Ga0307410_10143559
2423 Ga0307406_10132490
2424 Ga0307507_10125921
2425 Ga0307507_10150631
2426 Ga0307510_10126787
2427 Ga0307510_10152035
2428 Ga0315911_1000040
2429 Ga0316213_1002509
2430 Ga0373930_0008599
2431 Ga0373959_0012771
2432 Ga0373959_0023004
2433 Ga0373938_0006998
2434 Ga0373926_0000388
2435 Ga0373926_0011522
2436 Ga0373929_0004760
2437 Ga0373934_0047916
2438 Ga0373934_0053221
2439 Ga0373934_0084179
2440 Ga0373940_0027412
2441 Ga0373944_0002538
2442 Ga0373949_0006564
2443 Ga0373949_0022292
2444 Ga0373951_0031325
2445 Ga0373952_0000933
2446 Ga0373923_0003867
2447 Ga0373923_0043642
2448 Ga0373923_0049887
2449 Ga0373932_0003751
2450 Ga0373932_0020639
2451 Ga0373936_0006062
2452 Ga0373936_0053213
2453 Ga0373936_0054051
2454 Ga0373936_0104471
2455 Ga0373939_0002641
2456 Ga0373939_0003090
2457 Ga0373939_0062364
2458 Ga0373939_0069899
2459 Ga0373941_0014083
2460 Ga0373945_0007291
2461 Ga0373945_0011447
2462 Ga0373953_0012482
2463 Ga0373953_0018244
2464 Ga0373953_0051706
2465 Ga0373954_0001219
2466 Ga0373954_0008152
2467 Ga0373954_0031320
2468 Ga0373956_0004720
2469 Ga0373956_0025442
2470 Ga0373957_0003464
2471 Ga0373957_0010097
2472 Ga0373957_0053731
2473 Ga0373957_0103774
2474 Ga0373943_0001607
2475 Ga0373943_0028008
2476 Ga0373943_0033149
2477 Ga0373943_0101921
2478 Ga0373943_0165362
2479 Ga0373943_0214025
2480 Ga0373946_0020904
2481 Ga0373946_0027110
2482 Ga0373946_0075376
2483 Ga0373946_0101738
2484 Ga0373955_0002049
2485 Ga0373955_0005330
2486 Ga0373955_0012895
2487 Ga0373955_0323138
2488 Ga0373942_0006671
2489 Ga0373942_0031660
2490 Ga0373961_0002775
2491 Ga0373924_0014698
2492 Ga0373931_0002611
2493 Ga0373931_0006487
2494 Ga0373931_0305503
2495 Ga0373931_0344444
2496 Ga0373935_0000942
2497 Ga0373935_0027111
2498 Ga0373935_0042617
2499 Ga0373935_0051264
2500 Ga0373935_0057366
2501 Ga0373935_0057406
2502 Ga0373935_0121844
2503 Ga0373935_0196235
2504 Ga0373935_0439570
2505 Ga0373927_0000528
2506 Ga0373927_0021674
2507 Ga0373927_0030902
2508 Ga0373927_0035067
2509 Ga0373927_0041261
2510 Ga0373927_0066975
2511 Ga0373927_0148674
2512 Ga0373927_0214174
2513 Ga0373927_0227121
2514 Ga0373927_0297623
2515 Ga0373933_0000204
2516 Ga0373933_0002658
2517 Ga0373933_0010853
2518 Ga0373933_0034817
2519 Ga0373933_0077067
2520 Ga0373933_0090111
2521 Ga0373933_0188029
2522 Ga0373933_0293051
2523 Ga0373947_0000455
2524 Ga0373947_0003382
2525 Ga0373947_0026670
2526 Ga0373947_0067145
2527 Ga0373947_0078436
2528 Ga0373947_0101412
2529 Ga0373947_0225609
2530 Ga0373937_0008188
2531 Ga0373937_0021334
2532 Ga0373937_0194847
2533 Ga0372808_001169
2534 Ga0316582_0023146
2535 Ga0373925_0001434
2536 Ga0373925_0003563
2537 Ga0373925_0011034
2538 Ga0373925_0015076
2539 Ga0373925_0104455
2540 Ga0373925_0120167
2541 Ga0373925_0130934
2542 Ga0373925_0170838
2543 Ga0373925_0313178
2544 Ga0395900_0033975
2545 Ga0395900_0357002
2546 Ga0395900_0556389
2547 Ga0395898_0092172
2548 Ga0395905_0026848
2549 Ga0436364_0100847
2550 Ga0436364_1119586
2551 Ga0395901_0065664
2552 Ga0395901_0086125
2553 Ga0395901_0165542
2554 Ga0395901_0575766
2555 Ga0436365_1490250
2556 Ga0436360_0675457
2557 Ga0436361_0576775
2558 Ga0436361_0681610
2559 Ga0436363_1060587
2560 Ga0436362_0124208
2561 Ga0466969_0014448
2562 Ga0466972_0103734
2563 Ga0466966_0001614
2564 Ga0466966_0272714
2565 Ga0466961_0000192
2566 Ga0466963_0019050
2567 Ga0466963_0031458
2568 Ga0466964_0025350
2569 Ga0466971_0060412
2570 Ga0466968_0032806
2571 Ga0466957_0140210
2572 Ga0466959_0000934
2573 Ga0466959_0008049
2574 Ga0466959_0058009
2575 Ga0466959_0062872
2576 Ga0466967_0023977
2577 Ga0466967_0094324
2578 Ga0466967_0242814
2579 Ga0466967_0838598
2580 Ga0495592_0021465
2581 Ga0495592_0032569
2582 Ga0495592_0038867
2583 Ga0495592_0087914
2584 Ga0495603_0000239
2585 Ga0495603_0015374
2586 Ga0495603_0017749
2587 Ga0495603_0072211
2588 Ga0495590_0116445
2589 Ga0495629_0000139
2590 Ga0495629_0000457
2591 Ga0495629_0007972
2592 Ga0495629_0029920
2593 Ga0495629_0051611
2594 Ga0495629_0096371
2595 Ga0495629_0150450
2596 Ga0495629_0163427
2597 Ga0495629_0225033
2598 Ga0495641_0002157
2599 Ga0495641_0029301
2600 Ga0495651_0004984
2601 Ga0495651_0014000
2602 Ga0495651_0017171
2603 Ga0495651_0037984
2604 Ga0495651_0054995
2605 Ga0495651_0166592
2606 Ga0495653_0004257
2607 Ga0495653_0009797
2608 Ga0495653_0235853
2609 Ga0495580_0002960
2610 Ga0495580_0009072
2611 Ga0495580_0009091
2612 Ga0495582_0000077
2613 Ga0495582_0001850
2614 Ga0495582_0038297
2615 Ga0495582_0258275
2616 Ga0495605_0057694
2617 Ga0495605_0154703
2618 Ga0495639_0000101
2619 Ga0495639_0012036
2620 Ga0495662_0012510
2621 Ga0495662_0051472
2622 Ga0495664_0038052
2623 Ga0495664_0041464
2624 Ga0495664_0044789
2625 Ga0495584_0001897
2626 Ga0495584_0039510
2627 Ga0495585_0001030
2628 Ga0495585_0158482
2629 Ga0495594_0005795
2630 Ga0495594_0127044
2631 Ga0495594_0243805
2632 Ga0495607_0006002
2633 Ga0495606_0000357
2634 Ga0495606_0014109
2635 Ga0495608_0000911
2636 Ga0495608_0004649
2637 Ga0495608_0061364
2638 Ga0495608_0110421
2639 Ga0495608_0188827
2640 Ga0495618_0003586
2641 Ga0495618_0014258
2642 Ga0495618_0021739
2643 Ga0495618_0089816
2644 Ga0495618_0119090
2645 Ga0495618_0136315
2646 Ga0495620_0071983
2647 Ga0495620_0078633
2648 Ga0495628_0005614
2649 Ga0495628_0105477
2650 Ga0495628_0157361
2651 Ga0495628_0282913
2652 Ga0495630_0012819
2653 Ga0495630_0047522
2654 Ga0495630_0281866
2655 Ga0495631_0126651
2656 Ga0495643_0028502
2657 Ga0495644_0000513
2658 Ga0495644_0050156
2659 Ga0495648_0000897
2660 Ga0495648_0007226
2661 Ga0495648_0012169
2662 Ga0495648_0092889
2663 Ga0495648_0109736
2664 Ga0495663_0002372
2665 Ga0495666_0168340
2666 Ga0495652_0021917
2667 Ga0495652_0028137
2668 Ga0495652_0046433
2669 Ga0495652_0070477
2670 Ga0495652_0076180
2671 Ga0495652_0270423
2672 Ga0495665_0000055
2673 Ga0495665_0026195
2674 Ga0495640_0011661
2675 Ga0495640_0024673
2676 Ga0495640_0043321
2677 Ga0495640_0046767
2678 Ga0495640_0053786
2679 Ga0495640_0092694
2680 Ga0495586_0046428
2681 Ga0495587_0005897
2682 Ga0495587_0015897
2683 Ga0495587_0094947
2684 Ga0495587_0134777
2685 Ga0495587_0301376
2686 Ga0495598_0045979
2687 Ga0495609_0017406
2688 Ga0495609_0085365
2689 Ga0495609_0137657
2690 Ga0495597_0028153
2691 Ga0495645_0011340
2692 Ga0495645_0061920
2693 Ga0495645_0115470
2694 Ga0495645_0120887
2695 Ga0495622_0002233
2696 Ga0495622_0033493
2697 Ga0495622_0055262
2698 Ga0495622_0057388
2699 Ga0495622_0078894
2700 Ga0495622_0101465
2701 Ga0495633_0024926
2702 Ga0495667_0010518
2703 Ga0495667_0021423
2704 Ga0495667_0023279
2705 Ga0495667_0038378
2706 Ga0495667_0048600
2707 Ga0495667_0096798
2708 Ga0495656_0000091
2709 Ga0495656_0006841
2710 Ga0495668_0083718
2711 Ga0495634_0001036
2712 Ga0495634_0063846
2713 Ga0495634_0069546
2714 Ga0495634_0084757
2715 Ga0495634_0110477
2716 Ga0495611_0007030
2717 Ga0495611_0087470
2718 Ga0495625_0030051
2719 Ga0495625_0066315
2720 Ga0495635_0000815
2721 Ga0495635_0004810
2722 Ga0495635_0011194
2723 Ga0495635_0029736
2724 Ga0495635_0093114
2725 Ga0495659_0000632
2726 Ga0495659_0122405
2727 Ga0495661_0010120
2728 Ga0495661_0048855
2729 Ga0495588_0005058
2730 Ga0495588_0005077
2731 Ga0495588_0015996
2732 Ga0495657_0003079
2733 Ga0495657_0004591
2734 Ga0495657_0019481
2735 Ga0495657_0034720
2736 Ga0495657_0194463
2737 Ga0495599_0001945
2738 Ga0495599_0028704
2739 Ga0495599_0053717
2740 Ga0495623_0002783
2741 Ga0495623_0020870
2742 Ga0495623_0233769
2743 Ga0495646_0001642
2744 Ga0495646_0014188
2745 Ga0495646_0022610
2746 Ga0495646_0060647
2747 Ga0495646_0119405
2748 Ga0495647_0002436
2749 Ga0495647_0010626
2750 Ga0495647_0019267
2751 Ga0495647_0074495
2752 Ga0495647_0081217
2753 Ga0495658_0000065
2754 Ga0495658_0008416
2755 Ga0495658_0066140
2756 Ga0495658_0365868
2757 Ga0495613_0003480
2758 Ga0495613_0010328
2759 Ga0495613_0078788
2760 Ga0495613_0092005
2761 Ga0495613_0284765
2762 Ga0495624_0000235
2763 Ga0495624_0050807
2764 Ga0495624_0136811
2765 Ga0495670_0000199
2766 Ga0495670_0090418
2767 Ga0495671_0092637
2768 Ga0495671_0202048
2769 Ga0495649_0015557
2770 Ga0495649_0152989
2771 Ga0495589_0021779
2772 Ga0495600_0012719
2773 Ga0495600_0015147
2774 Ga0495600_0030346
2775 Ga0495581_0000041
2776 Ga0495581_0022819
2777 Ga0495581_0024475
2778 Ga0495604_0007221
2779 Ga0495604_0056249
2780 Ga0495604_0070109
2781 Ga0495604_0086405
2782 Ga0495604_0106288
2783 Ga0495604_0203136
2784 Ga0495636_0046361
2785 Ga0495674_0001192
2786 Ga0495674_0028002
2787 Ga0495674_0047281
2788 Ga0495674_0051263
2789 Ga0495674_0320433
2790 Ga0495674_0326857
2791 Ga0495672_0037589
2792 Ga0495676_0018550
2793 Ga0495676_0100156
2794 Ga0495676_0403146
2795 Ga0495680_0012071
2796 Ga0495680_0017326
2797 Ga0495680_0017765
2798 Ga0495680_0043618
2799 Ga0495687_050067
2800 Ga0495675_0040948
2801 Ga0495675_0152222
2802 Ga0495679_028585
2803 Ga0495673_0010425
2804 Ga0495673_0025589
2805 Ga0495684_0001073
2806 Ga0495684_0001399
2807 Ga0495684_0039273
2808 Ga0495684_0052644
2809 Ga0495684_0075698
2810 Ga0495684_0116868
2811 Ga0495686_0060885
2812 Ga0495686_0062790
2813 Ga0495686_0085485
2814 Ga0495686_0136095
2815 Ga0495686_0237214
2816 Ga0495593_0000024
2817 Ga0495593_0002018
2818 Ga0495593_0003557
2819 Ga0495593_0004938
2820 Ga0495593_0052823
2821 Ga0495593_0055700
2822 Ga0495602_0019419
2823 Ga0495602_0027637
2824 Ga0495602_0035012
2825 Ga0495602_0085186
2826 Ga0495614_0059008
2827 Ga0495615_0051171
2828 Ga0496100_0071720
2829 Ga0496101_0005706
2830 Ga0496101_0017665
2831 Ga0496101_0046113
2832 Ga0496101_0106497
2833 Ga0496101_0173978
2834 Ga0496101_0417516
2835 Ga0496102_0014041
2836 Ga0496102_0017084
2837 Ga0496102_0022366
2838 Ga0496102_0067126
2839 Ga0496102_0244050
2840 Ga0496103_0013626
2841 Ga0496103_0037032
2842 Ga0496103_0155467
2843 Ga0496103_0176854
2844 Ga0496103_0199908
2845 Ga0496104_0007787
2846 Ga0496104_0037009
2847 Ga0496104_0065417
2848 Ga0496104_0088068
2849 Ga0496104_0182742
2850 Ga0496104_0186109
2851 Ga0496104_0187277
2852 Ga0496104_0303283
2853 Ga0496104_0322350
2854 Ga0496104_0362524
2855 Ga0496105_0011205
2856 Ga0496105_0013422
2857 Ga0496105_0015800
2858 Ga0496105_0019532
2859 Ga0496105_0034013
2860 Ga0496105_0062282
2861 Ga0496105_0175327
2862 Ga0496105_0291129
2863 Ga0496106_0003446
2864 Ga0496106_0006865
2865 Ga0496106_0007383
2866 Ga0496106_0017314
2867 Ga0496106_0031297
2868 Ga0496106_0058706
2869 Ga0496106_0094631
2870 Ga0496106_0130932
2871 Ga0496106_0158517
2872 Ga0496107_0000509
2873 Ga0496107_0034178
2874 Ga0496107_0037811
2875 Ga0496107_0037820
2876 Ga0496108_0039234
2877 Ga0496108_0070491
2878 Ga0496108_0101833
2879 Ga0496108_0141329
2880 Ga0496108_0159941
2881 Ga0496109_0020639
2882 Ga0496109_0051292
2883 Ga0496109_0074608
2884 Ga0496109_0082674
2885 Ga0496109_0086401
2886 Ga0496109_0327342
2887 Ga0496110_0003123
2888 Ga0496110_0005741
2889 Ga0496110_0091790
2890 Ga0496110_0159652
2891 Ga0496110_0321195
2892 Ga0496110_0337214
2893 Ga0496111_0034236
2894 Ga0496111_0039373
2895 Ga0496111_0042463
2896 Ga0496111_0173154
2897 Ga0496111_0256530
2898 Ga0496112_0012582
2899 Ga0496112_0024108
2900 Ga0496112_0064719
2901 Ga0496112_0126632
2902 Ga0496112_0178060
2903 Ga0496112_0186684
2904 Ga0496112_0188030
2905 Ga0496112_0287838
2906 Ga0496112_0417522
2907 Ga0496113_0041662
2908 Ga0496113_0055757
2909 Ga0496113_0066166
2910 Ga0496113_0102680
2911 Ga0496113_0156050
2912 Ga0496113_0222184
2913 Ga0496113_0316048
2914 Ga0496114_0001306
2915 Ga0496114_0022402
2916 Ga0496114_0084963
2917 Ga0496114_0198573
2918 Ga0496114_0371093
2919 Ga0496115_0001250
2920 Ga0496115_0023466
2921 Ga0496115_0056055
2922 Ga0496115_0098174
2923 Ga0496115_0116508
2924 Ga0496115_0146012
2925 Ga0496115_0179206
2926 Ga0496117_0017488
2927 Ga0496117_0062933
2928 Ga0496118_0020990
2929 Ga0496118_0039136
2930 Ga0496118_0077455
2931 Ga0496118_0251433
2932 Ga0496119_0040669
2933 Ga0496119_0042593
2934 Ga0496119_0057347
2935 Ga0496119_0099423
2936 Ga0496119_0138407
2937 Ga0496120_0013345
2938 Ga0496121_0000927
2939 Ga0496121_0007064
2940 Ga0496121_0010667
2941 Ga0496121_0015737
2942 Ga0496121_0061566
2943 Ga0496121_0155804
2944 Ga0496121_0205975
2945 Ga0496121_0209073
2946 Ga0496121_0256326
2947 Ga0496124_0049273
2948 Ga0496124_0058635
2949 Ga0496124_0061641
2950 Ga0496124_0240865
2951 Ga0496125_0042169
2952 Ga0496125_0063623
2953 Ga0496125_0121414
2954 Ga0496125_0304141
2955 Ga0496126_0022004
2956 Ga0496126_0027336
2957 Ga0496126_0035592
2958 Ga0496126_0103819
2959 Ga0496126_0135129
2960 Ga0496126_0135967
2961 Ga0496126_0202331
2962 Ga0496126_0232203
2963 Ga0496126_0234965
2964 Ga0496126_0350508
2965 Ga0496126_0398398
2966 Ga0495682_0019019
2967 Ga0495682_0052153
2968 Ga0501031_0000398
2969 Ga0501031_0006934
2970 Ga0501031_0031248
2971 Ga0501032_0066313
2972 Ga0501032_0073505
2973 Ga0501032_0098657
2974 Ga0501033_0001316
2975 Ga0501033_0001463
2976 Ga0501033_0016180
2977 Ga0501033_0026599
2978 Ga0501033_0027952
2979 Ga0501033_0178464
2980 Ga0501033_0209494
2981 Ga0501034_0000072
2982 Ga0501034_0186662
2983 Ga0501034_0199578
2984 Ga0501034_0214716
2985 Ga0501034_0254182
2986 Ga0501034_0631845
2987 Ga0501036_0000050
2988 Ga0501036_0023850
2989 Ga0501036_0027119
2990 Ga0501036_0109654
2991 Ga0501036_0220338
2992 Ga0501036_0253779
2993 Ga0501037_0000030
2994 Ga0501037_0019157
2995 Ga0501037_0040958
2996 Ga0501037_0067050
2997 Ga0501037_0158463
2998 Ga0501037_0196762
2999 Ga0501038_0000039
3000 Ga0501038_0003573
3001 Ga0501038_0003903
3002 Ga0501038_0019522
3003 Ga0501038_0064610
3004 Ga0501038_0087612
3005 Ga0501038_0120846
3006 Ga0501038_0179009
3007 Ga0501039_0000060
3008 Ga0501039_0003437
3009 Ga0501039_0006389
3010 Ga0501039_0049810
3011 Ga0501039_0069222
3012 Ga0501039_0120324
3013 Ga0501039_0170764
3014 Ga0501042_0008343
3015 Ga0501042_0040413
3016 Ga0501043_0000980
3017 Ga0501043_0003512
3018 Ga0501043_0015596
3019 Ga0501043_0112845
3020 Ga0501046_0000419
3021 Ga0501046_0002900
3022 Ga0501046_0022009
3023 Ga0501047_0000174
3024 Ga0501047_0012410
3025 Ga0501047_0019117
3026 Ga0501047_0031187
3027 Ga0501047_0172472
3028 Ga0501047_0181618
3029 Ga0501047_0316665
3030 Ga0501048_0000068
3031 Ga0501048_0017640
3032 Ga0501048_0323580
3033 Ga0501067_0000068
3034 Ga0501067_0003637
3035 Ga0501067_0007709
3036 Ga0501067_0111382
3037 Ga0501067_0131537
3038 Ga0501068_0000949
3039 Ga0501068_0002589
3040 Ga0501068_0003549
3041 Ga0501069_0035352
3042 Ga0501070_0025353
3043 Ga0501070_0039676
3044 Ga0501070_0256961
3045 Ga0501071_0131428
3046 Ga0501072_0035557
3047 Ga0501072_0221508
3048 Ga0501073_0000009
3049 Ga0501073_0010592
3050 Ga0501073_0162995
3051 Ga0501073_0450101
3052 Ga0501074_0001057
3053 Ga0501074_0003293
3054 Ga0501074_0055835
3055 Ga0501077_0028394
3056 Ga0501079_0012968
3057 Ga0501079_0017176
3058 Ga0501079_0040305
3059 Ga0501080_0006205
3060 Ga0501080_0032682
3061 Ga0501080_0037424
3062 Ga0501080_0245242
3063 Ga0501080_0245636
3064 Ga0501083_0005994
3065 Ga0501083_0021673
3066 Ga0501083_0058662
3067 Ga0501035_0000067
3068 Ga0501035_0006796
3069 Ga0501035_0031489
3070 Ga0501035_0054807
3071 Ga0501035_0072940
3072 Ga0501035_0074309
3073 Ga0501035_0106024
3074 Ga0501035_0212386
3075 Ga0501035_0452169
3076 Ga0501044_0000258
3077 Ga0501044_0003604
3078 Ga0501044_0007503
3079 Ga0501044_0009609
3080 Ga0501044_0032713
3081 Ga0501044_0066602
3082 Ga0501044_0119538
3083 Ga0501044_0141974
3084 Ga0501044_0274006
3085 Ga0501044_0293875
3086 Ga0501044_0620766
3087 Ga0501045_0012008
3088 Ga0501045_0043356
3089 nmdc:mga03n38_71327_c1
3090 nmdc:mga00v17_50262_c1
3091 nmdc:mga00v17_59291_c1
3092 nmdc:mga0yw44_100540_c1
3093 nmdc:mga0yw44_31880_c1
3094 nmdc:mga0yw44_47176_c1
3095 nmdc:mga0yw44_87286_c1
3096 nmdc:mga0k408_41185_c1
3097 nmdc:mga06z11_33296_c1
3098 nmdc:mga04h51_105902_c1
3099 nmdc:mga07m45_16224_c2
3100 nmdc:mga05p37_151_c1
3101 nmdc:mga05p37_296846_c1
3102 nmdc:mga05p37_563132_c1
3103 nmdc:mga05p37_7272_c1
3104 nmdc:mga0qj67_9689_c1
3105 nmdc:mga06r32_755_c1
3106 nmdc:mga08y16_108_c1
3107 nmdc:mga08y16_2951_c1
3108 nmdc:mga0n895_24865_c1
3109 nmdc:mga0n895_25991_c1
3110 nmdc:mga0n895_265_c1
3111 nmdc:mga0n895_37633_c1
3112 nmdc:mga0rr50_12610_c1
3113 nmdc:mga0rr50_19659_c1
3114 nmdc:mga0rr50_642_c1
3115 nmdc:mga0a205_1049_c1
3116 nmdc:mga0a205_146_c1
3117 nmdc:mga0a205_21581_c1
3118 nmdc:mga0sz30_34108_c1
3119 nmdc:mga0sz30_40712_c2
3120 Ga0495601_0000355
3121 Ga0495601_0009169
3122 Ga0495601_0017539
3123 Ga0495601_0033848
3124 Ga0495601_0050959
3125 Ga0495601_0083171
3126 Ga0495601_0107560
3127 Ga0495601_0163327
3128 Ga0495601_0188965
3129 Ga0495601_0199885
3130 Ga0495612_0001097
3131 Ga0495612_0007774
3132 Ga0495612_0040958
3133 Ga0495612_0078568
3134 Ga0500635_0001974
3135 Ga0500635_0002613
3136 Ga0495655_0009734
3137 Ga0495595_0000554
3138 Ga0495595_0000637
3139 Ga0495595_0001043
3140 Ga0495595_0002582
3141 Ga0495595_0064823
3142 Ga0495619_0000048
3143 Ga0495619_0000256
3144 Ga0495619_0001080
3145 Ga0495619_0001353
3146 Ga0495619_0005007
3147 Ga0495619_0014512
3148 Ga0495619_0197915
3149 Ga0495619_0219931
3150 Ga0500578_0065579
3151 Ga0500643_000013
3152 Ga0500583_0056480
3153 Ga0500651_0038749
3154 Ga0500566_0001419
3155 Ga0500566_0012672
3156 Ga0500640_000253
3157 Ga0500641_0031622
3158 Ga0500554_003440
3159 Ga0500555_006750
3160 Ga0500572_000199
3161 Ga0500595_000842
3162 Ga0500595_007617
3163 Ga0500595_033593
3164 Ga0500607_076874
3165 Ga0500608_103967
3166 Ga0500614_000715
3167 Ga0500642_0020937
3168 Ga0500658_0011386
3169 Ga0500559_0001308
3170 Ga0500568_0014785
3171 Ga0500573_0008543
3172 Ga0500577_0109173
3173 Ga0500603_000226
3174 Ga0500604_0018512
3175 Ga0500616_0000028
3176 Ga0500619_072092
3177 Ga0500620_032573
3178 Ga0500627_0162643
3179 Ga0500630_000573
3180 Ga0500638_001609
3181 Ga0500639_000006
3182 Ga0500636_0000762
3183 Ga0500636_0013138
3184 Ga0500636_0030340
3185 Ga0500637_0000251
3186 Ga0500637_0003349
3187 Ga0500637_0187265
3188 Ga0500576_083610
3189 Ga0500657_054402
3190 Ga0500596_000603
3191 Ga0500596_011896
3192 Ga0500599_003944
3193 Ga0500601_000371
3194 Ga0501084_0006839
3195 Ga0501084_0007774
3196 Ga0501084_0034119
3197 Ga0501084_0354426
3198 Ga0500661_001477
3199 Ga0501082_0001593
3200 Ga0501082_0018224
3201 Ga0501082_0050188
3202 Ga0501082_0107881
3203 Ga0501082_0344249
3204 2507511877
3205 2508545541
3206 2508694359
3207 2509146623
3208 2513627760
3209 2513643305
3210 2513651094
3211 2513659238
3212 2513717791
3213 2513859041
3214 2513875299
3215 2513887729
3216 2513921882
3217 2514014405
3218 2515624710
3219 2517895963
3220 2528854956
3221 2617349629
3222 2617376815
3223 2644289771
3224 2671122757
3225 2745078535
3226 2793059632
3227 2793069607
3228 2793080290
3229 2805921874
3230 2818242190
3231 2824608016
3232 2824615056
3233 2824624849
3234 2824633745
3235 2824642308
3236 2824649646
3237 2824659530
3238 2824670058
3239 2824676704
3240 2824692995
3241 2824702578
3242 2824712400
3243 2824730051
3244 2824738292
3245 2824751731
3246 2824762426
3247 2824772739
3248 2824776990
3249 2838128391
3250 2841942251
3251 2841955619
3252 2841960960
3253 2841971228
3254 2841982348
3255 2841984265
3256 2842042003
3257 2842050046
3258 2844321094
3259 2847932305
3260 2847943540
3261 2849077263
3262 2874592257
3263 2874618720
3264 2874624010
3265 2874630982
3266 2874647373
3267 2876767415
3268 2876774784
3269 2876819737
3270 2879079352
3271 2879091530
3272 2879101398
3273 2879129086
3274 2879144759
3275 2881371130
3276 2881673238
3277 2885374060
3278 2885382990
3279 2888387387
3280 2888391816
3281 2888426608
3282 2903728517
3283 2903756067
3284 2904670721
3285 2904699115
3286 2904707118
3287 2904713672
3288 2906607709
3289 2906615567
3290 2906627114
3291 2906642015
3292 2906645374
3293 2906665001
3294 2908745612
3295 2908763684
3296 2908782713
3297 2922367287
3298 2922370558
3299 2922432439
3300 2929620134
3301 2929629447
3302 2932791489
3303 2932796892
3304 2932802330
3305 2932816745
3306 2932824073
3307 2932835391
3308 2933582051
3309 2935613480
3310 2935621134
3311 2935643559
3312 2935650476
3313 2935662918
3314 2935671131
3315 2935681263
3316 2935689394
3317 2935699969
3318 2935712100
3319 2935720340
3320 2935728043
3321 2935737360
3322 2935746579
3323 2935757546
3324 2935763923
3325 2935807900
3326 2935818766
3327 2935824667
3328 2935833076
3329 2935844268
3330 2935851887
3331 2935859673
3332 2935872071
3333 2935879005
3334 2935887230
3335 2935911237
3336 2935920769
3337 2935928266
3338 2935937911
3339 2935945193
3340 2935954301
3341 2935965620
3342 2935971431
3343 2935982051
3344 2935990610
3345 2936000352
3346 2936008510
3347 2936017168
3348 2936026697
3349 2936035440
3350 2936045576
3351 2936053589
3352 2936062667
3353 2940563632
3354 2941537270
3355 2941542600
3356 3005476600
3357 3005506906
3358 3005591713
3359 3005601434
3360 3005724125
3361 8006929468
3362 8006934886
3363 8006974854
3364 8016519488
3365 8016588685
3366 8016637185
3367 8017066034
3368 8019563773
3369 8019573838
3370 8019624150
3371 8019653671
3372 8019665806
3373 8019675332
3374 8019680772
3375 8019694995
3376 8055750113
3377 8056696200
3378 8056975892

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08501

Shikimate_dh_N

Shikimate dehydrogenase substrate binding domain

56

137

0.98

PF18317

SDH_C

Shikimate 5'-dehydrogenase C-terminal domain

287

312

0.95

PF01488

Shikimate_DH

Shikimate / quinate 5-dehydrogenase

165

242

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
2egg-assembly1.cif.gz_A crystal structure of shikimate 5-dehydrogenase (aroe) from geobacillus kaustophilus 0.9171 2 273
3sef-assembly2.cif.gz_C 2.4 angstrom resolution crystal structure of shikimate 5-dehydrogenase (aroe) from vibrio cholerae o1 biovar eltor str. n16961 in complex with shikimate and nadph 0.909 6 275
3jyo-assembly1.cif.gz_A quinate dehydrogenase from corynebacterium glutamicum in complex with nad 0.9062 6 273
3sef-assembly2.cif.gz_C 2.4 angstrom resolution crystal structure of shikimate 5-dehydrogenase (aroe) from vibrio cholerae o1 biovar eltor str. n16961 in complex with shikimate and nadph 0.8984 6 275
2cy0-assembly1.cif.gz_B crystal structure of shikimate 5-dehydrogenase (aroe) from thermus thermophilus hb8 in complex with nadp 0.8962 6 276
ID Description Score Start End Superfamily
af_Q2FXY1_2_97_3.40.50.10860 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 0.9412 8 100 3.40.50.10860
af_P0A6D5_8_104_1.10.560.10 Mainly Alpha;Orthogonal Bundle;GROEL; domain 1;GroEL-like equatorial domain 0.9398 6 100 1.10.560.10
af_P15770_4_98_2.40.10.10 Mainly Beta;Beta Barrel;Thrombin, subunit H;Trypsin-like serine proteases 0.9372 9 99 2.40.10.10
af_I6Y120_6_102_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9303 6 100 3.40.50.150
af_P0A6D5_3_112_3.40.50.10860 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 0.9275 1 108 3.40.50.10860
ID Description Score Start End GO Terms
AF-I5BWP7-F1-model_v4 Shikimate dehydrogenase (NADP(+)) (SDH) (EC 1.1.1.25) 0.9744 2 278 GO:0004764
GO:0005829
GO:0008652
GO:0009073
GO:0009117
GO:0009423
GO:0019632
GO:0047429
GO:0050661
AF-A0A2D5TG25-F1-model_v4 Shikimate dehydrogenase (NADP(+)) (SDH) (EC 1.1.1.25) 0.9733 6 271 GO:0004764
GO:0005829
GO:0008652
GO:0009073
GO:0009423
GO:0019632
GO:0050661
AF-A0A1M7E2Q4-F1-model_v4 Shikimate dehydrogenase (NADP(+)) (SDH) (EC 1.1.1.25) 0.9703 8 271 GO:0004764
GO:0005829
GO:0008652
GO:0009073
GO:0009423
GO:0019632
GO:0050661
AF-A0A520NVJ4-F1-model_v4 Shikimate dehydrogenase (NADP(+)) (SDH) (EC 1.1.1.25) 0.9686 2 274 GO:0004764
GO:0005829
GO:0008652
GO:0009073
GO:0009423
GO:0019632
GO:0050661
AF-A0A5C8SJ88-F1-model_v4 deleted 0.9685 1 278

Map