F495346

General Info

Members Datasets Scaffolds Average Seq Length
1689 705 3380 341

Family's Representative Sequence

Representative Sequence 3300044673|Ga0453683_0019366|Ga0453683_0019366_2188_3198
Length 336
Sequence MTQKRKIRIMDTTLRDGSHSVRHQYGADHVAKIAAALAKARIDTIEVTHGDGLGGSSIQYGFGKLSDQELLQAAKPVIGNSKLAVLLLPGIGIKEDLEMAYREGARVARIATHVTEADISAQHIELAKKIGMEVVGFLMLAHMVDPPKVLEQAKLMESYGADVVYVVDSAGAMVPDHVKSRVSPLVNQLKIKTGFHAHNNLGLAIGNTLAAIEEGVDVVDGSLAGMGAGAGNTPTEVLVAVLDKMGYETGVDLYAIMDAAEDVVRPLMQRPQVIDKAALSIGYAGVYSSFLLHTAKAAEKYKLDPRDILIELGKRKVVGGQEDMIVDVALELTRVR

Samples

Sample ID Description Type Environment
1 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
4 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
7 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
8 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
9 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
10 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
11 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
12 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
13 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
14 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
15 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
16 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
17 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
18 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
19 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
20 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
21 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
22 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
23 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
24 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
25 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
26 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
27 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
28 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
29 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
30 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
31 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
32 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
33 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
34 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
35 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
36 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
37 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
38 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
39 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
40 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
41 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
42 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
43 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
44 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
45 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
46 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
47 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
48 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
49 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
50 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
51 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
52 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
53 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
54 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
55 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
56 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
57 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
58 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
59 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
60 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
61 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
62 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
63 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
64 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
65 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
66 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
67 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
68 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
69 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
70 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
71 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
72 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
73 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
74 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
75 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
76 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
77 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
78 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
79 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
80 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
81 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
82 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
83 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
84 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
85 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
86 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
87 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
88 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
89 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
90 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
91 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
92 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
93 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
94 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
95 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
96 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
97 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
98 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
99 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
100 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
101 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
102 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
103 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
104 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
105 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
106 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
107 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
108 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
109 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
110 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
111 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
112 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
113 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
114 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
115 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
116 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
117 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
118 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
119 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
120 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
121 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
122 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
123 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
124 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
125 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
126 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
127 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
128 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
129 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
130 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
131 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
132 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
133 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
134 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
135 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
136 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
137 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
139 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
140 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
141 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
143 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
145 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
202 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
203 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
204 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
208 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
209 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
210 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
211 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
212 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
213 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
214 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
215 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
216 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
217 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
218 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
219 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
220 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
221 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
222 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
223 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
224 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
225 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
226 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
227 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
228 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
229 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
230 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
231 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
232 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
233 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
234 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
235 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
236 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
237 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
238 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
239 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
240 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
241 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
242 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
243 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
244 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
245 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
246 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
247 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
248 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
249 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
250 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
251 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
252 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
253 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
254 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
255 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
256 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
257 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
258 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
259 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
260 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
261 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
262 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
263 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
264 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
265 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
266 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
267 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
268 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
269 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
270 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
271 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
272 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
273 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
274 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
275 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
276 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
277 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
278 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
279 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
280 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
281 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
282 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
283 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
284 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
285 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
286 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
287 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
288 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
289 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
290 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
291 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
292 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
293 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
294 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
295 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
296 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
297 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
298 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
299 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
300 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
301 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
302 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
303 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
304 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
305 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
306 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
307 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
308 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
309 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
310 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
311 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
312 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
313 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
314 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
315 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
316 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
317 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
318 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
319 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
320 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
321 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
322 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
323 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
324 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
325 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
326 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
327 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
328 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
329 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
330 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
331 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
332 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
333 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
334 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
335 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
336 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
337 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
338 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
339 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
340 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
341 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
342 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
343 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
344 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
345 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
346 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
347 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
348 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
349 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
350 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
351 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
352 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
353 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
354 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
355 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
356 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
357 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
358 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
359 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
360 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
361 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
362 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
363 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
364 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
365 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
366 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
367 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
368 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
369 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
370 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
371 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
372 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
373 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
374 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
375 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
376 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
377 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
378 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
379 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
380 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
381 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
382 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
383 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
384 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
385 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
386 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
387 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
388 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
389 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
390 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
391 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
392 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
393 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
394 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
395 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
396 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
397 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
398 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
399 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
400 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
401 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
402 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
403 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
404 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
405 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
406 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
407 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
408 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
409 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
410 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
411 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
412 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
413 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
414 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
415 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
416 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
417 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
418 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
419 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
420 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
421 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
422 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
423 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
424 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
425 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
426 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
427 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
428 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
429 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
430 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
431 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
432 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
433 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
434 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
435 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
436 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
437 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
438 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
439 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
440 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
441 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
442 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
443 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
444 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
445 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
446 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
447 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
448 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
449 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
450 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
451 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
452 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
453 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
454 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
455 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
456 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
457 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
458 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
459 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
460 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
461 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
462 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
463 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
464 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
465 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
466 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
467 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
468 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
469 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
470 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
471 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
472 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
473 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
474 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
475 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
476 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
477 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
478 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
479 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
480 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
481 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
482 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
483 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
484 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
485 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
486 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
487 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
488 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
489 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
490 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
491 3300053734 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere Metagenome Endosphere
492 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
493 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
494 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
495 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
496 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
497 2506783011 Frankia datiscae Dg1 Isolate Nodule
498 2508501039 Frankia saprophytica CN3 Isolate Nodule
499 2511231006 Pseudomonas sp. GM17 Isolate Nodule
500 2511231007 Pseudomonas sp. GM18 Isolate Nodule
501 2511231010 Pseudomonas sp. GM25 Isolate Nodule
502 2511231012 Pseudomonas sp. GM33 Isolate Nodule
503 2511231014 Pseudomonas sp. GM48 Isolate Nodule
504 2511231015 Pseudomonas sp. GM49 Isolate Nodule
505 2511231017 Pseudomonas sp. GM55 Isolate Nodule
506 2511231020 Pseudomonas sp. GM74 Isolate Nodule
507 2511231021 Pseudomonas sp. GM78 Isolate Nodule
508 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
509 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
510 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
511 2517572101 Frankia sp. DC12 Isolate Nodule
512 2524023250 Niveispirillum irakense DSM 11586 Isolate Unclassified
513 2547132103 Chromobacterium sp. C-61 Isolate Rhizosphere
514 2547132424 Nocardia nova SH22a Isolate Unclassified
515 2558860280 Kutzneria sp. 744 Isolate Unclassified
516 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
517 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
518 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
519 2585428157 Microbacterium sp. CF335 Isolate Rhizosphere
520 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
521 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
522 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
523 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
524 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
525 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
526 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
527 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
528 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
529 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
530 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
531 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
532 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
533 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
534 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
535 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
536 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
537 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
538 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
539 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
540 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
541 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
542 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
543 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
544 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
545 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
546 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
547 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
548 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
549 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
550 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
551 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
552 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
553 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
554 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
555 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
556 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
557 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
558 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
559 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
560 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
561 2636415599 Klebsiella variicola DX120E Isolate Unclassified
562 2643221549 Agromyces sp. Root1464 Isolate Unclassified
563 2643221558 Rhizobium sp. Root149 Isolate Unclassified
564 2643221561 Nocardioides sp. Root151 Isolate Unclassified
565 2643221566 Microbacterium sp. Root166 Isolate Unclassified
566 2643221578 Streptomyces sp. Root63 Isolate Unclassified
567 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
568 2643221604 Nocardioides sp. Root190 Isolate Unclassified
569 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
570 2643221615 Nocardioides sp. Root224 Isolate Unclassified
571 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
572 2643221630 Microbacterium sp. Root322 Isolate Unclassified
573 2643221649 Leifsonia sp. Root4 Isolate Unclassified
574 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
575 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
576 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
577 2643221696 Nocardioides sp. Root140 Isolate Unclassified
578 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
579 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
580 2684623035 Frankia sp. NRRL B-16219 Isolate Rhizosphere
581 2687453737 Frankia sp. BMG5.36 Isolate Nodule
582 2687453743 Frankia colletiae Cc1.17 Isolate Nodule
583 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
584 2721755702 Agromyces sp. AR33 Isolate Rhizosphere
585 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
586 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
587 2738541272 Promicromonospora sp. AC04 Isolate Unclassified
588 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
589 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
590 2738541307 Variovorax sp. GV008 Isolate Unclassified
591 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
592 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
593 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
594 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
595 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
596 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
597 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
598 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
599 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
600 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
601 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
602 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
603 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
604 2773857933 Frankia sp. BMG5.30 Isolate Nodule
605 2775506735 Arthrobacter sp. S95 1704 Isolate Unclassified
606 2775506925 Saccharopolyspora phatthalungensis NRRL B-24798 Isolate Rhizosphere
607 2775507074 Klebsiella sp. D5A Isolate Unclassified
608 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
609 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
610 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
611 2791355199
612 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
613 2808606372 Agromyces sp. 23-23 Isolate Unclassified
614 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
615 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
616 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
617 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
618 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
619 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
620 2818991462 Terrabacter sp. 3264 Isolate Rhizosphere
621 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
622 2843690924 Chromobacterium rhizoryzae JP2-74 Isolate Rhizosphere
623 2852103415 Edaphovirga cremea DSM 105170 Isolate Rhizosphere
624 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
625 2858688981 Cupriavidus sp. UYMMa02A Isolate Unclassified
626 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
627 2862574272 Streptomyces sp. AcE210 Isolate Nodule
628 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
629 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
630 2870628048 Microbacterium thalassium DSM 12511 Isolate Rhizosphere
631 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
632 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
633 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
634 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
635 2885266251 Ralstonia sp. SET104 Isolate Nodule
636 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
637 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
638 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
639 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
640 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
641 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
642 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
643 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
644 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
645 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
646 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
647 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
648 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
649 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
650 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
651 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
652 2915358134 Pseudonocardia pini CAP47R Isolate Unclassified
653 2919051321 Sinomonas atrocyanea 1003 Isolate Rhizosphere
654 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
655 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
656 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
657 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
658 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
659 2922554459 Rhodococcus sp. 66b Isolate Unclassified
660 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
661 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
662 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
663 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
664 2935409751 Agromyces sp. PvR057 Isolate Rhizosphere
665 2939573065 Citrobacter sp. 506 Isolate Rhizosphere
666 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
667 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
668 2941485952 Brevundimonas faecalis 2814 Isolate Rhizosphere
669 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
670 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
671 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
672 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
673 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
674 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
675 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
676 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
677 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
678 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
679 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
680 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
681 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
682 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
683 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
684 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
685 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
686 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
687 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
688 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
689 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
690 8002784119 Frankia sp. AgB1.9 Isolate Nodule
691 8004212874 Microbacterium sp. NC79 Isolate Rhizosphere
692 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
693 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
694 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
695 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
696 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
697 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
698 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
699 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
700 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
701 8048746797 Alcaligenes endophyticus DSM 100498 Isolate Unclassified
702 8054002106 Azospirillum lipoferum 59b Isolate Unclassified
703 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule
704 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
705 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 86.08
Metatranscriptomes 0.18
Isolates 13.74

Biome Distribution

Category Percentage (%)
Aerial Root 0.24
Bulb 0
Endosphere 8.41
Nodule 2.25
Rhizoplane 5.33
Rhizosphere 71.94
Stem 0
Stem Tuber 0
Unclassified 0.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0453683_0019366 3300044673 Bacteria 4361
2 LJQas_1006075 3300000549 Bacteria 1512
3 JGI24736J21556_1001110 3300001904 Bacteria 4918
4 JGI24741J21665_1000113 3300001915 Bacteria 21885
5 JGI24740J21852_10000711 3300001979 Bacteria 14441
6 JGI24740J21852_10002626 3300001979 Bacteria 8094
7 JGI24740J21852_10002683 3300001979 Bacteria 7986
8 JGI24740J21852_10004751 3300001979 Bacteria 5804
9 JGI24740J21852_10009903 3300001979 Bacteria 3700
10 JGI24739J22299_10004028 3300001989 Bacteria 5620
11 JGI24739J22299_10004360 3300001989 Bacteria 5420
12 JGI24739J22299_10014764 3300001989 Bacteria 2840
13 JGI24737J22298_10007873 3300001990 Bacteria 3589
14 JGI24737J22298_10013837 3300001990 Bacteria 2624
15 JGI24735J21928_10011021 3300002067 Bacteria 2871
16 JGI24735J21928_10017697 3300002067 Bacteria 2202
17 JGI24750J21931_1002100 3300002070 Bacteria 2422
18 JGI24745J21846_1001283 3300002073 Bacteria 2427
19 JGI24738J21930_10000132 3300002075 Bacteria 18200
20 JGI24738J21930_10004974 3300002075 Bacteria 3217
21 JGI24749J21850_1004251 3300002076 Bacteria 2001
22 JGI24749J21850_1006511 3300002076 Bacteria 1627
23 JGI24744J21845_10000214 3300002077 Bacteria 9078
24 JGI24742J22300_10000517 3300002244 Bacteria 5750
25 JGI24751J29686_10012933 3300002459 Bacteria 1723
26 JGI24751J29686_10017101 3300002459 Bacteria 1498
27 JGI25154J39366_1000680 3300002738 Bacteria 15719
28 JGI25151J46595_10006212 3300003187 Bacteria 6044
29 JGI25406J46586_10004639 3300003203 Bacteria 6397
30 rootH1_10005611 3300003316 Bacteria 17859
31 rootH1_10005611 3300003323 Bacteria 26216
32 rootL2_10011255 3300003322 Bacteria 1538
33 rootL2_10024094 3300003322 Bacteria 17301
34 rootH1_10007244 3300003316 Bacteria 1760
35 rootH1_10007244 3300003323 Bacteria 12965
36 rootH1_10018354 3300003323 Bacteria 16678
37 Ga0006562J51391_1047977 3300003578 Bacteria 3722
38 Ga0006562J51391_1047978 3300003578 Bacteria 3020
39 Ga0055534_1008400 3300003784 Bacteria 2341
40 Ga0055530_10000093 3300003791 Bacteria 77624
41 Ga0055530_10000104 3300003791 Bacteria 72163
42 Ga0055530_10006899 3300003791 Bacteria 4921
43 Ga0055530_10013286 3300003791 Bacteria 2818
44 Ga0055540_1000104 3300003792 Bacteria 93795
45 Ga0055540_1000335 3300003792 Bacteria 40623
46 Ga0055540_1000374 3300003792 Bacteria 37462
47 Ga0055531_10000432 3300003794 Bacteria 39735
48 Ga0055531_10000475 3300003794 Bacteria 37156
49 Ga0055531_10000798 3300003794 Bacteria 26114
50 Ga0065714_10002253 3300005288 Bacteria 35579
51 Ga0065714_10002318 3300005288 Bacteria 24919
52 Ga0065714_10071256 3300005288 Bacteria 3624
53 Ga0065714_10072687 3300005288 Bacteria 3324
54 Ga0065707_10158656 3300005295 Bacteria 1584
55 Ga0070658_10002591 3300005327 Bacteria 15066
56 Ga0070658_10006024 3300005327 Bacteria 9839
57 Ga0070658_10085040 3300005327 Bacteria 2601
58 Ga0070683_100058031 3300005329 Bacteria 3596
59 Ga0070670_100035314 3300005331 Bacteria 4304
60 Ga0068869_100058671 3300005334 Bacteria 2815
61 Ga0070666_10038372 3300005335 Bacteria 3187
62 Ga0070680_100089435 3300005336 Bacteria 2548
63 Ga0070682_100177234 3300005337 Bacteria 1486
64 Ga0068868_100096800 3300005338 Bacteria 2384
65 Ga0068868_100211149 3300005338 Bacteria 1622
66 Ga0070660_100019900 3300005339 Bacteria 4925
67 Ga0070660_100068276 3300005339 Bacteria 2770
68 Ga0070687_100036621 3300005343 Bacteria 2446
69 Ga0070661_100017643 3300005344 Bacteria 5065
70 Ga0070661_100037246 3300005344 Bacteria 3538
71 Ga0070692_10040316 3300005345 Bacteria 2388
72 Ga0070668_100012270 3300005347 Bacteria 6384
73 Ga0070668_100298556 3300005347 Bacteria 1350
74 Ga0070669_100153879 3300005353 Bacteria 1782
75 Ga0070673_100066340 3300005364 Bacteria 2882
76 Ga0070659_100014358 3300005366 Bacteria 5917
77 Ga0070659_100016108 3300005366 Bacteria 5609
78 Ga0070659_100040971 3300005366 Bacteria 3619
79 Ga0070659_100097415 3300005366 Bacteria 2364
80 Ga0070667_100001179 3300005367 Bacteria 23784
81 Ga0070667_100143708 3300005367 Bacteria 2091
82 Ga0070667_100459785 3300005367 Bacteria 1164
83 Ga0070709_10013047 3300005434 Bacteria 4665
84 Ga0070709_10039557 3300005434 Bacteria 2894
85 Ga0070709_10074903 3300005434 Bacteria 2194
86 Ga0070714_100010158 3300005435 Bacteria 7430
87 Ga0070714_100061288 3300005435 Bacteria 3230
88 Ga0070714_100126052 3300005435 Bacteria 2283
89 Ga0070713_100086281 3300005436 Bacteria 2691
90 Ga0070713_100091314 3300005436 Bacteria 2620
91 Ga0070711_100017440 3300005439 Bacteria 4572
92 Ga0070711_100196943 3300005439 Bacteria 1552
93 Ga0070700_100233018 3300005441 Bacteria 1311
94 Ga0070708_100109310 3300005445 Bacteria 2540
95 Ga0070663_100001457 3300005455 Bacteria 12998
96 Ga0070663_100005366 3300005455 Bacteria 7611
97 Ga0070663_100171543 3300005455 Bacteria 1677
98 Ga0070662_100002546 3300005457 Bacteria 11224
99 Ga0070662_100040010 3300005457 Bacteria 3336
100 Ga0070662_100068871 3300005457 Bacteria 2603
101 Ga0070662_100109535 3300005457 Bacteria 2102
102 Ga0070662_100127245 3300005457 Bacteria 1960
103 Ga0070681_10023386 3300005458 Bacteria 6214
104 Ga0070706_100017747 3300005467 Bacteria 6567
105 Ga0070698_100024948 3300005471 Bacteria 6232
106 Ga0070698_100052415 3300005471 Bacteria 4150
107 Ga0070698_100094493 3300005471 Bacteria 2969
108 Ga0070679_100005894 3300005530 Bacteria 11386
109 Ga0070679_100389841 3300005530 Bacteria 1339
110 Ga0070679_100441610 3300005530 Bacteria 1246
111 Ga0070684_100042291 3300005535 Bacteria 3933
112 Ga0068853_100034643 3300005539 Bacteria 4286
113 Ga0068853_100094831 3300005539 Bacteria 2630
114 Ga0068853_100101111 3300005539 Bacteria 2549
115 Ga0068853_100120002 3300005539 Bacteria 2344
116 Ga0068853_100496487 3300005539 Bacteria 1152
117 Ga0070672_100240562 3300005543 Bacteria 1522
118 Ga0070686_100068812 3300005544 Bacteria 2310
119 Ga0070695_100022082 3300005545 Bacteria 3900
120 Ga0070665_100005167 3300005548 Bacteria 13507
121 Ga0070665_100096194 3300005548 Bacteria 2966
122 Ga0070665_100405076 3300005548 Bacteria 1372
123 Ga0070704_100052742 3300005549 Bacteria 2871
124 Ga0068855_100017817 3300005563 Bacteria 8538
125 Ga0068855_100073278 3300005563 Bacteria 3979
126 Ga0068855_100178472 3300005563 Bacteria 2402
127 Ga0068855_100639185 3300005563 Bacteria 1144
128 Ga0068857_100010913 3300005577 Bacteria 7908
129 Ga0068857_100070185 3300005577 Bacteria 3120
130 Ga0068854_100001955 3300005578 Bacteria 12590
131 Ga0068854_100010954 3300005578 Bacteria 5884
132 Ga0068854_100209882 3300005578 Bacteria 1535
133 Ga0068856_100001670 3300005614 Bacteria 23234
134 Ga0068856_100001903 3300005614 Bacteria 21771
135 Ga0068856_100004825 3300005614 Bacteria 13365
136 Ga0068856_100031379 3300005614 Bacteria 5198
137 Ga0068856_100124584 3300005614 Bacteria 2579
138 Ga0068852_100004005 3300005616 Bacteria 10362
139 Ga0068852_100010518 3300005616 Bacteria 6920
140 Ga0068852_100062126 3300005616 Bacteria 3248
141 Ga0068859_100062248 3300005617 Bacteria 3761
142 Ga0068859_100410724 3300005617 Bacteria 1450
143 Ga0068861_100162040 3300005719 Bacteria 1846
144 Ga0068851_10012360 3300005834 Bacteria 4023
145 Ga0068851_10014265 3300005834 Bacteria 3771
146 Ga0068851_10015819 3300005834 Bacteria 3600
147 Ga0068851_10046099 3300005834 Bacteria 2205
148 Ga0068863_100000884 3300005841 Bacteria 30131
149 Ga0068858_100000071 3300005842 Bacteria 105192
150 Ga0068858_100194908 3300005842 Bacteria 1914
151 Ga0068860_100002624 3300005843 Bacteria 18691
152 Ga0068862_100001916 3300005844 Bacteria 18895
153 Ga0068862_100081877 3300005844 Bacteria 2800
154 Ga0068862_100518719 3300005844 Bacteria 1134
155 Ga0081455_10000072 3300005937 Bacteria 108040
156 Ga0081455_10000942 3300005937 Bacteria 37176
157 Ga0081455_10049061 3300005937 Bacteria 3641
158 Ga0081455_10061316 3300005937 Bacteria 3165
159 Ga0081538_10005332 3300005981 Bacteria 11574
160 Ga0081540_1000803 3300005983 Bacteria 28862
161 Ga0081540_1056346 3300005983 Bacteria 1908
162 Ga0081540_1063790 3300005983 Bacteria 1742
163 Ga0081539_10000926 3300005985 Bacteria 55157
164 Ga0081539_10001862 3300005985 Bacteria 33219
165 Ga0081539_10002207 3300005985 Bacteria 28464
166 Ga0081539_10057026 3300005985 Bacteria 2164
167 Ga0081539_10102173 3300005985 Bacteria 1459
168 Ga0070717_10003368 3300006028 Bacteria 11417
169 Ga0075365_10000382 3300006038 Bacteria 16205
170 Ga0075365_10007998 3300006038 Bacteria 5968
171 Ga0075365_10009039 3300006038 Bacteria 5699
172 Ga0075365_10021267 3300006038 Bacteria 4044
173 Ga0075365_10024844 3300006038 Bacteria 3786
174 Ga0075365_10048223 3300006038 Bacteria 2803
175 Ga0075365_10240302 3300006038 Bacteria 1272
176 Ga0075368_10029108 3300006042 Bacteria 2135
177 Ga0075363_100019796 3300006048 Bacteria 3369
178 Ga0075363_100028448 3300006048 Bacteria 2875
179 Ga0075363_100033837 3300006048 Bacteria 2665
180 Ga0075363_100062426 3300006048 Bacteria 2009
181 Ga0075364_10001406 3300006051 Bacteria 13032
182 Ga0075364_10027911 3300006051 Bacteria 3609
183 Ga0075364_10033429 3300006051 Bacteria 3312
184 Ga0075364_10035089 3300006051 Bacteria 3240
185 Ga0075364_10050527 3300006051 Bacteria 2714
186 Ga0075364_10086976 3300006051 Bacteria 2071
187 Ga0075364_10137730 3300006051 Bacteria 1641
188 Ga0075432_10000250 3300006058 Bacteria 14598
189 Ga0075432_10064286 3300006058 Bacteria 1310
190 Ga0070715_10001319 3300006163 Bacteria 7149
191 Ga0070716_100002397 3300006173 Bacteria 8633
192 Ga0070712_100005544 3300006175 Bacteria 7809
193 Ga0070712_100022764 3300006175 Bacteria 4130
194 Ga0070712_100079503 3300006175 Bacteria 2370
195 Ga0075362_10000258 3300006177 Bacteria 14780
196 Ga0075362_10033344 3300006177 Bacteria 2239
197 Ga0075362_10037781 3300006177 Bacteria 2119
198 Ga0075362_10053428 3300006177 Bacteria 1813
199 Ga0075362_10094356 3300006177 Bacteria 1392
200 Ga0075367_10000249 3300006178 Bacteria 18331
201 Ga0075367_10000257 3300006178 Bacteria 18119
202 Ga0075367_10003322 3300006178 Bacteria 7637
203 Ga0075367_10053919 3300006178 Bacteria 2383
204 Ga0075367_10164293 3300006178 Bacteria 1381
205 Ga0075369_10003467 3300006186 Bacteria 5743
206 Ga0075369_10027436 3300006186 Bacteria 2380
207 Ga0075369_10051857 3300006186 Bacteria 1777
208 Ga0075369_10079529 3300006186 Bacteria 1452
209 Ga0075369_10083844 3300006186 Bacteria 1416
210 Ga0075366_10000691 3300006195 Bacteria 15970
211 Ga0075366_10002546 3300006195 Bacteria 9373
212 Ga0075366_10108758 3300006195 Bacteria 1667
213 Ga0075370_10000455 3300006353 Bacteria 15290
214 Ga0075370_10000589 3300006353 Bacteria 14025
215 Ga0075370_10000848 3300006353 Bacteria 12388
216 Ga0075370_10001354 3300006353 Bacteria 10555
217 Ga0075428_100000014 3300006844 Bacteria 166411
218 Ga0075430_100032200 3300006846 Bacteria 4451
219 Ga0075430_100090235 3300006846 Bacteria 2564
220 Ga0075430_100094610 3300006846 Bacteria 2498
221 Ga0075434_100010087 3300006871 Bacteria 8845
222 Ga0075434_100220638 3300006871 Bacteria 1916
223 Ga0075429_100203733 3300006880 Unclassified 1734
224 Ga0075436_100021640 3300006914 Bacteria 4414
225 Ga0097620_100062248 3300006931 Bacteria 3761
226 Ga0097620_100410757 3300006931 Bacteria 1450
227 Ga0079104_1002857 3300006946 Bacteria 8652
228 Ga0079104_1003799 3300006946 Bacteria 6791
229 Ga0079104_1023539 3300006946 Bacteria 1637
230 Ga0099826_10011905 3300006948 Bacteria 6553
231 Ga0075435_100015300 3300007076 Bacteria 5765
232 Ga0105251_10046942 3300009011 Bacteria 2076
233 Ga0105251_10066983 3300009011 Bacteria 1678
234 Ga0105244_10000488 3300009036 Bacteria 35867
235 Ga0105244_10009031 3300009036 Bacteria 6167
236 Ga0105244_10023365 3300009036 Bacteria 3390
237 Ga0105250_10000052 3300009092 Bacteria 116382
238 Ga0105250_10030697 3300009092 Bacteria 2160
239 Ga0105240_10001140 3300009093 Bacteria 46522
240 Ga0105240_10018798 3300009093 Bacteria 9258
241 Ga0105240_10021903 3300009093 Bacteria 8489
242 Ga0105240_10023949 3300009093 Bacteria 8064
243 Ga0105240_10076538 3300009093 Bacteria 4124
244 Ga0105240_10077435 3300009093 Bacteria 4097
245 Ga0105240_10086545 3300009093 Bacteria 3838
246 Ga0105240_10093850 3300009093 Bacteria 3662
247 Ga0105240_10100206 3300009093 Bacteria 3525
248 Ga0105240_10103573 3300009093 Bacteria 3457
249 Ga0105240_10144154 3300009093 Bacteria 2844
250 Ga0105240_10160150 3300009093 Bacteria 2674
251 Ga0105240_10326952 3300009093 Bacteria 1746
252 Ga0111539_10000019 3300009094 Bacteria 266927
253 Ga0111539_10275603 3300009094 Bacteria 1958
254 Ga0105245_10603499 3300009098 Bacteria 1124
255 Ga0114129_10019234 3300009147 Bacteria 9728
256 Ga0105243_10003676 3300009148 Bacteria 12326
257 Ga0105243_10013641 3300009148 Bacteria 6147
258 Ga0105243_10224913 3300009148 Bacteria 1661
259 Ga0105241_10000004 3300009174 Bacteria 803007
260 Ga0105241_10000897 3300009174 Bacteria 22503
261 Ga0105241_10004450 3300009174 Bacteria 10363
262 Ga0105241_10023205 3300009174 Bacteria 4599
263 Ga0105241_10103152 3300009174 Bacteria 2271
264 Ga0105241_10111705 3300009174 Bacteria 2188
265 Ga0105242_10128315 3300009176 Bacteria 2185
266 Ga0105248_10000450 3300009177 Bacteria 46809
267 Ga0105237_10000874 3300009545 Bacteria 40867
268 Ga0105237_10001013 3300009545 Bacteria 37790
269 Ga0105237_10001636 3300009545 Bacteria 29088
270 Ga0105237_10019441 3300009545 Bacteria 7014
271 Ga0105237_10028483 3300009545 Bacteria 5689
272 Ga0105237_10036578 3300009545 Bacteria 4969
273 Ga0105237_10042233 3300009545 Bacteria 4599
274 Ga0105237_10055888 3300009545 Bacteria 3952
275 Ga0105237_10168910 3300009545 Bacteria 2187
276 Ga0105237_10329919 3300009545 Bacteria 1530
277 Ga0105238_10000514 3300009551 Bacteria 40634
278 Ga0105238_10011534 3300009551 Bacteria 8903
279 Ga0105238_10019463 3300009551 Bacteria 6914
280 Ga0105238_10022891 3300009551 Bacteria 6369
281 Ga0105238_10030906 3300009551 Bacteria 5450
282 Ga0105238_10056949 3300009551 Bacteria 3920
283 Ga0105238_10159496 3300009551 Bacteria 2231
284 Ga0105238_10168284 3300009551 Bacteria 2168
285 Ga0105249_10000439 3300009553 Bacteria 39200
286 Ga0105249_10014870 3300009553 Bacteria 6883
287 Ga0105249_10019951 3300009553 Bacteria 5985
288 Ga0105249_10132765 3300009553 Bacteria 2379
289 Ga0105239_10000113 3300010375 Bacteria 114562
290 Ga0105239_10000626 3300010375 Bacteria 50329
291 Ga0105239_10001157 3300010375 Bacteria 36242
292 Ga0105239_10003283 3300010375 Bacteria 19951
293 Ga0105239_10006533 3300010375 Bacteria 13509
294 Ga0105239_10007549 3300010375 Bacteria 12474
295 Ga0105239_10011168 3300010375 Bacteria 10022
296 Ga0105239_10019695 3300010375 Bacteria 7447
297 Ga0105239_10021350 3300010375 Bacteria 7140
298 Ga0105239_10031465 3300010375 Bacteria 5835
299 Ga0105239_10037487 3300010375 Bacteria 5313
300 Ga0105239_10040307 3300010375 Bacteria 5117
301 Ga0105239_10153076 3300010375 Bacteria 2574
302 Ga0105239_10166869 3300010375 Bacteria 2462
303 Ga0105239_10360114 3300010375 Bacteria 1643
304 Ga0105246_10033362 3300011119 Bacteria 3422
305 Ga0105246_10062811 3300011119 Bacteria 2588
306 Ga0157373_10002444 3300013100 Bacteria 14139
307 Ga0157373_10004285 3300013100 Bacteria 10736
308 Ga0157371_10000776 3300013102 Bacteria 36737
309 Ga0157371_10006002 3300013102 Bacteria 10126
310 Ga0157370_10004423 3300013104 Bacteria 16103
311 Ga0157370_10009299 3300013104 Bacteria 10522
312 Ga0157370_10016479 3300013104 Bacteria 7479
313 Ga0157370_10017127 3300013104 Bacteria 7317
314 Ga0157369_10008980 3300013105 Bacteria 11450
315 Ga0157369_10073351 3300013105 Bacteria 3672
316 Ga0157369_10264853 3300013105 Bacteria 1792
317 Ga0157374_10142773 3300013296 Bacteria 2324
318 Ga0163162_10319926 3300013306 Bacteria 1684
319 Ga0157372_10002002 3300013307 Bacteria 22134
320 Ga0157372_10004609 3300013307 Bacteria 14656
321 Ga0157372_10021286 3300013307 Bacteria 7004
322 Ga0157372_10045106 3300013307 Bacteria 4888
323 Ga0157372_10653592 3300013307 Bacteria 1224
324 Ga0157375_10000312 3300013308 Bacteria 43933
325 Ga0157375_10107544 3300013308 Bacteria 2883
326 Ga0157375_10145300 3300013308 Bacteria 2502
327 Ga0163163_10000004 3300014325 Bacteria 416569
328 Ga0163163_10171930 3300014325 Bacteria 2213
329 Ga0163163_10300813 3300014325 Bacteria 1657
330 Ga0157380_10266818 3300014326 Bacteria 1558
331 Ga0157380_10339860 3300014326 Bacteria 1400
332 Ga0182008_10000353 3300014497 Bacteria 35789
333 Ga0182008_10001321 3300014497 Bacteria 16896
334 Ga0157379_10000015 3300014968 Bacteria 104289
335 Ga0157379_10000284 3300014968 Bacteria 40135
336 Ga0157379_10106140 3300014968 Bacteria 2521
337 Ga0157376_10044652 3300014969 Bacteria 3644
338 Ga0182006_1001200 3300015261 Bacteria 16189
339 Ga0163161_10000201 3300017792 Bacteria 54704
340 Ga0163161_10002299 3300017792 Bacteria 13707
341 Ga0163161_10018606 3300017792 Bacteria 4868
342 Ga0163161_10024418 3300017792 Bacteria 4270
343 Ga0163161_10048305 3300017792 Bacteria 3073
344 Ga0163161_10055743 3300017792 Bacteria 2869
345 Ga0206354_11589331 3300020081 Bacteria 1377
346 Ga0213872_10004853 3300021361 Bacteria 7016
347 Ga0209147_100156 3300025229 Bacteria 93105
348 Ga0209147_100430 3300025229 Bacteria 27091
349 Ga0209646_1000049 3300025246 Bacteria 301924
350 Ga0209673_1028864 3300025273 Bacteria 1778
351 Ga0209675_1000132 3300025291 Bacteria 102062
352 Ga0209676_1000118 3300025292 Bacteria 201939
353 Ga0209676_1000779 3300025292 Bacteria 42577
354 Ga0209676_1006141 3300025292 Bacteria 6023
355 Ga0209676_1035842 3300025292 Bacteria 1450
356 Ga0209025_1000029 3300025294 Bacteria 488571
357 Ga0209050_1000115 3300025298 Bacteria 204622
358 Ga0209050_1000148 3300025298 Bacteria 164093
359 Ga0209050_1000412 3300025298 Bacteria 79647
360 Ga0209050_1001181 3300025298 Bacteria 30804
361 Ga0207426_1006425 3300025302 Bacteria 5119
362 Ga0209051_1000150 3300025303 Bacteria 132005
363 Ga0209051_1000231 3300025303 Bacteria 93859
364 Ga0209051_1000294 3300025303 Bacteria 79686
365 Ga0209051_1005966 3300025303 Bacteria 6967
366 Ga0209051_1013164 3300025303 Bacteria 3953
367 Ga0209051_1045640 3300025303 Bacteria 1514
368 Ga0209257_1000160 3300025304 Bacteria 177175
369 Ga0209257_1000275 3300025304 Bacteria 116952
370 Ga0207656_10002772 3300025321 Bacteria 5949
371 Ga0207656_10010781 3300025321 Bacteria 3435
372 Ga0207696_1000003 3300025711 Bacteria 860639
373 Ga0207655_1000022 3300025728 Bacteria 483933
374 Ga0207655_1006740 3300025728 Bacteria 7561
375 Ga0207655_1022408 3300025728 Bacteria 3167
376 Ga0207655_1029269 3300025728 Bacteria 2581
377 Ga0207655_1035585 3300025728 Bacteria 2221
378 Ga0207713_1000093 3300025735 Bacteria 146199
379 Ga0207692_10023138 3300025898 Bacteria 2869
380 Ga0207642_10038024 3300025899 Bacteria 2079
381 Ga0207710_10039827 3300025900 Bacteria 2081
382 Ga0207688_10015128 3300025901 Bacteria 4185
383 Ga0207688_10016838 3300025901 Bacteria 3969
384 Ga0207680_10017843 3300025903 Bacteria 3758
385 Ga0207647_10001831 3300025904 Bacteria 16309
386 Ga0207647_10003420 3300025904 Bacteria 11902
387 Ga0207647_10015326 3300025904 Bacteria 5259
388 Ga0207647_10023664 3300025904 Bacteria 4059
389 Ga0207685_10014285 3300025905 Bacteria 2482
390 Ga0207699_10023992 3300025906 Bacteria 3328
391 Ga0207699_10024826 3300025906 Bacteria 3283
392 Ga0207699_10115784 3300025906 Bacteria 1725
393 Ga0207645_10006008 3300025907 Bacteria 8732
394 Ga0207643_10088240 3300025908 Bacteria 1805
395 Ga0207705_10008265 3300025909 Bacteria 7604
396 Ga0207705_10070773 3300025909 Bacteria 2528
397 Ga0207684_10055485 3300025910 Bacteria 3361
398 Ga0207654_10000006 3300025911 Bacteria 815027
399 Ga0207654_10000069 3300025911 Bacteria 67460
400 Ga0207654_10000383 3300025911 Bacteria 25754
401 Ga0207654_10006919 3300025911 Bacteria 5712
402 Ga0207654_10028403 3300025911 Bacteria 3049
403 Ga0207654_10045006 3300025911 Bacteria 2510
404 Ga0207707_10077753 3300025912 Bacteria 2897
405 Ga0207695_10000936 3300025913 Bacteria 52151
406 Ga0207695_10008781 3300025913 Bacteria 12600
407 Ga0207695_10008866 3300025913 Bacteria 12526
408 Ga0207695_10020466 3300025913 Bacteria 7576
409 Ga0207695_10032104 3300025913 Bacteria 5750
410 Ga0207695_10055228 3300025913 Bacteria 4140
411 Ga0207695_10056256 3300025913 Bacteria 4094
412 Ga0207695_10255339 3300025913 Bacteria 1652
413 Ga0207671_10000702 3300025914 Bacteria 43116
414 Ga0207671_10000759 3300025914 Bacteria 40972
415 Ga0207671_10001691 3300025914 Bacteria 24991
416 Ga0207671_10010953 3300025914 Bacteria 7430
417 Ga0207671_10156617 3300025914 Bacteria 1762
418 Ga0207693_10004892 3300025915 Bacteria 11257
419 Ga0207693_10004935 3300025915 Bacteria 11209
420 Ga0207693_10005274 3300025915 Bacteria 10809
421 Ga0207693_10106318 3300025915 Bacteria 2201
422 Ga0207663_10081169 3300025916 Bacteria 2123
423 Ga0207660_10046905 3300025917 Bacteria 3052
424 Ga0207662_10000254 3300025918 Bacteria 24692
425 Ga0207657_10013359 3300025919 Bacteria 8056
426 Ga0207657_10034449 3300025919 Bacteria 4552
427 Ga0207657_10036394 3300025919 Bacteria 4405
428 Ga0207657_10041494 3300025919 Bacteria 4068
429 Ga0207649_10039932 3300025920 Bacteria 2848
430 Ga0207694_10000120 3300025924 Bacteria 83624
431 Ga0207694_10000933 3300025924 Bacteria 25869
432 Ga0207694_10056955 3300025924 Bacteria 3037
433 Ga0207694_10091331 3300025924 Bacteria 2403
434 Ga0207694_10348615 3300025924 Bacteria 1225
435 Ga0207700_10004057 3300025928 Bacteria 8581
436 Ga0207700_10031541 3300025928 Bacteria 3766
437 Ga0207700_10048466 3300025928 Bacteria 3155
438 Ga0207664_10032588 3300025929 Bacteria 3996
439 Ga0207690_10036892 3300025932 Bacteria 3169
440 Ga0207690_10118527 3300025932 Bacteria 1918
441 Ga0207690_10149493 3300025932 Bacteria 1730
442 Ga0207706_10002971 3300025933 Bacteria 16353
443 Ga0207706_10005299 3300025933 Bacteria 12024
444 Ga0207706_10015662 3300025933 Bacteria 6852
445 Ga0207706_10028246 3300025933 Bacteria 5011
446 Ga0207706_10035172 3300025933 Bacteria 4456
447 Ga0207706_10059270 3300025933 Bacteria 3371
448 Ga0207706_10065155 3300025933 Bacteria 3208
449 Ga0207686_10003225 3300025934 Bacteria 8768
450 Ga0207709_10003334 3300025935 Bacteria 9619
451 Ga0207709_10009590 3300025935 Bacteria 5329
452 Ga0207709_10037084 3300025935 Bacteria 2894
453 Ga0207709_10055055 3300025935 Bacteria 2456
454 Ga0207709_10156514 3300025935 Bacteria 1584
455 Ga0207665_10000636 3300025939 Bacteria 23620
456 Ga0207665_10003419 3300025939 Bacteria 10622
457 Ga0207665_10055951 3300025939 Bacteria 2663
458 Ga0207691_10013126 3300025940 Bacteria 7930
459 Ga0207711_10001827 3300025941 Bacteria 19417
460 Ga0207689_10022570 3300025942 Bacteria 5288
461 Ga0207689_10284814 3300025942 Bacteria 1368
462 Ga0207679_10062252 3300025945 Bacteria 2780
463 Ga0207679_10288493 3300025945 Bacteria 1410
464 Ga0207667_10006732 3300025949 Bacteria 13882
465 Ga0207667_10007448 3300025949 Bacteria 13151
466 Ga0207667_10050218 3300025949 Bacteria 4401
467 Ga0207667_10169458 3300025949 Bacteria 2244
468 Ga0207712_10000334 3300025961 Bacteria 43010
469 Ga0207668_10035999 3300025972 Bacteria 3302
470 Ga0207640_10005679 3300025981 Bacteria 6798
471 Ga0207640_10007022 3300025981 Bacteria 6199
472 Ga0207640_10373902 3300025981 Bacteria 1153
473 Ga0207658_10000947 3300025986 Bacteria 23931
474 Ga0207658_10004952 3300025986 Bacteria 9189
475 Ga0207703_10000094 3300026035 Bacteria 104297
476 Ga0207639_10000438 3300026041 Bacteria 28804
477 Ga0207639_10001071 3300026041 Bacteria 18579
478 Ga0207639_10003561 3300026041 Bacteria 10462
479 Ga0207639_10013881 3300026041 Bacteria 5650
480 Ga0207639_10046183 3300026041 Bacteria 3285
481 Ga0207639_10443242 3300026041 Bacteria 1177
482 Ga0207678_10000022 3300026067 Bacteria 129767
483 Ga0207678_10000116 3300026067 Bacteria 65805
484 Ga0207678_10003208 3300026067 Bacteria 14783
485 Ga0207678_10012246 3300026067 Bacteria 7531
486 Ga0207678_10075496 3300026067 Bacteria 2887
487 Ga0207678_10180867 3300026067 Bacteria 1801
488 Ga0207708_10011471 3300026075 Bacteria 6604
489 Ga0207702_10000019 3300026078 Bacteria 211843
490 Ga0207702_10002429 3300026078 Bacteria 17702
491 Ga0207702_10003041 3300026078 Bacteria 15589
492 Ga0207702_10004744 3300026078 Bacteria 12004
493 Ga0207702_10012384 3300026078 Bacteria 7102
494 Ga0207702_10173590 3300026078 Bacteria 1979
495 Ga0207641_10002649 3300026088 Bacteria 16364
496 Ga0207641_10100637 3300026088 Bacteria 2546
497 Ga0207648_10015533 3300026089 Bacteria 6998
498 Ga0207674_10004606 3300026116 Bacteria 16555
499 Ga0207674_10151585 3300026116 Bacteria 2275
500 Ga0207674_10478449 3300026116 Bacteria 1204
501 Ga0207675_100018468 3300026118 Bacteria 6504
502 Ga0207675_100019177 3300026118 Bacteria 6383
503 Ga0207675_100062339 3300026118 Bacteria 3482
504 Ga0207683_10013203 3300026121 Bacteria 7046
505 Ga0207683_10100938 3300026121 Bacteria 2576
506 Ga0207683_10199936 3300026121 Bacteria 1816
507 Ga0207698_10002072 3300026142 Bacteria 11824
508 Ga0207698_10003380 3300026142 Bacteria 9609
509 Ga0209281_1000008 3300027111 Bacteria 867470
510 Ga0209371_1001588 3300027312 Bacteria 14807
511 Ga0207428_10004342 3300027907 Bacteria 13543
512 Ga0207428_10008192 3300027907 Bacteria 9454
513 Ga0207428_10028732 3300027907 Bacteria 4617
514 Ga0268266_10000948 3300028379 Bacteria 36942
515 Ga0268266_10020341 3300028379 Bacteria 5658
516 Ga0268266_10331744 3300028379 Bacteria 1426
517 Ga0268265_10000962 3300028380 Bacteria 26448
518 Ga0268265_10054223 3300028380 Bacteria 3041
519 Ga0268265_10224900 3300028380 Bacteria 1645
520 Ga0268264_10001094 3300028381 Bacteria 26758
521 Ga0268264_10001384 3300028381 Bacteria 22721
522 Ga0307517_10002656 3300028786 Bacteria 28559
523 Ga0307517_10078648 3300028786 Bacteria 2849
524 Ga0307517_10099582 3300028786 Bacteria 2303
525 Ga0307515_10003461 3300028794 Bacteria 33183
526 Ga0307515_10042191 3300028794 Bacteria 7146
527 Ga0307515_10100958 3300028794 Bacteria 3488
528 Ga0307515_10157547 3300028794 Bacteria 2334
529 Ga0307515_10264390 3300028794 Bacteria 1451
530 Ga0307515_10265026 3300028794 Bacteria 1448
531 Ga0307515_10279768 3300028794 Bacteria 1377
532 Ga0265338_10139736 3300028800 Bacteria 1899
533 Ga0268256_1001370 3300030500 Bacteria 14807
534 Ga0307511_10000050 3300030521 Bacteria 97101
535 Ga0307511_10000401 3300030521 Bacteria 46025
536 Ga0307511_10026796 3300030521 Bacteria 5280
537 Ga0307511_10034094 3300030521 Bacteria 4478
538 Ga0307512_10008551 3300030522 Bacteria 9961
539 Ga0307512_10022005 3300030522 Bacteria 5740
540 Ga0307512_10055026 3300030522 Bacteria 3143
541 Ga0316181_1154916 3300030744 Bacteria 3410
542 Ga0316182_1153087 3300030745 Bacteria 1080
543 Ga0265316_10005411 3300031344 Bacteria 12404
544 Ga0307513_10000219 3300031456 Bacteria 82663
545 Ga0307513_10001108 3300031456 Bacteria 38970
546 Ga0307513_10023992 3300031456 Bacteria 7107
547 Ga0307513_10037999 3300031456 Bacteria 5351
548 Ga0307513_10126960 3300031456 Bacteria 2504
549 Ga0307509_10001929 3300031507 Bacteria 34257
550 Ga0307509_10019317 3300031507 Bacteria 7778
551 Ga0307509_10028803 3300031507 Bacteria 6171
552 Ga0307509_10101119 3300031507 Bacteria 2918
553 Ga0307509_10102176 3300031507 Bacteria 2899
554 Ga0307408_100002141 3300031548 Bacteria 14149
555 Ga0307408_100012250 3300031548 Bacteria 5677
556 Ga0307408_100165109 3300031548 Bacteria 1762
557 Ga0307508_10001419 3300031616 Bacteria 26970
558 Ga0307508_10001653 3300031616 Bacteria 24829
559 Ga0307508_10002660 3300031616 Bacteria 18747
560 Ga0307508_10004136 3300031616 Bacteria 14290
561 Ga0307508_10030043 3300031616 Bacteria 4911
562 Ga0307508_10041918 3300031616 Bacteria 4108
563 Ga0307508_10089809 3300031616 Bacteria 2658
564 Ga0307514_10043511 3300031649 Bacteria 3525
565 Ga0307514_10070607 3300031649 Bacteria 2622
566 Ga0265314_10037140 3300031711 Bacteria 3532
567 Ga0307516_10004179 3300031730 Bacteria 17982
568 Ga0307516_10005739 3300031730 Bacteria 14707
569 Ga0307516_10026058 3300031730 Bacteria 5944
570 Ga0307516_10030738 3300031730 Bacteria 5417
571 Ga0307516_10105779 3300031730 Bacteria 2625
572 Ga0307405_10087645 3300031731 Bacteria 2052
573 Ga0307405_10349870 3300031731 Bacteria 1139
574 Ga0307413_10118980 3300031824 Bacteria 1785
575 Ga0307518_10001376 3300031838 Bacteria 18082
576 Ga0307518_10023205 3300031838 Bacteria 4468
577 Ga0307406_10003739 3300031901 Bacteria 8275
578 Ga0307412_10000304 3300031911 Bacteria 31110
579 Ga0307412_10040867 3300031911 Bacteria 3002
580 Ga0307412_10063625 3300031911 Bacteria 2489
581 Ga0307412_10109468 3300031911 Bacteria 1969
582 Ga0307412_10226929 3300031911 Bacteria 1435
583 Ga0307412_10232468 3300031911 Bacteria 1420
584 Ga0307409_100015488 3300031995 Bacteria 5007
585 Ga0307409_100359717 3300031995 Bacteria 1376
586 Ga0307409_100404966 3300031995 Bacteria 1304
587 Ga0307409_100415053 3300031995 Bacteria 1290
588 Ga0307416_100544319 3300032002 Bacteria 1233
589 Ga0307414_10002087 3300032004 Bacteria 10400
590 Ga0307414_10015307 3300032004 Bacteria 4630
591 Ga0307414_10015942 3300032004 Bacteria 4553
592 Ga0307414_10172545 3300032004 Bacteria 1730
593 Ga0307411_10064143 3300032005 Bacteria 2458
594 Ga0307411_10102079 3300032005 Bacteria 2031
595 Ga0307507_10000003 3300033179 Bacteria 371707
596 Ga0307507_10000031 3300033179 Bacteria 195619
597 Ga0307507_10011820 3300033179 Bacteria 10931
598 Ga0307510_10003088 3300033180 Bacteria 19248
599 Ga0307510_10009123 3300033180 Bacteria 11807
600 Ga0307510_10027972 3300033180 Bacteria 6448
601 Ga0316214_1001712 3300033545 Bacteria 2612
602 Ga0373952_0017907 3300035092 Bacteria 1460
603 Ga0373946_0024183 3300035171 Bacteria 2378
604 Ga0373931_0003665 3300035691 Bacteria 6946
605 Ga0373927_0000410 3300035695 Bacteria 33006
606 Ga0373947_0009173 3300035725 Bacteria 5687
607 Ga0373925_0000730 3300037068 Bacteria 30523
608 Ga0395899_0013724 3300037312 Bacteria 6195
609 Ga0395899_0023133 3300037312 Bacteria 4710
610 Ga0395899_0026758 3300037312 Bacteria 4352
611 Ga0395899_0102359 3300037312 Bacteria 2067
612 Ga0395900_0000474 3300037418 Bacteria 57230
613 Ga0395900_0001603 3300037418 Bacteria 26692
614 Ga0395900_0004209 3300037418 Bacteria 15268
615 Ga0395900_0074799 3300037418 Bacteria 3482
616 Ga0395900_0102275 3300037418 Bacteria 2944
617 Ga0395900_0153446 3300037418 Bacteria 2353
618 Ga0395900_0440889 3300037418 Bacteria 1260
619 Ga0395898_0000751 3300037466 Bacteria 56660
620 Ga0395898_0004678 3300037466 Bacteria 14915
621 Ga0395898_0012071 3300037466 Bacteria 8943
622 Ga0395898_0012419 3300037466 Bacteria 8805
623 Ga0395898_0019940 3300037466 Bacteria 6817
624 Ga0395898_0035174 3300037466 Bacteria 4985
625 Ga0395898_0164832 3300037466 Bacteria 2120
626 Ga0395898_0445558 3300037466 Bacteria 1233
627 Ga0395905_0005858 3300037471 Bacteria 12491
628 Ga0395905_0018917 3300037471 Bacteria 6532
629 Ga0395905_0050569 3300037471 Bacteria 3893
630 Ga0395905_0062684 3300037471 Bacteria 3477
631 Ga0395905_0066056 3300037471 Bacteria 3387
632 Ga0395905_0085393 3300037471 Bacteria 2957
633 Ga0395905_0212001 3300037471 Bacteria 1814
634 Ga0395901_0000077 3300038443 Bacteria 135073
635 Ga0395901_0000246 3300038443 Bacteria 67512
636 Ga0395901_0000908 3300038443 Bacteria 32498
637 Ga0395901_0026128 3300038443 Bacteria 5994
638 Ga0395901_0030832 3300038443 Bacteria 5526
639 Ga0395901_0043177 3300038443 Bacteria 4677
640 Ga0395901_0123752 3300038443 Bacteria 2717
641 Ga0395901_0130622 3300038443 Bacteria 2639
642 Ga0395901_0288605 3300038443 Bacteria 1703
643 Ga0237819_01112 3300038705 Bacteria 7847
644 Ga0400483_108750 3300039062 Bacteria 3354
645 Ga0400483_135484 3300039062 Bacteria 7954
646 Ga0400483_180197 3300039062 Bacteria 7396
647 Ga0400483_243671 3300039062 Bacteria 5670
648 Ga0436361_0108407 3300039447 Bacteria 32994
649 Ga0436361_0659434 3300039447 Bacteria 4276
650 Ga0436361_1220162 3300039447 Bacteria 2895
651 Ga0436363_1150514 3300039450 Bacteria 5432
652 Ga0439436_0013263 3300041404 Bacteria 2494
653 Ga0439436_0028606 3300041404 Bacteria 1626
654 Ga0439466_0003736 3300041411 Bacteria 5880
655 Ga0439465_0030638 3300041413 Bacteria 1712
656 Ga0451795_0226724 3300041456 Bacteria 2470
657 Ga0451839_0426667 3300041496 Bacteria 1693
658 Ga0439445_0024077 3300042004 Bacteria 1545
659 Ga0439448_0010380 3300042005 Bacteria 2762
660 Ga0439448_0019533 3300042005 Bacteria 2087
661 Ga0439448_0025958 3300042005 Bacteria 1840
662 Ga0439432_004797 3300042006 Bacteria 4915
663 Ga0439449_0018184 3300042007 Bacteria 2637
664 Ga0439449_0040347 3300042007 Bacteria 1735
665 Ga0439450_009204 3300042008 Bacteria 1868
666 Ga0439451_000125 3300042009 Bacteria 14064
667 Ga0439451_000134 3300042009 Bacteria 13696
668 Ga0439452_000130 3300042010 Bacteria 57394
669 Ga0439452_009390 3300042010 Bacteria 2883
670 Ga0439457_000234 3300042014 Bacteria 14914
671 Ga0439457_003788 3300042014 Bacteria 4060
672 Ga0439463_013229 3300042016 Bacteria 2031
673 Ga0450911_003786 3300042115 Bacteria 2596
674 Ga0450920_008457 3300042122 Bacteria 1881
675 Ga0450923_003270 3300042125 Bacteria 2427
676 Ga0450894_000475 3300042131 Bacteria 6845
677 Ga0450898_002595 3300042134 Bacteria 2532
678 Ga0450902_009804 3300042137 Bacteria 1511
679 Ga0450906_000347 3300042145 Bacteria 9410
680 Ga0450907_002519 3300042146 Bacteria 3476
681 Ga0439458_0003190 3300042157 Bacteria 3886
682 Ga0450908_000522 3300042184 Bacteria 7425
683 Ga0439434_0003886 3300042435 Bacteria 4365
684 Ga0439464_0005925 3300042439 Bacteria 3176
685 Ga0439460_0008127 3300042461 Bacteria 2646
686 Ga0451577_0089587 3300042876 Bacteria 2745
687 Ga0466969_0009500 3300044656 Bacteria 5157
688 Ga0466969_0018605 3300044656 Bacteria 3618
689 Ga0466969_0039455 3300044656 Bacteria 2371
690 Ga0466972_0000462 3300044658 Bacteria 20710
691 Ga0466972_0007761 3300044658 Bacteria 5386
692 Ga0466972_0015619 3300044658 Bacteria 3797
693 Ga0466972_0111947 3300044658 Bacteria 1290
694 Ga0466965_0004793 3300044683 Bacteria 6033
695 Ga0466965_0010740 3300044683 Bacteria 4281
696 Ga0466965_0017187 3300044683 Bacteria 3454
697 Ga0466965_0038068 3300044683 Bacteria 2362
698 Ga0466966_0000927 3300044684 Bacteria 18684
699 Ga0466966_0001156 3300044684 Bacteria 16964
700 Ga0466966_0001664 3300044684 Bacteria 14332
701 Ga0466966_0009048 3300044684 Bacteria 6598
702 Ga0466966_0075818 3300044684 Bacteria 2100
703 Ga0466966_0109047 3300044684 Bacteria 1708
704 Ga0466961_0005318 3300044693 Bacteria 8101
705 Ga0466961_0012135 3300044693 Bacteria 5508
706 Ga0466961_0034753 3300044693 Bacteria 3236
707 Ga0466963_0001264 3300044694 Bacteria 13403
708 Ga0466963_0002989 3300044694 Bacteria 9560
709 Ga0466964_0006530 3300044706 Bacteria 4350
710 Ga0453684_0259954 3300044712 Bacteria 1989
711 Ga0453684_0297449 3300044712 Bacteria 1835
712 Ga0466971_0001070 3300044719 Bacteria 11373
713 Ga0466971_0024430 3300044719 Bacteria 2696
714 Ga0466971_0098252 3300044719 Bacteria 1344
715 Ga0466968_0013336 3300044735 Bacteria 3231
716 Ga0466970_0004934 3300044765 Bacteria 6591
717 Ga0466970_0026319 3300044765 Bacteria 3049
718 Ga0466957_0000029 3300044842 Bacteria 52517
719 Ga0466957_0001270 3300044842 Bacteria 13146
720 Ga0466957_0123522 3300044842 Bacteria 1652
721 Ga0466957_0143405 3300044842 Bacteria 1540
722 Ga0466960_0024039 3300044901 Bacteria 2744
723 Ga0466959_0006518 3300045049 Bacteria 8094
724 Ga0466959_0007787 3300045049 Bacteria 7536
725 Ga0466959_0019614 3300045049 Bacteria 4973
726 Ga0466959_0077580 3300045049 Bacteria 2397
727 Ga0451576_0008986 3300045051 Bacteria 11641
728 Ga0451576_0027926 3300045051 Bacteria 6053
729 Ga0466958_0000352 3300045836 Bacteria 18502
730 Ga0466958_0004427 3300045836 Bacteria 7418
731 Ga0466958_0020230 3300045836 Bacteria 3881
732 Ga0466958_0114456 3300045836 Bacteria 1685
733 Ga0466967_0022489 3300045976 Bacteria 5146
734 Ga0466967_0040101 3300045976 Bacteria 4030
735 Ga0466967_0378902 3300045976 Bacteria 1373
736 Ga0495617_000642 3300046452 Bacteria 17510
737 Ga0495617_006827 3300046452 Bacteria 3988
738 Ga0495617_010652 3300046452 Bacteria 3150
739 Ga0495617_014761 3300046452 Bacteria 2653
740 Ga0495617_028167 3300046452 Bacteria 1888
741 Ga0495617_052606 3300046452 Bacteria 1353
742 Ga0495627_000254 3300046453 Bacteria 54795
743 Ga0495627_001072 3300046453 Bacteria 18018
744 Ga0495627_026424 3300046453 Bacteria 1872
745 Ga0495592_0012672 3300046454 Bacteria 6407
746 Ga0495592_0015756 3300046454 Bacteria 5735
747 Ga0495603_0002962 3300046455 Bacteria 10043
748 Ga0495603_0007336 3300046455 Bacteria 6629
749 Ga0495603_0015983 3300046455 Bacteria 4537
750 Ga0495603_0019131 3300046455 Bacteria 4145
751 Ga0495590_0000965 3300046457 Bacteria 12679
752 Ga0495590_0007568 3300046457 Bacteria 4179
753 Ga0495590_0015204 3300046457 Bacteria 2797
754 Ga0495590_0044467 3300046457 Bacteria 1548
755 Ga0495591_000005 3300046458 Bacteria 394092
756 Ga0495591_000088 3300046458 Bacteria 102486
757 Ga0495591_003293 3300046458 Bacteria 8451
758 Ga0495591_009522 3300046458 Bacteria 3849
759 Ga0495629_0008564 3300046459 Bacteria 7532
760 Ga0495629_0010005 3300046459 Bacteria 6921
761 Ga0495629_0019619 3300046459 Bacteria 4829
762 Ga0495629_0072821 3300046459 Bacteria 2399
763 Ga0495629_0124042 3300046459 Bacteria 1799
764 Ga0495638_0001071 3300046460 Bacteria 26689
765 Ga0495638_0003500 3300046460 Bacteria 12329
766 Ga0495638_0004007 3300046460 Bacteria 11309
767 Ga0495638_0011558 3300046460 Bacteria 6082
768 Ga0495638_0017740 3300046460 Bacteria 4739
769 Ga0495638_0040011 3300046460 Bacteria 2972
770 Ga0495638_0042721 3300046460 Bacteria 2863
771 Ga0495638_0064128 3300046460 Bacteria 2263
772 Ga0495638_0110876 3300046460 Bacteria 1630
773 Ga0495653_0001089 3300046463 Bacteria 20969
774 Ga0495653_0004894 3300046463 Bacteria 10865
775 Ga0495653_0036548 3300046463 Bacteria 3867
776 Ga0495653_0045911 3300046463 Bacteria 3384
777 Ga0495650_0001499 3300046471 Bacteria 22259
778 Ga0495650_0001536 3300046471 Bacteria 21887
779 Ga0495650_0001808 3300046471 Bacteria 19256
780 Ga0495650_0002221 3300046471 Bacteria 16296
781 Ga0495650_0002985 3300046471 Bacteria 12811
782 Ga0495650_0005447 3300046471 Bacteria 8262
783 Ga0495650_0019653 3300046471 Bacteria 3315
784 Ga0495580_0010092 3300046472 Bacteria 7379
785 Ga0495580_0015860 3300046472 Bacteria 5670
786 Ga0495605_0000195 3300046474 Bacteria 75899
787 Ga0495605_0000199 3300046474 Bacteria 74613
788 Ga0495605_0000257 3300046474 Bacteria 62503
789 Ga0495605_0001546 3300046474 Bacteria 14942
790 Ga0495605_0007942 3300046474 Bacteria 6008
791 Ga0495605_0019276 3300046474 Bacteria 3648
792 Ga0495639_0003285 3300046475 Bacteria 7015
793 Ga0495662_0008243 3300046476 Bacteria 5133
794 Ga0495664_0003557 3300046477 Bacteria 8499
795 Ga0495664_0032744 3300046477 Bacteria 3052
796 Ga0495664_0097429 3300046477 Bacteria 1770
797 Ga0495584_0001017 3300046491 Bacteria 17518
798 Ga0495584_0002370 3300046491 Bacteria 10719
799 Ga0495584_0024427 3300046491 Bacteria 3065
800 Ga0495584_0030071 3300046491 Bacteria 2752
801 Ga0495584_0118609 3300046491 Bacteria 1340
802 Ga0495585_0000142 3300046492 Bacteria 79060
803 Ga0495585_0000577 3300046492 Bacteria 34550
804 Ga0495585_0000795 3300046492 Bacteria 27671
805 Ga0495585_0002260 3300046492 Bacteria 13931
806 Ga0495585_0012745 3300046492 Bacteria 4947
807 Ga0495585_0035019 3300046492 Bacteria 2839
808 Ga0495585_0080431 3300046492 Bacteria 1766
809 Ga0495585_0092144 3300046492 Bacteria 1631
810 Ga0495594_0091268 3300046499 Bacteria 1707
811 Ga0495596_0000061 3300046500 Bacteria 79205
812 Ga0495596_0001643 3300046500 Bacteria 12706
813 Ga0495607_0000138 3300046501 Bacteria 77180
814 Ga0495607_0000394 3300046501 Bacteria 44392
815 Ga0495607_0001084 3300046501 Bacteria 24861
816 Ga0495607_0001219 3300046501 Bacteria 23108
817 Ga0495607_0001489 3300046501 Bacteria 20785
818 Ga0495607_0003744 3300046501 Bacteria 11500
819 Ga0495607_0006485 3300046501 Bacteria 8228
820 Ga0495607_0013896 3300046501 Bacteria 5260
821 Ga0495607_0025057 3300046501 Bacteria 3714
822 Ga0495607_0033723 3300046501 Bacteria 3113
823 Ga0495607_0035928 3300046501 Bacteria 2992
824 Ga0495583_0002568 3300046506 Bacteria 15282
825 Ga0495583_0071013 3300046506 Bacteria 1530
826 Ga0495583_0084457 3300046506 Bacteria 1375
827 Ga0495606_0000081 3300046507 Bacteria 160491
828 Ga0495606_0000525 3300046507 Bacteria 61969
829 Ga0495606_0005029 3300046507 Bacteria 12873
830 Ga0495606_0005176 3300046507 Bacteria 12615
831 Ga0495606_0005506 3300046507 Bacteria 12103
832 Ga0495606_0009409 3300046507 Bacteria 8272
833 Ga0495606_0025173 3300046507 Bacteria 4269
834 Ga0495606_0028965 3300046507 Bacteria 3896
835 Ga0495606_0034505 3300046507 Bacteria 3473
836 Ga0495608_0073290 3300046511 Bacteria 2233
837 Ga0495610_0000198 3300046512 Bacteria 67337
838 Ga0495610_0000963 3300046512 Bacteria 26633
839 Ga0495610_0008811 3300046512 Bacteria 6470
840 Ga0495610_0057593 3300046512 Bacteria 1863
841 Ga0495610_0068188 3300046512 Bacteria 1668
842 Ga0495616_0002680 3300046513 Bacteria 11668
843 Ga0495616_0006038 3300046513 Bacteria 7380
844 Ga0495616_0008012 3300046513 Bacteria 6292
845 Ga0495616_0014248 3300046513 Bacteria 4459
846 Ga0495616_0024064 3300046513 Bacteria 3270
847 Ga0495616_0033012 3300046513 Bacteria 2700
848 Ga0495616_0037408 3300046513 Bacteria 2497
849 Ga0495620_0000035 3300046515 Bacteria 115562
850 Ga0495620_0031909 3300046515 Bacteria 2406
851 Ga0495628_0046359 3300046516 Bacteria 3452
852 Ga0495628_0064348 3300046516 Bacteria 2871
853 Ga0495630_0002568 3300046517 Bacteria 12585
854 Ga0495630_0006537 3300046517 Bacteria 8302
855 Ga0495630_0063736 3300046517 Bacteria 2769
856 Ga0495631_0000063 3300046518 Bacteria 66560
857 Ga0495631_0000122 3300046518 Bacteria 52205
858 Ga0495631_0001230 3300046518 Bacteria 15793
859 Ga0495631_0017620 3300046518 Bacteria 3375
860 Ga0495632_0000058 3300046519 Bacteria 122648
861 Ga0495632_0000395 3300046519 Bacteria 41002
862 Ga0495632_0000518 3300046519 Bacteria 36310
863 Ga0495632_0000908 3300046519 Bacteria 25958
864 Ga0495632_0000983 3300046519 Bacteria 24906
865 Ga0495632_0003288 3300046519 Bacteria 11546
866 Ga0495632_0005029 3300046519 Bacteria 8853
867 Ga0495632_0008756 3300046519 Bacteria 6168
868 Ga0495632_0014772 3300046519 Bacteria 4405
869 Ga0495632_0019335 3300046519 Bacteria 3713
870 Ga0495632_0027861 3300046519 Bacteria 2953
871 Ga0495637_0000113 3300046520 Bacteria 58600
872 Ga0495637_0000315 3300046520 Bacteria 37537
873 Ga0495637_0000473 3300046520 Bacteria 29387
874 Ga0495637_0001685 3300046520 Bacteria 12767
875 Ga0495637_0007094 3300046520 Bacteria 5580
876 Ga0495637_0023097 3300046520 Bacteria 2830
877 Ga0495637_0023593 3300046520 Bacteria 2793
878 Ga0495637_0046766 3300046520 Bacteria 1829
879 Ga0495643_0000044 3300046522 Bacteria 226211
880 Ga0495643_0000880 3300046522 Bacteria 31960
881 Ga0495643_0002862 3300046522 Bacteria 13117
882 Ga0495643_0003493 3300046522 Bacteria 11453
883 Ga0495643_0006532 3300046522 Bacteria 7670
884 Ga0495643_0018596 3300046522 Bacteria 4035
885 Ga0495643_0021770 3300046522 Bacteria 3669
886 Ga0495643_0070273 3300046522 Bacteria 1839
887 Ga0495644_0001098 3300046523 Bacteria 11173
888 Ga0495644_0021452 3300046523 Bacteria 2464
889 Ga0495648_0000241 3300046524 Bacteria 61991
890 Ga0495648_0002312 3300046524 Bacteria 17749
891 Ga0495648_0016866 3300046524 Bacteria 5248
892 Ga0495648_0017766 3300046524 Bacteria 5071
893 Ga0495648_0026949 3300046524 Bacteria 3857
894 Ga0495648_0031424 3300046524 Bacteria 3495
895 Ga0495663_0000394 3300046525 Bacteria 16143
896 Ga0495666_0000069 3300046526 Bacteria 40652
897 Ga0495666_0000092 3300046526 Bacteria 36757
898 Ga0495666_0002984 3300046526 Bacteria 8492
899 Ga0495666_0004604 3300046526 Bacteria 6974
900 Ga0495666_0005780 3300046526 Bacteria 6230
901 Ga0495666_0009363 3300046526 Bacteria 4901
902 Ga0495666_0038050 3300046526 Bacteria 2340
903 Ga0495666_0062478 3300046526 Bacteria 1778
904 Ga0495642_0000003 3300046528 Bacteria 185425
905 Ga0495642_0076951 3300046528 Bacteria 1401
906 Ga0495642_0090933 3300046528 Bacteria 1292
907 Ga0495652_0000784 3300046529 Bacteria 36623
908 Ga0495652_0034602 3300046529 Bacteria 4402
909 Ga0495654_0000799 3300046530 Bacteria 24142
910 Ga0495654_0001139 3300046530 Bacteria 19069
911 Ga0495654_0002457 3300046530 Bacteria 11922
912 Ga0495654_0002606 3300046530 Bacteria 11494
913 Ga0495654_0002865 3300046530 Bacteria 10838
914 Ga0495654_0017248 3300046530 Bacteria 3799
915 Ga0495654_0064580 3300046530 Bacteria 1749
916 Ga0495665_0002959 3300046531 Bacteria 9171
917 Ga0495665_0033485 3300046531 Bacteria 2748
918 Ga0495640_0016046 3300046533 Bacteria 5614
919 Ga0495586_0014575 3300046535 Bacteria 4177
920 Ga0495586_0042300 3300046535 Bacteria 2454
921 Ga0495587_0001318 3300046536 Bacteria 16481
922 Ga0495609_0000490 3300046538 Bacteria 31718
923 Ga0495597_0000216 3300046542 Bacteria 52708
924 Ga0495597_0000253 3300046542 Bacteria 48591
925 Ga0495597_0002240 3300046542 Bacteria 12617
926 Ga0495597_0002886 3300046542 Bacteria 10479
927 Ga0495597_0007992 3300046542 Bacteria 5322
928 Ga0495645_0011206 3300046543 Bacteria 6303
929 Ga0495645_0017315 3300046543 Bacteria 5161
930 Ga0495622_0006141 3300046557 Bacteria 5582
931 Ga0495622_0011238 3300046557 Bacteria 4134
932 Ga0495622_0019278 3300046557 Bacteria 3177
933 Ga0495633_0006427 3300046558 Bacteria 6966
934 Ga0495633_0010354 3300046558 Bacteria 5095
935 Ga0495633_0067193 3300046558 Bacteria 1674
936 Ga0495667_0059961 3300046559 Bacteria 2496
937 Ga0495656_0000104 3300046615 Bacteria 35209
938 Ga0495656_0003267 3300046615 Bacteria 5471
939 Ga0495668_0000140 3300046616 Bacteria 109138
940 Ga0495668_0001118 3300046616 Bacteria 27674
941 Ga0495668_0043700 3300046616 Bacteria 2491
942 Ga0495668_0080318 3300046616 Bacteria 1789
943 Ga0495634_0016136 3300046642 Bacteria 5346
944 Ga0495634_0239724 3300046642 Bacteria 1113
945 Ga0495611_0001324 3300046648 Bacteria 12567
946 Ga0495611_0025688 3300046648 Bacteria 2568
947 Ga0495625_0000056 3300046660 Bacteria 186024
948 Ga0495625_0000095 3300046660 Bacteria 143468
949 Ga0495625_0001135 3300046660 Bacteria 34436
950 Ga0495625_0001678 3300046660 Bacteria 25843
951 Ga0495625_0012504 3300046660 Bacteria 6874
952 Ga0495625_0014369 3300046660 Bacteria 6323
953 Ga0495625_0018924 3300046660 Bacteria 5360
954 Ga0495625_0031487 3300046660 Bacteria 3944
955 Ga0495625_0032310 3300046660 Bacteria 3883
956 Ga0495625_0059375 3300046660 Bacteria 2714
957 Ga0495659_0000116 3300046664 Bacteria 35444
958 Ga0495661_0000010 3300046665 Bacteria 284261
959 Ga0495661_0000049 3300046665 Bacteria 144060
960 Ga0495661_0000085 3300046665 Bacteria 114501
961 Ga0495661_0013544 3300046665 Bacteria 5474
962 Ga0495661_0017164 3300046665 Bacteria 4783
963 Ga0495661_0031376 3300046665 Bacteria 3374
964 Ga0495661_0060608 3300046665 Bacteria 2247
965 Ga0495588_0023820 3300046674 Bacteria 3035
966 Ga0495657_0059057 3300046675 Bacteria 2545
967 Ga0495599_0001037 3300046678 Bacteria 15615
968 Ga0495623_0001804 3300046679 Bacteria 14390
969 Ga0495623_0003834 3300046679 Bacteria 9910
970 Ga0495623_0030607 3300046679 Bacteria 3463
971 Ga0495623_0202603 3300046679 Bacteria 1140
972 Ga0495646_0000390 3300046680 Bacteria 22972
973 Ga0495669_0000263 3300046684 Bacteria 30264
974 Ga0495669_0002053 3300046684 Bacteria 8256
975 Ga0495613_0005666 3300046689 Bacteria 9357
976 Ga0495613_0109142 3300046689 Bacteria 1995
977 Ga0495613_0111465 3300046689 Bacteria 1971
978 Ga0495613_0128580 3300046689 Bacteria 1815
979 Ga0495613_0283440 3300046689 Bacteria 1150
980 Ga0495624_0011630 3300046690 Bacteria 6045
981 Ga0495624_0063046 3300046690 Bacteria 2318
982 Ga0495670_0008981 3300046691 Bacteria 4916
983 Ga0495670_0024495 3300046691 Bacteria 2983
984 Ga0495671_0001083 3300046692 Bacteria 18831
985 Ga0495671_0001728 3300046692 Bacteria 14176
986 Ga0495671_0001868 3300046692 Bacteria 13535
987 Ga0495671_0002038 3300046692 Bacteria 12929
988 Ga0495671_0005199 3300046692 Bacteria 7654
989 Ga0495671_0034418 3300046692 Bacteria 2575
990 Ga0495671_0103777 3300046692 Bacteria 1388
991 Ga0495649_0000039 3300046694 Bacteria 126399
992 Ga0495649_0000083 3300046694 Bacteria 81883
993 Ga0495649_0005034 3300046694 Bacteria 8498
994 Ga0495649_0013467 3300046694 Bacteria 4716
995 Ga0495649_0019649 3300046694 Bacteria 3795
996 Ga0495649_0022739 3300046694 Bacteria 3506
997 Ga0495649_0029073 3300046694 Bacteria 3061
998 Ga0495649_0066989 3300046694 Bacteria 1926
999 Ga0495589_0000549 3300046794 Bacteria 25906
1000 Ga0495589_0005805 3300046794 Bacteria 6509
1001 Ga0495589_0006501 3300046794 Bacteria 6165
1002 Ga0495589_0025127 3300046794 Bacteria 3024
1003 Ga0495589_0034424 3300046794 Bacteria 2543
1004 Ga0495600_0001254 3300046809 Bacteria 13970
1005 Ga0495600_0006329 3300046809 Bacteria 7197
1006 Ga0495660_0000287 3300046810 Bacteria 46709
1007 Ga0495660_0000388 3300046810 Bacteria 38112
1008 Ga0495660_0000392 3300046810 Bacteria 37864
1009 Ga0495660_0000454 3300046810 Bacteria 34113
1010 Ga0495660_0000517 3300046810 Bacteria 31676
1011 Ga0495660_0002257 3300046810 Bacteria 12400
1012 Ga0495660_0020177 3300046810 Bacteria 3820
1013 Ga0495660_0021034 3300046810 Bacteria 3739
1014 Ga0495660_0026115 3300046810 Bacteria 3313
1015 Ga0495660_0027303 3300046810 Bacteria 3231
1016 Ga0495660_0045561 3300046810 Bacteria 2407
1017 Ga0495660_0051545 3300046810 Bacteria 2239
1018 Ga0495581_0016932 3300047315 Bacteria 4236
1019 Ga0495581_0069012 3300047315 Bacteria 2044
1020 Ga0495581_0103882 3300047315 Bacteria 1651
1021 Ga0495581_0104411 3300047315 Bacteria 1647
1022 Ga0495604_0001552 3300047317 Bacteria 18929
1023 Ga0495604_0003658 3300047317 Bacteria 12253
1024 Ga0495604_0034809 3300047317 Bacteria 3982
1025 Ga0495604_0075169 3300047317 Bacteria 2544
1026 Ga0495604_0108577 3300047317 Bacteria 2027
1027 Ga0495636_0002723 3300047318 Bacteria 6815
1028 Ga0495636_0005002 3300047318 Bacteria 5200
1029 Ga0495636_0066331 3300047318 Bacteria 1534
1030 Ga0495636_0083151 3300047318 Bacteria 1381
1031 Ga0495674_0006435 3300047319 Bacteria 11264
1032 Ga0495674_0007194 3300047319 Bacteria 10645
1033 Ga0495674_0023541 3300047319 Bacteria 5674
1034 Ga0495674_0070938 3300047319 Bacteria 3009
1035 Ga0495672_0000006 3300047320 Bacteria 589807
1036 Ga0495672_0000190 3300047320 Bacteria 88698
1037 Ga0495672_0000213 3300047320 Bacteria 82925
1038 Ga0495672_0000442 3300047320 Bacteria 49513
1039 Ga0495672_0001989 3300047320 Bacteria 19308
1040 Ga0495672_0002680 3300047320 Bacteria 16016
1041 Ga0495672_0003117 3300047320 Bacteria 14464
1042 Ga0495672_0007520 3300047320 Bacteria 8182
1043 Ga0495672_0080258 3300047320 Bacteria 1820
1044 Ga0495676_0000393 3300047321 Bacteria 35418
1045 Ga0495676_0007316 3300047321 Bacteria 10128
1046 Ga0495676_0010140 3300047321 Bacteria 8555
1047 Ga0495676_0030011 3300047321 Bacteria 4621
1048 Ga0495676_0036507 3300047321 Bacteria 4102
1049 Ga0495676_0067182 3300047321 Bacteria 2775
1050 Ga0495680_0000543 3300047322 Bacteria 42425
1051 Ga0495680_0000608 3300047322 Bacteria 40455
1052 Ga0495680_0000992 3300047322 Bacteria 31598
1053 Ga0495680_0001350 3300047322 Bacteria 26630
1054 Ga0495680_0002710 3300047322 Bacteria 17882
1055 Ga0495680_0004753 3300047322 Bacteria 12899
1056 Ga0495680_0046210 3300047322 Bacteria 3434
1057 Ga0495683_0000245 3300047323 Bacteria 48819
1058 Ga0495683_0000253 3300047323 Bacteria 48373
1059 Ga0495683_0000416 3300047323 Bacteria 34093
1060 Ga0495683_0003035 3300047323 Bacteria 9872
1061 Ga0495683_0003458 3300047323 Bacteria 9215
1062 Ga0495683_0014751 3300047323 Bacteria 4070
1063 Ga0495683_0018717 3300047323 Bacteria 3578
1064 Ga0495687_000308 3300047443 Bacteria 64153
1065 Ga0495687_000389 3300047443 Bacteria 54468
1066 Ga0495687_000495 3300047443 Bacteria 47456
1067 Ga0495687_000724 3300047443 Bacteria 36493
1068 Ga0495687_000845 3300047443 Bacteria 32633
1069 Ga0495687_002228 3300047443 Bacteria 16011
1070 Ga0495687_003776 3300047443 Bacteria 10697
1071 Ga0495687_003894 3300047443 Bacteria 10467
1072 Ga0495687_029428 3300047443 Bacteria 2542
1073 Ga0495687_036191 3300047443 Bacteria 2211
1074 Ga0495687_036601 3300047443 Bacteria 2195
1075 Ga0495687_039781 3300047443 Bacteria 2077
1076 Ga0495675_0000123 3300047444 Bacteria 55312
1077 Ga0495675_0001415 3300047444 Bacteria 14536
1078 Ga0495675_0001577 3300047444 Bacteria 13745
1079 Ga0495675_0007815 3300047444 Bacteria 6602
1080 Ga0495675_0024018 3300047444 Bacteria 3884
1081 Ga0495675_0230393 3300047444 Bacteria 1118
1082 Ga0495677_0000047 3300047445 Bacteria 72197
1083 Ga0495679_000672 3300047446 Bacteria 22404
1084 Ga0495679_021500 3300047446 Bacteria 2226
1085 Ga0495685_000850 3300047447 Bacteria 9302
1086 Ga0495685_007619 3300047447 Bacteria 3579
1087 Ga0495685_041402 3300047447 Bacteria 1574
1088 Ga0495673_0000025 3300047469 Bacteria 512352
1089 Ga0495673_0000155 3300047469 Bacteria 120879
1090 Ga0495673_0000178 3300047469 Bacteria 102182
1091 Ga0495673_0000221 3300047469 Bacteria 84565
1092 Ga0495673_0000922 3300047469 Bacteria 26684
1093 Ga0495673_0001024 3300047469 Bacteria 24647
1094 Ga0495673_0001183 3300047469 Bacteria 21964
1095 Ga0495673_0002914 3300047469 Bacteria 11602
1096 Ga0495673_0008706 3300047469 Bacteria 5671
1097 Ga0495673_0016529 3300047469 Bacteria 3771
1098 Ga0495673_0018987 3300047469 Bacteria 3452
1099 Ga0495681_0000026 3300047470 Bacteria 144911
1100 Ga0495681_0000198 3300047470 Bacteria 50496
1101 Ga0495681_0002726 3300047470 Bacteria 12496
1102 Ga0495681_0003820 3300047470 Bacteria 10425
1103 Ga0495681_0004705 3300047470 Bacteria 9254
1104 Ga0495681_0012414 3300047470 Bacteria 5006
1105 Ga0495681_0014290 3300047470 Bacteria 4558
1106 Ga0495684_0002582 3300047471 Bacteria 14390
1107 Ga0495686_0098785 3300047472 Bacteria 1763
1108 Ga0495593_0002886 3300047673 Bacteria 10361
1109 Ga0495593_0004344 3300047673 Bacteria 8434
1110 Ga0495602_0005230 3300048088 Bacteria 13597
1111 Ga0495602_0006180 3300048088 Bacteria 12560
1112 Ga0495614_0005431 3300048089 Bacteria 5747
1113 Ga0495614_0005865 3300048089 Bacteria 5533
1114 Ga0495614_0020059 3300048089 Bacteria 2891
1115 Ga0495626_0000033 3300048091 Bacteria 184008
1116 Ga0495626_0000132 3300048091 Bacteria 94157
1117 Ga0495626_0000522 3300048091 Bacteria 38417
1118 Ga0495626_0000528 3300048091 Bacteria 38040
1119 Ga0495626_0000760 3300048091 Bacteria 29752
1120 Ga0495626_0002344 3300048091 Bacteria 13348
1121 Ga0495626_0005636 3300048091 Bacteria 7253
1122 Ga0495626_0014908 3300048091 Bacteria 3991
1123 Ga0496100_0008351 3300048903 Bacteria 5770
1124 Ga0496100_0009196 3300048903 Bacteria 5544
1125 Ga0496100_0063090 3300048903 Bacteria 2448
1126 Ga0496100_0154789 3300048903 Bacteria 1638
1127 Ga0496101_0006713 3300048904 Bacteria 7421
1128 Ga0496101_0052905 3300048904 Bacteria 2928
1129 Ga0496102_0000640 3300048905 Bacteria 35507
1130 Ga0496102_0001362 3300048905 Bacteria 21888
1131 Ga0496102_0004150 3300048905 Bacteria 12274
1132 Ga0496102_0017432 3300048905 Bacteria 6291
1133 Ga0496102_0046800 3300048905 Bacteria 3930
1134 Ga0496102_0115949 3300048905 Bacteria 2499
1135 Ga0496103_0000197 3300048906 Bacteria 60344
1136 Ga0496103_0003193 3300048906 Bacteria 10065
1137 Ga0496103_0004050 3300048906 Bacteria 8907
1138 Ga0496103_0008193 3300048906 Bacteria 6203
1139 Ga0496104_0016732 3300048907 Bacteria 6666
1140 Ga0496104_0020106 3300048907 Bacteria 6117
1141 Ga0496104_0034365 3300048907 Bacteria 4728
1142 Ga0496104_0078834 3300048907 Bacteria 3139
1143 Ga0496104_0276725 3300048907 Bacteria 1591
1144 Ga0496105_0005813 3300048908 Bacteria 9409
1145 Ga0496105_0043486 3300048908 Bacteria 3705
1146 Ga0496105_0063948 3300048908 Bacteria 3036
1147 Ga0496105_0128627 3300048908 Bacteria 2088
1148 Ga0496106_0048984 3300048909 Bacteria 3182
1149 Ga0496106_0100261 3300048909 Bacteria 2246
1150 Ga0496106_0135009 3300048909 Bacteria 1937
1151 Ga0496106_0142053 3300048909 Bacteria 1889
1152 Ga0496108_0147251 3300048911 Bacteria 2030
1153 Ga0496109_0128879 3300048912 Bacteria 2360
1154 Ga0496109_0160594 3300048912 Bacteria 2106
1155 Ga0496109_0207237 3300048912 Bacteria 1843
1156 Ga0496109_0444592 3300048912 Bacteria 1225
1157 Ga0496110_0004506 3300048913 Bacteria 10805
1158 Ga0496110_0019584 3300048913 Bacteria 5699
1159 Ga0496110_0042373 3300048913 Bacteria 3973
1160 Ga0496110_0291118 3300048913 Bacteria 1487
1161 Ga0496111_0049764 3300048914 Bacteria 3022
1162 Ga0496111_0168151 3300048914 Bacteria 1629
1163 Ga0496111_0295995 3300048914 Bacteria 1200
1164 Ga0496112_0019536 3300048915 Bacteria 6396
1165 Ga0496113_0000915 3300048916 Bacteria 15596
1166 Ga0496113_0006120 3300048916 Bacteria 7595
1167 Ga0496113_0019641 3300048916 Bacteria 4731
1168 Ga0496113_0027368 3300048916 Bacteria 4088
1169 Ga0496113_0072833 3300048916 Bacteria 2616
1170 Ga0496114_0008420 3300048917 Bacteria 8167
1171 Ga0496114_0051083 3300048917 Bacteria 3442
1172 Ga0496114_0169692 3300048917 Bacteria 1901
1173 Ga0496114_0327104 3300048917 Bacteria 1355
1174 Ga0496116_0000014 3300048919 Bacteria 569049
1175 Ga0496116_0001609 3300048919 Bacteria 24823
1176 Ga0496117_0000467 3300048920 Bacteria 67483
1177 Ga0496117_0008128 3300048920 Bacteria 10029
1178 Ga0496118_0000459 3300048921 Bacteria 67483
1179 Ga0496118_0003112 3300048921 Bacteria 21269
1180 Ga0496118_0008803 3300048921 Bacteria 10342
1181 Ga0496118_0029338 3300048921 Bacteria 4615
1182 Ga0496118_0109992 3300048921 Bacteria 1832
1183 Ga0496119_0000119 3300048922 Bacteria 110434
1184 Ga0496119_0000346 3300048922 Bacteria 65007
1185 Ga0496119_0051837 3300048922 Bacteria 2518
1186 Ga0496120_0031371 3300048923 Bacteria 3218
1187 Ga0496121_0000079 3300048924 Bacteria 232653
1188 Ga0496121_0000382 3300048924 Bacteria 90517
1189 Ga0496121_0000511 3300048924 Bacteria 73863
1190 Ga0496121_0002155 3300048924 Bacteria 30799
1191 Ga0496121_0009162 3300048924 Bacteria 11442
1192 Ga0496122_0000310 3300048925 Bacteria 107506
1193 Ga0496122_0000552 3300048925 Bacteria 77275
1194 Ga0496122_0000662 3300048925 Bacteria 69323
1195 Ga0496122_0001487 3300048925 Bacteria 37655
1196 Ga0496122_0027018 3300048925 Bacteria 4924
1197 Ga0496122_0085809 3300048925 Bacteria 2170
1198 Ga0496123_0000478 3300048926 Bacteria 69650
1199 Ga0496123_0000815 3300048926 Bacteria 50251
1200 Ga0496123_0001031 3300048926 Bacteria 42310
1201 Ga0496123_0007781 3300048926 Bacteria 9984
1202 Ga0496123_0060403 3300048926 Bacteria 2444
1203 Ga0496123_0126229 3300048926 Bacteria 1427
1204 Ga0496124_0000499 3300048927 Bacteria 67483
1205 Ga0496124_0000569 3300048927 Bacteria 62485
1206 Ga0496124_0006777 3300048927 Bacteria 12374
1207 Ga0496124_0008365 3300048927 Bacteria 10832
1208 Ga0496124_0043380 3300048927 Bacteria 3867
1209 Ga0496124_0278695 3300048927 Bacteria 1220
1210 Ga0496125_0000122 3300048928 Bacteria 174898
1211 Ga0496125_0000395 3300048928 Bacteria 81224
1212 Ga0496125_0001860 3300048928 Bacteria 29047
1213 Ga0496125_0003943 3300048928 Bacteria 17516
1214 Ga0496125_0005275 3300048928 Bacteria 14467
1215 Ga0496125_0008770 3300048928 Bacteria 10515
1216 Ga0496125_0029798 3300048928 Bacteria 4896
1217 Ga0496125_0202191 3300048928 Bacteria 1299
1218 Ga0496126_0006618 3300048929 Bacteria 12898
1219 Ga0496126_0020454 3300048929 Bacteria 6486
1220 Ga0496126_0151825 3300048929 Bacteria 1985
1221 Ga0496126_0186830 3300048929 Bacteria 1757
1222 Ga0495678_001207 3300049459 Bacteria 21222
1223 Ga0495678_002246 3300049459 Bacteria 13448
1224 Ga0495678_003338 3300049459 Bacteria 9996
1225 Ga0495678_009079 3300049459 Bacteria 4960
1226 Ga0495678_015185 3300049459 Bacteria 3554
1227 Ga0495678_015883 3300049459 Bacteria 3455
1228 Ga0495678_036129 3300049459 Bacteria 2019
1229 Ga0495678_052718 3300049459 Bacteria 1565
1230 Ga0495678_073908 3300049459 Bacteria 1241
1231 Ga0495682_0000039 3300049460 Bacteria 119714
1232 Ga0495682_0000410 3300049460 Bacteria 30462
1233 Ga0495682_0000749 3300049460 Bacteria 20952
1234 Ga0495682_0000926 3300049460 Bacteria 17782
1235 Ga0495682_0013509 3300049460 Bacteria 3106
1236 Ga0501031_0010394 3300049568 Bacteria 6061
1237 Ga0501031_0010803 3300049568 Bacteria 5947
1238 Ga0501031_0013109 3300049568 Bacteria 5407
1239 Ga0501031_0024216 3300049568 Bacteria 3957
1240 Ga0501031_0092593 3300049568 Bacteria 1972
1241 Ga0501031_0147415 3300049568 Bacteria 1537
1242 Ga0501031_0168856 3300049568 Bacteria 1429
1243 Ga0501032_0002092 3300049569 Bacteria 15735
1244 Ga0501032_0003209 3300049569 Bacteria 12570
1245 Ga0501032_0006722 3300049569 Bacteria 8439
1246 Ga0501032_0010214 3300049569 Bacteria 6776
1247 Ga0501032_0014996 3300049569 Bacteria 5480
1248 Ga0501032_0093180 3300049569 Bacteria 1998
1249 Ga0501033_0001171 3300049570 Bacteria 23655
1250 Ga0501033_0002171 3300049570 Bacteria 16930
1251 Ga0501033_0022401 3300049570 Bacteria 4766
1252 Ga0501033_0042082 3300049570 Unclassified 3406
1253 Ga0501033_0162376 3300049570 Bacteria 1608
1254 Ga0501034_0000106 3300049571 Bacteria 153523
1255 Ga0501034_0008467 3300049571 Bacteria 10864
1256 Ga0501034_0020595 3300049571 Bacteria 6736
1257 Ga0501034_0055155 3300049571 Bacteria 4000
1258 Ga0501034_0121765 3300049571 Bacteria 2595
1259 Ga0501036_0003079 3300049572 Bacteria 13298
1260 Ga0501036_0012260 3300049572 Bacteria 7101
1261 Ga0501036_0021057 3300049572 Bacteria 5477
1262 Ga0501036_0044297 3300049572 Bacteria 3769
1263 Ga0501036_0075491 3300049572 Bacteria 2850
1264 Ga0501036_0188381 3300049572 Bacteria 1736
1265 Ga0501037_0007407 3300049573 Bacteria 8023
1266 Ga0501037_0010386 3300049573 Bacteria 6831
1267 Ga0501037_0019972 3300049573 Bacteria 4944
1268 Ga0501037_0110019 3300049573 Bacteria 1985
1269 Ga0501037_0122942 3300049573 Bacteria 1865
1270 Ga0501037_0253784 3300049573 Bacteria 1230
1271 Ga0501037_0347067 3300049573 Bacteria 1024
1272 Ga0501038_0002634 3300049574 Bacteria 16782
1273 Ga0501038_0003415 3300049574 Bacteria 14802
1274 Ga0501038_0010728 3300049574 Bacteria 8375
1275 Ga0501038_0014617 3300049574 Bacteria 7152
1276 Ga0501038_0018815 3300049574 Bacteria 6234
1277 Ga0501038_0072181 3300049574 Bacteria 2926
1278 Ga0501038_0094812 3300049574 Bacteria 2494
1279 Ga0501038_0196611 3300049574 Bacteria 1620
1280 Ga0501038_0243660 3300049574 Bacteria 1426
1281 Ga0501038_0261647 3300049574 Bacteria 1367
1282 Ga0501039_0000282 3300049575 Bacteria 36301
1283 Ga0501039_0002340 3300049575 Bacteria 14096
1284 Ga0501039_0024041 3300049575 Bacteria 4679
1285 Ga0501039_0109677 3300049575 Bacteria 2157
1286 Ga0501040_0004628 3300049576 Bacteria 8924
1287 Ga0501040_0011583 3300049576 Bacteria 5772
1288 Ga0501040_0116572 3300049576 Bacteria 1871
1289 Ga0501041_0020186 3300049577 Bacteria 3980
1290 Ga0501041_0027866 3300049577 Bacteria 3406
1291 Ga0501042_0017244 3300049578 Bacteria 4978
1292 Ga0501042_0163828 3300049578 Bacteria 1604
1293 Ga0501043_0011878 3300049579 Bacteria 6821
1294 Ga0501043_0015353 3300049579 Bacteria 5998
1295 Ga0501043_0027415 3300049579 Bacteria 4472
1296 Ga0501043_0045241 3300049579 Bacteria 3462
1297 Ga0501043_0106392 3300049579 Bacteria 2203
1298 Ga0501043_0198016 3300049579 Bacteria 1560
1299 Ga0501046_0001006 3300049580 Bacteria 27557
1300 Ga0501046_0007593 3300049580 Bacteria 9511
1301 Ga0501046_0031213 3300049580 Bacteria 4321
1302 Ga0501046_0155916 3300049580 Bacteria 1720
1303 Ga0501047_0000036 3300049581 Bacteria 195504
1304 Ga0501047_0003625 3300049581 Bacteria 14548
1305 Ga0501047_0009898 3300049581 Bacteria 9012
1306 Ga0501047_0031744 3300049581 Bacteria 5095
1307 Ga0501047_0040722 3300049581 Bacteria 4492
1308 Ga0501047_0075216 3300049581 Bacteria 3250
1309 Ga0501047_0288475 3300049581 Bacteria 1485
1310 Ga0501047_0295781 3300049581 Bacteria 1462
1311 Ga0501048_0019782 3300049582 Bacteria 4937
1312 Ga0501048_0053301 3300049582 Bacteria 2877
1313 Ga0501048_0240324 3300049582 Bacteria 1285
1314 Ga0501067_0001886 3300049583 Bacteria 11508
1315 Ga0501068_0007938 3300049584 Bacteria 5884
1316 Ga0501068_0032522 3300049584 Bacteria 3103
1317 Ga0501069_0003811 3300049585 Bacteria 7758
1318 Ga0501070_0038723 3300049586 Bacteria 3978
1319 Ga0501071_0024811 3300049587 Bacteria 4194
1320 Ga0501071_0071954 3300049587 Bacteria 2521
1321 Ga0501072_0024579 3300049588 Bacteria 4688
1322 Ga0501073_0003630 3300049589 Bacteria 11602
1323 Ga0501073_0011234 3300049589 Bacteria 6550
1324 Ga0501073_0036317 3300049589 Bacteria 3502
1325 Ga0501073_0172633 3300049589 Bacteria 1497
1326 Ga0501073_0239640 3300049589 Bacteria 1253
1327 Ga0501073_0240221 3300049589 Bacteria 1251
1328 Ga0501074_0002288 3300049590 Bacteria 13324
1329 Ga0501074_0005080 3300049590 Bacteria 9445
1330 Ga0501074_0089514 3300049590 Bacteria 2204
1331 Ga0501075_0020312 3300049591 Bacteria 4830
1332 Ga0501076_0022686 3300049592 Bacteria 4826
1333 Ga0501076_0112372 3300049592 Bacteria 2203
1334 Ga0501076_0370151 3300049592 Bacteria 1177
1335 Ga0501243_001464 3300049675 Bacteria 3384
1336 Ga0501257_001732 3300049686 Bacteria 4549
1337 Ga0501079_0020833 3300049741 Bacteria 5013
1338 Ga0501080_0016873 3300049742 Bacteria 6744
1339 Ga0501080_0071579 3300049742 Bacteria 3225
1340 Ga0501080_0203779 3300049742 Bacteria 1815
1341 Ga0501081_0025728 3300049743 Bacteria 3962
1342 Ga0501081_0252980 3300049743 Bacteria 1286
1343 Ga0501083_0003958 3300049744 Bacteria 10404
1344 Ga0501083_0016958 3300049744 Bacteria 5086
1345 Ga0501241_000061 3300049758 Bacteria 27062
1346 Ga0501269_001275 3300049766 Bacteria 3375
1347 Ga0501280_001356 3300049776 Bacteria 4644
1348 Ga0501035_0001192 3300049822 Bacteria 27078
1349 Ga0501035_0003108 3300049822 Bacteria 15951
1350 Ga0501035_0028985 3300049822 Bacteria 5049
1351 Ga0501035_0039087 3300049822 Bacteria 4295
1352 Ga0501035_0040698 3300049822 Bacteria 4198
1353 Ga0501035_0373541 3300049822 Bacteria 1190
1354 Ga0501044_0000915 3300049823 Bacteria 35537
1355 Ga0501044_0009480 3300049823 Bacteria 10601
1356 Ga0501044_0025273 3300049823 Bacteria 6294
1357 Ga0501044_0055998 3300049823 Bacteria 4048
1358 Ga0501044_0075136 3300049823 Bacteria 3431
1359 Ga0501044_0093884 3300049823 Bacteria 3025
1360 Ga0501044_0107928 3300049823 Bacteria 2794
1361 Ga0501044_0139614 3300049823 Bacteria 2412
1362 Ga0501044_0215945 3300049823 Bacteria 1870
1363 Ga0501044_0227518 3300049823 Bacteria 1814
1364 Ga0501044_0236557 3300049823 Bacteria 1772
1365 Ga0501044_0240447 3300049823 Bacteria 1754
1366 Ga0501044_0428002 3300049823 Bacteria 1233
1367 Ga0501044_0487492 3300049823 Bacteria 1135
1368 Ga0501045_0035056 3300049824 Bacteria 3643
1369 Ga0501045_0081085 3300049824 Bacteria 2392
1370 Ga0501045_0160260 3300049824 Bacteria 1674
1371 nmdc:mga03683_12240_c1 3300050489 Bacteria 3129
1372 nmdc:mga03683_174_c1 3300050489 Bacteria 15592
1373 nmdc:mga03683_9790_c1 3300050489 Bacteria 3419
1374 nmdc:mga03n38_11270_c1 3300050490 Bacteria 3324
1375 nmdc:mga03n38_155138_c1 3300050490 Bacteria 1155
1376 nmdc:mga03n38_265_c1 3300050490 Bacteria 12400
1377 nmdc:mga00v17_11359_c1 3300050491 Bacteria 4894
1378 nmdc:mga00v17_141113_c1 3300050491 Bacteria 1545
1379 nmdc:mga00v17_195_c1 3300050491 Bacteria 36325
1380 nmdc:mga00v17_2323_c1 3300050491 Bacteria 9739
1381 nmdc:mga00v17_37683_c1 3300050491 Bacteria 2888
1382 nmdc:mga00v17_6863_c1 3300050491 Bacteria 6052
1383 nmdc:mga00v17_6918_c1 3300050491 Bacteria 6029
1384 nmdc:mga00v17_85329_c1 3300050491 Bacteria 1977
1385 nmdc:mga0yw44_1997_c1 3300050492 Bacteria 8478
1386 nmdc:mga0yw44_21739_c1 3300050492 Bacteria 3585
1387 nmdc:mga0yw44_224_c1 3300050492 Bacteria 19415
1388 nmdc:mga0yw44_32929_c1 3300050492 Bacteria 3024
1389 nmdc:mga0yw44_48330_c1 3300050492 Bacteria 2565
1390 nmdc:mga0k408_2031_c1 3300050493 Bacteria 10832
1391 nmdc:mga0k408_29312_c1 3300050493 Bacteria 3132
1392 nmdc:mga0k408_3752_c1 3300050493 Bacteria 8057
1393 nmdc:mga06z11_23022_c1 3300050494 Bacteria 2920
1394 nmdc:mga06z11_27245_c1 3300050494 Bacteria 2731
1395 nmdc:mga06z11_566_c1 3300050494 Bacteria 13548
1396 nmdc:mga06z11_66994_c1 3300050494 Bacteria 1889
1397 nmdc:mga04h51_16705_c1 3300050495 Bacteria 2134
1398 nmdc:mga07m45_1348_c1 3300050496 Bacteria 11186
1399 nmdc:mga07m45_28397_c1 3300050496 Bacteria 3088
1400 nmdc:mga07m45_4378_c1 3300050496 Bacteria 6912
1401 nmdc:mga0qj67_247037_c1 3300050509 Bacteria 1448
1402 nmdc:mga0n895_7312_c1 3300050512 Bacteria 9465
1403 nmdc:mga0rr50_23734_c1 3300050513 Bacteria 4236
1404 nmdc:mga08x19_16585_c1 3300050514 Bacteria 4494
1405 nmdc:mga0sz30_10786_c1 3300050516 Bacteria 3509
1406 nmdc:mga0sz30_46130_c1 3300050516 Bacteria 1839
1407 Ga0495601_0000136 3300053077 Bacteria 41775
1408 Ga0495601_0000631 3300053077 Bacteria 18818
1409 Ga0495601_0039665 3300053077 Bacteria 2949
1410 Ga0495601_0107814 3300053077 Bacteria 1802
1411 Ga0495612_0009485 3300053078 Bacteria 3947
1412 Ga0500610_0000020 3300053079 Bacteria 68771
1413 Ga0495655_0005623 3300053083 Bacteria 2226
1414 Ga0495655_0024373 3300053083 Bacteria 1405
1415 Ga0500643_000006 3300053087 Bacteria 479605
1416 Ga0500643_000288 3300053087 Bacteria 43145
1417 Ga0500643_000806 3300053087 Bacteria 20226
1418 Ga0500643_047016 3300053087 Bacteria 1245
1419 Ga0500644_0024613 3300053088 Bacteria 1843
1420 Ga0500646_0000243 3300053090 Bacteria 16708
1421 Ga0500583_0004080 3300053092 Bacteria 4705
1422 Ga0500660_058423 3300053100 Bacteria 1870
1423 Ga0500553_077520 3300053101 Bacteria 1507
1424 Ga0500556_0000694 3300053104 Bacteria 20691
1425 Ga0500556_0001563 3300053104 Bacteria 9298
1426 Ga0500562_000274 3300053108 Bacteria 12749
1427 Ga0500593_000390 3300053117 Bacteria 17526
1428 Ga0500628_001979 3300053129 Bacteria 3443
1429 Ga0500658_0011791 3300053134 Bacteria 3221
1430 Ga0500559_0000539 3300053136 Bacteria 26232
1431 Ga0500559_0088021 3300053136 Bacteria 1419
1432 Ga0500561_0004018 3300053137 Bacteria 2625
1433 Ga0500579_047035 3300053143 Bacteria 2666
1434 Ga0500588_0017800 3300053146 Bacteria 1862
1435 Ga0500588_0029193 3300053146 Bacteria 1571
1436 Ga0500600_0036492 3300053149 Bacteria 2857
1437 Ga0500616_0000090 3300053153 Bacteria 187734
1438 Ga0500616_0000366 3300053153 Bacteria 63761
1439 Ga0500616_0006429 3300053153 Bacteria 7695
1440 Ga0500624_003000 3300053157 Bacteria 2229
1441 Ga0500627_0097501 3300053158 Bacteria 1318
1442 Ga0500633_0003880 3300053160 Bacteria 3340
1443 Ga0500638_000052 3300053162 Bacteria 26431
1444 Ga0500636_0053914 3300053177 Bacteria 2359
1445 Ga0500645_013100 3300053730 Bacteria 2668
1446 Ga0500656_000664 3300053732 Bacteria 2661
1447 Ga0500565_000835 3300053734 Bacteria 1860
1448 Ga0500587_001296 3300053739 Bacteria 3503
1449 Ga0501084_0003841 3300054114 Bacteria 12227
1450 Ga0501084_0006423 3300054114 Bacteria 9662
1451 Ga0501084_0153371 3300054114 Unclassified 1942
1452 Ga0501082_0007219 3300060353 Bacteria 9578
1453 Ga0501082_0077527 3300060353 Bacteria 2865
1454 Ga0466962_0002590 3300061719 Bacteria 8589
1455 Ga0466962_0003058 3300061719 Bacteria 7970
1456 Ga0466962_0065263 3300061719 Bacteria 1738
1457 Ga0466962_0103894 3300061719 Bacteria 1365
1458 Ga0530510_0034331 3300061734 Bacteria 3653
1459 2506866591 2506783011 Bacteria 5323186
1460 2508676500 2508501039 Bacteria 9978592
1461 2511265326 2511231006 Bacteria 6794709
1462 2511271868 2511231007 Bacteria 6306603
1463 2511290386 2511231010 Bacteria 6373152
1464 2511300026 2511231012 Bacteria 6738011
1465 2511314516 2511231014 Bacteria 6462302
1466 2511322094 2511231015 Bacteria 6598026
1467 2511322662 2511231015 Bacteria 6598026
1468 2511331900 2511231017 Bacteria 6503007
1469 2511347854 2511231020 Bacteria 6115223
1470 2511348960 2511231020 Bacteria 6115223
1471 2511354147 2511231021 Bacteria 7302637
1472 2513962115 2513237151 Bacteria 6309801
1473 2515687836 2515154123 Bacteria 6387382
1474 2516021844 2515154189 Bacteria 9629850
1475 2517763276 2517572101 Bacteria 6884336
1476 2524613814 2524023250 Bacteria 5457705
1477 2547374727 2547132103 Bacteria 5115736
1478 2548697399 2547132424 Bacteria 8348532
1479 2559431727 2558860280 Bacteria 11429938
1480 2563056847 2562617112 Bacteria 10918404
1481 2563057937 2562617112 Bacteria 10918404
1482 2566997100 2565956761 Bacteria 6601618
1483 2585312308 2582581314 Bacteria 11452267
1484 2588109337 2585428157 Bacteria 3018951
1485 2599408945 2599185169 Bacteria 5441380
1486 2600023000 2599185316 Bacteria 6320029
1487 2600076368 2599185325 Bacteria 6324919
1488 2600815086 2600255067 Bacteria 6795583
1489 2601522538 2600255254 Bacteria 5281859
1490 2601527565 2600255255 Bacteria 5282785
1491 2601614396 2600255280 Bacteria 5292309
1492 2601619116 2600255281 Bacteria 5288753
1493 2601642264 2600255287 Bacteria 5210468
1494 2601647126 2600255288 Bacteria 5282738
1495 2601652543 2600255289 Bacteria 5281907
1496 2601657869 2600255290 Bacteria 5282218
1497 2601662087 2600255291 Bacteria 5217298
1498 2601695045 2600255298 Bacteria 5215185
1499 2601699717 2600255299 Bacteria 5218662
1500 2601706388 2600255300 Bacteria 5287774
1501 2601710694 2600255301 Bacteria 5280532
1502 2601715708 2600255302 Bacteria 5288235
1503 2601720068 2600255303 Bacteria 5219315
1504 2601726114 2600255304 Bacteria 5283973
1505 2601730655 2600255305 Bacteria 5282329
1506 2601735671 2600255306 Bacteria 5281613
1507 2601740939 2600255307 Bacteria 5439064
1508 2601750869 2600255309 Bacteria 5431045
1509 2602018123 2600255392 Bacteria 5437392
1510 2603659449 2602042052 Bacteria 5215873
1511 2603664724 2602042053 Bacteria 5214361
1512 2603838047 2602042103 Bacteria 5284714
1513 2603843125 2602042104 Bacteria 5281639
1514 2603848198 2602042105 Bacteria 5282303
1515 2603853273 2602042106 Bacteria 5282744
1516 2603871324 2602042110 Bacteria 5283285
1517 2603876255 2602042111 Bacteria 5212080
1518 2606048517 2603880178 Bacteria 5283018
1519 2606069151 2603880184 Bacteria 5217896
1520 2606144973 2603880202 Bacteria 5284684
1521 2606175918 2603880211 Bacteria 5284226
1522 2616900590 2616644941 Bacteria 8510691
1523 2621299508 2619619299 Bacteria 6649820
1524 2621300473 2619619299 Bacteria 6649820
1525 2623498752 2622736605 Bacteria 4992138
1526 2623500936 2622736605 Bacteria 4992138
1527 2624479896 2623620443 Bacteria 6427864
1528 2637224820 2636415599 Bacteria 5718434
1529 2643766676 2643221549 Bacteria 4042819
1530 2643811030 2643221558 Bacteria 5460675
1531 2643824625 2643221561 Bacteria 4984412
1532 2643846924 2643221566 Bacteria 3460379
1533 2643900950 2643221578 Bacteria 9213798
1534 2643999425 2643221598 Bacteria 4578346
1535 2644032370 2643221604 Bacteria 5014917
1536 2644038347 2643221605 Bacteria 4772303
1537 2644092067 2643221615 Bacteria 5487866
1538 2644158927 2643221628 Bacteria 5745828
1539 2644172031 2643221630 Bacteria 3601215
1540 2644278126 2643221649 Bacteria 3867359
1541 2644321870 2643221657 Bacteria 5490246
1542 2644407096 2643221673 Bacteria 9196637
1543 2644489758 2643221687 Bacteria 6500351
1544 2644535877 2643221696 Bacteria 5431823
1545 2676200598 2675902999 Bacteria 9438463
1546 2676406085 2675903046 Bacteria 5451247
1547 2686538252 2684623035 Bacteria 8032739
1548 2686539124 2684623035 Bacteria 8032739
1549 2689956911 2687453737 Bacteria 11203906
1550 2689994600 2687453743 Bacteria 8361025
1551 2689996405 2687453743 Bacteria 8361025
1552 2713473360 2711768613 Bacteria 11048459
1553 2713481141 2711768613 Bacteria 11048459
1554 2723640571 2721755702 Bacteria 4373124
1555 2723848337 2721755755 Bacteria 8322773
1556 2738673137 2738541265 Bacteria 6594665
1557 2738694628 2738541272 Bacteria 6848551
1558 2738751530 2738541282 Bacteria 6593925
1559 2738860571 2738541303 Bacteria 6591772
1560 2738886481 2738541307 Bacteria 8606193
1561 2738893014 2738541308 Bacteria 7020677
1562 2739205899 2738543005 Bacteria 5278128
1563 2739236131 2738543011 Bacteria 5731169
1564 2739257939 2738543015 Bacteria 6750701
1565 2739261348 2738543015 Bacteria 6750701
1566 2739332531 2738543028 Bacteria 6917070
1567 2739363401 2738543034 Bacteria 6084756
1568 2744957679 2744054611 Bacteria 5611514
1569 2753040036 2751185725 Bacteria 5740550
1570 2753328546 2751185792 Bacteria 5739090
1571 2753568354 2751185846 Bacteria 7242164
1572 2753764942 2751185897 Bacteria 5322941
1573 2774396166 2773857762 Bacteria 5971770
1574 2774845176 2773857921 Bacteria 9435764
1575 2774903118 2773857933 Bacteria 5818019
1576 2775658984 2775506735 Bacteria 4556596
1577 2776376818 2775506925 Bacteria 7237746
1578 2777022155 2775507074 Bacteria 5532402
1579 2785338952 2784746763 Bacteria 9783172
1580 2786666593 2786546132 Bacteria 10419719
1581 2786675103 2786546132 Bacteria 10419719
1582 2792837774 2791355137 Bacteria 9654227
1583 2793080200
1584 2808848596 2808606359 Bacteria 9866990
1585 2808899371 2808606372 Bacteria 4649509
1586 2808900092 2808606372 Bacteria 4649509
1587 2809145039 2808606418 Bacteria 6724496
1588 2809197803 2808606439 Bacteria 5952208
1589 2812330890 2811994874 Bacteria 5367947
1590 2812347706 2811994878 Bacteria 5992952
1591 2812358301 2811994879 Bacteria 9313447
1592 2817490452 2816332298 Bacteria 6852809
1593 2817490871 2816332298 Bacteria 6852809
1594 2819689309 2818991462 Bacteria 4320267
1595 2834645108 2834641062 Bacteria 5559922
1596 2843693297 2843690924 Bacteria 5169057
1597 2852108231 2852103415 Bacteria 5193810
1598 2855387397 2855386786 Bacteria 4752232
1599 2858692522 2858688981 Bacteria 8184122
1600 2862385394 2862382967 Bacteria 10317375
1601 2862385739 2862382967 Bacteria 10317375
1602 2862575659 2862574272 Bacteria 10567477
1603 2863072772 2863067949 Bacteria 8541735
1604 2867347023 2867346516 Bacteria 7608576
1605 2870628179 2870628048 Bacteria 3696012
1606 2873315454 2873314349 Bacteria 8512634
1607 2874611376 2874604998 Bacteria 7834745
1608 2877684670 2877676314 Bacteria 9512378
1609 2881104882 2881101125 Bacteria 4590519
1610 2885267480 2885266251 Bacteria 4796748
1611 2889304499 2889300758 Bacteria 5690814
1612 2891052136 2891048133 Bacteria 4447501
1613 2891968884 2891968417 Bacteria 5821697
1614 2895428621 2895427314 Bacteria 13147766
1615 2895887647 2895880812 Bacteria 11255272
1616 2900642698 2900634093 Bacteria 10263517
1617 2902794389 2902792274 Bacteria 7270173
1618 2902838784 2902837492 Bacteria 6697721
1619 2904514292 2904513164 Bacteria 5476410
1620 2904536690 2904535858 Bacteria 6308016
1621 2904545693 2904541872 Bacteria 8915136
1622 2904549507 2904541872 Bacteria 8915136
1623 2904619292 2904615490 Bacteria 10047340
1624 2904766414 2904765812 Bacteria 5369154
1625 2904770311 2904765812 Bacteria 5369154
1626 2904770426 2904765812 Bacteria 5369154
1627 2904772477 2904770941 Bacteria 5580202
1628 2908816357 2908811453 Bacteria 5478616
1629 2912728671 2912723979 Bacteria 8557534
1630 2915358969 2915358134 Bacteria 6050864
1631 2919054981 2919051321 Bacteria 4210889
1632 2919140844 2919138771 Bacteria 5281312
1633 2919156355 2919155634 Bacteria 4860545
1634 2919421155 2919420072 Bacteria 5390363
1635 2919422313 2919420072 Bacteria 5390363
1636 2919422327 2919420072 Bacteria 5390363
1637 2919433087 2919432681 Bacteria 5390474
1638 2919435420 2919432681 Bacteria 5390474
1639 2919435434 2919432681 Bacteria 5390474
1640 2919720169 2919713450 Bacteria 7431245
1641 2922555139 2922554459 Bacteria 6683962
1642 2928143647 2928142448 Bacteria 5288925
1643 2929168348 2929160207 Bacteria 9075316
1644 2929214030 2929212328 Bacteria 7708288
1645 2929217851 2929212328 Bacteria 7708288
1646 2935393775 2935390628 Bacteria 7043367
1647 2935410066 2935409751 Bacteria 4179611
1648 2939575007 2939573065 Bacteria 4926053
1649 2939674789 2939674588 Bacteria 4844420
1650 2939745103 2939743619 Bacteria 5762299
1651 2941489122 2941485952 Bacteria 3591484
1652 2945914585 2945909444 Bacteria 7065066
1653 2945990014 2945984333 Bacteria 7358892
1654 2946073377 2946072368 Bacteria 8999607
1655 2954680273 2954673503 Bacteria 9685905
1656 2954681684 2954673503 Bacteria 9685905
1657 2954683878 2954682443 Bacteria 9862841
1658 2954711922 2954711539 Bacteria 10867210
1659 2954721856 2954721474 Bacteria 10456478
1660 2954739993 2954731030 Bacteria 10243860
1661 2954740752 2954740390 Bacteria 10229294
1662 2954758811 2954749733 Bacteria 10366972
1663 2954759762 2954759201 Bacteria 9358192
1664 2969081800 2969079654 Bacteria 5439582
1665 2984564225 2984559226 Bacteria 5683096
1666 2984580488 2984576629 Bacteria 4248407
1667 2984596960 2984595703 Bacteria 5682994
1668 2990067775 2990059506 Bacteria 9321252
1669 2990258180 2990256926 Bacteria 4252839
1670 3003002588 3002998708 Bacteria 11715108
1671 3006494426 3006493962 Bacteria 8825450
1672 3007719907 3007718800 Bacteria 5971527
1673 642595293 642555112 Bacteria 8676562
1674 8002787277 8002784119 Bacteria 9788632
1675 8004212912 8004212874 Bacteria 2861420
1676 8006989693 8006984368 Bacteria 9651211
1677 8008559210 8008558824 Bacteria 10610750
1678 8008560778 8008558824 Bacteria 10610750
1679 8015691598 8015687852 Bacteria 6613826
1680 8033688493 8033684223 Bacteria 6906479
1681 8047712035 8047710418 Bacteria 11023148
1682 8048364369 8048356638 Bacteria 11044339
1683 8048371700 8048369669 Bacteria 11666822
1684 8048380633 8048379754 Bacteria 11877923
1685 8048408705 8048406513 Bacteria 8936924
1686 8048747391 8048746797 Bacteria 3557226
1687 8054002910 8054002106 Bacteria 7987183
1688 8054609905 8054609563 Bacteria 5170090
1689 8055883933 8055878733 Bacteria 5907058
1690 8056174141 8056172158 Bacteria 6133900
1691 8056174155 8056172158 Bacteria 6133900
1692 Ga0453683_0019366
1693 LJQas_1006075
1694 JGI24736J21556_1001110
1695 JGI24741J21665_1000113
1696 JGI24740J21852_10000711
1697 JGI24740J21852_10002626
1698 JGI24740J21852_10002683
1699 JGI24740J21852_10004751
1700 JGI24740J21852_10009903
1701 JGI24739J22299_10004028
1702 JGI24739J22299_10004360
1703 JGI24739J22299_10014764
1704 JGI24737J22298_10007873
1705 JGI24737J22298_10013837
1706 JGI24735J21928_10011021
1707 JGI24735J21928_10017697
1708 JGI24750J21931_1002100
1709 JGI24745J21846_1001283
1710 JGI24738J21930_10000132
1711 JGI24738J21930_10004974
1712 JGI24749J21850_1004251
1713 JGI24749J21850_1006511
1714 JGI24744J21845_10000214
1715 JGI24742J22300_10000517
1716 JGI24751J29686_10012933
1717 JGI24751J29686_10017101
1718 JGI25154J39366_1000680
1719 JGI25151J46595_10006212
1720 JGI25406J46586_10004639
1721 rootH1_10005611
1722 rootL2_10011255
1723 rootL2_10024094
1724 rootH1_10007244
1725 rootH1_10018354
1726 Ga0006562J51391_1047977
1727 Ga0006562J51391_1047978
1728 Ga0055534_1008400
1729 Ga0055530_10000093
1730 Ga0055530_10000104
1731 Ga0055530_10006899
1732 Ga0055530_10013286
1733 Ga0055540_1000104
1734 Ga0055540_1000335
1735 Ga0055540_1000374
1736 Ga0055531_10000432
1737 Ga0055531_10000475
1738 Ga0055531_10000798
1739 Ga0065714_10002253
1740 Ga0065714_10002318
1741 Ga0065714_10071256
1742 Ga0065714_10072687
1743 Ga0065707_10158656
1744 Ga0070658_10002591
1745 Ga0070658_10006024
1746 Ga0070658_10085040
1747 Ga0070683_100058031
1748 Ga0070670_100035314
1749 Ga0068869_100058671
1750 Ga0070666_10038372
1751 Ga0070680_100089435
1752 Ga0070682_100177234
1753 Ga0068868_100096800
1754 Ga0068868_100211149
1755 Ga0070660_100019900
1756 Ga0070660_100068276
1757 Ga0070687_100036621
1758 Ga0070661_100017643
1759 Ga0070661_100037246
1760 Ga0070692_10040316
1761 Ga0070668_100012270
1762 Ga0070668_100298556
1763 Ga0070669_100153879
1764 Ga0070673_100066340
1765 Ga0070659_100014358
1766 Ga0070659_100016108
1767 Ga0070659_100040971
1768 Ga0070659_100097415
1769 Ga0070667_100001179
1770 Ga0070667_100143708
1771 Ga0070667_100459785
1772 Ga0070709_10013047
1773 Ga0070709_10039557
1774 Ga0070709_10074903
1775 Ga0070714_100010158
1776 Ga0070714_100061288
1777 Ga0070714_100126052
1778 Ga0070713_100086281
1779 Ga0070713_100091314
1780 Ga0070711_100017440
1781 Ga0070711_100196943
1782 Ga0070700_100233018
1783 Ga0070708_100109310
1784 Ga0070663_100001457
1785 Ga0070663_100005366
1786 Ga0070663_100171543
1787 Ga0070662_100002546
1788 Ga0070662_100040010
1789 Ga0070662_100068871
1790 Ga0070662_100109535
1791 Ga0070662_100127245
1792 Ga0070681_10023386
1793 Ga0070706_100017747
1794 Ga0070698_100024948
1795 Ga0070698_100052415
1796 Ga0070698_100094493
1797 Ga0070679_100005894
1798 Ga0070679_100389841
1799 Ga0070679_100441610
1800 Ga0070684_100042291
1801 Ga0068853_100034643
1802 Ga0068853_100094831
1803 Ga0068853_100101111
1804 Ga0068853_100120002
1805 Ga0068853_100496487
1806 Ga0070672_100240562
1807 Ga0070686_100068812
1808 Ga0070695_100022082
1809 Ga0070665_100005167
1810 Ga0070665_100096194
1811 Ga0070665_100405076
1812 Ga0070704_100052742
1813 Ga0068855_100017817
1814 Ga0068855_100073278
1815 Ga0068855_100178472
1816 Ga0068855_100639185
1817 Ga0068857_100010913
1818 Ga0068857_100070185
1819 Ga0068854_100001955
1820 Ga0068854_100010954
1821 Ga0068854_100209882
1822 Ga0068856_100001670
1823 Ga0068856_100001903
1824 Ga0068856_100004825
1825 Ga0068856_100031379
1826 Ga0068856_100124584
1827 Ga0068852_100004005
1828 Ga0068852_100010518
1829 Ga0068852_100062126
1830 Ga0068859_100062248
1831 Ga0068859_100410724
1832 Ga0068861_100162040
1833 Ga0068851_10012360
1834 Ga0068851_10014265
1835 Ga0068851_10015819
1836 Ga0068851_10046099
1837 Ga0068863_100000884
1838 Ga0068858_100000071
1839 Ga0068858_100194908
1840 Ga0068860_100002624
1841 Ga0068862_100001916
1842 Ga0068862_100081877
1843 Ga0068862_100518719
1844 Ga0081455_10000072
1845 Ga0081455_10000942
1846 Ga0081455_10049061
1847 Ga0081455_10061316
1848 Ga0081538_10005332
1849 Ga0081540_1000803
1850 Ga0081540_1056346
1851 Ga0081540_1063790
1852 Ga0081539_10000926
1853 Ga0081539_10001862
1854 Ga0081539_10002207
1855 Ga0081539_10057026
1856 Ga0081539_10102173
1857 Ga0070717_10003368
1858 Ga0075365_10000382
1859 Ga0075365_10007998
1860 Ga0075365_10009039
1861 Ga0075365_10021267
1862 Ga0075365_10024844
1863 Ga0075365_10048223
1864 Ga0075365_10240302
1865 Ga0075368_10029108
1866 Ga0075363_100019796
1867 Ga0075363_100028448
1868 Ga0075363_100033837
1869 Ga0075363_100062426
1870 Ga0075364_10001406
1871 Ga0075364_10027911
1872 Ga0075364_10033429
1873 Ga0075364_10035089
1874 Ga0075364_10050527
1875 Ga0075364_10086976
1876 Ga0075364_10137730
1877 Ga0075432_10000250
1878 Ga0075432_10064286
1879 Ga0070715_10001319
1880 Ga0070716_100002397
1881 Ga0070712_100005544
1882 Ga0070712_100022764
1883 Ga0070712_100079503
1884 Ga0075362_10000258
1885 Ga0075362_10033344
1886 Ga0075362_10037781
1887 Ga0075362_10053428
1888 Ga0075362_10094356
1889 Ga0075367_10000249
1890 Ga0075367_10000257
1891 Ga0075367_10003322
1892 Ga0075367_10053919
1893 Ga0075367_10164293
1894 Ga0075369_10003467
1895 Ga0075369_10027436
1896 Ga0075369_10051857
1897 Ga0075369_10079529
1898 Ga0075369_10083844
1899 Ga0075366_10000691
1900 Ga0075366_10002546
1901 Ga0075366_10108758
1902 Ga0075370_10000455
1903 Ga0075370_10000589
1904 Ga0075370_10000848
1905 Ga0075370_10001354
1906 Ga0075428_100000014
1907 Ga0075430_100032200
1908 Ga0075430_100090235
1909 Ga0075430_100094610
1910 Ga0075434_100010087
1911 Ga0075434_100220638
1912 Ga0075429_100203733
1913 Ga0075436_100021640
1914 Ga0097620_100062248
1915 Ga0097620_100410757
1916 Ga0079104_1002857
1917 Ga0079104_1003799
1918 Ga0079104_1023539
1919 Ga0099826_10011905
1920 Ga0075435_100015300
1921 Ga0105251_10046942
1922 Ga0105251_10066983
1923 Ga0105244_10000488
1924 Ga0105244_10009031
1925 Ga0105244_10023365
1926 Ga0105250_10000052
1927 Ga0105250_10030697
1928 Ga0105240_10001140
1929 Ga0105240_10018798
1930 Ga0105240_10021903
1931 Ga0105240_10023949
1932 Ga0105240_10076538
1933 Ga0105240_10077435
1934 Ga0105240_10086545
1935 Ga0105240_10093850
1936 Ga0105240_10100206
1937 Ga0105240_10103573
1938 Ga0105240_10144154
1939 Ga0105240_10160150
1940 Ga0105240_10326952
1941 Ga0111539_10000019
1942 Ga0111539_10275603
1943 Ga0105245_10603499
1944 Ga0114129_10019234
1945 Ga0105243_10003676
1946 Ga0105243_10013641
1947 Ga0105243_10224913
1948 Ga0105241_10000004
1949 Ga0105241_10000897
1950 Ga0105241_10004450
1951 Ga0105241_10023205
1952 Ga0105241_10103152
1953 Ga0105241_10111705
1954 Ga0105242_10128315
1955 Ga0105248_10000450
1956 Ga0105237_10000874
1957 Ga0105237_10001013
1958 Ga0105237_10001636
1959 Ga0105237_10019441
1960 Ga0105237_10028483
1961 Ga0105237_10036578
1962 Ga0105237_10042233
1963 Ga0105237_10055888
1964 Ga0105237_10168910
1965 Ga0105237_10329919
1966 Ga0105238_10000514
1967 Ga0105238_10011534
1968 Ga0105238_10019463
1969 Ga0105238_10022891
1970 Ga0105238_10030906
1971 Ga0105238_10056949
1972 Ga0105238_10159496
1973 Ga0105238_10168284
1974 Ga0105249_10000439
1975 Ga0105249_10014870
1976 Ga0105249_10019951
1977 Ga0105249_10132765
1978 Ga0105239_10000113
1979 Ga0105239_10000626
1980 Ga0105239_10001157
1981 Ga0105239_10003283
1982 Ga0105239_10006533
1983 Ga0105239_10007549
1984 Ga0105239_10011168
1985 Ga0105239_10019695
1986 Ga0105239_10021350
1987 Ga0105239_10031465
1988 Ga0105239_10037487
1989 Ga0105239_10040307
1990 Ga0105239_10153076
1991 Ga0105239_10166869
1992 Ga0105239_10360114
1993 Ga0105246_10033362
1994 Ga0105246_10062811
1995 Ga0157373_10002444
1996 Ga0157373_10004285
1997 Ga0157371_10000776
1998 Ga0157371_10006002
1999 Ga0157370_10004423
2000 Ga0157370_10009299
2001 Ga0157370_10016479
2002 Ga0157370_10017127
2003 Ga0157369_10008980
2004 Ga0157369_10073351
2005 Ga0157369_10264853
2006 Ga0157374_10142773
2007 Ga0163162_10319926
2008 Ga0157372_10002002
2009 Ga0157372_10004609
2010 Ga0157372_10021286
2011 Ga0157372_10045106
2012 Ga0157372_10653592
2013 Ga0157375_10000312
2014 Ga0157375_10107544
2015 Ga0157375_10145300
2016 Ga0163163_10000004
2017 Ga0163163_10171930
2018 Ga0163163_10300813
2019 Ga0157380_10266818
2020 Ga0157380_10339860
2021 Ga0182008_10000353
2022 Ga0182008_10001321
2023 Ga0157379_10000015
2024 Ga0157379_10000284
2025 Ga0157379_10106140
2026 Ga0157376_10044652
2027 Ga0182006_1001200
2028 Ga0163161_10000201
2029 Ga0163161_10002299
2030 Ga0163161_10018606
2031 Ga0163161_10024418
2032 Ga0163161_10048305
2033 Ga0163161_10055743
2034 Ga0206354_11589331
2035 Ga0213872_10004853
2036 Ga0209147_100156
2037 Ga0209147_100430
2038 Ga0209646_1000049
2039 Ga0209673_1028864
2040 Ga0209675_1000132
2041 Ga0209676_1000118
2042 Ga0209676_1000779
2043 Ga0209676_1006141
2044 Ga0209676_1035842
2045 Ga0209025_1000029
2046 Ga0209050_1000115
2047 Ga0209050_1000148
2048 Ga0209050_1000412
2049 Ga0209050_1001181
2050 Ga0207426_1006425
2051 Ga0209051_1000150
2052 Ga0209051_1000231
2053 Ga0209051_1000294
2054 Ga0209051_1005966
2055 Ga0209051_1013164
2056 Ga0209051_1045640
2057 Ga0209257_1000160
2058 Ga0209257_1000275
2059 Ga0207656_10002772
2060 Ga0207656_10010781
2061 Ga0207696_1000003
2062 Ga0207655_1000022
2063 Ga0207655_1006740
2064 Ga0207655_1022408
2065 Ga0207655_1029269
2066 Ga0207655_1035585
2067 Ga0207713_1000093
2068 Ga0207692_10023138
2069 Ga0207642_10038024
2070 Ga0207710_10039827
2071 Ga0207688_10015128
2072 Ga0207688_10016838
2073 Ga0207680_10017843
2074 Ga0207647_10001831
2075 Ga0207647_10003420
2076 Ga0207647_10015326
2077 Ga0207647_10023664
2078 Ga0207685_10014285
2079 Ga0207699_10023992
2080 Ga0207699_10024826
2081 Ga0207699_10115784
2082 Ga0207645_10006008
2083 Ga0207643_10088240
2084 Ga0207705_10008265
2085 Ga0207705_10070773
2086 Ga0207684_10055485
2087 Ga0207654_10000006
2088 Ga0207654_10000069
2089 Ga0207654_10000383
2090 Ga0207654_10006919
2091 Ga0207654_10028403
2092 Ga0207654_10045006
2093 Ga0207707_10077753
2094 Ga0207695_10000936
2095 Ga0207695_10008781
2096 Ga0207695_10008866
2097 Ga0207695_10020466
2098 Ga0207695_10032104
2099 Ga0207695_10055228
2100 Ga0207695_10056256
2101 Ga0207695_10255339
2102 Ga0207671_10000702
2103 Ga0207671_10000759
2104 Ga0207671_10001691
2105 Ga0207671_10010953
2106 Ga0207671_10156617
2107 Ga0207693_10004892
2108 Ga0207693_10004935
2109 Ga0207693_10005274
2110 Ga0207693_10106318
2111 Ga0207663_10081169
2112 Ga0207660_10046905
2113 Ga0207662_10000254
2114 Ga0207657_10013359
2115 Ga0207657_10034449
2116 Ga0207657_10036394
2117 Ga0207657_10041494
2118 Ga0207649_10039932
2119 Ga0207694_10000120
2120 Ga0207694_10000933
2121 Ga0207694_10056955
2122 Ga0207694_10091331
2123 Ga0207694_10348615
2124 Ga0207700_10004057
2125 Ga0207700_10031541
2126 Ga0207700_10048466
2127 Ga0207664_10032588
2128 Ga0207690_10036892
2129 Ga0207690_10118527
2130 Ga0207690_10149493
2131 Ga0207706_10002971
2132 Ga0207706_10005299
2133 Ga0207706_10015662
2134 Ga0207706_10028246
2135 Ga0207706_10035172
2136 Ga0207706_10059270
2137 Ga0207706_10065155
2138 Ga0207686_10003225
2139 Ga0207709_10003334
2140 Ga0207709_10009590
2141 Ga0207709_10037084
2142 Ga0207709_10055055
2143 Ga0207709_10156514
2144 Ga0207665_10000636
2145 Ga0207665_10003419
2146 Ga0207665_10055951
2147 Ga0207691_10013126
2148 Ga0207711_10001827
2149 Ga0207689_10022570
2150 Ga0207689_10284814
2151 Ga0207679_10062252
2152 Ga0207679_10288493
2153 Ga0207667_10006732
2154 Ga0207667_10007448
2155 Ga0207667_10050218
2156 Ga0207667_10169458
2157 Ga0207712_10000334
2158 Ga0207668_10035999
2159 Ga0207640_10005679
2160 Ga0207640_10007022
2161 Ga0207640_10373902
2162 Ga0207658_10000947
2163 Ga0207658_10004952
2164 Ga0207703_10000094
2165 Ga0207639_10000438
2166 Ga0207639_10001071
2167 Ga0207639_10003561
2168 Ga0207639_10013881
2169 Ga0207639_10046183
2170 Ga0207639_10443242
2171 Ga0207678_10000022
2172 Ga0207678_10000116
2173 Ga0207678_10003208
2174 Ga0207678_10012246
2175 Ga0207678_10075496
2176 Ga0207678_10180867
2177 Ga0207708_10011471
2178 Ga0207702_10000019
2179 Ga0207702_10002429
2180 Ga0207702_10003041
2181 Ga0207702_10004744
2182 Ga0207702_10012384
2183 Ga0207702_10173590
2184 Ga0207641_10002649
2185 Ga0207641_10100637
2186 Ga0207648_10015533
2187 Ga0207674_10004606
2188 Ga0207674_10151585
2189 Ga0207674_10478449
2190 Ga0207675_100018468
2191 Ga0207675_100019177
2192 Ga0207675_100062339
2193 Ga0207683_10013203
2194 Ga0207683_10100938
2195 Ga0207683_10199936
2196 Ga0207698_10002072
2197 Ga0207698_10003380
2198 Ga0209281_1000008
2199 Ga0209371_1001588
2200 Ga0207428_10004342
2201 Ga0207428_10008192
2202 Ga0207428_10028732
2203 Ga0268266_10000948
2204 Ga0268266_10020341
2205 Ga0268266_10331744
2206 Ga0268265_10000962
2207 Ga0268265_10054223
2208 Ga0268265_10224900
2209 Ga0268264_10001094
2210 Ga0268264_10001384
2211 Ga0307517_10002656
2212 Ga0307517_10078648
2213 Ga0307517_10099582
2214 Ga0307515_10003461
2215 Ga0307515_10042191
2216 Ga0307515_10100958
2217 Ga0307515_10157547
2218 Ga0307515_10264390
2219 Ga0307515_10265026
2220 Ga0307515_10279768
2221 Ga0265338_10139736
2222 Ga0268256_1001370
2223 Ga0307511_10000050
2224 Ga0307511_10000401
2225 Ga0307511_10026796
2226 Ga0307511_10034094
2227 Ga0307512_10008551
2228 Ga0307512_10022005
2229 Ga0307512_10055026
2230 Ga0316181_1154916
2231 Ga0316182_1153087
2232 Ga0265316_10005411
2233 Ga0307513_10000219
2234 Ga0307513_10001108
2235 Ga0307513_10023992
2236 Ga0307513_10037999
2237 Ga0307513_10126960
2238 Ga0307509_10001929
2239 Ga0307509_10019317
2240 Ga0307509_10028803
2241 Ga0307509_10101119
2242 Ga0307509_10102176
2243 Ga0307408_100002141
2244 Ga0307408_100012250
2245 Ga0307408_100165109
2246 Ga0307508_10001419
2247 Ga0307508_10001653
2248 Ga0307508_10002660
2249 Ga0307508_10004136
2250 Ga0307508_10030043
2251 Ga0307508_10041918
2252 Ga0307508_10089809
2253 Ga0307514_10043511
2254 Ga0307514_10070607
2255 Ga0265314_10037140
2256 Ga0307516_10004179
2257 Ga0307516_10005739
2258 Ga0307516_10026058
2259 Ga0307516_10030738
2260 Ga0307516_10105779
2261 Ga0307405_10087645
2262 Ga0307405_10349870
2263 Ga0307413_10118980
2264 Ga0307518_10001376
2265 Ga0307518_10023205
2266 Ga0307406_10003739
2267 Ga0307412_10000304
2268 Ga0307412_10040867
2269 Ga0307412_10063625
2270 Ga0307412_10109468
2271 Ga0307412_10226929
2272 Ga0307412_10232468
2273 Ga0307409_100015488
2274 Ga0307409_100359717
2275 Ga0307409_100404966
2276 Ga0307409_100415053
2277 Ga0307416_100544319
2278 Ga0307414_10002087
2279 Ga0307414_10015307
2280 Ga0307414_10015942
2281 Ga0307414_10172545
2282 Ga0307411_10064143
2283 Ga0307411_10102079
2284 Ga0307507_10000003
2285 Ga0307507_10000031
2286 Ga0307507_10011820
2287 Ga0307510_10003088
2288 Ga0307510_10009123
2289 Ga0307510_10027972
2290 Ga0316214_1001712
2291 Ga0373952_0017907
2292 Ga0373946_0024183
2293 Ga0373931_0003665
2294 Ga0373927_0000410
2295 Ga0373947_0009173
2296 Ga0373925_0000730
2297 Ga0395899_0013724
2298 Ga0395899_0023133
2299 Ga0395899_0026758
2300 Ga0395899_0102359
2301 Ga0395900_0000474
2302 Ga0395900_0001603
2303 Ga0395900_0004209
2304 Ga0395900_0074799
2305 Ga0395900_0102275
2306 Ga0395900_0153446
2307 Ga0395900_0440889
2308 Ga0395898_0000751
2309 Ga0395898_0004678
2310 Ga0395898_0012071
2311 Ga0395898_0012419
2312 Ga0395898_0019940
2313 Ga0395898_0035174
2314 Ga0395898_0164832
2315 Ga0395898_0445558
2316 Ga0395905_0005858
2317 Ga0395905_0018917
2318 Ga0395905_0050569
2319 Ga0395905_0062684
2320 Ga0395905_0066056
2321 Ga0395905_0085393
2322 Ga0395905_0212001
2323 Ga0395901_0000077
2324 Ga0395901_0000246
2325 Ga0395901_0000908
2326 Ga0395901_0026128
2327 Ga0395901_0030832
2328 Ga0395901_0043177
2329 Ga0395901_0123752
2330 Ga0395901_0130622
2331 Ga0395901_0288605
2332 Ga0237819_01112
2333 Ga0400483_108750
2334 Ga0400483_135484
2335 Ga0400483_180197
2336 Ga0400483_243671
2337 Ga0436361_0108407
2338 Ga0436361_0659434
2339 Ga0436361_1220162
2340 Ga0436363_1150514
2341 Ga0439436_0013263
2342 Ga0439436_0028606
2343 Ga0439466_0003736
2344 Ga0439465_0030638
2345 Ga0451795_0226724
2346 Ga0451839_0426667
2347 Ga0439445_0024077
2348 Ga0439448_0010380
2349 Ga0439448_0019533
2350 Ga0439448_0025958
2351 Ga0439432_004797
2352 Ga0439449_0018184
2353 Ga0439449_0040347
2354 Ga0439450_009204
2355 Ga0439451_000125
2356 Ga0439451_000134
2357 Ga0439452_000130
2358 Ga0439452_009390
2359 Ga0439457_000234
2360 Ga0439457_003788
2361 Ga0439463_013229
2362 Ga0450911_003786
2363 Ga0450920_008457
2364 Ga0450923_003270
2365 Ga0450894_000475
2366 Ga0450898_002595
2367 Ga0450902_009804
2368 Ga0450906_000347
2369 Ga0450907_002519
2370 Ga0439458_0003190
2371 Ga0450908_000522
2372 Ga0439434_0003886
2373 Ga0439464_0005925
2374 Ga0439460_0008127
2375 Ga0451577_0089587
2376 Ga0466969_0009500
2377 Ga0466969_0018605
2378 Ga0466969_0039455
2379 Ga0466972_0000462
2380 Ga0466972_0007761
2381 Ga0466972_0015619
2382 Ga0466972_0111947
2383 Ga0466965_0004793
2384 Ga0466965_0010740
2385 Ga0466965_0017187
2386 Ga0466965_0038068
2387 Ga0466966_0000927
2388 Ga0466966_0001156
2389 Ga0466966_0001664
2390 Ga0466966_0009048
2391 Ga0466966_0075818
2392 Ga0466966_0109047
2393 Ga0466961_0005318
2394 Ga0466961_0012135
2395 Ga0466961_0034753
2396 Ga0466963_0001264
2397 Ga0466963_0002989
2398 Ga0466964_0006530
2399 Ga0453684_0259954
2400 Ga0453684_0297449
2401 Ga0466971_0001070
2402 Ga0466971_0024430
2403 Ga0466971_0098252
2404 Ga0466968_0013336
2405 Ga0466970_0004934
2406 Ga0466970_0026319
2407 Ga0466957_0000029
2408 Ga0466957_0001270
2409 Ga0466957_0123522
2410 Ga0466957_0143405
2411 Ga0466960_0024039
2412 Ga0466959_0006518
2413 Ga0466959_0007787
2414 Ga0466959_0019614
2415 Ga0466959_0077580
2416 Ga0451576_0008986
2417 Ga0451576_0027926
2418 Ga0466958_0000352
2419 Ga0466958_0004427
2420 Ga0466958_0020230
2421 Ga0466958_0114456
2422 Ga0466967_0022489
2423 Ga0466967_0040101
2424 Ga0466967_0378902
2425 Ga0495617_000642
2426 Ga0495617_006827
2427 Ga0495617_010652
2428 Ga0495617_014761
2429 Ga0495617_028167
2430 Ga0495617_052606
2431 Ga0495627_000254
2432 Ga0495627_001072
2433 Ga0495627_026424
2434 Ga0495592_0012672
2435 Ga0495592_0015756
2436 Ga0495603_0002962
2437 Ga0495603_0007336
2438 Ga0495603_0015983
2439 Ga0495603_0019131
2440 Ga0495590_0000965
2441 Ga0495590_0007568
2442 Ga0495590_0015204
2443 Ga0495590_0044467
2444 Ga0495591_000005
2445 Ga0495591_000088
2446 Ga0495591_003293
2447 Ga0495591_009522
2448 Ga0495629_0008564
2449 Ga0495629_0010005
2450 Ga0495629_0019619
2451 Ga0495629_0072821
2452 Ga0495629_0124042
2453 Ga0495638_0001071
2454 Ga0495638_0003500
2455 Ga0495638_0004007
2456 Ga0495638_0011558
2457 Ga0495638_0017740
2458 Ga0495638_0040011
2459 Ga0495638_0042721
2460 Ga0495638_0064128
2461 Ga0495638_0110876
2462 Ga0495653_0001089
2463 Ga0495653_0004894
2464 Ga0495653_0036548
2465 Ga0495653_0045911
2466 Ga0495650_0001499
2467 Ga0495650_0001536
2468 Ga0495650_0001808
2469 Ga0495650_0002221
2470 Ga0495650_0002985
2471 Ga0495650_0005447
2472 Ga0495650_0019653
2473 Ga0495580_0010092
2474 Ga0495580_0015860
2475 Ga0495605_0000195
2476 Ga0495605_0000199
2477 Ga0495605_0000257
2478 Ga0495605_0001546
2479 Ga0495605_0007942
2480 Ga0495605_0019276
2481 Ga0495639_0003285
2482 Ga0495662_0008243
2483 Ga0495664_0003557
2484 Ga0495664_0032744
2485 Ga0495664_0097429
2486 Ga0495584_0001017
2487 Ga0495584_0002370
2488 Ga0495584_0024427
2489 Ga0495584_0030071
2490 Ga0495584_0118609
2491 Ga0495585_0000142
2492 Ga0495585_0000577
2493 Ga0495585_0000795
2494 Ga0495585_0002260
2495 Ga0495585_0012745
2496 Ga0495585_0035019
2497 Ga0495585_0080431
2498 Ga0495585_0092144
2499 Ga0495594_0091268
2500 Ga0495596_0000061
2501 Ga0495596_0001643
2502 Ga0495607_0000138
2503 Ga0495607_0000394
2504 Ga0495607_0001084
2505 Ga0495607_0001219
2506 Ga0495607_0001489
2507 Ga0495607_0003744
2508 Ga0495607_0006485
2509 Ga0495607_0013896
2510 Ga0495607_0025057
2511 Ga0495607_0033723
2512 Ga0495607_0035928
2513 Ga0495583_0002568
2514 Ga0495583_0071013
2515 Ga0495583_0084457
2516 Ga0495606_0000081
2517 Ga0495606_0000525
2518 Ga0495606_0005029
2519 Ga0495606_0005176
2520 Ga0495606_0005506
2521 Ga0495606_0009409
2522 Ga0495606_0025173
2523 Ga0495606_0028965
2524 Ga0495606_0034505
2525 Ga0495608_0073290
2526 Ga0495610_0000198
2527 Ga0495610_0000963
2528 Ga0495610_0008811
2529 Ga0495610_0057593
2530 Ga0495610_0068188
2531 Ga0495616_0002680
2532 Ga0495616_0006038
2533 Ga0495616_0008012
2534 Ga0495616_0014248
2535 Ga0495616_0024064
2536 Ga0495616_0033012
2537 Ga0495616_0037408
2538 Ga0495620_0000035
2539 Ga0495620_0031909
2540 Ga0495628_0046359
2541 Ga0495628_0064348
2542 Ga0495630_0002568
2543 Ga0495630_0006537
2544 Ga0495630_0063736
2545 Ga0495631_0000063
2546 Ga0495631_0000122
2547 Ga0495631_0001230
2548 Ga0495631_0017620
2549 Ga0495632_0000058
2550 Ga0495632_0000395
2551 Ga0495632_0000518
2552 Ga0495632_0000908
2553 Ga0495632_0000983
2554 Ga0495632_0003288
2555 Ga0495632_0005029
2556 Ga0495632_0008756
2557 Ga0495632_0014772
2558 Ga0495632_0019335
2559 Ga0495632_0027861
2560 Ga0495637_0000113
2561 Ga0495637_0000315
2562 Ga0495637_0000473
2563 Ga0495637_0001685
2564 Ga0495637_0007094
2565 Ga0495637_0023097
2566 Ga0495637_0023593
2567 Ga0495637_0046766
2568 Ga0495643_0000044
2569 Ga0495643_0000880
2570 Ga0495643_0002862
2571 Ga0495643_0003493
2572 Ga0495643_0006532
2573 Ga0495643_0018596
2574 Ga0495643_0021770
2575 Ga0495643_0070273
2576 Ga0495644_0001098
2577 Ga0495644_0021452
2578 Ga0495648_0000241
2579 Ga0495648_0002312
2580 Ga0495648_0016866
2581 Ga0495648_0017766
2582 Ga0495648_0026949
2583 Ga0495648_0031424
2584 Ga0495663_0000394
2585 Ga0495666_0000069
2586 Ga0495666_0000092
2587 Ga0495666_0002984
2588 Ga0495666_0004604
2589 Ga0495666_0005780
2590 Ga0495666_0009363
2591 Ga0495666_0038050
2592 Ga0495666_0062478
2593 Ga0495642_0000003
2594 Ga0495642_0076951
2595 Ga0495642_0090933
2596 Ga0495652_0000784
2597 Ga0495652_0034602
2598 Ga0495654_0000799
2599 Ga0495654_0001139
2600 Ga0495654_0002457
2601 Ga0495654_0002606
2602 Ga0495654_0002865
2603 Ga0495654_0017248
2604 Ga0495654_0064580
2605 Ga0495665_0002959
2606 Ga0495665_0033485
2607 Ga0495640_0016046
2608 Ga0495586_0014575
2609 Ga0495586_0042300
2610 Ga0495587_0001318
2611 Ga0495609_0000490
2612 Ga0495597_0000216
2613 Ga0495597_0000253
2614 Ga0495597_0002240
2615 Ga0495597_0002886
2616 Ga0495597_0007992
2617 Ga0495645_0011206
2618 Ga0495645_0017315
2619 Ga0495622_0006141
2620 Ga0495622_0011238
2621 Ga0495622_0019278
2622 Ga0495633_0006427
2623 Ga0495633_0010354
2624 Ga0495633_0067193
2625 Ga0495667_0059961
2626 Ga0495656_0000104
2627 Ga0495656_0003267
2628 Ga0495668_0000140
2629 Ga0495668_0001118
2630 Ga0495668_0043700
2631 Ga0495668_0080318
2632 Ga0495634_0016136
2633 Ga0495634_0239724
2634 Ga0495611_0001324
2635 Ga0495611_0025688
2636 Ga0495625_0000056
2637 Ga0495625_0000095
2638 Ga0495625_0001135
2639 Ga0495625_0001678
2640 Ga0495625_0012504
2641 Ga0495625_0014369
2642 Ga0495625_0018924
2643 Ga0495625_0031487
2644 Ga0495625_0032310
2645 Ga0495625_0059375
2646 Ga0495659_0000116
2647 Ga0495661_0000010
2648 Ga0495661_0000049
2649 Ga0495661_0000085
2650 Ga0495661_0013544
2651 Ga0495661_0017164
2652 Ga0495661_0031376
2653 Ga0495661_0060608
2654 Ga0495588_0023820
2655 Ga0495657_0059057
2656 Ga0495599_0001037
2657 Ga0495623_0001804
2658 Ga0495623_0003834
2659 Ga0495623_0030607
2660 Ga0495623_0202603
2661 Ga0495646_0000390
2662 Ga0495669_0000263
2663 Ga0495669_0002053
2664 Ga0495613_0005666
2665 Ga0495613_0109142
2666 Ga0495613_0111465
2667 Ga0495613_0128580
2668 Ga0495613_0283440
2669 Ga0495624_0011630
2670 Ga0495624_0063046
2671 Ga0495670_0008981
2672 Ga0495670_0024495
2673 Ga0495671_0001083
2674 Ga0495671_0001728
2675 Ga0495671_0001868
2676 Ga0495671_0002038
2677 Ga0495671_0005199
2678 Ga0495671_0034418
2679 Ga0495671_0103777
2680 Ga0495649_0000039
2681 Ga0495649_0000083
2682 Ga0495649_0005034
2683 Ga0495649_0013467
2684 Ga0495649_0019649
2685 Ga0495649_0022739
2686 Ga0495649_0029073
2687 Ga0495649_0066989
2688 Ga0495589_0000549
2689 Ga0495589_0005805
2690 Ga0495589_0006501
2691 Ga0495589_0025127
2692 Ga0495589_0034424
2693 Ga0495600_0001254
2694 Ga0495600_0006329
2695 Ga0495660_0000287
2696 Ga0495660_0000388
2697 Ga0495660_0000392
2698 Ga0495660_0000454
2699 Ga0495660_0000517
2700 Ga0495660_0002257
2701 Ga0495660_0020177
2702 Ga0495660_0021034
2703 Ga0495660_0026115
2704 Ga0495660_0027303
2705 Ga0495660_0045561
2706 Ga0495660_0051545
2707 Ga0495581_0016932
2708 Ga0495581_0069012
2709 Ga0495581_0103882
2710 Ga0495581_0104411
2711 Ga0495604_0001552
2712 Ga0495604_0003658
2713 Ga0495604_0034809
2714 Ga0495604_0075169
2715 Ga0495604_0108577
2716 Ga0495636_0002723
2717 Ga0495636_0005002
2718 Ga0495636_0066331
2719 Ga0495636_0083151
2720 Ga0495674_0006435
2721 Ga0495674_0007194
2722 Ga0495674_0023541
2723 Ga0495674_0070938
2724 Ga0495672_0000006
2725 Ga0495672_0000190
2726 Ga0495672_0000213
2727 Ga0495672_0000442
2728 Ga0495672_0001989
2729 Ga0495672_0002680
2730 Ga0495672_0003117
2731 Ga0495672_0007520
2732 Ga0495672_0080258
2733 Ga0495676_0000393
2734 Ga0495676_0007316
2735 Ga0495676_0010140
2736 Ga0495676_0030011
2737 Ga0495676_0036507
2738 Ga0495676_0067182
2739 Ga0495680_0000543
2740 Ga0495680_0000608
2741 Ga0495680_0000992
2742 Ga0495680_0001350
2743 Ga0495680_0002710
2744 Ga0495680_0004753
2745 Ga0495680_0046210
2746 Ga0495683_0000245
2747 Ga0495683_0000253
2748 Ga0495683_0000416
2749 Ga0495683_0003035
2750 Ga0495683_0003458
2751 Ga0495683_0014751
2752 Ga0495683_0018717
2753 Ga0495687_000308
2754 Ga0495687_000389
2755 Ga0495687_000495
2756 Ga0495687_000724
2757 Ga0495687_000845
2758 Ga0495687_002228
2759 Ga0495687_003776
2760 Ga0495687_003894
2761 Ga0495687_029428
2762 Ga0495687_036191
2763 Ga0495687_036601
2764 Ga0495687_039781
2765 Ga0495675_0000123
2766 Ga0495675_0001415
2767 Ga0495675_0001577
2768 Ga0495675_0007815
2769 Ga0495675_0024018
2770 Ga0495675_0230393
2771 Ga0495677_0000047
2772 Ga0495679_000672
2773 Ga0495679_021500
2774 Ga0495685_000850
2775 Ga0495685_007619
2776 Ga0495685_041402
2777 Ga0495673_0000025
2778 Ga0495673_0000155
2779 Ga0495673_0000178
2780 Ga0495673_0000221
2781 Ga0495673_0000922
2782 Ga0495673_0001024
2783 Ga0495673_0001183
2784 Ga0495673_0002914
2785 Ga0495673_0008706
2786 Ga0495673_0016529
2787 Ga0495673_0018987
2788 Ga0495681_0000026
2789 Ga0495681_0000198
2790 Ga0495681_0002726
2791 Ga0495681_0003820
2792 Ga0495681_0004705
2793 Ga0495681_0012414
2794 Ga0495681_0014290
2795 Ga0495684_0002582
2796 Ga0495686_0098785
2797 Ga0495593_0002886
2798 Ga0495593_0004344
2799 Ga0495602_0005230
2800 Ga0495602_0006180
2801 Ga0495614_0005431
2802 Ga0495614_0005865
2803 Ga0495614_0020059
2804 Ga0495626_0000033
2805 Ga0495626_0000132
2806 Ga0495626_0000522
2807 Ga0495626_0000528
2808 Ga0495626_0000760
2809 Ga0495626_0002344
2810 Ga0495626_0005636
2811 Ga0495626_0014908
2812 Ga0496100_0008351
2813 Ga0496100_0009196
2814 Ga0496100_0063090
2815 Ga0496100_0154789
2816 Ga0496101_0006713
2817 Ga0496101_0052905
2818 Ga0496102_0000640
2819 Ga0496102_0001362
2820 Ga0496102_0004150
2821 Ga0496102_0017432
2822 Ga0496102_0046800
2823 Ga0496102_0115949
2824 Ga0496103_0000197
2825 Ga0496103_0003193
2826 Ga0496103_0004050
2827 Ga0496103_0008193
2828 Ga0496104_0016732
2829 Ga0496104_0020106
2830 Ga0496104_0034365
2831 Ga0496104_0078834
2832 Ga0496104_0276725
2833 Ga0496105_0005813
2834 Ga0496105_0043486
2835 Ga0496105_0063948
2836 Ga0496105_0128627
2837 Ga0496106_0048984
2838 Ga0496106_0100261
2839 Ga0496106_0135009
2840 Ga0496106_0142053
2841 Ga0496108_0147251
2842 Ga0496109_0128879
2843 Ga0496109_0160594
2844 Ga0496109_0207237
2845 Ga0496109_0444592
2846 Ga0496110_0004506
2847 Ga0496110_0019584
2848 Ga0496110_0042373
2849 Ga0496110_0291118
2850 Ga0496111_0049764
2851 Ga0496111_0168151
2852 Ga0496111_0295995
2853 Ga0496112_0019536
2854 Ga0496113_0000915
2855 Ga0496113_0006120
2856 Ga0496113_0019641
2857 Ga0496113_0027368
2858 Ga0496113_0072833
2859 Ga0496114_0008420
2860 Ga0496114_0051083
2861 Ga0496114_0169692
2862 Ga0496114_0327104
2863 Ga0496116_0000014
2864 Ga0496116_0001609
2865 Ga0496117_0000467
2866 Ga0496117_0008128
2867 Ga0496118_0000459
2868 Ga0496118_0003112
2869 Ga0496118_0008803
2870 Ga0496118_0029338
2871 Ga0496118_0109992
2872 Ga0496119_0000119
2873 Ga0496119_0000346
2874 Ga0496119_0051837
2875 Ga0496120_0031371
2876 Ga0496121_0000079
2877 Ga0496121_0000382
2878 Ga0496121_0000511
2879 Ga0496121_0002155
2880 Ga0496121_0009162
2881 Ga0496122_0000310
2882 Ga0496122_0000552
2883 Ga0496122_0000662
2884 Ga0496122_0001487
2885 Ga0496122_0027018
2886 Ga0496122_0085809
2887 Ga0496123_0000478
2888 Ga0496123_0000815
2889 Ga0496123_0001031
2890 Ga0496123_0007781
2891 Ga0496123_0060403
2892 Ga0496123_0126229
2893 Ga0496124_0000499
2894 Ga0496124_0000569
2895 Ga0496124_0006777
2896 Ga0496124_0008365
2897 Ga0496124_0043380
2898 Ga0496124_0278695
2899 Ga0496125_0000122
2900 Ga0496125_0000395
2901 Ga0496125_0001860
2902 Ga0496125_0003943
2903 Ga0496125_0005275
2904 Ga0496125_0008770
2905 Ga0496125_0029798
2906 Ga0496125_0202191
2907 Ga0496126_0006618
2908 Ga0496126_0020454
2909 Ga0496126_0151825
2910 Ga0496126_0186830
2911 Ga0495678_001207
2912 Ga0495678_002246
2913 Ga0495678_003338
2914 Ga0495678_009079
2915 Ga0495678_015185
2916 Ga0495678_015883
2917 Ga0495678_036129
2918 Ga0495678_052718
2919 Ga0495678_073908
2920 Ga0495682_0000039
2921 Ga0495682_0000410
2922 Ga0495682_0000749
2923 Ga0495682_0000926
2924 Ga0495682_0013509
2925 Ga0501031_0010394
2926 Ga0501031_0010803
2927 Ga0501031_0013109
2928 Ga0501031_0024216
2929 Ga0501031_0092593
2930 Ga0501031_0147415
2931 Ga0501031_0168856
2932 Ga0501032_0002092
2933 Ga0501032_0003209
2934 Ga0501032_0006722
2935 Ga0501032_0010214
2936 Ga0501032_0014996
2937 Ga0501032_0093180
2938 Ga0501033_0001171
2939 Ga0501033_0002171
2940 Ga0501033_0022401
2941 Ga0501033_0042082
2942 Ga0501033_0162376
2943 Ga0501034_0000106
2944 Ga0501034_0008467
2945 Ga0501034_0020595
2946 Ga0501034_0055155
2947 Ga0501034_0121765
2948 Ga0501036_0003079
2949 Ga0501036_0012260
2950 Ga0501036_0021057
2951 Ga0501036_0044297
2952 Ga0501036_0075491
2953 Ga0501036_0188381
2954 Ga0501037_0007407
2955 Ga0501037_0010386
2956 Ga0501037_0019972
2957 Ga0501037_0110019
2958 Ga0501037_0122942
2959 Ga0501037_0253784
2960 Ga0501037_0347067
2961 Ga0501038_0002634
2962 Ga0501038_0003415
2963 Ga0501038_0010728
2964 Ga0501038_0014617
2965 Ga0501038_0018815
2966 Ga0501038_0072181
2967 Ga0501038_0094812
2968 Ga0501038_0196611
2969 Ga0501038_0243660
2970 Ga0501038_0261647
2971 Ga0501039_0000282
2972 Ga0501039_0002340
2973 Ga0501039_0024041
2974 Ga0501039_0109677
2975 Ga0501040_0004628
2976 Ga0501040_0011583
2977 Ga0501040_0116572
2978 Ga0501041_0020186
2979 Ga0501041_0027866
2980 Ga0501042_0017244
2981 Ga0501042_0163828
2982 Ga0501043_0011878
2983 Ga0501043_0015353
2984 Ga0501043_0027415
2985 Ga0501043_0045241
2986 Ga0501043_0106392
2987 Ga0501043_0198016
2988 Ga0501046_0001006
2989 Ga0501046_0007593
2990 Ga0501046_0031213
2991 Ga0501046_0155916
2992 Ga0501047_0000036
2993 Ga0501047_0003625
2994 Ga0501047_0009898
2995 Ga0501047_0031744
2996 Ga0501047_0040722
2997 Ga0501047_0075216
2998 Ga0501047_0288475
2999 Ga0501047_0295781
3000 Ga0501048_0019782
3001 Ga0501048_0053301
3002 Ga0501048_0240324
3003 Ga0501067_0001886
3004 Ga0501068_0007938
3005 Ga0501068_0032522
3006 Ga0501069_0003811
3007 Ga0501070_0038723
3008 Ga0501071_0024811
3009 Ga0501071_0071954
3010 Ga0501072_0024579
3011 Ga0501073_0003630
3012 Ga0501073_0011234
3013 Ga0501073_0036317
3014 Ga0501073_0172633
3015 Ga0501073_0239640
3016 Ga0501073_0240221
3017 Ga0501074_0002288
3018 Ga0501074_0005080
3019 Ga0501074_0089514
3020 Ga0501075_0020312
3021 Ga0501076_0022686
3022 Ga0501076_0112372
3023 Ga0501076_0370151
3024 Ga0501243_001464
3025 Ga0501257_001732
3026 Ga0501079_0020833
3027 Ga0501080_0016873
3028 Ga0501080_0071579
3029 Ga0501080_0203779
3030 Ga0501081_0025728
3031 Ga0501081_0252980
3032 Ga0501083_0003958
3033 Ga0501083_0016958
3034 Ga0501241_000061
3035 Ga0501269_001275
3036 Ga0501280_001356
3037 Ga0501035_0001192
3038 Ga0501035_0003108
3039 Ga0501035_0028985
3040 Ga0501035_0039087
3041 Ga0501035_0040698
3042 Ga0501035_0373541
3043 Ga0501044_0000915
3044 Ga0501044_0009480
3045 Ga0501044_0025273
3046 Ga0501044_0055998
3047 Ga0501044_0075136
3048 Ga0501044_0093884
3049 Ga0501044_0107928
3050 Ga0501044_0139614
3051 Ga0501044_0215945
3052 Ga0501044_0227518
3053 Ga0501044_0236557
3054 Ga0501044_0240447
3055 Ga0501044_0428002
3056 Ga0501044_0487492
3057 Ga0501045_0035056
3058 Ga0501045_0081085
3059 Ga0501045_0160260
3060 nmdc:mga03683_12240_c1
3061 nmdc:mga03683_174_c1
3062 nmdc:mga03683_9790_c1
3063 nmdc:mga03n38_11270_c1
3064 nmdc:mga03n38_155138_c1
3065 nmdc:mga03n38_265_c1
3066 nmdc:mga00v17_11359_c1
3067 nmdc:mga00v17_141113_c1
3068 nmdc:mga00v17_195_c1
3069 nmdc:mga00v17_2323_c1
3070 nmdc:mga00v17_37683_c1
3071 nmdc:mga00v17_6863_c1
3072 nmdc:mga00v17_6918_c1
3073 nmdc:mga00v17_85329_c1
3074 nmdc:mga0yw44_1997_c1
3075 nmdc:mga0yw44_21739_c1
3076 nmdc:mga0yw44_224_c1
3077 nmdc:mga0yw44_32929_c1
3078 nmdc:mga0yw44_48330_c1
3079 nmdc:mga0k408_2031_c1
3080 nmdc:mga0k408_29312_c1
3081 nmdc:mga0k408_3752_c1
3082 nmdc:mga06z11_23022_c1
3083 nmdc:mga06z11_27245_c1
3084 nmdc:mga06z11_566_c1
3085 nmdc:mga06z11_66994_c1
3086 nmdc:mga04h51_16705_c1
3087 nmdc:mga07m45_1348_c1
3088 nmdc:mga07m45_28397_c1
3089 nmdc:mga07m45_4378_c1
3090 nmdc:mga0qj67_247037_c1
3091 nmdc:mga0n895_7312_c1
3092 nmdc:mga0rr50_23734_c1
3093 nmdc:mga08x19_16585_c1
3094 nmdc:mga0sz30_10786_c1
3095 nmdc:mga0sz30_46130_c1
3096 Ga0495601_0000136
3097 Ga0495601_0000631
3098 Ga0495601_0039665
3099 Ga0495601_0107814
3100 Ga0495612_0009485
3101 Ga0500610_0000020
3102 Ga0495655_0005623
3103 Ga0495655_0024373
3104 Ga0500643_000006
3105 Ga0500643_000288
3106 Ga0500643_000806
3107 Ga0500643_047016
3108 Ga0500644_0024613
3109 Ga0500646_0000243
3110 Ga0500583_0004080
3111 Ga0500660_058423
3112 Ga0500553_077520
3113 Ga0500556_0000694
3114 Ga0500556_0001563
3115 Ga0500562_000274
3116 Ga0500593_000390
3117 Ga0500628_001979
3118 Ga0500658_0011791
3119 Ga0500559_0000539
3120 Ga0500559_0088021
3121 Ga0500561_0004018
3122 Ga0500579_047035
3123 Ga0500588_0017800
3124 Ga0500588_0029193
3125 Ga0500600_0036492
3126 Ga0500616_0000090
3127 Ga0500616_0000366
3128 Ga0500616_0006429
3129 Ga0500624_003000
3130 Ga0500627_0097501
3131 Ga0500633_0003880
3132 Ga0500638_000052
3133 Ga0500636_0053914
3134 Ga0500645_013100
3135 Ga0500656_000664
3136 Ga0500565_000835
3137 Ga0500587_001296
3138 Ga0501084_0003841
3139 Ga0501084_0006423
3140 Ga0501084_0153371
3141 Ga0501082_0007219
3142 Ga0501082_0077527
3143 Ga0466962_0002590
3144 Ga0466962_0003058
3145 Ga0466962_0065263
3146 Ga0466962_0103894
3147 Ga0530510_0034331
3148 2506866591
3149 2508676500
3150 2511265326
3151 2511271868
3152 2511290386
3153 2511300026
3154 2511314516
3155 2511322094
3156 2511322662
3157 2511331900
3158 2511347854
3159 2511348960
3160 2511354147
3161 2513962115
3162 2515687836
3163 2516021844
3164 2517763276
3165 2524613814
3166 2547374727
3167 2548697399
3168 2559431727
3169 2563056847
3170 2563057937
3171 2566997100
3172 2585312308
3173 2588109337
3174 2599408945
3175 2600023000
3176 2600076368
3177 2600815086
3178 2601522538
3179 2601527565
3180 2601614396
3181 2601619116
3182 2601642264
3183 2601647126
3184 2601652543
3185 2601657869
3186 2601662087
3187 2601695045
3188 2601699717
3189 2601706388
3190 2601710694
3191 2601715708
3192 2601720068
3193 2601726114
3194 2601730655
3195 2601735671
3196 2601740939
3197 2601750869
3198 2602018123
3199 2603659449
3200 2603664724
3201 2603838047
3202 2603843125
3203 2603848198
3204 2603853273
3205 2603871324
3206 2603876255
3207 2606048517
3208 2606069151
3209 2606144973
3210 2606175918
3211 2616900590
3212 2621299508
3213 2621300473
3214 2623498752
3215 2623500936
3216 2624479896
3217 2637224820
3218 2643766676
3219 2643811030
3220 2643824625
3221 2643846924
3222 2643900950
3223 2643999425
3224 2644032370
3225 2644038347
3226 2644092067
3227 2644158927
3228 2644172031
3229 2644278126
3230 2644321870
3231 2644407096
3232 2644489758
3233 2644535877
3234 2676200598
3235 2676406085
3236 2686538252
3237 2686539124
3238 2689956911
3239 2689994600
3240 2689996405
3241 2713473360
3242 2713481141
3243 2723640571
3244 2723848337
3245 2738673137
3246 2738694628
3247 2738751530
3248 2738860571
3249 2738886481
3250 2738893014
3251 2739205899
3252 2739236131
3253 2739257939
3254 2739261348
3255 2739332531
3256 2739363401
3257 2744957679
3258 2753040036
3259 2753328546
3260 2753568354
3261 2753764942
3262 2774396166
3263 2774845176
3264 2774903118
3265 2775658984
3266 2776376818
3267 2777022155
3268 2785338952
3269 2786666593
3270 2786675103
3271 2792837774
3272 2793080200
3273 2808848596
3274 2808899371
3275 2808900092
3276 2809145039
3277 2809197803
3278 2812330890
3279 2812347706
3280 2812358301
3281 2817490452
3282 2817490871
3283 2819689309
3284 2834645108
3285 2843693297
3286 2852108231
3287 2855387397
3288 2858692522
3289 2862385394
3290 2862385739
3291 2862575659
3292 2863072772
3293 2867347023
3294 2870628179
3295 2873315454
3296 2874611376
3297 2877684670
3298 2881104882
3299 2885267480
3300 2889304499
3301 2891052136
3302 2891968884
3303 2895428621
3304 2895887647
3305 2900642698
3306 2902794389
3307 2902838784
3308 2904514292
3309 2904536690
3310 2904545693
3311 2904549507
3312 2904619292
3313 2904766414
3314 2904770311
3315 2904770426
3316 2904772477
3317 2908816357
3318 2912728671
3319 2915358969
3320 2919054981
3321 2919140844
3322 2919156355
3323 2919421155
3324 2919422313
3325 2919422327
3326 2919433087
3327 2919435420
3328 2919435434
3329 2919720169
3330 2922555139
3331 2928143647
3332 2929168348
3333 2929214030
3334 2929217851
3335 2935393775
3336 2935410066
3337 2939575007
3338 2939674789
3339 2939745103
3340 2941489122
3341 2945914585
3342 2945990014
3343 2946073377
3344 2954680273
3345 2954681684
3346 2954683878
3347 2954711922
3348 2954721856
3349 2954739993
3350 2954740752
3351 2954758811
3352 2954759762
3353 2969081800
3354 2984564225
3355 2984580488
3356 2984596960
3357 2990067775
3358 2990258180
3359 3003002588
3360 3006494426
3361 3007719907
3362 642595293
3363 8002787277
3364 8004212912
3365 8006989693
3366 8008559210
3367 8008560778
3368 8015691598
3369 8033688493
3370 8047712035
3371 8048364369
3372 8048371700
3373 8048380633
3374 8048408705
3375 8048747391
3376 8054002910
3377 8054609905
3378 8055883933
3379 8056174141
3380 8056174155

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00682

HMGL-like

HMGL-like

6

263

0.97

PF07836

DmpG_comm

DmpG-like communication domain

272

334

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1nvm-assembly1.cif.gz_A crystal structure of a bifunctional aldolase-dehydrogenase : sequestering a reactive and volatile intermediate 0.9925 3 335
4lrs-assembly1.cif.gz_A crystal and solution structures of the bifunctional enzyme (aldolase/aldehyde dehydrogenase) from thermomonospora curvata, reveal a cofactor-binding domain motion during nad+ and coa accommodation whithin the shared cofactor-binding site 0.9845 3 337
4jn6-assembly1.cif.gz_A crystal structure of the aldolase-dehydrogenase complex from mycobacterium tuberculosis hrv37 0.9794 1 338
4jn6-assembly1.cif.gz_A crystal structure of the aldolase-dehydrogenase complex from mycobacterium tuberculosis hrv37 0.9766 1 338
4lrs-assembly1.cif.gz_A crystal and solution structures of the bifunctional enzyme (aldolase/aldehyde dehydrogenase) from thermomonospora curvata, reveal a cofactor-binding domain motion during nad+ and coa accommodation whithin the shared cofactor-binding site 0.9759 3 337
ID Description Score Start End Superfamily
1nvmE01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9965 3 265 3.20.20.70
1nvmG02 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.9916 273 335 1.10.8.60
af_P51020_275_337_1.10.8.60 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.9909 273 334 1.10.8.60
1nvmE02 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.9903 273 333 1.10.8.60
af_O06334_8_264_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9769 3 260 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A6P1I588-F1-model_v4 4-hydroxy-2-oxovalerate aldolase (EC 4.1.3.39) 1.003 84 233 GO:0003852
GO:0008701
GO:0009098
AF-A0A4Q2QN03-F1-model_v4 4-hydroxy-2-oxovalerate aldolase 1.003 82 209 GO:0003852
GO:0009098
AF-A0A6B3D2C3-F1-model_v4 4-hydroxy-2-oxovalerate aldolase 1.003 62 163 GO:0003824
AF-A0A3D9TR18-F1-model_v4 deleted 1.002 136 275
AF-A0A6M1I1J8-F1-model_v4 deleted 1.002 99 228

Map