F495346
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1689 | 705 | 3380 | 341 |
Family's Representative Sequence
| Representative Sequence | 3300044673|Ga0453683_0019366|Ga0453683_0019366_2188_3198 |
| Length | 336 |
| Sequence | MTQKRKIRIMDTTLRDGSHSVRHQYGADHVAKIAAALAKARIDTIEVTHGDGLGGSSIQYGFGKLSDQELLQAAKPVIGNSKLAVLLLPGIGIKEDLEMAYREGARVARIATHVTEADISAQHIELAKKIGMEVVGFLMLAHMVDPPKVLEQAKLMESYGADVVYVVDSAGAMVPDHVKSRVSPLVNQLKIKTGFHAHNNLGLAIGNTLAAIEEGVDVVDGSLAGMGAGAGNTPTEVLVAVLDKMGYETGVDLYAIMDAAEDVVRPLMQRPQVIDKAALSIGYAGVYSSFLLHTAKAAEKYKLDPRDILIELGKRKVVGGQEDMIVDVALELTRVR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 2 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 4 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 5 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 6 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 7 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 8 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 9 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 10 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 11 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 12 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 13 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 14 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 15 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 16 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 17 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 18 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 19 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 20 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 21 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 22 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 23 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 24 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 25 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 26 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 27 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 28 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 29 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 33 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 37 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 58 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 60 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 66 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 67 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 68 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 69 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 70 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 71 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 72 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 73 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 74 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 75 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 76 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 77 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 78 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 79 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 80 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 81 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 83 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 84 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 85 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 86 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 87 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 88 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 89 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 90 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 91 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 92 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 93 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 94 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 95 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 96 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 97 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 98 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 99 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 100 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 102 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 103 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 104 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 131 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 134 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 136 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 137 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 139 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 140 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 141 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 202 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 204 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 208 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 209 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 210 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 211 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 212 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 213 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 214 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 215 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 216 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 217 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 218 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 219 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 220 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 221 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 222 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 223 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 224 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 225 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 226 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 227 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 228 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 229 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 230 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 231 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 232 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 233 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 234 | 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Metagenome | Unclassified |
| 235 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 236 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 237 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 238 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 239 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 240 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 241 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 242 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 243 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 244 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 245 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 246 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 247 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 248 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 249 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 250 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 251 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 252 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 253 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 254 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 255 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 256 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 257 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 258 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 259 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 260 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 261 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 262 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 263 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 264 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 265 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 266 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 267 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 268 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 269 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 270 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 271 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 272 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 273 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 274 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 275 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 276 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 277 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 278 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 279 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 280 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 281 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 282 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 283 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 284 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 285 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 286 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 287 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 288 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 289 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 290 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 291 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 292 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 293 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 294 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 295 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 387 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 388 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 389 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 390 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 391 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 392 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 393 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 394 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 395 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 396 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 397 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 398 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 399 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 400 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 401 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 402 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 403 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 404 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 405 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 406 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 407 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 408 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 409 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 410 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 411 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 414 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 415 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 416 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 417 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 418 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 419 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 420 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 421 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 422 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 423 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 424 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 425 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 426 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 427 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 428 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 429 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 430 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 431 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 432 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 433 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 434 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 435 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 436 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 437 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 438 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 439 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 440 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 441 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 442 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 443 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 444 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 445 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 446 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 447 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 448 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 449 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 450 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 451 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 452 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 453 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 454 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 455 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 456 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 457 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 458 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 459 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 460 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 461 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 462 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 463 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 464 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 465 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 466 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 467 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 468 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 469 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 470 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 471 | 3300053100 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere | Metagenome | Endosphere |
| 472 | 3300053101 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere | Metagenome | Endosphere |
| 473 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 474 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 475 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 476 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 477 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 478 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 479 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 480 | 3300053143 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere | Metagenome | Endosphere |
| 481 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 482 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 483 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 484 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 485 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 486 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 487 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 488 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 489 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 490 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 491 | 3300053734 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere | Metagenome | Endosphere |
| 492 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 493 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 494 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 495 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 496 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 497 | 2506783011 | Frankia datiscae Dg1 | Isolate | Nodule |
| 498 | 2508501039 | Frankia saprophytica CN3 | Isolate | Nodule |
| 499 | 2511231006 | Pseudomonas sp. GM17 | Isolate | Nodule |
| 500 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 501 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 502 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 503 | 2511231014 | Pseudomonas sp. GM48 | Isolate | Nodule |
| 504 | 2511231015 | Pseudomonas sp. GM49 | Isolate | Nodule |
| 505 | 2511231017 | Pseudomonas sp. GM55 | Isolate | Nodule |
| 506 | 2511231020 | Pseudomonas sp. GM74 | Isolate | Nodule |
| 507 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 508 | 2513237151 | Burkholderia sp. WSM2230 | Isolate | Nodule |
| 509 | 2515154123 | Trinickia symbiotica JPY347 | Isolate | Nodule |
| 510 | 2515154189 | Paraburkholderia nodosa DSM 21604 | Isolate | Unclassified |
| 511 | 2517572101 | Frankia sp. DC12 | Isolate | Nodule |
| 512 | 2524023250 | Niveispirillum irakense DSM 11586 | Isolate | Unclassified |
| 513 | 2547132103 | Chromobacterium sp. C-61 | Isolate | Rhizosphere |
| 514 | 2547132424 | Nocardia nova SH22a | Isolate | Unclassified |
| 515 | 2558860280 | Kutzneria sp. 744 | Isolate | Unclassified |
| 516 | 2562617112 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 517 | 2565956761 | Rhodococcus qingshengii BKS 20-40 | Isolate | Rhizosphere |
| 518 | 2582581314 | Streptomyces mirabilis YR139 | Isolate | Rhizosphere |
| 519 | 2585428157 | Microbacterium sp. CF335 | Isolate | Rhizosphere |
| 520 | 2599185169 | Klebsiella quasipneumoniae NFPP35 | Isolate | Rhizoplane |
| 521 | 2599185316 | Pseudomonas sp. NFACC52 | Isolate | Rhizoplane |
| 522 | 2599185325 | Pseudomonas sp. NFACC56-3 | Isolate | Rhizoplane |
| 523 | 2600255067 | Paraburkholderia kururiensis thiooxydans NBRC 107107 | Isolate | Unclassified |
| 524 | 2600255254 | Klebsiella quasipneumoniae NFIX15 | Isolate | Rhizoplane |
| 525 | 2600255255 | Klebsiella quasipneumoniae NFIX23 | Isolate | Rhizoplane |
| 526 | 2600255280 | Klebsiella quasipneumoniae NFIX42 | Isolate | Rhizoplane |
| 527 | 2600255281 | Klebsiella quasipneumoniae NFIX43 | Isolate | Rhizoplane |
| 528 | 2600255287 | Klebsiella quasipneumoniae NFIX11 | Isolate | Rhizoplane |
| 529 | 2600255288 | Klebsiella quasipneumoniae NFIX14 | Isolate | Rhizoplane |
| 530 | 2600255289 | Klebsiella quasipneumoniae NFIX16 | Isolate | Rhizoplane |
| 531 | 2600255290 | Klebsiella quasipneumoniae NFIX17 | Isolate | Rhizoplane |
| 532 | 2600255291 | Klebsiella quasipneumoniae NFIX19 | Isolate | Rhizoplane |
| 533 | 2600255298 | Klebsiella quasipneumoniae NFIX21 | Isolate | Rhizoplane |
| 534 | 2600255299 | Klebsiella quasipneumoniae NFIX22 | Isolate | Rhizoplane |
| 535 | 2600255300 | Klebsiella quasipneumoniae NFIX30 | Isolate | Rhizoplane |
| 536 | 2600255301 | Klebsiella quasipneumoniae NFIX33 | Isolate | Rhizoplane |
| 537 | 2600255302 | Klebsiella quasipneumoniae NFIX35 | Isolate | Rhizoplane |
| 538 | 2600255303 | Klebsiella quasipneumoniae NFIX36 | Isolate | Rhizoplane |
| 539 | 2600255304 | Klebsiella quasipneumoniae NFIX37 | Isolate | Rhizoplane |
| 540 | 2600255305 | Klebsiella quasipneumoniae NFIX41 | Isolate | Rhizoplane |
| 541 | 2600255306 | Klebsiella quasipneumoniae NFIX44 | Isolate | Rhizoplane |
| 542 | 2600255307 | Klebsiella quasipneumoniae NFIX56 | Isolate | Rhizoplane |
| 543 | 2600255309 | Klebsiella sp. NFIX53 | Isolate | Rhizoplane |
| 544 | 2600255392 | Klebsiella quasipneumoniae NFIX54 | Isolate | Rhizoplane |
| 545 | 2602042052 | Klebsiella quasipneumoniae NFIX18 | Isolate | Rhizoplane |
| 546 | 2602042053 | Klebsiella quasipneumoniae NFIX12 | Isolate | Rhizoplane |
| 547 | 2602042103 | Klebsiella quasipneumoniae NFIX29 | Isolate | Rhizoplane |
| 548 | 2602042104 | Klebsiella quasipneumoniae NFIX26 | Isolate | Rhizoplane |
| 549 | 2602042105 | Klebsiella quasipneumoniae NFIX25 | Isolate | Rhizoplane |
| 550 | 2602042106 | Klebsiella quasipneumoniae NFIX13 | Isolate | Rhizoplane |
| 551 | 2602042110 | Klebsiella quasipneumoniae NFIX40 | Isolate | Rhizoplane |
| 552 | 2602042111 | Klebsiella quasipneumoniae NFIX20 | Isolate | Rhizoplane |
| 553 | 2603880178 | Klebsiella quasipneumoniae NFIX34 | Isolate | Rhizoplane |
| 554 | 2603880184 | Klebsiella quasipneumoniae NFIX27 | Isolate | Rhizoplane |
| 555 | 2603880202 | Klebsiella quasipneumoniae NFIX38 | Isolate | Rhizoplane |
| 556 | 2603880211 | Klebsiella quasipneumoniae NFIX24 | Isolate | Rhizoplane |
| 557 | 2616644941 | Streptomyces atratus OK807 | Isolate | Rhizosphere |
| 558 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 559 | 2622736605 | Geodermatophilus ruber DSM 45317 | Isolate | Rhizosphere |
| 560 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 561 | 2636415599 | Klebsiella variicola DX120E | Isolate | Unclassified |
| 562 | 2643221549 | Agromyces sp. Root1464 | Isolate | Unclassified |
| 563 | 2643221558 | Rhizobium sp. Root149 | Isolate | Unclassified |
| 564 | 2643221561 | Nocardioides sp. Root151 | Isolate | Unclassified |
| 565 | 2643221566 | Microbacterium sp. Root166 | Isolate | Unclassified |
| 566 | 2643221578 | Streptomyces sp. Root63 | Isolate | Unclassified |
| 567 | 2643221598 | Phenylobacterium sp. Root700 | Isolate | Unclassified |
| 568 | 2643221604 | Nocardioides sp. Root190 | Isolate | Unclassified |
| 569 | 2643221605 | Sphingomonas sp. Root710 | Isolate | Unclassified |
| 570 | 2643221615 | Nocardioides sp. Root224 | Isolate | Unclassified |
| 571 | 2643221628 | Variovorax sp. Root318D1 | Isolate | Unclassified |
| 572 | 2643221630 | Microbacterium sp. Root322 | Isolate | Unclassified |
| 573 | 2643221649 | Leifsonia sp. Root4 | Isolate | Unclassified |
| 574 | 2643221657 | Nocardioides sp. Root1257 | Isolate | Unclassified |
| 575 | 2643221673 | Streptomyces sp. Root1295 | Isolate | Unclassified |
| 576 | 2643221687 | Mycobacterium sp. Root135 | Isolate | Unclassified |
| 577 | 2643221696 | Nocardioides sp. Root140 | Isolate | Unclassified |
| 578 | 2675902999 | Frankia asymbiotica NRRL B-16386 | Isolate | Nodule |
| 579 | 2675903046 | Klebsiella quasipneumoniae NFIX52 | Isolate | Rhizoplane |
| 580 | 2684623035 | Frankia sp. NRRL B-16219 | Isolate | Rhizosphere |
| 581 | 2687453737 | Frankia sp. BMG5.36 | Isolate | Nodule |
| 582 | 2687453743 | Frankia colletiae Cc1.17 | Isolate | Nodule |
| 583 | 2711768613 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 584 | 2721755702 | Agromyces sp. AR33 | Isolate | Rhizosphere |
| 585 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 586 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 587 | 2738541272 | Promicromonospora sp. AC04 | Isolate | Unclassified |
| 588 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 589 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 590 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 591 | 2738541308 | Rhodococcus sp. OK551 | Isolate | Unclassified |
| 592 | 2738543005 | Rhodococcus sp. OK519 | Isolate | Unclassified |
| 593 | 2738543011 | Rhodococcus sp. OK611 | Isolate | Unclassified |
| 594 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 595 | 2738543028 | Mycobacterium sp. YR782 | Isolate | Unclassified |
| 596 | 2738543034 | Rhodococcus sp. OK269 | Isolate | Unclassified |
| 597 | 2744054611 | Aldersonia kunmingensis DSM 45001 | Isolate | Rhizosphere |
| 598 | 2751185725 | Microbispora sp. NRRL B-24597 | Isolate | Unclassified |
| 599 | 2751185792 | Kitasatospora arboriphila NRRL B-24581 | Isolate | Unclassified |
| 600 | 2751185846 | Paraburkholderia ribeironis STM 7296 | Isolate | Unclassified |
| 601 | 2751185897 | Sphingomonas panacis DCY99 | Isolate | Unclassified |
| 602 | 2773857762 | Nocardioides sp. SAI-095 | Isolate | Unclassified |
| 603 | 2773857921 | Frankia asymbiotica NRRL B-16386 | Isolate | Nodule |
| 604 | 2773857933 | Frankia sp. BMG5.30 | Isolate | Nodule |
| 605 | 2775506735 | Arthrobacter sp. S95 1704 | Isolate | Unclassified |
| 606 | 2775506925 | Saccharopolyspora phatthalungensis NRRL B-24798 | Isolate | Rhizosphere |
| 607 | 2775507074 | Klebsiella sp. D5A | Isolate | Unclassified |
| 608 | 2784746763 | Streptomyces ossamyceticus SAI-001 | Isolate | Unclassified |
| 609 | 2786546132 | Streptomyces sp. W SAI-097 | Isolate | Unclassified |
| 610 | 2791355137 | Paraburkholderia piptadeniae STM7183 | Isolate | Unclassified |
| 611 | 2791355199 | |||
| 612 | 2808606359 | Streptomyces sp. RJA2910 | Isolate | Unclassified |
| 613 | 2808606372 | Agromyces sp. 23-23 | Isolate | Unclassified |
| 614 | 2808606418 | Herbaspirillum sp. SJZ107 | Isolate | Rhizosphere |
| 615 | 2808606439 | Nocardioides sp. SLBN-172 | Isolate | Unclassified |
| 616 | 2811994874 | Nocardioides sp. SLBN-35 | Isolate | Unclassified |
| 617 | 2811994878 | Nocardioides sp. SLBN-169 | Isolate | Unclassified |
| 618 | 2811994879 | Streptomyces sp. 4-17 | Isolate | Unclassified |
| 619 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 620 | 2818991462 | Terrabacter sp. 3264 | Isolate | Rhizosphere |
| 621 | 2834641062 | Cupriavidus gilardii JZ4 | Isolate | Unclassified |
| 622 | 2843690924 | Chromobacterium rhizoryzae JP2-74 | Isolate | Rhizosphere |
| 623 | 2852103415 | Edaphovirga cremea DSM 105170 | Isolate | Rhizosphere |
| 624 | 2855386786 | Nocardioides ferulae EGI 63112 | Isolate | Unclassified |
| 625 | 2858688981 | Cupriavidus sp. UYMMa02A | Isolate | Unclassified |
| 626 | 2862382967 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 627 | 2862574272 | Streptomyces sp. AcE210 | Isolate | Nodule |
| 628 | 2863067949 | Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) | Isolate | Rhizosphere |
| 629 | 2867346516 | Streptomyces radicis AZ1-7 | Isolate | Unclassified |
| 630 | 2870628048 | Microbacterium thalassium DSM 12511 | Isolate | Rhizosphere |
| 631 | 2873314349 | Sphaerisporangium siamense DSM 45784 | Isolate | Rhizosphere |
| 632 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 633 | 2877676314 | Streptomyces griseorubiginosus 3E-1 | Isolate | Unclassified |
| 634 | 2881101125 | Ramlibacter rhizophilus CCTCC AB2015357 | Isolate | Rhizosphere |
| 635 | 2885266251 | Ralstonia sp. SET104 | Isolate | Nodule |
| 636 | 2889300758 | Rhodococcus sp. PvR099 | Isolate | Rhizosphere |
| 637 | 2891048133 | Martelella lutilitoris GH2-6 | Isolate | Rhizosphere |
| 638 | 2891968417 | Nocardioides luteus SAI-037 | Isolate | Unclassified |
| 639 | 2895427314 | Nonomuraea sp. PA05 | Isolate | Unclassified |
| 640 | 2895880812 | Frankia sp. BMG5.11 | Isolate | Unclassified |
| 641 | 2900634093 | Paraburkholderia dipogonis ICMP 19430 | Isolate | Unclassified |
| 642 | 2902792274 | Mycolicibacterium sp. P9-64 | Isolate | Unclassified |
| 643 | 2902837492 | Mycolicibacterium sp. P1-18 | Isolate | Unclassified |
| 644 | 2904513164 | Klebsiella variicola 1431 | Isolate | Rhizosphere |
| 645 | 2904535858 | Rhodococcus erythropolis 2017 | Isolate | Unclassified |
| 646 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 647 | 2904615490 | Paraburkholderia franconis CNPSo 3157 | Isolate | Unclassified |
| 648 | 2904765812 | Rhodococcus fascians 1590 | Isolate | Rhizosphere |
| 649 | 2904770941 | Rhodococcus fascians 1339 | Isolate | Rhizosphere |
| 650 | 2908811453 | Rhodococcus sp. 1R11 | Isolate | Unclassified |
| 651 | 2912723979 | Streptomyces sp. NEAU-sy36 | Isolate | Rhizosphere |
| 652 | 2915358134 | Pseudonocardia pini CAP47R | Isolate | Unclassified |
| 653 | 2919051321 | Sinomonas atrocyanea 1003 | Isolate | Rhizosphere |
| 654 | 2919138771 | Novosphingobium sp. 1748 | Isolate | Rhizosphere |
| 655 | 2919155634 | Pseudomonas fulva 1992 | Isolate | Unclassified |
| 656 | 2919420072 | Rhodococcus fascians 3241 | Isolate | Rhizosphere |
| 657 | 2919432681 | Rhodococcus sp. 3258 | Isolate | Rhizosphere |
| 658 | 2919713450 | Nocardia kruczakiae 4272 | Isolate | Rhizosphere |
| 659 | 2922554459 | Rhodococcus sp. 66b | Isolate | Unclassified |
| 660 | 2928142448 | Prescottella equi DPS 2018 | Isolate | Unclassified |
| 661 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 662 | 2929212328 | Mycolicibacterium sp. R-73050 Hybrid assembly | Isolate | Unclassified |
| 663 | 2935390628 | Streptomyces sp. PvR034 | Isolate | Rhizosphere |
| 664 | 2935409751 | Agromyces sp. PvR057 | Isolate | Rhizosphere |
| 665 | 2939573065 | Citrobacter sp. 506 | Isolate | Rhizosphere |
| 666 | 2939674588 | Arthrobacter bambusae 3552 | Isolate | Rhizosphere |
| 667 | 2939743619 | Rhodococcus sp. PvR044 | Isolate | Rhizosphere |
| 668 | 2941485952 | Brevundimonas faecalis 2814 | Isolate | Rhizosphere |
| 669 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 670 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 671 | 2946072368 | Streptomyces achromogenes W4I19-2 | Isolate | Rhizosphere |
| 672 | 2954673503 | Streptomyces sp. SAI-119 | Isolate | Rhizosphere |
| 673 | 2954682443 | Streptomyces sp. SAI-149 | Isolate | Rhizosphere |
| 674 | 2954711539 | Streptomyces sp. SAI-090 | Isolate | Rhizosphere |
| 675 | 2954721474 | Streptomyces sp. SAI-117 | Isolate | Rhizosphere |
| 676 | 2954731030 | Streptomyces sp. SAI-133 | Isolate | Rhizosphere |
| 677 | 2954740390 | Streptomyces sp. SAI-041 | Isolate | Rhizosphere |
| 678 | 2954749733 | Streptomyces sp. SAI-135 | Isolate | Rhizosphere |
| 679 | 2954759201 | Streptomyces sp. SAI-208 | Isolate | Rhizosphere |
| 680 | 2969079654 | Klebsiella variicola E57-7 | Isolate | Unclassified |
| 681 | 2984559226 | Klebsiella variicola SORGH_AS834 | Isolate | Aerial Root |
| 682 | 2984576629 | Nocardioides zeae SORGH_AS913 | Isolate | Aerial Root |
| 683 | 2984595703 | Klebsiella variicola SORGH_AS1070 | Isolate | Aerial Root |
| 684 | 2990059506 | Streptomyces sp. CAP261 | Isolate | Unclassified |
| 685 | 2990256926 | Nocardioides zeae SORGH_AS885 | Isolate | Aerial Root |
| 686 | 3002998708 | Actinomadura barringtoniae GKU 128 | Isolate | Unclassified |
| 687 | 3006493962 | Streptomyces grisecoloratus TRM S81-3 | Isolate | Rhizosphere |
| 688 | 3007718800 | Pseudomonas fluorescens BW11P2 | Isolate | Rhizosphere |
| 689 | 642555112 | Paraburkholderia phymatum STM815 | Isolate | Nodule |
| 690 | 8002784119 | Frankia sp. AgB1.9 | Isolate | Nodule |
| 691 | 8004212874 | Microbacterium sp. NC79 | Isolate | Rhizosphere |
| 692 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 693 | 8008558824 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 694 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 695 | 8033684223 | Streptomyces phytophilus PIP175 | Isolate | Unclassified |
| 696 | 8047710418 | Umezawaea endophytica DSM 103496 | Isolate | Unclassified |
| 697 | 8048356638 | Streptomyces rhizosphaericus DSM 41760 | Isolate | Rhizosphere |
| 698 | 8048369669 | Streptomyces indonesiensis DSM 41759 | Isolate | Rhizoplane |
| 699 | 8048379754 | Streptomyces asiaticus DSM 41761 | Isolate | Rhizosphere |
| 700 | 8048406513 | Streptomyces heilongjiangensis NEAU-W2 | Isolate | Unclassified |
| 701 | 8048746797 | Alcaligenes endophyticus DSM 100498 | Isolate | Unclassified |
| 702 | 8054002106 | Azospirillum lipoferum 59b | Isolate | Unclassified |
| 703 | 8054609563 | Nocardioides astragali CGMCC 4.7327 | Isolate | Nodule |
| 704 | 8055878733 | Pseudomonas palmensis BBB001 | Isolate | Rhizosphere |
| 705 | 8056172158 | Pseudomonas ekonensis COR58 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 86.08 |
| Metatranscriptomes | 0.18 |
| Isolates | 13.74 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.24 |
| Bulb | 0 |
| Endosphere | 8.41 |
| Nodule | 2.25 |
| Rhizoplane | 5.33 |
| Rhizosphere | 71.94 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.18 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0453683_0019366 | 3300044673 | Bacteria | 4361 |
| 2 | LJQas_1006075 | 3300000549 | Bacteria | 1512 |
| 3 | JGI24736J21556_1001110 | 3300001904 | Bacteria | 4918 |
| 4 | JGI24741J21665_1000113 | 3300001915 | Bacteria | 21885 |
| 5 | JGI24740J21852_10000711 | 3300001979 | Bacteria | 14441 |
| 6 | JGI24740J21852_10002626 | 3300001979 | Bacteria | 8094 |
| 7 | JGI24740J21852_10002683 | 3300001979 | Bacteria | 7986 |
| 8 | JGI24740J21852_10004751 | 3300001979 | Bacteria | 5804 |
| 9 | JGI24740J21852_10009903 | 3300001979 | Bacteria | 3700 |
| 10 | JGI24739J22299_10004028 | 3300001989 | Bacteria | 5620 |
| 11 | JGI24739J22299_10004360 | 3300001989 | Bacteria | 5420 |
| 12 | JGI24739J22299_10014764 | 3300001989 | Bacteria | 2840 |
| 13 | JGI24737J22298_10007873 | 3300001990 | Bacteria | 3589 |
| 14 | JGI24737J22298_10013837 | 3300001990 | Bacteria | 2624 |
| 15 | JGI24735J21928_10011021 | 3300002067 | Bacteria | 2871 |
| 16 | JGI24735J21928_10017697 | 3300002067 | Bacteria | 2202 |
| 17 | JGI24750J21931_1002100 | 3300002070 | Bacteria | 2422 |
| 18 | JGI24745J21846_1001283 | 3300002073 | Bacteria | 2427 |
| 19 | JGI24738J21930_10000132 | 3300002075 | Bacteria | 18200 |
| 20 | JGI24738J21930_10004974 | 3300002075 | Bacteria | 3217 |
| 21 | JGI24749J21850_1004251 | 3300002076 | Bacteria | 2001 |
| 22 | JGI24749J21850_1006511 | 3300002076 | Bacteria | 1627 |
| 23 | JGI24744J21845_10000214 | 3300002077 | Bacteria | 9078 |
| 24 | JGI24742J22300_10000517 | 3300002244 | Bacteria | 5750 |
| 25 | JGI24751J29686_10012933 | 3300002459 | Bacteria | 1723 |
| 26 | JGI24751J29686_10017101 | 3300002459 | Bacteria | 1498 |
| 27 | JGI25154J39366_1000680 | 3300002738 | Bacteria | 15719 |
| 28 | JGI25151J46595_10006212 | 3300003187 | Bacteria | 6044 |
| 29 | JGI25406J46586_10004639 | 3300003203 | Bacteria | 6397 |
| 30 | rootH1_10005611 | 3300003316 | Bacteria | 17859 |
| 31 | rootH1_10005611 | 3300003323 | Bacteria | 26216 |
| 32 | rootL2_10011255 | 3300003322 | Bacteria | 1538 |
| 33 | rootL2_10024094 | 3300003322 | Bacteria | 17301 |
| 34 | rootH1_10007244 | 3300003316 | Bacteria | 1760 |
| 35 | rootH1_10007244 | 3300003323 | Bacteria | 12965 |
| 36 | rootH1_10018354 | 3300003323 | Bacteria | 16678 |
| 37 | Ga0006562J51391_1047977 | 3300003578 | Bacteria | 3722 |
| 38 | Ga0006562J51391_1047978 | 3300003578 | Bacteria | 3020 |
| 39 | Ga0055534_1008400 | 3300003784 | Bacteria | 2341 |
| 40 | Ga0055530_10000093 | 3300003791 | Bacteria | 77624 |
| 41 | Ga0055530_10000104 | 3300003791 | Bacteria | 72163 |
| 42 | Ga0055530_10006899 | 3300003791 | Bacteria | 4921 |
| 43 | Ga0055530_10013286 | 3300003791 | Bacteria | 2818 |
| 44 | Ga0055540_1000104 | 3300003792 | Bacteria | 93795 |
| 45 | Ga0055540_1000335 | 3300003792 | Bacteria | 40623 |
| 46 | Ga0055540_1000374 | 3300003792 | Bacteria | 37462 |
| 47 | Ga0055531_10000432 | 3300003794 | Bacteria | 39735 |
| 48 | Ga0055531_10000475 | 3300003794 | Bacteria | 37156 |
| 49 | Ga0055531_10000798 | 3300003794 | Bacteria | 26114 |
| 50 | Ga0065714_10002253 | 3300005288 | Bacteria | 35579 |
| 51 | Ga0065714_10002318 | 3300005288 | Bacteria | 24919 |
| 52 | Ga0065714_10071256 | 3300005288 | Bacteria | 3624 |
| 53 | Ga0065714_10072687 | 3300005288 | Bacteria | 3324 |
| 54 | Ga0065707_10158656 | 3300005295 | Bacteria | 1584 |
| 55 | Ga0070658_10002591 | 3300005327 | Bacteria | 15066 |
| 56 | Ga0070658_10006024 | 3300005327 | Bacteria | 9839 |
| 57 | Ga0070658_10085040 | 3300005327 | Bacteria | 2601 |
| 58 | Ga0070683_100058031 | 3300005329 | Bacteria | 3596 |
| 59 | Ga0070670_100035314 | 3300005331 | Bacteria | 4304 |
| 60 | Ga0068869_100058671 | 3300005334 | Bacteria | 2815 |
| 61 | Ga0070666_10038372 | 3300005335 | Bacteria | 3187 |
| 62 | Ga0070680_100089435 | 3300005336 | Bacteria | 2548 |
| 63 | Ga0070682_100177234 | 3300005337 | Bacteria | 1486 |
| 64 | Ga0068868_100096800 | 3300005338 | Bacteria | 2384 |
| 65 | Ga0068868_100211149 | 3300005338 | Bacteria | 1622 |
| 66 | Ga0070660_100019900 | 3300005339 | Bacteria | 4925 |
| 67 | Ga0070660_100068276 | 3300005339 | Bacteria | 2770 |
| 68 | Ga0070687_100036621 | 3300005343 | Bacteria | 2446 |
| 69 | Ga0070661_100017643 | 3300005344 | Bacteria | 5065 |
| 70 | Ga0070661_100037246 | 3300005344 | Bacteria | 3538 |
| 71 | Ga0070692_10040316 | 3300005345 | Bacteria | 2388 |
| 72 | Ga0070668_100012270 | 3300005347 | Bacteria | 6384 |
| 73 | Ga0070668_100298556 | 3300005347 | Bacteria | 1350 |
| 74 | Ga0070669_100153879 | 3300005353 | Bacteria | 1782 |
| 75 | Ga0070673_100066340 | 3300005364 | Bacteria | 2882 |
| 76 | Ga0070659_100014358 | 3300005366 | Bacteria | 5917 |
| 77 | Ga0070659_100016108 | 3300005366 | Bacteria | 5609 |
| 78 | Ga0070659_100040971 | 3300005366 | Bacteria | 3619 |
| 79 | Ga0070659_100097415 | 3300005366 | Bacteria | 2364 |
| 80 | Ga0070667_100001179 | 3300005367 | Bacteria | 23784 |
| 81 | Ga0070667_100143708 | 3300005367 | Bacteria | 2091 |
| 82 | Ga0070667_100459785 | 3300005367 | Bacteria | 1164 |
| 83 | Ga0070709_10013047 | 3300005434 | Bacteria | 4665 |
| 84 | Ga0070709_10039557 | 3300005434 | Bacteria | 2894 |
| 85 | Ga0070709_10074903 | 3300005434 | Bacteria | 2194 |
| 86 | Ga0070714_100010158 | 3300005435 | Bacteria | 7430 |
| 87 | Ga0070714_100061288 | 3300005435 | Bacteria | 3230 |
| 88 | Ga0070714_100126052 | 3300005435 | Bacteria | 2283 |
| 89 | Ga0070713_100086281 | 3300005436 | Bacteria | 2691 |
| 90 | Ga0070713_100091314 | 3300005436 | Bacteria | 2620 |
| 91 | Ga0070711_100017440 | 3300005439 | Bacteria | 4572 |
| 92 | Ga0070711_100196943 | 3300005439 | Bacteria | 1552 |
| 93 | Ga0070700_100233018 | 3300005441 | Bacteria | 1311 |
| 94 | Ga0070708_100109310 | 3300005445 | Bacteria | 2540 |
| 95 | Ga0070663_100001457 | 3300005455 | Bacteria | 12998 |
| 96 | Ga0070663_100005366 | 3300005455 | Bacteria | 7611 |
| 97 | Ga0070663_100171543 | 3300005455 | Bacteria | 1677 |
| 98 | Ga0070662_100002546 | 3300005457 | Bacteria | 11224 |
| 99 | Ga0070662_100040010 | 3300005457 | Bacteria | 3336 |
| 100 | Ga0070662_100068871 | 3300005457 | Bacteria | 2603 |
| 101 | Ga0070662_100109535 | 3300005457 | Bacteria | 2102 |
| 102 | Ga0070662_100127245 | 3300005457 | Bacteria | 1960 |
| 103 | Ga0070681_10023386 | 3300005458 | Bacteria | 6214 |
| 104 | Ga0070706_100017747 | 3300005467 | Bacteria | 6567 |
| 105 | Ga0070698_100024948 | 3300005471 | Bacteria | 6232 |
| 106 | Ga0070698_100052415 | 3300005471 | Bacteria | 4150 |
| 107 | Ga0070698_100094493 | 3300005471 | Bacteria | 2969 |
| 108 | Ga0070679_100005894 | 3300005530 | Bacteria | 11386 |
| 109 | Ga0070679_100389841 | 3300005530 | Bacteria | 1339 |
| 110 | Ga0070679_100441610 | 3300005530 | Bacteria | 1246 |
| 111 | Ga0070684_100042291 | 3300005535 | Bacteria | 3933 |
| 112 | Ga0068853_100034643 | 3300005539 | Bacteria | 4286 |
| 113 | Ga0068853_100094831 | 3300005539 | Bacteria | 2630 |
| 114 | Ga0068853_100101111 | 3300005539 | Bacteria | 2549 |
| 115 | Ga0068853_100120002 | 3300005539 | Bacteria | 2344 |
| 116 | Ga0068853_100496487 | 3300005539 | Bacteria | 1152 |
| 117 | Ga0070672_100240562 | 3300005543 | Bacteria | 1522 |
| 118 | Ga0070686_100068812 | 3300005544 | Bacteria | 2310 |
| 119 | Ga0070695_100022082 | 3300005545 | Bacteria | 3900 |
| 120 | Ga0070665_100005167 | 3300005548 | Bacteria | 13507 |
| 121 | Ga0070665_100096194 | 3300005548 | Bacteria | 2966 |
| 122 | Ga0070665_100405076 | 3300005548 | Bacteria | 1372 |
| 123 | Ga0070704_100052742 | 3300005549 | Bacteria | 2871 |
| 124 | Ga0068855_100017817 | 3300005563 | Bacteria | 8538 |
| 125 | Ga0068855_100073278 | 3300005563 | Bacteria | 3979 |
| 126 | Ga0068855_100178472 | 3300005563 | Bacteria | 2402 |
| 127 | Ga0068855_100639185 | 3300005563 | Bacteria | 1144 |
| 128 | Ga0068857_100010913 | 3300005577 | Bacteria | 7908 |
| 129 | Ga0068857_100070185 | 3300005577 | Bacteria | 3120 |
| 130 | Ga0068854_100001955 | 3300005578 | Bacteria | 12590 |
| 131 | Ga0068854_100010954 | 3300005578 | Bacteria | 5884 |
| 132 | Ga0068854_100209882 | 3300005578 | Bacteria | 1535 |
| 133 | Ga0068856_100001670 | 3300005614 | Bacteria | 23234 |
| 134 | Ga0068856_100001903 | 3300005614 | Bacteria | 21771 |
| 135 | Ga0068856_100004825 | 3300005614 | Bacteria | 13365 |
| 136 | Ga0068856_100031379 | 3300005614 | Bacteria | 5198 |
| 137 | Ga0068856_100124584 | 3300005614 | Bacteria | 2579 |
| 138 | Ga0068852_100004005 | 3300005616 | Bacteria | 10362 |
| 139 | Ga0068852_100010518 | 3300005616 | Bacteria | 6920 |
| 140 | Ga0068852_100062126 | 3300005616 | Bacteria | 3248 |
| 141 | Ga0068859_100062248 | 3300005617 | Bacteria | 3761 |
| 142 | Ga0068859_100410724 | 3300005617 | Bacteria | 1450 |
| 143 | Ga0068861_100162040 | 3300005719 | Bacteria | 1846 |
| 144 | Ga0068851_10012360 | 3300005834 | Bacteria | 4023 |
| 145 | Ga0068851_10014265 | 3300005834 | Bacteria | 3771 |
| 146 | Ga0068851_10015819 | 3300005834 | Bacteria | 3600 |
| 147 | Ga0068851_10046099 | 3300005834 | Bacteria | 2205 |
| 148 | Ga0068863_100000884 | 3300005841 | Bacteria | 30131 |
| 149 | Ga0068858_100000071 | 3300005842 | Bacteria | 105192 |
| 150 | Ga0068858_100194908 | 3300005842 | Bacteria | 1914 |
| 151 | Ga0068860_100002624 | 3300005843 | Bacteria | 18691 |
| 152 | Ga0068862_100001916 | 3300005844 | Bacteria | 18895 |
| 153 | Ga0068862_100081877 | 3300005844 | Bacteria | 2800 |
| 154 | Ga0068862_100518719 | 3300005844 | Bacteria | 1134 |
| 155 | Ga0081455_10000072 | 3300005937 | Bacteria | 108040 |
| 156 | Ga0081455_10000942 | 3300005937 | Bacteria | 37176 |
| 157 | Ga0081455_10049061 | 3300005937 | Bacteria | 3641 |
| 158 | Ga0081455_10061316 | 3300005937 | Bacteria | 3165 |
| 159 | Ga0081538_10005332 | 3300005981 | Bacteria | 11574 |
| 160 | Ga0081540_1000803 | 3300005983 | Bacteria | 28862 |
| 161 | Ga0081540_1056346 | 3300005983 | Bacteria | 1908 |
| 162 | Ga0081540_1063790 | 3300005983 | Bacteria | 1742 |
| 163 | Ga0081539_10000926 | 3300005985 | Bacteria | 55157 |
| 164 | Ga0081539_10001862 | 3300005985 | Bacteria | 33219 |
| 165 | Ga0081539_10002207 | 3300005985 | Bacteria | 28464 |
| 166 | Ga0081539_10057026 | 3300005985 | Bacteria | 2164 |
| 167 | Ga0081539_10102173 | 3300005985 | Bacteria | 1459 |
| 168 | Ga0070717_10003368 | 3300006028 | Bacteria | 11417 |
| 169 | Ga0075365_10000382 | 3300006038 | Bacteria | 16205 |
| 170 | Ga0075365_10007998 | 3300006038 | Bacteria | 5968 |
| 171 | Ga0075365_10009039 | 3300006038 | Bacteria | 5699 |
| 172 | Ga0075365_10021267 | 3300006038 | Bacteria | 4044 |
| 173 | Ga0075365_10024844 | 3300006038 | Bacteria | 3786 |
| 174 | Ga0075365_10048223 | 3300006038 | Bacteria | 2803 |
| 175 | Ga0075365_10240302 | 3300006038 | Bacteria | 1272 |
| 176 | Ga0075368_10029108 | 3300006042 | Bacteria | 2135 |
| 177 | Ga0075363_100019796 | 3300006048 | Bacteria | 3369 |
| 178 | Ga0075363_100028448 | 3300006048 | Bacteria | 2875 |
| 179 | Ga0075363_100033837 | 3300006048 | Bacteria | 2665 |
| 180 | Ga0075363_100062426 | 3300006048 | Bacteria | 2009 |
| 181 | Ga0075364_10001406 | 3300006051 | Bacteria | 13032 |
| 182 | Ga0075364_10027911 | 3300006051 | Bacteria | 3609 |
| 183 | Ga0075364_10033429 | 3300006051 | Bacteria | 3312 |
| 184 | Ga0075364_10035089 | 3300006051 | Bacteria | 3240 |
| 185 | Ga0075364_10050527 | 3300006051 | Bacteria | 2714 |
| 186 | Ga0075364_10086976 | 3300006051 | Bacteria | 2071 |
| 187 | Ga0075364_10137730 | 3300006051 | Bacteria | 1641 |
| 188 | Ga0075432_10000250 | 3300006058 | Bacteria | 14598 |
| 189 | Ga0075432_10064286 | 3300006058 | Bacteria | 1310 |
| 190 | Ga0070715_10001319 | 3300006163 | Bacteria | 7149 |
| 191 | Ga0070716_100002397 | 3300006173 | Bacteria | 8633 |
| 192 | Ga0070712_100005544 | 3300006175 | Bacteria | 7809 |
| 193 | Ga0070712_100022764 | 3300006175 | Bacteria | 4130 |
| 194 | Ga0070712_100079503 | 3300006175 | Bacteria | 2370 |
| 195 | Ga0075362_10000258 | 3300006177 | Bacteria | 14780 |
| 196 | Ga0075362_10033344 | 3300006177 | Bacteria | 2239 |
| 197 | Ga0075362_10037781 | 3300006177 | Bacteria | 2119 |
| 198 | Ga0075362_10053428 | 3300006177 | Bacteria | 1813 |
| 199 | Ga0075362_10094356 | 3300006177 | Bacteria | 1392 |
| 200 | Ga0075367_10000249 | 3300006178 | Bacteria | 18331 |
| 201 | Ga0075367_10000257 | 3300006178 | Bacteria | 18119 |
| 202 | Ga0075367_10003322 | 3300006178 | Bacteria | 7637 |
| 203 | Ga0075367_10053919 | 3300006178 | Bacteria | 2383 |
| 204 | Ga0075367_10164293 | 3300006178 | Bacteria | 1381 |
| 205 | Ga0075369_10003467 | 3300006186 | Bacteria | 5743 |
| 206 | Ga0075369_10027436 | 3300006186 | Bacteria | 2380 |
| 207 | Ga0075369_10051857 | 3300006186 | Bacteria | 1777 |
| 208 | Ga0075369_10079529 | 3300006186 | Bacteria | 1452 |
| 209 | Ga0075369_10083844 | 3300006186 | Bacteria | 1416 |
| 210 | Ga0075366_10000691 | 3300006195 | Bacteria | 15970 |
| 211 | Ga0075366_10002546 | 3300006195 | Bacteria | 9373 |
| 212 | Ga0075366_10108758 | 3300006195 | Bacteria | 1667 |
| 213 | Ga0075370_10000455 | 3300006353 | Bacteria | 15290 |
| 214 | Ga0075370_10000589 | 3300006353 | Bacteria | 14025 |
| 215 | Ga0075370_10000848 | 3300006353 | Bacteria | 12388 |
| 216 | Ga0075370_10001354 | 3300006353 | Bacteria | 10555 |
| 217 | Ga0075428_100000014 | 3300006844 | Bacteria | 166411 |
| 218 | Ga0075430_100032200 | 3300006846 | Bacteria | 4451 |
| 219 | Ga0075430_100090235 | 3300006846 | Bacteria | 2564 |
| 220 | Ga0075430_100094610 | 3300006846 | Bacteria | 2498 |
| 221 | Ga0075434_100010087 | 3300006871 | Bacteria | 8845 |
| 222 | Ga0075434_100220638 | 3300006871 | Bacteria | 1916 |
| 223 | Ga0075429_100203733 | 3300006880 | Unclassified | 1734 |
| 224 | Ga0075436_100021640 | 3300006914 | Bacteria | 4414 |
| 225 | Ga0097620_100062248 | 3300006931 | Bacteria | 3761 |
| 226 | Ga0097620_100410757 | 3300006931 | Bacteria | 1450 |
| 227 | Ga0079104_1002857 | 3300006946 | Bacteria | 8652 |
| 228 | Ga0079104_1003799 | 3300006946 | Bacteria | 6791 |
| 229 | Ga0079104_1023539 | 3300006946 | Bacteria | 1637 |
| 230 | Ga0099826_10011905 | 3300006948 | Bacteria | 6553 |
| 231 | Ga0075435_100015300 | 3300007076 | Bacteria | 5765 |
| 232 | Ga0105251_10046942 | 3300009011 | Bacteria | 2076 |
| 233 | Ga0105251_10066983 | 3300009011 | Bacteria | 1678 |
| 234 | Ga0105244_10000488 | 3300009036 | Bacteria | 35867 |
| 235 | Ga0105244_10009031 | 3300009036 | Bacteria | 6167 |
| 236 | Ga0105244_10023365 | 3300009036 | Bacteria | 3390 |
| 237 | Ga0105250_10000052 | 3300009092 | Bacteria | 116382 |
| 238 | Ga0105250_10030697 | 3300009092 | Bacteria | 2160 |
| 239 | Ga0105240_10001140 | 3300009093 | Bacteria | 46522 |
| 240 | Ga0105240_10018798 | 3300009093 | Bacteria | 9258 |
| 241 | Ga0105240_10021903 | 3300009093 | Bacteria | 8489 |
| 242 | Ga0105240_10023949 | 3300009093 | Bacteria | 8064 |
| 243 | Ga0105240_10076538 | 3300009093 | Bacteria | 4124 |
| 244 | Ga0105240_10077435 | 3300009093 | Bacteria | 4097 |
| 245 | Ga0105240_10086545 | 3300009093 | Bacteria | 3838 |
| 246 | Ga0105240_10093850 | 3300009093 | Bacteria | 3662 |
| 247 | Ga0105240_10100206 | 3300009093 | Bacteria | 3525 |
| 248 | Ga0105240_10103573 | 3300009093 | Bacteria | 3457 |
| 249 | Ga0105240_10144154 | 3300009093 | Bacteria | 2844 |
| 250 | Ga0105240_10160150 | 3300009093 | Bacteria | 2674 |
| 251 | Ga0105240_10326952 | 3300009093 | Bacteria | 1746 |
| 252 | Ga0111539_10000019 | 3300009094 | Bacteria | 266927 |
| 253 | Ga0111539_10275603 | 3300009094 | Bacteria | 1958 |
| 254 | Ga0105245_10603499 | 3300009098 | Bacteria | 1124 |
| 255 | Ga0114129_10019234 | 3300009147 | Bacteria | 9728 |
| 256 | Ga0105243_10003676 | 3300009148 | Bacteria | 12326 |
| 257 | Ga0105243_10013641 | 3300009148 | Bacteria | 6147 |
| 258 | Ga0105243_10224913 | 3300009148 | Bacteria | 1661 |
| 259 | Ga0105241_10000004 | 3300009174 | Bacteria | 803007 |
| 260 | Ga0105241_10000897 | 3300009174 | Bacteria | 22503 |
| 261 | Ga0105241_10004450 | 3300009174 | Bacteria | 10363 |
| 262 | Ga0105241_10023205 | 3300009174 | Bacteria | 4599 |
| 263 | Ga0105241_10103152 | 3300009174 | Bacteria | 2271 |
| 264 | Ga0105241_10111705 | 3300009174 | Bacteria | 2188 |
| 265 | Ga0105242_10128315 | 3300009176 | Bacteria | 2185 |
| 266 | Ga0105248_10000450 | 3300009177 | Bacteria | 46809 |
| 267 | Ga0105237_10000874 | 3300009545 | Bacteria | 40867 |
| 268 | Ga0105237_10001013 | 3300009545 | Bacteria | 37790 |
| 269 | Ga0105237_10001636 | 3300009545 | Bacteria | 29088 |
| 270 | Ga0105237_10019441 | 3300009545 | Bacteria | 7014 |
| 271 | Ga0105237_10028483 | 3300009545 | Bacteria | 5689 |
| 272 | Ga0105237_10036578 | 3300009545 | Bacteria | 4969 |
| 273 | Ga0105237_10042233 | 3300009545 | Bacteria | 4599 |
| 274 | Ga0105237_10055888 | 3300009545 | Bacteria | 3952 |
| 275 | Ga0105237_10168910 | 3300009545 | Bacteria | 2187 |
| 276 | Ga0105237_10329919 | 3300009545 | Bacteria | 1530 |
| 277 | Ga0105238_10000514 | 3300009551 | Bacteria | 40634 |
| 278 | Ga0105238_10011534 | 3300009551 | Bacteria | 8903 |
| 279 | Ga0105238_10019463 | 3300009551 | Bacteria | 6914 |
| 280 | Ga0105238_10022891 | 3300009551 | Bacteria | 6369 |
| 281 | Ga0105238_10030906 | 3300009551 | Bacteria | 5450 |
| 282 | Ga0105238_10056949 | 3300009551 | Bacteria | 3920 |
| 283 | Ga0105238_10159496 | 3300009551 | Bacteria | 2231 |
| 284 | Ga0105238_10168284 | 3300009551 | Bacteria | 2168 |
| 285 | Ga0105249_10000439 | 3300009553 | Bacteria | 39200 |
| 286 | Ga0105249_10014870 | 3300009553 | Bacteria | 6883 |
| 287 | Ga0105249_10019951 | 3300009553 | Bacteria | 5985 |
| 288 | Ga0105249_10132765 | 3300009553 | Bacteria | 2379 |
| 289 | Ga0105239_10000113 | 3300010375 | Bacteria | 114562 |
| 290 | Ga0105239_10000626 | 3300010375 | Bacteria | 50329 |
| 291 | Ga0105239_10001157 | 3300010375 | Bacteria | 36242 |
| 292 | Ga0105239_10003283 | 3300010375 | Bacteria | 19951 |
| 293 | Ga0105239_10006533 | 3300010375 | Bacteria | 13509 |
| 294 | Ga0105239_10007549 | 3300010375 | Bacteria | 12474 |
| 295 | Ga0105239_10011168 | 3300010375 | Bacteria | 10022 |
| 296 | Ga0105239_10019695 | 3300010375 | Bacteria | 7447 |
| 297 | Ga0105239_10021350 | 3300010375 | Bacteria | 7140 |
| 298 | Ga0105239_10031465 | 3300010375 | Bacteria | 5835 |
| 299 | Ga0105239_10037487 | 3300010375 | Bacteria | 5313 |
| 300 | Ga0105239_10040307 | 3300010375 | Bacteria | 5117 |
| 301 | Ga0105239_10153076 | 3300010375 | Bacteria | 2574 |
| 302 | Ga0105239_10166869 | 3300010375 | Bacteria | 2462 |
| 303 | Ga0105239_10360114 | 3300010375 | Bacteria | 1643 |
| 304 | Ga0105246_10033362 | 3300011119 | Bacteria | 3422 |
| 305 | Ga0105246_10062811 | 3300011119 | Bacteria | 2588 |
| 306 | Ga0157373_10002444 | 3300013100 | Bacteria | 14139 |
| 307 | Ga0157373_10004285 | 3300013100 | Bacteria | 10736 |
| 308 | Ga0157371_10000776 | 3300013102 | Bacteria | 36737 |
| 309 | Ga0157371_10006002 | 3300013102 | Bacteria | 10126 |
| 310 | Ga0157370_10004423 | 3300013104 | Bacteria | 16103 |
| 311 | Ga0157370_10009299 | 3300013104 | Bacteria | 10522 |
| 312 | Ga0157370_10016479 | 3300013104 | Bacteria | 7479 |
| 313 | Ga0157370_10017127 | 3300013104 | Bacteria | 7317 |
| 314 | Ga0157369_10008980 | 3300013105 | Bacteria | 11450 |
| 315 | Ga0157369_10073351 | 3300013105 | Bacteria | 3672 |
| 316 | Ga0157369_10264853 | 3300013105 | Bacteria | 1792 |
| 317 | Ga0157374_10142773 | 3300013296 | Bacteria | 2324 |
| 318 | Ga0163162_10319926 | 3300013306 | Bacteria | 1684 |
| 319 | Ga0157372_10002002 | 3300013307 | Bacteria | 22134 |
| 320 | Ga0157372_10004609 | 3300013307 | Bacteria | 14656 |
| 321 | Ga0157372_10021286 | 3300013307 | Bacteria | 7004 |
| 322 | Ga0157372_10045106 | 3300013307 | Bacteria | 4888 |
| 323 | Ga0157372_10653592 | 3300013307 | Bacteria | 1224 |
| 324 | Ga0157375_10000312 | 3300013308 | Bacteria | 43933 |
| 325 | Ga0157375_10107544 | 3300013308 | Bacteria | 2883 |
| 326 | Ga0157375_10145300 | 3300013308 | Bacteria | 2502 |
| 327 | Ga0163163_10000004 | 3300014325 | Bacteria | 416569 |
| 328 | Ga0163163_10171930 | 3300014325 | Bacteria | 2213 |
| 329 | Ga0163163_10300813 | 3300014325 | Bacteria | 1657 |
| 330 | Ga0157380_10266818 | 3300014326 | Bacteria | 1558 |
| 331 | Ga0157380_10339860 | 3300014326 | Bacteria | 1400 |
| 332 | Ga0182008_10000353 | 3300014497 | Bacteria | 35789 |
| 333 | Ga0182008_10001321 | 3300014497 | Bacteria | 16896 |
| 334 | Ga0157379_10000015 | 3300014968 | Bacteria | 104289 |
| 335 | Ga0157379_10000284 | 3300014968 | Bacteria | 40135 |
| 336 | Ga0157379_10106140 | 3300014968 | Bacteria | 2521 |
| 337 | Ga0157376_10044652 | 3300014969 | Bacteria | 3644 |
| 338 | Ga0182006_1001200 | 3300015261 | Bacteria | 16189 |
| 339 | Ga0163161_10000201 | 3300017792 | Bacteria | 54704 |
| 340 | Ga0163161_10002299 | 3300017792 | Bacteria | 13707 |
| 341 | Ga0163161_10018606 | 3300017792 | Bacteria | 4868 |
| 342 | Ga0163161_10024418 | 3300017792 | Bacteria | 4270 |
| 343 | Ga0163161_10048305 | 3300017792 | Bacteria | 3073 |
| 344 | Ga0163161_10055743 | 3300017792 | Bacteria | 2869 |
| 345 | Ga0206354_11589331 | 3300020081 | Bacteria | 1377 |
| 346 | Ga0213872_10004853 | 3300021361 | Bacteria | 7016 |
| 347 | Ga0209147_100156 | 3300025229 | Bacteria | 93105 |
| 348 | Ga0209147_100430 | 3300025229 | Bacteria | 27091 |
| 349 | Ga0209646_1000049 | 3300025246 | Bacteria | 301924 |
| 350 | Ga0209673_1028864 | 3300025273 | Bacteria | 1778 |
| 351 | Ga0209675_1000132 | 3300025291 | Bacteria | 102062 |
| 352 | Ga0209676_1000118 | 3300025292 | Bacteria | 201939 |
| 353 | Ga0209676_1000779 | 3300025292 | Bacteria | 42577 |
| 354 | Ga0209676_1006141 | 3300025292 | Bacteria | 6023 |
| 355 | Ga0209676_1035842 | 3300025292 | Bacteria | 1450 |
| 356 | Ga0209025_1000029 | 3300025294 | Bacteria | 488571 |
| 357 | Ga0209050_1000115 | 3300025298 | Bacteria | 204622 |
| 358 | Ga0209050_1000148 | 3300025298 | Bacteria | 164093 |
| 359 | Ga0209050_1000412 | 3300025298 | Bacteria | 79647 |
| 360 | Ga0209050_1001181 | 3300025298 | Bacteria | 30804 |
| 361 | Ga0207426_1006425 | 3300025302 | Bacteria | 5119 |
| 362 | Ga0209051_1000150 | 3300025303 | Bacteria | 132005 |
| 363 | Ga0209051_1000231 | 3300025303 | Bacteria | 93859 |
| 364 | Ga0209051_1000294 | 3300025303 | Bacteria | 79686 |
| 365 | Ga0209051_1005966 | 3300025303 | Bacteria | 6967 |
| 366 | Ga0209051_1013164 | 3300025303 | Bacteria | 3953 |
| 367 | Ga0209051_1045640 | 3300025303 | Bacteria | 1514 |
| 368 | Ga0209257_1000160 | 3300025304 | Bacteria | 177175 |
| 369 | Ga0209257_1000275 | 3300025304 | Bacteria | 116952 |
| 370 | Ga0207656_10002772 | 3300025321 | Bacteria | 5949 |
| 371 | Ga0207656_10010781 | 3300025321 | Bacteria | 3435 |
| 372 | Ga0207696_1000003 | 3300025711 | Bacteria | 860639 |
| 373 | Ga0207655_1000022 | 3300025728 | Bacteria | 483933 |
| 374 | Ga0207655_1006740 | 3300025728 | Bacteria | 7561 |
| 375 | Ga0207655_1022408 | 3300025728 | Bacteria | 3167 |
| 376 | Ga0207655_1029269 | 3300025728 | Bacteria | 2581 |
| 377 | Ga0207655_1035585 | 3300025728 | Bacteria | 2221 |
| 378 | Ga0207713_1000093 | 3300025735 | Bacteria | 146199 |
| 379 | Ga0207692_10023138 | 3300025898 | Bacteria | 2869 |
| 380 | Ga0207642_10038024 | 3300025899 | Bacteria | 2079 |
| 381 | Ga0207710_10039827 | 3300025900 | Bacteria | 2081 |
| 382 | Ga0207688_10015128 | 3300025901 | Bacteria | 4185 |
| 383 | Ga0207688_10016838 | 3300025901 | Bacteria | 3969 |
| 384 | Ga0207680_10017843 | 3300025903 | Bacteria | 3758 |
| 385 | Ga0207647_10001831 | 3300025904 | Bacteria | 16309 |
| 386 | Ga0207647_10003420 | 3300025904 | Bacteria | 11902 |
| 387 | Ga0207647_10015326 | 3300025904 | Bacteria | 5259 |
| 388 | Ga0207647_10023664 | 3300025904 | Bacteria | 4059 |
| 389 | Ga0207685_10014285 | 3300025905 | Bacteria | 2482 |
| 390 | Ga0207699_10023992 | 3300025906 | Bacteria | 3328 |
| 391 | Ga0207699_10024826 | 3300025906 | Bacteria | 3283 |
| 392 | Ga0207699_10115784 | 3300025906 | Bacteria | 1725 |
| 393 | Ga0207645_10006008 | 3300025907 | Bacteria | 8732 |
| 394 | Ga0207643_10088240 | 3300025908 | Bacteria | 1805 |
| 395 | Ga0207705_10008265 | 3300025909 | Bacteria | 7604 |
| 396 | Ga0207705_10070773 | 3300025909 | Bacteria | 2528 |
| 397 | Ga0207684_10055485 | 3300025910 | Bacteria | 3361 |
| 398 | Ga0207654_10000006 | 3300025911 | Bacteria | 815027 |
| 399 | Ga0207654_10000069 | 3300025911 | Bacteria | 67460 |
| 400 | Ga0207654_10000383 | 3300025911 | Bacteria | 25754 |
| 401 | Ga0207654_10006919 | 3300025911 | Bacteria | 5712 |
| 402 | Ga0207654_10028403 | 3300025911 | Bacteria | 3049 |
| 403 | Ga0207654_10045006 | 3300025911 | Bacteria | 2510 |
| 404 | Ga0207707_10077753 | 3300025912 | Bacteria | 2897 |
| 405 | Ga0207695_10000936 | 3300025913 | Bacteria | 52151 |
| 406 | Ga0207695_10008781 | 3300025913 | Bacteria | 12600 |
| 407 | Ga0207695_10008866 | 3300025913 | Bacteria | 12526 |
| 408 | Ga0207695_10020466 | 3300025913 | Bacteria | 7576 |
| 409 | Ga0207695_10032104 | 3300025913 | Bacteria | 5750 |
| 410 | Ga0207695_10055228 | 3300025913 | Bacteria | 4140 |
| 411 | Ga0207695_10056256 | 3300025913 | Bacteria | 4094 |
| 412 | Ga0207695_10255339 | 3300025913 | Bacteria | 1652 |
| 413 | Ga0207671_10000702 | 3300025914 | Bacteria | 43116 |
| 414 | Ga0207671_10000759 | 3300025914 | Bacteria | 40972 |
| 415 | Ga0207671_10001691 | 3300025914 | Bacteria | 24991 |
| 416 | Ga0207671_10010953 | 3300025914 | Bacteria | 7430 |
| 417 | Ga0207671_10156617 | 3300025914 | Bacteria | 1762 |
| 418 | Ga0207693_10004892 | 3300025915 | Bacteria | 11257 |
| 419 | Ga0207693_10004935 | 3300025915 | Bacteria | 11209 |
| 420 | Ga0207693_10005274 | 3300025915 | Bacteria | 10809 |
| 421 | Ga0207693_10106318 | 3300025915 | Bacteria | 2201 |
| 422 | Ga0207663_10081169 | 3300025916 | Bacteria | 2123 |
| 423 | Ga0207660_10046905 | 3300025917 | Bacteria | 3052 |
| 424 | Ga0207662_10000254 | 3300025918 | Bacteria | 24692 |
| 425 | Ga0207657_10013359 | 3300025919 | Bacteria | 8056 |
| 426 | Ga0207657_10034449 | 3300025919 | Bacteria | 4552 |
| 427 | Ga0207657_10036394 | 3300025919 | Bacteria | 4405 |
| 428 | Ga0207657_10041494 | 3300025919 | Bacteria | 4068 |
| 429 | Ga0207649_10039932 | 3300025920 | Bacteria | 2848 |
| 430 | Ga0207694_10000120 | 3300025924 | Bacteria | 83624 |
| 431 | Ga0207694_10000933 | 3300025924 | Bacteria | 25869 |
| 432 | Ga0207694_10056955 | 3300025924 | Bacteria | 3037 |
| 433 | Ga0207694_10091331 | 3300025924 | Bacteria | 2403 |
| 434 | Ga0207694_10348615 | 3300025924 | Bacteria | 1225 |
| 435 | Ga0207700_10004057 | 3300025928 | Bacteria | 8581 |
| 436 | Ga0207700_10031541 | 3300025928 | Bacteria | 3766 |
| 437 | Ga0207700_10048466 | 3300025928 | Bacteria | 3155 |
| 438 | Ga0207664_10032588 | 3300025929 | Bacteria | 3996 |
| 439 | Ga0207690_10036892 | 3300025932 | Bacteria | 3169 |
| 440 | Ga0207690_10118527 | 3300025932 | Bacteria | 1918 |
| 441 | Ga0207690_10149493 | 3300025932 | Bacteria | 1730 |
| 442 | Ga0207706_10002971 | 3300025933 | Bacteria | 16353 |
| 443 | Ga0207706_10005299 | 3300025933 | Bacteria | 12024 |
| 444 | Ga0207706_10015662 | 3300025933 | Bacteria | 6852 |
| 445 | Ga0207706_10028246 | 3300025933 | Bacteria | 5011 |
| 446 | Ga0207706_10035172 | 3300025933 | Bacteria | 4456 |
| 447 | Ga0207706_10059270 | 3300025933 | Bacteria | 3371 |
| 448 | Ga0207706_10065155 | 3300025933 | Bacteria | 3208 |
| 449 | Ga0207686_10003225 | 3300025934 | Bacteria | 8768 |
| 450 | Ga0207709_10003334 | 3300025935 | Bacteria | 9619 |
| 451 | Ga0207709_10009590 | 3300025935 | Bacteria | 5329 |
| 452 | Ga0207709_10037084 | 3300025935 | Bacteria | 2894 |
| 453 | Ga0207709_10055055 | 3300025935 | Bacteria | 2456 |
| 454 | Ga0207709_10156514 | 3300025935 | Bacteria | 1584 |
| 455 | Ga0207665_10000636 | 3300025939 | Bacteria | 23620 |
| 456 | Ga0207665_10003419 | 3300025939 | Bacteria | 10622 |
| 457 | Ga0207665_10055951 | 3300025939 | Bacteria | 2663 |
| 458 | Ga0207691_10013126 | 3300025940 | Bacteria | 7930 |
| 459 | Ga0207711_10001827 | 3300025941 | Bacteria | 19417 |
| 460 | Ga0207689_10022570 | 3300025942 | Bacteria | 5288 |
| 461 | Ga0207689_10284814 | 3300025942 | Bacteria | 1368 |
| 462 | Ga0207679_10062252 | 3300025945 | Bacteria | 2780 |
| 463 | Ga0207679_10288493 | 3300025945 | Bacteria | 1410 |
| 464 | Ga0207667_10006732 | 3300025949 | Bacteria | 13882 |
| 465 | Ga0207667_10007448 | 3300025949 | Bacteria | 13151 |
| 466 | Ga0207667_10050218 | 3300025949 | Bacteria | 4401 |
| 467 | Ga0207667_10169458 | 3300025949 | Bacteria | 2244 |
| 468 | Ga0207712_10000334 | 3300025961 | Bacteria | 43010 |
| 469 | Ga0207668_10035999 | 3300025972 | Bacteria | 3302 |
| 470 | Ga0207640_10005679 | 3300025981 | Bacteria | 6798 |
| 471 | Ga0207640_10007022 | 3300025981 | Bacteria | 6199 |
| 472 | Ga0207640_10373902 | 3300025981 | Bacteria | 1153 |
| 473 | Ga0207658_10000947 | 3300025986 | Bacteria | 23931 |
| 474 | Ga0207658_10004952 | 3300025986 | Bacteria | 9189 |
| 475 | Ga0207703_10000094 | 3300026035 | Bacteria | 104297 |
| 476 | Ga0207639_10000438 | 3300026041 | Bacteria | 28804 |
| 477 | Ga0207639_10001071 | 3300026041 | Bacteria | 18579 |
| 478 | Ga0207639_10003561 | 3300026041 | Bacteria | 10462 |
| 479 | Ga0207639_10013881 | 3300026041 | Bacteria | 5650 |
| 480 | Ga0207639_10046183 | 3300026041 | Bacteria | 3285 |
| 481 | Ga0207639_10443242 | 3300026041 | Bacteria | 1177 |
| 482 | Ga0207678_10000022 | 3300026067 | Bacteria | 129767 |
| 483 | Ga0207678_10000116 | 3300026067 | Bacteria | 65805 |
| 484 | Ga0207678_10003208 | 3300026067 | Bacteria | 14783 |
| 485 | Ga0207678_10012246 | 3300026067 | Bacteria | 7531 |
| 486 | Ga0207678_10075496 | 3300026067 | Bacteria | 2887 |
| 487 | Ga0207678_10180867 | 3300026067 | Bacteria | 1801 |
| 488 | Ga0207708_10011471 | 3300026075 | Bacteria | 6604 |
| 489 | Ga0207702_10000019 | 3300026078 | Bacteria | 211843 |
| 490 | Ga0207702_10002429 | 3300026078 | Bacteria | 17702 |
| 491 | Ga0207702_10003041 | 3300026078 | Bacteria | 15589 |
| 492 | Ga0207702_10004744 | 3300026078 | Bacteria | 12004 |
| 493 | Ga0207702_10012384 | 3300026078 | Bacteria | 7102 |
| 494 | Ga0207702_10173590 | 3300026078 | Bacteria | 1979 |
| 495 | Ga0207641_10002649 | 3300026088 | Bacteria | 16364 |
| 496 | Ga0207641_10100637 | 3300026088 | Bacteria | 2546 |
| 497 | Ga0207648_10015533 | 3300026089 | Bacteria | 6998 |
| 498 | Ga0207674_10004606 | 3300026116 | Bacteria | 16555 |
| 499 | Ga0207674_10151585 | 3300026116 | Bacteria | 2275 |
| 500 | Ga0207674_10478449 | 3300026116 | Bacteria | 1204 |
| 501 | Ga0207675_100018468 | 3300026118 | Bacteria | 6504 |
| 502 | Ga0207675_100019177 | 3300026118 | Bacteria | 6383 |
| 503 | Ga0207675_100062339 | 3300026118 | Bacteria | 3482 |
| 504 | Ga0207683_10013203 | 3300026121 | Bacteria | 7046 |
| 505 | Ga0207683_10100938 | 3300026121 | Bacteria | 2576 |
| 506 | Ga0207683_10199936 | 3300026121 | Bacteria | 1816 |
| 507 | Ga0207698_10002072 | 3300026142 | Bacteria | 11824 |
| 508 | Ga0207698_10003380 | 3300026142 | Bacteria | 9609 |
| 509 | Ga0209281_1000008 | 3300027111 | Bacteria | 867470 |
| 510 | Ga0209371_1001588 | 3300027312 | Bacteria | 14807 |
| 511 | Ga0207428_10004342 | 3300027907 | Bacteria | 13543 |
| 512 | Ga0207428_10008192 | 3300027907 | Bacteria | 9454 |
| 513 | Ga0207428_10028732 | 3300027907 | Bacteria | 4617 |
| 514 | Ga0268266_10000948 | 3300028379 | Bacteria | 36942 |
| 515 | Ga0268266_10020341 | 3300028379 | Bacteria | 5658 |
| 516 | Ga0268266_10331744 | 3300028379 | Bacteria | 1426 |
| 517 | Ga0268265_10000962 | 3300028380 | Bacteria | 26448 |
| 518 | Ga0268265_10054223 | 3300028380 | Bacteria | 3041 |
| 519 | Ga0268265_10224900 | 3300028380 | Bacteria | 1645 |
| 520 | Ga0268264_10001094 | 3300028381 | Bacteria | 26758 |
| 521 | Ga0268264_10001384 | 3300028381 | Bacteria | 22721 |
| 522 | Ga0307517_10002656 | 3300028786 | Bacteria | 28559 |
| 523 | Ga0307517_10078648 | 3300028786 | Bacteria | 2849 |
| 524 | Ga0307517_10099582 | 3300028786 | Bacteria | 2303 |
| 525 | Ga0307515_10003461 | 3300028794 | Bacteria | 33183 |
| 526 | Ga0307515_10042191 | 3300028794 | Bacteria | 7146 |
| 527 | Ga0307515_10100958 | 3300028794 | Bacteria | 3488 |
| 528 | Ga0307515_10157547 | 3300028794 | Bacteria | 2334 |
| 529 | Ga0307515_10264390 | 3300028794 | Bacteria | 1451 |
| 530 | Ga0307515_10265026 | 3300028794 | Bacteria | 1448 |
| 531 | Ga0307515_10279768 | 3300028794 | Bacteria | 1377 |
| 532 | Ga0265338_10139736 | 3300028800 | Bacteria | 1899 |
| 533 | Ga0268256_1001370 | 3300030500 | Bacteria | 14807 |
| 534 | Ga0307511_10000050 | 3300030521 | Bacteria | 97101 |
| 535 | Ga0307511_10000401 | 3300030521 | Bacteria | 46025 |
| 536 | Ga0307511_10026796 | 3300030521 | Bacteria | 5280 |
| 537 | Ga0307511_10034094 | 3300030521 | Bacteria | 4478 |
| 538 | Ga0307512_10008551 | 3300030522 | Bacteria | 9961 |
| 539 | Ga0307512_10022005 | 3300030522 | Bacteria | 5740 |
| 540 | Ga0307512_10055026 | 3300030522 | Bacteria | 3143 |
| 541 | Ga0316181_1154916 | 3300030744 | Bacteria | 3410 |
| 542 | Ga0316182_1153087 | 3300030745 | Bacteria | 1080 |
| 543 | Ga0265316_10005411 | 3300031344 | Bacteria | 12404 |
| 544 | Ga0307513_10000219 | 3300031456 | Bacteria | 82663 |
| 545 | Ga0307513_10001108 | 3300031456 | Bacteria | 38970 |
| 546 | Ga0307513_10023992 | 3300031456 | Bacteria | 7107 |
| 547 | Ga0307513_10037999 | 3300031456 | Bacteria | 5351 |
| 548 | Ga0307513_10126960 | 3300031456 | Bacteria | 2504 |
| 549 | Ga0307509_10001929 | 3300031507 | Bacteria | 34257 |
| 550 | Ga0307509_10019317 | 3300031507 | Bacteria | 7778 |
| 551 | Ga0307509_10028803 | 3300031507 | Bacteria | 6171 |
| 552 | Ga0307509_10101119 | 3300031507 | Bacteria | 2918 |
| 553 | Ga0307509_10102176 | 3300031507 | Bacteria | 2899 |
| 554 | Ga0307408_100002141 | 3300031548 | Bacteria | 14149 |
| 555 | Ga0307408_100012250 | 3300031548 | Bacteria | 5677 |
| 556 | Ga0307408_100165109 | 3300031548 | Bacteria | 1762 |
| 557 | Ga0307508_10001419 | 3300031616 | Bacteria | 26970 |
| 558 | Ga0307508_10001653 | 3300031616 | Bacteria | 24829 |
| 559 | Ga0307508_10002660 | 3300031616 | Bacteria | 18747 |
| 560 | Ga0307508_10004136 | 3300031616 | Bacteria | 14290 |
| 561 | Ga0307508_10030043 | 3300031616 | Bacteria | 4911 |
| 562 | Ga0307508_10041918 | 3300031616 | Bacteria | 4108 |
| 563 | Ga0307508_10089809 | 3300031616 | Bacteria | 2658 |
| 564 | Ga0307514_10043511 | 3300031649 | Bacteria | 3525 |
| 565 | Ga0307514_10070607 | 3300031649 | Bacteria | 2622 |
| 566 | Ga0265314_10037140 | 3300031711 | Bacteria | 3532 |
| 567 | Ga0307516_10004179 | 3300031730 | Bacteria | 17982 |
| 568 | Ga0307516_10005739 | 3300031730 | Bacteria | 14707 |
| 569 | Ga0307516_10026058 | 3300031730 | Bacteria | 5944 |
| 570 | Ga0307516_10030738 | 3300031730 | Bacteria | 5417 |
| 571 | Ga0307516_10105779 | 3300031730 | Bacteria | 2625 |
| 572 | Ga0307405_10087645 | 3300031731 | Bacteria | 2052 |
| 573 | Ga0307405_10349870 | 3300031731 | Bacteria | 1139 |
| 574 | Ga0307413_10118980 | 3300031824 | Bacteria | 1785 |
| 575 | Ga0307518_10001376 | 3300031838 | Bacteria | 18082 |
| 576 | Ga0307518_10023205 | 3300031838 | Bacteria | 4468 |
| 577 | Ga0307406_10003739 | 3300031901 | Bacteria | 8275 |
| 578 | Ga0307412_10000304 | 3300031911 | Bacteria | 31110 |
| 579 | Ga0307412_10040867 | 3300031911 | Bacteria | 3002 |
| 580 | Ga0307412_10063625 | 3300031911 | Bacteria | 2489 |
| 581 | Ga0307412_10109468 | 3300031911 | Bacteria | 1969 |
| 582 | Ga0307412_10226929 | 3300031911 | Bacteria | 1435 |
| 583 | Ga0307412_10232468 | 3300031911 | Bacteria | 1420 |
| 584 | Ga0307409_100015488 | 3300031995 | Bacteria | 5007 |
| 585 | Ga0307409_100359717 | 3300031995 | Bacteria | 1376 |
| 586 | Ga0307409_100404966 | 3300031995 | Bacteria | 1304 |
| 587 | Ga0307409_100415053 | 3300031995 | Bacteria | 1290 |
| 588 | Ga0307416_100544319 | 3300032002 | Bacteria | 1233 |
| 589 | Ga0307414_10002087 | 3300032004 | Bacteria | 10400 |
| 590 | Ga0307414_10015307 | 3300032004 | Bacteria | 4630 |
| 591 | Ga0307414_10015942 | 3300032004 | Bacteria | 4553 |
| 592 | Ga0307414_10172545 | 3300032004 | Bacteria | 1730 |
| 593 | Ga0307411_10064143 | 3300032005 | Bacteria | 2458 |
| 594 | Ga0307411_10102079 | 3300032005 | Bacteria | 2031 |
| 595 | Ga0307507_10000003 | 3300033179 | Bacteria | 371707 |
| 596 | Ga0307507_10000031 | 3300033179 | Bacteria | 195619 |
| 597 | Ga0307507_10011820 | 3300033179 | Bacteria | 10931 |
| 598 | Ga0307510_10003088 | 3300033180 | Bacteria | 19248 |
| 599 | Ga0307510_10009123 | 3300033180 | Bacteria | 11807 |
| 600 | Ga0307510_10027972 | 3300033180 | Bacteria | 6448 |
| 601 | Ga0316214_1001712 | 3300033545 | Bacteria | 2612 |
| 602 | Ga0373952_0017907 | 3300035092 | Bacteria | 1460 |
| 603 | Ga0373946_0024183 | 3300035171 | Bacteria | 2378 |
| 604 | Ga0373931_0003665 | 3300035691 | Bacteria | 6946 |
| 605 | Ga0373927_0000410 | 3300035695 | Bacteria | 33006 |
| 606 | Ga0373947_0009173 | 3300035725 | Bacteria | 5687 |
| 607 | Ga0373925_0000730 | 3300037068 | Bacteria | 30523 |
| 608 | Ga0395899_0013724 | 3300037312 | Bacteria | 6195 |
| 609 | Ga0395899_0023133 | 3300037312 | Bacteria | 4710 |
| 610 | Ga0395899_0026758 | 3300037312 | Bacteria | 4352 |
| 611 | Ga0395899_0102359 | 3300037312 | Bacteria | 2067 |
| 612 | Ga0395900_0000474 | 3300037418 | Bacteria | 57230 |
| 613 | Ga0395900_0001603 | 3300037418 | Bacteria | 26692 |
| 614 | Ga0395900_0004209 | 3300037418 | Bacteria | 15268 |
| 615 | Ga0395900_0074799 | 3300037418 | Bacteria | 3482 |
| 616 | Ga0395900_0102275 | 3300037418 | Bacteria | 2944 |
| 617 | Ga0395900_0153446 | 3300037418 | Bacteria | 2353 |
| 618 | Ga0395900_0440889 | 3300037418 | Bacteria | 1260 |
| 619 | Ga0395898_0000751 | 3300037466 | Bacteria | 56660 |
| 620 | Ga0395898_0004678 | 3300037466 | Bacteria | 14915 |
| 621 | Ga0395898_0012071 | 3300037466 | Bacteria | 8943 |
| 622 | Ga0395898_0012419 | 3300037466 | Bacteria | 8805 |
| 623 | Ga0395898_0019940 | 3300037466 | Bacteria | 6817 |
| 624 | Ga0395898_0035174 | 3300037466 | Bacteria | 4985 |
| 625 | Ga0395898_0164832 | 3300037466 | Bacteria | 2120 |
| 626 | Ga0395898_0445558 | 3300037466 | Bacteria | 1233 |
| 627 | Ga0395905_0005858 | 3300037471 | Bacteria | 12491 |
| 628 | Ga0395905_0018917 | 3300037471 | Bacteria | 6532 |
| 629 | Ga0395905_0050569 | 3300037471 | Bacteria | 3893 |
| 630 | Ga0395905_0062684 | 3300037471 | Bacteria | 3477 |
| 631 | Ga0395905_0066056 | 3300037471 | Bacteria | 3387 |
| 632 | Ga0395905_0085393 | 3300037471 | Bacteria | 2957 |
| 633 | Ga0395905_0212001 | 3300037471 | Bacteria | 1814 |
| 634 | Ga0395901_0000077 | 3300038443 | Bacteria | 135073 |
| 635 | Ga0395901_0000246 | 3300038443 | Bacteria | 67512 |
| 636 | Ga0395901_0000908 | 3300038443 | Bacteria | 32498 |
| 637 | Ga0395901_0026128 | 3300038443 | Bacteria | 5994 |
| 638 | Ga0395901_0030832 | 3300038443 | Bacteria | 5526 |
| 639 | Ga0395901_0043177 | 3300038443 | Bacteria | 4677 |
| 640 | Ga0395901_0123752 | 3300038443 | Bacteria | 2717 |
| 641 | Ga0395901_0130622 | 3300038443 | Bacteria | 2639 |
| 642 | Ga0395901_0288605 | 3300038443 | Bacteria | 1703 |
| 643 | Ga0237819_01112 | 3300038705 | Bacteria | 7847 |
| 644 | Ga0400483_108750 | 3300039062 | Bacteria | 3354 |
| 645 | Ga0400483_135484 | 3300039062 | Bacteria | 7954 |
| 646 | Ga0400483_180197 | 3300039062 | Bacteria | 7396 |
| 647 | Ga0400483_243671 | 3300039062 | Bacteria | 5670 |
| 648 | Ga0436361_0108407 | 3300039447 | Bacteria | 32994 |
| 649 | Ga0436361_0659434 | 3300039447 | Bacteria | 4276 |
| 650 | Ga0436361_1220162 | 3300039447 | Bacteria | 2895 |
| 651 | Ga0436363_1150514 | 3300039450 | Bacteria | 5432 |
| 652 | Ga0439436_0013263 | 3300041404 | Bacteria | 2494 |
| 653 | Ga0439436_0028606 | 3300041404 | Bacteria | 1626 |
| 654 | Ga0439466_0003736 | 3300041411 | Bacteria | 5880 |
| 655 | Ga0439465_0030638 | 3300041413 | Bacteria | 1712 |
| 656 | Ga0451795_0226724 | 3300041456 | Bacteria | 2470 |
| 657 | Ga0451839_0426667 | 3300041496 | Bacteria | 1693 |
| 658 | Ga0439445_0024077 | 3300042004 | Bacteria | 1545 |
| 659 | Ga0439448_0010380 | 3300042005 | Bacteria | 2762 |
| 660 | Ga0439448_0019533 | 3300042005 | Bacteria | 2087 |
| 661 | Ga0439448_0025958 | 3300042005 | Bacteria | 1840 |
| 662 | Ga0439432_004797 | 3300042006 | Bacteria | 4915 |
| 663 | Ga0439449_0018184 | 3300042007 | Bacteria | 2637 |
| 664 | Ga0439449_0040347 | 3300042007 | Bacteria | 1735 |
| 665 | Ga0439450_009204 | 3300042008 | Bacteria | 1868 |
| 666 | Ga0439451_000125 | 3300042009 | Bacteria | 14064 |
| 667 | Ga0439451_000134 | 3300042009 | Bacteria | 13696 |
| 668 | Ga0439452_000130 | 3300042010 | Bacteria | 57394 |
| 669 | Ga0439452_009390 | 3300042010 | Bacteria | 2883 |
| 670 | Ga0439457_000234 | 3300042014 | Bacteria | 14914 |
| 671 | Ga0439457_003788 | 3300042014 | Bacteria | 4060 |
| 672 | Ga0439463_013229 | 3300042016 | Bacteria | 2031 |
| 673 | Ga0450911_003786 | 3300042115 | Bacteria | 2596 |
| 674 | Ga0450920_008457 | 3300042122 | Bacteria | 1881 |
| 675 | Ga0450923_003270 | 3300042125 | Bacteria | 2427 |
| 676 | Ga0450894_000475 | 3300042131 | Bacteria | 6845 |
| 677 | Ga0450898_002595 | 3300042134 | Bacteria | 2532 |
| 678 | Ga0450902_009804 | 3300042137 | Bacteria | 1511 |
| 679 | Ga0450906_000347 | 3300042145 | Bacteria | 9410 |
| 680 | Ga0450907_002519 | 3300042146 | Bacteria | 3476 |
| 681 | Ga0439458_0003190 | 3300042157 | Bacteria | 3886 |
| 682 | Ga0450908_000522 | 3300042184 | Bacteria | 7425 |
| 683 | Ga0439434_0003886 | 3300042435 | Bacteria | 4365 |
| 684 | Ga0439464_0005925 | 3300042439 | Bacteria | 3176 |
| 685 | Ga0439460_0008127 | 3300042461 | Bacteria | 2646 |
| 686 | Ga0451577_0089587 | 3300042876 | Bacteria | 2745 |
| 687 | Ga0466969_0009500 | 3300044656 | Bacteria | 5157 |
| 688 | Ga0466969_0018605 | 3300044656 | Bacteria | 3618 |
| 689 | Ga0466969_0039455 | 3300044656 | Bacteria | 2371 |
| 690 | Ga0466972_0000462 | 3300044658 | Bacteria | 20710 |
| 691 | Ga0466972_0007761 | 3300044658 | Bacteria | 5386 |
| 692 | Ga0466972_0015619 | 3300044658 | Bacteria | 3797 |
| 693 | Ga0466972_0111947 | 3300044658 | Bacteria | 1290 |
| 694 | Ga0466965_0004793 | 3300044683 | Bacteria | 6033 |
| 695 | Ga0466965_0010740 | 3300044683 | Bacteria | 4281 |
| 696 | Ga0466965_0017187 | 3300044683 | Bacteria | 3454 |
| 697 | Ga0466965_0038068 | 3300044683 | Bacteria | 2362 |
| 698 | Ga0466966_0000927 | 3300044684 | Bacteria | 18684 |
| 699 | Ga0466966_0001156 | 3300044684 | Bacteria | 16964 |
| 700 | Ga0466966_0001664 | 3300044684 | Bacteria | 14332 |
| 701 | Ga0466966_0009048 | 3300044684 | Bacteria | 6598 |
| 702 | Ga0466966_0075818 | 3300044684 | Bacteria | 2100 |
| 703 | Ga0466966_0109047 | 3300044684 | Bacteria | 1708 |
| 704 | Ga0466961_0005318 | 3300044693 | Bacteria | 8101 |
| 705 | Ga0466961_0012135 | 3300044693 | Bacteria | 5508 |
| 706 | Ga0466961_0034753 | 3300044693 | Bacteria | 3236 |
| 707 | Ga0466963_0001264 | 3300044694 | Bacteria | 13403 |
| 708 | Ga0466963_0002989 | 3300044694 | Bacteria | 9560 |
| 709 | Ga0466964_0006530 | 3300044706 | Bacteria | 4350 |
| 710 | Ga0453684_0259954 | 3300044712 | Bacteria | 1989 |
| 711 | Ga0453684_0297449 | 3300044712 | Bacteria | 1835 |
| 712 | Ga0466971_0001070 | 3300044719 | Bacteria | 11373 |
| 713 | Ga0466971_0024430 | 3300044719 | Bacteria | 2696 |
| 714 | Ga0466971_0098252 | 3300044719 | Bacteria | 1344 |
| 715 | Ga0466968_0013336 | 3300044735 | Bacteria | 3231 |
| 716 | Ga0466970_0004934 | 3300044765 | Bacteria | 6591 |
| 717 | Ga0466970_0026319 | 3300044765 | Bacteria | 3049 |
| 718 | Ga0466957_0000029 | 3300044842 | Bacteria | 52517 |
| 719 | Ga0466957_0001270 | 3300044842 | Bacteria | 13146 |
| 720 | Ga0466957_0123522 | 3300044842 | Bacteria | 1652 |
| 721 | Ga0466957_0143405 | 3300044842 | Bacteria | 1540 |
| 722 | Ga0466960_0024039 | 3300044901 | Bacteria | 2744 |
| 723 | Ga0466959_0006518 | 3300045049 | Bacteria | 8094 |
| 724 | Ga0466959_0007787 | 3300045049 | Bacteria | 7536 |
| 725 | Ga0466959_0019614 | 3300045049 | Bacteria | 4973 |
| 726 | Ga0466959_0077580 | 3300045049 | Bacteria | 2397 |
| 727 | Ga0451576_0008986 | 3300045051 | Bacteria | 11641 |
| 728 | Ga0451576_0027926 | 3300045051 | Bacteria | 6053 |
| 729 | Ga0466958_0000352 | 3300045836 | Bacteria | 18502 |
| 730 | Ga0466958_0004427 | 3300045836 | Bacteria | 7418 |
| 731 | Ga0466958_0020230 | 3300045836 | Bacteria | 3881 |
| 732 | Ga0466958_0114456 | 3300045836 | Bacteria | 1685 |
| 733 | Ga0466967_0022489 | 3300045976 | Bacteria | 5146 |
| 734 | Ga0466967_0040101 | 3300045976 | Bacteria | 4030 |
| 735 | Ga0466967_0378902 | 3300045976 | Bacteria | 1373 |
| 736 | Ga0495617_000642 | 3300046452 | Bacteria | 17510 |
| 737 | Ga0495617_006827 | 3300046452 | Bacteria | 3988 |
| 738 | Ga0495617_010652 | 3300046452 | Bacteria | 3150 |
| 739 | Ga0495617_014761 | 3300046452 | Bacteria | 2653 |
| 740 | Ga0495617_028167 | 3300046452 | Bacteria | 1888 |
| 741 | Ga0495617_052606 | 3300046452 | Bacteria | 1353 |
| 742 | Ga0495627_000254 | 3300046453 | Bacteria | 54795 |
| 743 | Ga0495627_001072 | 3300046453 | Bacteria | 18018 |
| 744 | Ga0495627_026424 | 3300046453 | Bacteria | 1872 |
| 745 | Ga0495592_0012672 | 3300046454 | Bacteria | 6407 |
| 746 | Ga0495592_0015756 | 3300046454 | Bacteria | 5735 |
| 747 | Ga0495603_0002962 | 3300046455 | Bacteria | 10043 |
| 748 | Ga0495603_0007336 | 3300046455 | Bacteria | 6629 |
| 749 | Ga0495603_0015983 | 3300046455 | Bacteria | 4537 |
| 750 | Ga0495603_0019131 | 3300046455 | Bacteria | 4145 |
| 751 | Ga0495590_0000965 | 3300046457 | Bacteria | 12679 |
| 752 | Ga0495590_0007568 | 3300046457 | Bacteria | 4179 |
| 753 | Ga0495590_0015204 | 3300046457 | Bacteria | 2797 |
| 754 | Ga0495590_0044467 | 3300046457 | Bacteria | 1548 |
| 755 | Ga0495591_000005 | 3300046458 | Bacteria | 394092 |
| 756 | Ga0495591_000088 | 3300046458 | Bacteria | 102486 |
| 757 | Ga0495591_003293 | 3300046458 | Bacteria | 8451 |
| 758 | Ga0495591_009522 | 3300046458 | Bacteria | 3849 |
| 759 | Ga0495629_0008564 | 3300046459 | Bacteria | 7532 |
| 760 | Ga0495629_0010005 | 3300046459 | Bacteria | 6921 |
| 761 | Ga0495629_0019619 | 3300046459 | Bacteria | 4829 |
| 762 | Ga0495629_0072821 | 3300046459 | Bacteria | 2399 |
| 763 | Ga0495629_0124042 | 3300046459 | Bacteria | 1799 |
| 764 | Ga0495638_0001071 | 3300046460 | Bacteria | 26689 |
| 765 | Ga0495638_0003500 | 3300046460 | Bacteria | 12329 |
| 766 | Ga0495638_0004007 | 3300046460 | Bacteria | 11309 |
| 767 | Ga0495638_0011558 | 3300046460 | Bacteria | 6082 |
| 768 | Ga0495638_0017740 | 3300046460 | Bacteria | 4739 |
| 769 | Ga0495638_0040011 | 3300046460 | Bacteria | 2972 |
| 770 | Ga0495638_0042721 | 3300046460 | Bacteria | 2863 |
| 771 | Ga0495638_0064128 | 3300046460 | Bacteria | 2263 |
| 772 | Ga0495638_0110876 | 3300046460 | Bacteria | 1630 |
| 773 | Ga0495653_0001089 | 3300046463 | Bacteria | 20969 |
| 774 | Ga0495653_0004894 | 3300046463 | Bacteria | 10865 |
| 775 | Ga0495653_0036548 | 3300046463 | Bacteria | 3867 |
| 776 | Ga0495653_0045911 | 3300046463 | Bacteria | 3384 |
| 777 | Ga0495650_0001499 | 3300046471 | Bacteria | 22259 |
| 778 | Ga0495650_0001536 | 3300046471 | Bacteria | 21887 |
| 779 | Ga0495650_0001808 | 3300046471 | Bacteria | 19256 |
| 780 | Ga0495650_0002221 | 3300046471 | Bacteria | 16296 |
| 781 | Ga0495650_0002985 | 3300046471 | Bacteria | 12811 |
| 782 | Ga0495650_0005447 | 3300046471 | Bacteria | 8262 |
| 783 | Ga0495650_0019653 | 3300046471 | Bacteria | 3315 |
| 784 | Ga0495580_0010092 | 3300046472 | Bacteria | 7379 |
| 785 | Ga0495580_0015860 | 3300046472 | Bacteria | 5670 |
| 786 | Ga0495605_0000195 | 3300046474 | Bacteria | 75899 |
| 787 | Ga0495605_0000199 | 3300046474 | Bacteria | 74613 |
| 788 | Ga0495605_0000257 | 3300046474 | Bacteria | 62503 |
| 789 | Ga0495605_0001546 | 3300046474 | Bacteria | 14942 |
| 790 | Ga0495605_0007942 | 3300046474 | Bacteria | 6008 |
| 791 | Ga0495605_0019276 | 3300046474 | Bacteria | 3648 |
| 792 | Ga0495639_0003285 | 3300046475 | Bacteria | 7015 |
| 793 | Ga0495662_0008243 | 3300046476 | Bacteria | 5133 |
| 794 | Ga0495664_0003557 | 3300046477 | Bacteria | 8499 |
| 795 | Ga0495664_0032744 | 3300046477 | Bacteria | 3052 |
| 796 | Ga0495664_0097429 | 3300046477 | Bacteria | 1770 |
| 797 | Ga0495584_0001017 | 3300046491 | Bacteria | 17518 |
| 798 | Ga0495584_0002370 | 3300046491 | Bacteria | 10719 |
| 799 | Ga0495584_0024427 | 3300046491 | Bacteria | 3065 |
| 800 | Ga0495584_0030071 | 3300046491 | Bacteria | 2752 |
| 801 | Ga0495584_0118609 | 3300046491 | Bacteria | 1340 |
| 802 | Ga0495585_0000142 | 3300046492 | Bacteria | 79060 |
| 803 | Ga0495585_0000577 | 3300046492 | Bacteria | 34550 |
| 804 | Ga0495585_0000795 | 3300046492 | Bacteria | 27671 |
| 805 | Ga0495585_0002260 | 3300046492 | Bacteria | 13931 |
| 806 | Ga0495585_0012745 | 3300046492 | Bacteria | 4947 |
| 807 | Ga0495585_0035019 | 3300046492 | Bacteria | 2839 |
| 808 | Ga0495585_0080431 | 3300046492 | Bacteria | 1766 |
| 809 | Ga0495585_0092144 | 3300046492 | Bacteria | 1631 |
| 810 | Ga0495594_0091268 | 3300046499 | Bacteria | 1707 |
| 811 | Ga0495596_0000061 | 3300046500 | Bacteria | 79205 |
| 812 | Ga0495596_0001643 | 3300046500 | Bacteria | 12706 |
| 813 | Ga0495607_0000138 | 3300046501 | Bacteria | 77180 |
| 814 | Ga0495607_0000394 | 3300046501 | Bacteria | 44392 |
| 815 | Ga0495607_0001084 | 3300046501 | Bacteria | 24861 |
| 816 | Ga0495607_0001219 | 3300046501 | Bacteria | 23108 |
| 817 | Ga0495607_0001489 | 3300046501 | Bacteria | 20785 |
| 818 | Ga0495607_0003744 | 3300046501 | Bacteria | 11500 |
| 819 | Ga0495607_0006485 | 3300046501 | Bacteria | 8228 |
| 820 | Ga0495607_0013896 | 3300046501 | Bacteria | 5260 |
| 821 | Ga0495607_0025057 | 3300046501 | Bacteria | 3714 |
| 822 | Ga0495607_0033723 | 3300046501 | Bacteria | 3113 |
| 823 | Ga0495607_0035928 | 3300046501 | Bacteria | 2992 |
| 824 | Ga0495583_0002568 | 3300046506 | Bacteria | 15282 |
| 825 | Ga0495583_0071013 | 3300046506 | Bacteria | 1530 |
| 826 | Ga0495583_0084457 | 3300046506 | Bacteria | 1375 |
| 827 | Ga0495606_0000081 | 3300046507 | Bacteria | 160491 |
| 828 | Ga0495606_0000525 | 3300046507 | Bacteria | 61969 |
| 829 | Ga0495606_0005029 | 3300046507 | Bacteria | 12873 |
| 830 | Ga0495606_0005176 | 3300046507 | Bacteria | 12615 |
| 831 | Ga0495606_0005506 | 3300046507 | Bacteria | 12103 |
| 832 | Ga0495606_0009409 | 3300046507 | Bacteria | 8272 |
| 833 | Ga0495606_0025173 | 3300046507 | Bacteria | 4269 |
| 834 | Ga0495606_0028965 | 3300046507 | Bacteria | 3896 |
| 835 | Ga0495606_0034505 | 3300046507 | Bacteria | 3473 |
| 836 | Ga0495608_0073290 | 3300046511 | Bacteria | 2233 |
| 837 | Ga0495610_0000198 | 3300046512 | Bacteria | 67337 |
| 838 | Ga0495610_0000963 | 3300046512 | Bacteria | 26633 |
| 839 | Ga0495610_0008811 | 3300046512 | Bacteria | 6470 |
| 840 | Ga0495610_0057593 | 3300046512 | Bacteria | 1863 |
| 841 | Ga0495610_0068188 | 3300046512 | Bacteria | 1668 |
| 842 | Ga0495616_0002680 | 3300046513 | Bacteria | 11668 |
| 843 | Ga0495616_0006038 | 3300046513 | Bacteria | 7380 |
| 844 | Ga0495616_0008012 | 3300046513 | Bacteria | 6292 |
| 845 | Ga0495616_0014248 | 3300046513 | Bacteria | 4459 |
| 846 | Ga0495616_0024064 | 3300046513 | Bacteria | 3270 |
| 847 | Ga0495616_0033012 | 3300046513 | Bacteria | 2700 |
| 848 | Ga0495616_0037408 | 3300046513 | Bacteria | 2497 |
| 849 | Ga0495620_0000035 | 3300046515 | Bacteria | 115562 |
| 850 | Ga0495620_0031909 | 3300046515 | Bacteria | 2406 |
| 851 | Ga0495628_0046359 | 3300046516 | Bacteria | 3452 |
| 852 | Ga0495628_0064348 | 3300046516 | Bacteria | 2871 |
| 853 | Ga0495630_0002568 | 3300046517 | Bacteria | 12585 |
| 854 | Ga0495630_0006537 | 3300046517 | Bacteria | 8302 |
| 855 | Ga0495630_0063736 | 3300046517 | Bacteria | 2769 |
| 856 | Ga0495631_0000063 | 3300046518 | Bacteria | 66560 |
| 857 | Ga0495631_0000122 | 3300046518 | Bacteria | 52205 |
| 858 | Ga0495631_0001230 | 3300046518 | Bacteria | 15793 |
| 859 | Ga0495631_0017620 | 3300046518 | Bacteria | 3375 |
| 860 | Ga0495632_0000058 | 3300046519 | Bacteria | 122648 |
| 861 | Ga0495632_0000395 | 3300046519 | Bacteria | 41002 |
| 862 | Ga0495632_0000518 | 3300046519 | Bacteria | 36310 |
| 863 | Ga0495632_0000908 | 3300046519 | Bacteria | 25958 |
| 864 | Ga0495632_0000983 | 3300046519 | Bacteria | 24906 |
| 865 | Ga0495632_0003288 | 3300046519 | Bacteria | 11546 |
| 866 | Ga0495632_0005029 | 3300046519 | Bacteria | 8853 |
| 867 | Ga0495632_0008756 | 3300046519 | Bacteria | 6168 |
| 868 | Ga0495632_0014772 | 3300046519 | Bacteria | 4405 |
| 869 | Ga0495632_0019335 | 3300046519 | Bacteria | 3713 |
| 870 | Ga0495632_0027861 | 3300046519 | Bacteria | 2953 |
| 871 | Ga0495637_0000113 | 3300046520 | Bacteria | 58600 |
| 872 | Ga0495637_0000315 | 3300046520 | Bacteria | 37537 |
| 873 | Ga0495637_0000473 | 3300046520 | Bacteria | 29387 |
| 874 | Ga0495637_0001685 | 3300046520 | Bacteria | 12767 |
| 875 | Ga0495637_0007094 | 3300046520 | Bacteria | 5580 |
| 876 | Ga0495637_0023097 | 3300046520 | Bacteria | 2830 |
| 877 | Ga0495637_0023593 | 3300046520 | Bacteria | 2793 |
| 878 | Ga0495637_0046766 | 3300046520 | Bacteria | 1829 |
| 879 | Ga0495643_0000044 | 3300046522 | Bacteria | 226211 |
| 880 | Ga0495643_0000880 | 3300046522 | Bacteria | 31960 |
| 881 | Ga0495643_0002862 | 3300046522 | Bacteria | 13117 |
| 882 | Ga0495643_0003493 | 3300046522 | Bacteria | 11453 |
| 883 | Ga0495643_0006532 | 3300046522 | Bacteria | 7670 |
| 884 | Ga0495643_0018596 | 3300046522 | Bacteria | 4035 |
| 885 | Ga0495643_0021770 | 3300046522 | Bacteria | 3669 |
| 886 | Ga0495643_0070273 | 3300046522 | Bacteria | 1839 |
| 887 | Ga0495644_0001098 | 3300046523 | Bacteria | 11173 |
| 888 | Ga0495644_0021452 | 3300046523 | Bacteria | 2464 |
| 889 | Ga0495648_0000241 | 3300046524 | Bacteria | 61991 |
| 890 | Ga0495648_0002312 | 3300046524 | Bacteria | 17749 |
| 891 | Ga0495648_0016866 | 3300046524 | Bacteria | 5248 |
| 892 | Ga0495648_0017766 | 3300046524 | Bacteria | 5071 |
| 893 | Ga0495648_0026949 | 3300046524 | Bacteria | 3857 |
| 894 | Ga0495648_0031424 | 3300046524 | Bacteria | 3495 |
| 895 | Ga0495663_0000394 | 3300046525 | Bacteria | 16143 |
| 896 | Ga0495666_0000069 | 3300046526 | Bacteria | 40652 |
| 897 | Ga0495666_0000092 | 3300046526 | Bacteria | 36757 |
| 898 | Ga0495666_0002984 | 3300046526 | Bacteria | 8492 |
| 899 | Ga0495666_0004604 | 3300046526 | Bacteria | 6974 |
| 900 | Ga0495666_0005780 | 3300046526 | Bacteria | 6230 |
| 901 | Ga0495666_0009363 | 3300046526 | Bacteria | 4901 |
| 902 | Ga0495666_0038050 | 3300046526 | Bacteria | 2340 |
| 903 | Ga0495666_0062478 | 3300046526 | Bacteria | 1778 |
| 904 | Ga0495642_0000003 | 3300046528 | Bacteria | 185425 |
| 905 | Ga0495642_0076951 | 3300046528 | Bacteria | 1401 |
| 906 | Ga0495642_0090933 | 3300046528 | Bacteria | 1292 |
| 907 | Ga0495652_0000784 | 3300046529 | Bacteria | 36623 |
| 908 | Ga0495652_0034602 | 3300046529 | Bacteria | 4402 |
| 909 | Ga0495654_0000799 | 3300046530 | Bacteria | 24142 |
| 910 | Ga0495654_0001139 | 3300046530 | Bacteria | 19069 |
| 911 | Ga0495654_0002457 | 3300046530 | Bacteria | 11922 |
| 912 | Ga0495654_0002606 | 3300046530 | Bacteria | 11494 |
| 913 | Ga0495654_0002865 | 3300046530 | Bacteria | 10838 |
| 914 | Ga0495654_0017248 | 3300046530 | Bacteria | 3799 |
| 915 | Ga0495654_0064580 | 3300046530 | Bacteria | 1749 |
| 916 | Ga0495665_0002959 | 3300046531 | Bacteria | 9171 |
| 917 | Ga0495665_0033485 | 3300046531 | Bacteria | 2748 |
| 918 | Ga0495640_0016046 | 3300046533 | Bacteria | 5614 |
| 919 | Ga0495586_0014575 | 3300046535 | Bacteria | 4177 |
| 920 | Ga0495586_0042300 | 3300046535 | Bacteria | 2454 |
| 921 | Ga0495587_0001318 | 3300046536 | Bacteria | 16481 |
| 922 | Ga0495609_0000490 | 3300046538 | Bacteria | 31718 |
| 923 | Ga0495597_0000216 | 3300046542 | Bacteria | 52708 |
| 924 | Ga0495597_0000253 | 3300046542 | Bacteria | 48591 |
| 925 | Ga0495597_0002240 | 3300046542 | Bacteria | 12617 |
| 926 | Ga0495597_0002886 | 3300046542 | Bacteria | 10479 |
| 927 | Ga0495597_0007992 | 3300046542 | Bacteria | 5322 |
| 928 | Ga0495645_0011206 | 3300046543 | Bacteria | 6303 |
| 929 | Ga0495645_0017315 | 3300046543 | Bacteria | 5161 |
| 930 | Ga0495622_0006141 | 3300046557 | Bacteria | 5582 |
| 931 | Ga0495622_0011238 | 3300046557 | Bacteria | 4134 |
| 932 | Ga0495622_0019278 | 3300046557 | Bacteria | 3177 |
| 933 | Ga0495633_0006427 | 3300046558 | Bacteria | 6966 |
| 934 | Ga0495633_0010354 | 3300046558 | Bacteria | 5095 |
| 935 | Ga0495633_0067193 | 3300046558 | Bacteria | 1674 |
| 936 | Ga0495667_0059961 | 3300046559 | Bacteria | 2496 |
| 937 | Ga0495656_0000104 | 3300046615 | Bacteria | 35209 |
| 938 | Ga0495656_0003267 | 3300046615 | Bacteria | 5471 |
| 939 | Ga0495668_0000140 | 3300046616 | Bacteria | 109138 |
| 940 | Ga0495668_0001118 | 3300046616 | Bacteria | 27674 |
| 941 | Ga0495668_0043700 | 3300046616 | Bacteria | 2491 |
| 942 | Ga0495668_0080318 | 3300046616 | Bacteria | 1789 |
| 943 | Ga0495634_0016136 | 3300046642 | Bacteria | 5346 |
| 944 | Ga0495634_0239724 | 3300046642 | Bacteria | 1113 |
| 945 | Ga0495611_0001324 | 3300046648 | Bacteria | 12567 |
| 946 | Ga0495611_0025688 | 3300046648 | Bacteria | 2568 |
| 947 | Ga0495625_0000056 | 3300046660 | Bacteria | 186024 |
| 948 | Ga0495625_0000095 | 3300046660 | Bacteria | 143468 |
| 949 | Ga0495625_0001135 | 3300046660 | Bacteria | 34436 |
| 950 | Ga0495625_0001678 | 3300046660 | Bacteria | 25843 |
| 951 | Ga0495625_0012504 | 3300046660 | Bacteria | 6874 |
| 952 | Ga0495625_0014369 | 3300046660 | Bacteria | 6323 |
| 953 | Ga0495625_0018924 | 3300046660 | Bacteria | 5360 |
| 954 | Ga0495625_0031487 | 3300046660 | Bacteria | 3944 |
| 955 | Ga0495625_0032310 | 3300046660 | Bacteria | 3883 |
| 956 | Ga0495625_0059375 | 3300046660 | Bacteria | 2714 |
| 957 | Ga0495659_0000116 | 3300046664 | Bacteria | 35444 |
| 958 | Ga0495661_0000010 | 3300046665 | Bacteria | 284261 |
| 959 | Ga0495661_0000049 | 3300046665 | Bacteria | 144060 |
| 960 | Ga0495661_0000085 | 3300046665 | Bacteria | 114501 |
| 961 | Ga0495661_0013544 | 3300046665 | Bacteria | 5474 |
| 962 | Ga0495661_0017164 | 3300046665 | Bacteria | 4783 |
| 963 | Ga0495661_0031376 | 3300046665 | Bacteria | 3374 |
| 964 | Ga0495661_0060608 | 3300046665 | Bacteria | 2247 |
| 965 | Ga0495588_0023820 | 3300046674 | Bacteria | 3035 |
| 966 | Ga0495657_0059057 | 3300046675 | Bacteria | 2545 |
| 967 | Ga0495599_0001037 | 3300046678 | Bacteria | 15615 |
| 968 | Ga0495623_0001804 | 3300046679 | Bacteria | 14390 |
| 969 | Ga0495623_0003834 | 3300046679 | Bacteria | 9910 |
| 970 | Ga0495623_0030607 | 3300046679 | Bacteria | 3463 |
| 971 | Ga0495623_0202603 | 3300046679 | Bacteria | 1140 |
| 972 | Ga0495646_0000390 | 3300046680 | Bacteria | 22972 |
| 973 | Ga0495669_0000263 | 3300046684 | Bacteria | 30264 |
| 974 | Ga0495669_0002053 | 3300046684 | Bacteria | 8256 |
| 975 | Ga0495613_0005666 | 3300046689 | Bacteria | 9357 |
| 976 | Ga0495613_0109142 | 3300046689 | Bacteria | 1995 |
| 977 | Ga0495613_0111465 | 3300046689 | Bacteria | 1971 |
| 978 | Ga0495613_0128580 | 3300046689 | Bacteria | 1815 |
| 979 | Ga0495613_0283440 | 3300046689 | Bacteria | 1150 |
| 980 | Ga0495624_0011630 | 3300046690 | Bacteria | 6045 |
| 981 | Ga0495624_0063046 | 3300046690 | Bacteria | 2318 |
| 982 | Ga0495670_0008981 | 3300046691 | Bacteria | 4916 |
| 983 | Ga0495670_0024495 | 3300046691 | Bacteria | 2983 |
| 984 | Ga0495671_0001083 | 3300046692 | Bacteria | 18831 |
| 985 | Ga0495671_0001728 | 3300046692 | Bacteria | 14176 |
| 986 | Ga0495671_0001868 | 3300046692 | Bacteria | 13535 |
| 987 | Ga0495671_0002038 | 3300046692 | Bacteria | 12929 |
| 988 | Ga0495671_0005199 | 3300046692 | Bacteria | 7654 |
| 989 | Ga0495671_0034418 | 3300046692 | Bacteria | 2575 |
| 990 | Ga0495671_0103777 | 3300046692 | Bacteria | 1388 |
| 991 | Ga0495649_0000039 | 3300046694 | Bacteria | 126399 |
| 992 | Ga0495649_0000083 | 3300046694 | Bacteria | 81883 |
| 993 | Ga0495649_0005034 | 3300046694 | Bacteria | 8498 |
| 994 | Ga0495649_0013467 | 3300046694 | Bacteria | 4716 |
| 995 | Ga0495649_0019649 | 3300046694 | Bacteria | 3795 |
| 996 | Ga0495649_0022739 | 3300046694 | Bacteria | 3506 |
| 997 | Ga0495649_0029073 | 3300046694 | Bacteria | 3061 |
| 998 | Ga0495649_0066989 | 3300046694 | Bacteria | 1926 |
| 999 | Ga0495589_0000549 | 3300046794 | Bacteria | 25906 |
| 1000 | Ga0495589_0005805 | 3300046794 | Bacteria | 6509 |
| 1001 | Ga0495589_0006501 | 3300046794 | Bacteria | 6165 |
| 1002 | Ga0495589_0025127 | 3300046794 | Bacteria | 3024 |
| 1003 | Ga0495589_0034424 | 3300046794 | Bacteria | 2543 |
| 1004 | Ga0495600_0001254 | 3300046809 | Bacteria | 13970 |
| 1005 | Ga0495600_0006329 | 3300046809 | Bacteria | 7197 |
| 1006 | Ga0495660_0000287 | 3300046810 | Bacteria | 46709 |
| 1007 | Ga0495660_0000388 | 3300046810 | Bacteria | 38112 |
| 1008 | Ga0495660_0000392 | 3300046810 | Bacteria | 37864 |
| 1009 | Ga0495660_0000454 | 3300046810 | Bacteria | 34113 |
| 1010 | Ga0495660_0000517 | 3300046810 | Bacteria | 31676 |
| 1011 | Ga0495660_0002257 | 3300046810 | Bacteria | 12400 |
| 1012 | Ga0495660_0020177 | 3300046810 | Bacteria | 3820 |
| 1013 | Ga0495660_0021034 | 3300046810 | Bacteria | 3739 |
| 1014 | Ga0495660_0026115 | 3300046810 | Bacteria | 3313 |
| 1015 | Ga0495660_0027303 | 3300046810 | Bacteria | 3231 |
| 1016 | Ga0495660_0045561 | 3300046810 | Bacteria | 2407 |
| 1017 | Ga0495660_0051545 | 3300046810 | Bacteria | 2239 |
| 1018 | Ga0495581_0016932 | 3300047315 | Bacteria | 4236 |
| 1019 | Ga0495581_0069012 | 3300047315 | Bacteria | 2044 |
| 1020 | Ga0495581_0103882 | 3300047315 | Bacteria | 1651 |
| 1021 | Ga0495581_0104411 | 3300047315 | Bacteria | 1647 |
| 1022 | Ga0495604_0001552 | 3300047317 | Bacteria | 18929 |
| 1023 | Ga0495604_0003658 | 3300047317 | Bacteria | 12253 |
| 1024 | Ga0495604_0034809 | 3300047317 | Bacteria | 3982 |
| 1025 | Ga0495604_0075169 | 3300047317 | Bacteria | 2544 |
| 1026 | Ga0495604_0108577 | 3300047317 | Bacteria | 2027 |
| 1027 | Ga0495636_0002723 | 3300047318 | Bacteria | 6815 |
| 1028 | Ga0495636_0005002 | 3300047318 | Bacteria | 5200 |
| 1029 | Ga0495636_0066331 | 3300047318 | Bacteria | 1534 |
| 1030 | Ga0495636_0083151 | 3300047318 | Bacteria | 1381 |
| 1031 | Ga0495674_0006435 | 3300047319 | Bacteria | 11264 |
| 1032 | Ga0495674_0007194 | 3300047319 | Bacteria | 10645 |
| 1033 | Ga0495674_0023541 | 3300047319 | Bacteria | 5674 |
| 1034 | Ga0495674_0070938 | 3300047319 | Bacteria | 3009 |
| 1035 | Ga0495672_0000006 | 3300047320 | Bacteria | 589807 |
| 1036 | Ga0495672_0000190 | 3300047320 | Bacteria | 88698 |
| 1037 | Ga0495672_0000213 | 3300047320 | Bacteria | 82925 |
| 1038 | Ga0495672_0000442 | 3300047320 | Bacteria | 49513 |
| 1039 | Ga0495672_0001989 | 3300047320 | Bacteria | 19308 |
| 1040 | Ga0495672_0002680 | 3300047320 | Bacteria | 16016 |
| 1041 | Ga0495672_0003117 | 3300047320 | Bacteria | 14464 |
| 1042 | Ga0495672_0007520 | 3300047320 | Bacteria | 8182 |
| 1043 | Ga0495672_0080258 | 3300047320 | Bacteria | 1820 |
| 1044 | Ga0495676_0000393 | 3300047321 | Bacteria | 35418 |
| 1045 | Ga0495676_0007316 | 3300047321 | Bacteria | 10128 |
| 1046 | Ga0495676_0010140 | 3300047321 | Bacteria | 8555 |
| 1047 | Ga0495676_0030011 | 3300047321 | Bacteria | 4621 |
| 1048 | Ga0495676_0036507 | 3300047321 | Bacteria | 4102 |
| 1049 | Ga0495676_0067182 | 3300047321 | Bacteria | 2775 |
| 1050 | Ga0495680_0000543 | 3300047322 | Bacteria | 42425 |
| 1051 | Ga0495680_0000608 | 3300047322 | Bacteria | 40455 |
| 1052 | Ga0495680_0000992 | 3300047322 | Bacteria | 31598 |
| 1053 | Ga0495680_0001350 | 3300047322 | Bacteria | 26630 |
| 1054 | Ga0495680_0002710 | 3300047322 | Bacteria | 17882 |
| 1055 | Ga0495680_0004753 | 3300047322 | Bacteria | 12899 |
| 1056 | Ga0495680_0046210 | 3300047322 | Bacteria | 3434 |
| 1057 | Ga0495683_0000245 | 3300047323 | Bacteria | 48819 |
| 1058 | Ga0495683_0000253 | 3300047323 | Bacteria | 48373 |
| 1059 | Ga0495683_0000416 | 3300047323 | Bacteria | 34093 |
| 1060 | Ga0495683_0003035 | 3300047323 | Bacteria | 9872 |
| 1061 | Ga0495683_0003458 | 3300047323 | Bacteria | 9215 |
| 1062 | Ga0495683_0014751 | 3300047323 | Bacteria | 4070 |
| 1063 | Ga0495683_0018717 | 3300047323 | Bacteria | 3578 |
| 1064 | Ga0495687_000308 | 3300047443 | Bacteria | 64153 |
| 1065 | Ga0495687_000389 | 3300047443 | Bacteria | 54468 |
| 1066 | Ga0495687_000495 | 3300047443 | Bacteria | 47456 |
| 1067 | Ga0495687_000724 | 3300047443 | Bacteria | 36493 |
| 1068 | Ga0495687_000845 | 3300047443 | Bacteria | 32633 |
| 1069 | Ga0495687_002228 | 3300047443 | Bacteria | 16011 |
| 1070 | Ga0495687_003776 | 3300047443 | Bacteria | 10697 |
| 1071 | Ga0495687_003894 | 3300047443 | Bacteria | 10467 |
| 1072 | Ga0495687_029428 | 3300047443 | Bacteria | 2542 |
| 1073 | Ga0495687_036191 | 3300047443 | Bacteria | 2211 |
| 1074 | Ga0495687_036601 | 3300047443 | Bacteria | 2195 |
| 1075 | Ga0495687_039781 | 3300047443 | Bacteria | 2077 |
| 1076 | Ga0495675_0000123 | 3300047444 | Bacteria | 55312 |
| 1077 | Ga0495675_0001415 | 3300047444 | Bacteria | 14536 |
| 1078 | Ga0495675_0001577 | 3300047444 | Bacteria | 13745 |
| 1079 | Ga0495675_0007815 | 3300047444 | Bacteria | 6602 |
| 1080 | Ga0495675_0024018 | 3300047444 | Bacteria | 3884 |
| 1081 | Ga0495675_0230393 | 3300047444 | Bacteria | 1118 |
| 1082 | Ga0495677_0000047 | 3300047445 | Bacteria | 72197 |
| 1083 | Ga0495679_000672 | 3300047446 | Bacteria | 22404 |
| 1084 | Ga0495679_021500 | 3300047446 | Bacteria | 2226 |
| 1085 | Ga0495685_000850 | 3300047447 | Bacteria | 9302 |
| 1086 | Ga0495685_007619 | 3300047447 | Bacteria | 3579 |
| 1087 | Ga0495685_041402 | 3300047447 | Bacteria | 1574 |
| 1088 | Ga0495673_0000025 | 3300047469 | Bacteria | 512352 |
| 1089 | Ga0495673_0000155 | 3300047469 | Bacteria | 120879 |
| 1090 | Ga0495673_0000178 | 3300047469 | Bacteria | 102182 |
| 1091 | Ga0495673_0000221 | 3300047469 | Bacteria | 84565 |
| 1092 | Ga0495673_0000922 | 3300047469 | Bacteria | 26684 |
| 1093 | Ga0495673_0001024 | 3300047469 | Bacteria | 24647 |
| 1094 | Ga0495673_0001183 | 3300047469 | Bacteria | 21964 |
| 1095 | Ga0495673_0002914 | 3300047469 | Bacteria | 11602 |
| 1096 | Ga0495673_0008706 | 3300047469 | Bacteria | 5671 |
| 1097 | Ga0495673_0016529 | 3300047469 | Bacteria | 3771 |
| 1098 | Ga0495673_0018987 | 3300047469 | Bacteria | 3452 |
| 1099 | Ga0495681_0000026 | 3300047470 | Bacteria | 144911 |
| 1100 | Ga0495681_0000198 | 3300047470 | Bacteria | 50496 |
| 1101 | Ga0495681_0002726 | 3300047470 | Bacteria | 12496 |
| 1102 | Ga0495681_0003820 | 3300047470 | Bacteria | 10425 |
| 1103 | Ga0495681_0004705 | 3300047470 | Bacteria | 9254 |
| 1104 | Ga0495681_0012414 | 3300047470 | Bacteria | 5006 |
| 1105 | Ga0495681_0014290 | 3300047470 | Bacteria | 4558 |
| 1106 | Ga0495684_0002582 | 3300047471 | Bacteria | 14390 |
| 1107 | Ga0495686_0098785 | 3300047472 | Bacteria | 1763 |
| 1108 | Ga0495593_0002886 | 3300047673 | Bacteria | 10361 |
| 1109 | Ga0495593_0004344 | 3300047673 | Bacteria | 8434 |
| 1110 | Ga0495602_0005230 | 3300048088 | Bacteria | 13597 |
| 1111 | Ga0495602_0006180 | 3300048088 | Bacteria | 12560 |
| 1112 | Ga0495614_0005431 | 3300048089 | Bacteria | 5747 |
| 1113 | Ga0495614_0005865 | 3300048089 | Bacteria | 5533 |
| 1114 | Ga0495614_0020059 | 3300048089 | Bacteria | 2891 |
| 1115 | Ga0495626_0000033 | 3300048091 | Bacteria | 184008 |
| 1116 | Ga0495626_0000132 | 3300048091 | Bacteria | 94157 |
| 1117 | Ga0495626_0000522 | 3300048091 | Bacteria | 38417 |
| 1118 | Ga0495626_0000528 | 3300048091 | Bacteria | 38040 |
| 1119 | Ga0495626_0000760 | 3300048091 | Bacteria | 29752 |
| 1120 | Ga0495626_0002344 | 3300048091 | Bacteria | 13348 |
| 1121 | Ga0495626_0005636 | 3300048091 | Bacteria | 7253 |
| 1122 | Ga0495626_0014908 | 3300048091 | Bacteria | 3991 |
| 1123 | Ga0496100_0008351 | 3300048903 | Bacteria | 5770 |
| 1124 | Ga0496100_0009196 | 3300048903 | Bacteria | 5544 |
| 1125 | Ga0496100_0063090 | 3300048903 | Bacteria | 2448 |
| 1126 | Ga0496100_0154789 | 3300048903 | Bacteria | 1638 |
| 1127 | Ga0496101_0006713 | 3300048904 | Bacteria | 7421 |
| 1128 | Ga0496101_0052905 | 3300048904 | Bacteria | 2928 |
| 1129 | Ga0496102_0000640 | 3300048905 | Bacteria | 35507 |
| 1130 | Ga0496102_0001362 | 3300048905 | Bacteria | 21888 |
| 1131 | Ga0496102_0004150 | 3300048905 | Bacteria | 12274 |
| 1132 | Ga0496102_0017432 | 3300048905 | Bacteria | 6291 |
| 1133 | Ga0496102_0046800 | 3300048905 | Bacteria | 3930 |
| 1134 | Ga0496102_0115949 | 3300048905 | Bacteria | 2499 |
| 1135 | Ga0496103_0000197 | 3300048906 | Bacteria | 60344 |
| 1136 | Ga0496103_0003193 | 3300048906 | Bacteria | 10065 |
| 1137 | Ga0496103_0004050 | 3300048906 | Bacteria | 8907 |
| 1138 | Ga0496103_0008193 | 3300048906 | Bacteria | 6203 |
| 1139 | Ga0496104_0016732 | 3300048907 | Bacteria | 6666 |
| 1140 | Ga0496104_0020106 | 3300048907 | Bacteria | 6117 |
| 1141 | Ga0496104_0034365 | 3300048907 | Bacteria | 4728 |
| 1142 | Ga0496104_0078834 | 3300048907 | Bacteria | 3139 |
| 1143 | Ga0496104_0276725 | 3300048907 | Bacteria | 1591 |
| 1144 | Ga0496105_0005813 | 3300048908 | Bacteria | 9409 |
| 1145 | Ga0496105_0043486 | 3300048908 | Bacteria | 3705 |
| 1146 | Ga0496105_0063948 | 3300048908 | Bacteria | 3036 |
| 1147 | Ga0496105_0128627 | 3300048908 | Bacteria | 2088 |
| 1148 | Ga0496106_0048984 | 3300048909 | Bacteria | 3182 |
| 1149 | Ga0496106_0100261 | 3300048909 | Bacteria | 2246 |
| 1150 | Ga0496106_0135009 | 3300048909 | Bacteria | 1937 |
| 1151 | Ga0496106_0142053 | 3300048909 | Bacteria | 1889 |
| 1152 | Ga0496108_0147251 | 3300048911 | Bacteria | 2030 |
| 1153 | Ga0496109_0128879 | 3300048912 | Bacteria | 2360 |
| 1154 | Ga0496109_0160594 | 3300048912 | Bacteria | 2106 |
| 1155 | Ga0496109_0207237 | 3300048912 | Bacteria | 1843 |
| 1156 | Ga0496109_0444592 | 3300048912 | Bacteria | 1225 |
| 1157 | Ga0496110_0004506 | 3300048913 | Bacteria | 10805 |
| 1158 | Ga0496110_0019584 | 3300048913 | Bacteria | 5699 |
| 1159 | Ga0496110_0042373 | 3300048913 | Bacteria | 3973 |
| 1160 | Ga0496110_0291118 | 3300048913 | Bacteria | 1487 |
| 1161 | Ga0496111_0049764 | 3300048914 | Bacteria | 3022 |
| 1162 | Ga0496111_0168151 | 3300048914 | Bacteria | 1629 |
| 1163 | Ga0496111_0295995 | 3300048914 | Bacteria | 1200 |
| 1164 | Ga0496112_0019536 | 3300048915 | Bacteria | 6396 |
| 1165 | Ga0496113_0000915 | 3300048916 | Bacteria | 15596 |
| 1166 | Ga0496113_0006120 | 3300048916 | Bacteria | 7595 |
| 1167 | Ga0496113_0019641 | 3300048916 | Bacteria | 4731 |
| 1168 | Ga0496113_0027368 | 3300048916 | Bacteria | 4088 |
| 1169 | Ga0496113_0072833 | 3300048916 | Bacteria | 2616 |
| 1170 | Ga0496114_0008420 | 3300048917 | Bacteria | 8167 |
| 1171 | Ga0496114_0051083 | 3300048917 | Bacteria | 3442 |
| 1172 | Ga0496114_0169692 | 3300048917 | Bacteria | 1901 |
| 1173 | Ga0496114_0327104 | 3300048917 | Bacteria | 1355 |
| 1174 | Ga0496116_0000014 | 3300048919 | Bacteria | 569049 |
| 1175 | Ga0496116_0001609 | 3300048919 | Bacteria | 24823 |
| 1176 | Ga0496117_0000467 | 3300048920 | Bacteria | 67483 |
| 1177 | Ga0496117_0008128 | 3300048920 | Bacteria | 10029 |
| 1178 | Ga0496118_0000459 | 3300048921 | Bacteria | 67483 |
| 1179 | Ga0496118_0003112 | 3300048921 | Bacteria | 21269 |
| 1180 | Ga0496118_0008803 | 3300048921 | Bacteria | 10342 |
| 1181 | Ga0496118_0029338 | 3300048921 | Bacteria | 4615 |
| 1182 | Ga0496118_0109992 | 3300048921 | Bacteria | 1832 |
| 1183 | Ga0496119_0000119 | 3300048922 | Bacteria | 110434 |
| 1184 | Ga0496119_0000346 | 3300048922 | Bacteria | 65007 |
| 1185 | Ga0496119_0051837 | 3300048922 | Bacteria | 2518 |
| 1186 | Ga0496120_0031371 | 3300048923 | Bacteria | 3218 |
| 1187 | Ga0496121_0000079 | 3300048924 | Bacteria | 232653 |
| 1188 | Ga0496121_0000382 | 3300048924 | Bacteria | 90517 |
| 1189 | Ga0496121_0000511 | 3300048924 | Bacteria | 73863 |
| 1190 | Ga0496121_0002155 | 3300048924 | Bacteria | 30799 |
| 1191 | Ga0496121_0009162 | 3300048924 | Bacteria | 11442 |
| 1192 | Ga0496122_0000310 | 3300048925 | Bacteria | 107506 |
| 1193 | Ga0496122_0000552 | 3300048925 | Bacteria | 77275 |
| 1194 | Ga0496122_0000662 | 3300048925 | Bacteria | 69323 |
| 1195 | Ga0496122_0001487 | 3300048925 | Bacteria | 37655 |
| 1196 | Ga0496122_0027018 | 3300048925 | Bacteria | 4924 |
| 1197 | Ga0496122_0085809 | 3300048925 | Bacteria | 2170 |
| 1198 | Ga0496123_0000478 | 3300048926 | Bacteria | 69650 |
| 1199 | Ga0496123_0000815 | 3300048926 | Bacteria | 50251 |
| 1200 | Ga0496123_0001031 | 3300048926 | Bacteria | 42310 |
| 1201 | Ga0496123_0007781 | 3300048926 | Bacteria | 9984 |
| 1202 | Ga0496123_0060403 | 3300048926 | Bacteria | 2444 |
| 1203 | Ga0496123_0126229 | 3300048926 | Bacteria | 1427 |
| 1204 | Ga0496124_0000499 | 3300048927 | Bacteria | 67483 |
| 1205 | Ga0496124_0000569 | 3300048927 | Bacteria | 62485 |
| 1206 | Ga0496124_0006777 | 3300048927 | Bacteria | 12374 |
| 1207 | Ga0496124_0008365 | 3300048927 | Bacteria | 10832 |
| 1208 | Ga0496124_0043380 | 3300048927 | Bacteria | 3867 |
| 1209 | Ga0496124_0278695 | 3300048927 | Bacteria | 1220 |
| 1210 | Ga0496125_0000122 | 3300048928 | Bacteria | 174898 |
| 1211 | Ga0496125_0000395 | 3300048928 | Bacteria | 81224 |
| 1212 | Ga0496125_0001860 | 3300048928 | Bacteria | 29047 |
| 1213 | Ga0496125_0003943 | 3300048928 | Bacteria | 17516 |
| 1214 | Ga0496125_0005275 | 3300048928 | Bacteria | 14467 |
| 1215 | Ga0496125_0008770 | 3300048928 | Bacteria | 10515 |
| 1216 | Ga0496125_0029798 | 3300048928 | Bacteria | 4896 |
| 1217 | Ga0496125_0202191 | 3300048928 | Bacteria | 1299 |
| 1218 | Ga0496126_0006618 | 3300048929 | Bacteria | 12898 |
| 1219 | Ga0496126_0020454 | 3300048929 | Bacteria | 6486 |
| 1220 | Ga0496126_0151825 | 3300048929 | Bacteria | 1985 |
| 1221 | Ga0496126_0186830 | 3300048929 | Bacteria | 1757 |
| 1222 | Ga0495678_001207 | 3300049459 | Bacteria | 21222 |
| 1223 | Ga0495678_002246 | 3300049459 | Bacteria | 13448 |
| 1224 | Ga0495678_003338 | 3300049459 | Bacteria | 9996 |
| 1225 | Ga0495678_009079 | 3300049459 | Bacteria | 4960 |
| 1226 | Ga0495678_015185 | 3300049459 | Bacteria | 3554 |
| 1227 | Ga0495678_015883 | 3300049459 | Bacteria | 3455 |
| 1228 | Ga0495678_036129 | 3300049459 | Bacteria | 2019 |
| 1229 | Ga0495678_052718 | 3300049459 | Bacteria | 1565 |
| 1230 | Ga0495678_073908 | 3300049459 | Bacteria | 1241 |
| 1231 | Ga0495682_0000039 | 3300049460 | Bacteria | 119714 |
| 1232 | Ga0495682_0000410 | 3300049460 | Bacteria | 30462 |
| 1233 | Ga0495682_0000749 | 3300049460 | Bacteria | 20952 |
| 1234 | Ga0495682_0000926 | 3300049460 | Bacteria | 17782 |
| 1235 | Ga0495682_0013509 | 3300049460 | Bacteria | 3106 |
| 1236 | Ga0501031_0010394 | 3300049568 | Bacteria | 6061 |
| 1237 | Ga0501031_0010803 | 3300049568 | Bacteria | 5947 |
| 1238 | Ga0501031_0013109 | 3300049568 | Bacteria | 5407 |
| 1239 | Ga0501031_0024216 | 3300049568 | Bacteria | 3957 |
| 1240 | Ga0501031_0092593 | 3300049568 | Bacteria | 1972 |
| 1241 | Ga0501031_0147415 | 3300049568 | Bacteria | 1537 |
| 1242 | Ga0501031_0168856 | 3300049568 | Bacteria | 1429 |
| 1243 | Ga0501032_0002092 | 3300049569 | Bacteria | 15735 |
| 1244 | Ga0501032_0003209 | 3300049569 | Bacteria | 12570 |
| 1245 | Ga0501032_0006722 | 3300049569 | Bacteria | 8439 |
| 1246 | Ga0501032_0010214 | 3300049569 | Bacteria | 6776 |
| 1247 | Ga0501032_0014996 | 3300049569 | Bacteria | 5480 |
| 1248 | Ga0501032_0093180 | 3300049569 | Bacteria | 1998 |
| 1249 | Ga0501033_0001171 | 3300049570 | Bacteria | 23655 |
| 1250 | Ga0501033_0002171 | 3300049570 | Bacteria | 16930 |
| 1251 | Ga0501033_0022401 | 3300049570 | Bacteria | 4766 |
| 1252 | Ga0501033_0042082 | 3300049570 | Unclassified | 3406 |
| 1253 | Ga0501033_0162376 | 3300049570 | Bacteria | 1608 |
| 1254 | Ga0501034_0000106 | 3300049571 | Bacteria | 153523 |
| 1255 | Ga0501034_0008467 | 3300049571 | Bacteria | 10864 |
| 1256 | Ga0501034_0020595 | 3300049571 | Bacteria | 6736 |
| 1257 | Ga0501034_0055155 | 3300049571 | Bacteria | 4000 |
| 1258 | Ga0501034_0121765 | 3300049571 | Bacteria | 2595 |
| 1259 | Ga0501036_0003079 | 3300049572 | Bacteria | 13298 |
| 1260 | Ga0501036_0012260 | 3300049572 | Bacteria | 7101 |
| 1261 | Ga0501036_0021057 | 3300049572 | Bacteria | 5477 |
| 1262 | Ga0501036_0044297 | 3300049572 | Bacteria | 3769 |
| 1263 | Ga0501036_0075491 | 3300049572 | Bacteria | 2850 |
| 1264 | Ga0501036_0188381 | 3300049572 | Bacteria | 1736 |
| 1265 | Ga0501037_0007407 | 3300049573 | Bacteria | 8023 |
| 1266 | Ga0501037_0010386 | 3300049573 | Bacteria | 6831 |
| 1267 | Ga0501037_0019972 | 3300049573 | Bacteria | 4944 |
| 1268 | Ga0501037_0110019 | 3300049573 | Bacteria | 1985 |
| 1269 | Ga0501037_0122942 | 3300049573 | Bacteria | 1865 |
| 1270 | Ga0501037_0253784 | 3300049573 | Bacteria | 1230 |
| 1271 | Ga0501037_0347067 | 3300049573 | Bacteria | 1024 |
| 1272 | Ga0501038_0002634 | 3300049574 | Bacteria | 16782 |
| 1273 | Ga0501038_0003415 | 3300049574 | Bacteria | 14802 |
| 1274 | Ga0501038_0010728 | 3300049574 | Bacteria | 8375 |
| 1275 | Ga0501038_0014617 | 3300049574 | Bacteria | 7152 |
| 1276 | Ga0501038_0018815 | 3300049574 | Bacteria | 6234 |
| 1277 | Ga0501038_0072181 | 3300049574 | Bacteria | 2926 |
| 1278 | Ga0501038_0094812 | 3300049574 | Bacteria | 2494 |
| 1279 | Ga0501038_0196611 | 3300049574 | Bacteria | 1620 |
| 1280 | Ga0501038_0243660 | 3300049574 | Bacteria | 1426 |
| 1281 | Ga0501038_0261647 | 3300049574 | Bacteria | 1367 |
| 1282 | Ga0501039_0000282 | 3300049575 | Bacteria | 36301 |
| 1283 | Ga0501039_0002340 | 3300049575 | Bacteria | 14096 |
| 1284 | Ga0501039_0024041 | 3300049575 | Bacteria | 4679 |
| 1285 | Ga0501039_0109677 | 3300049575 | Bacteria | 2157 |
| 1286 | Ga0501040_0004628 | 3300049576 | Bacteria | 8924 |
| 1287 | Ga0501040_0011583 | 3300049576 | Bacteria | 5772 |
| 1288 | Ga0501040_0116572 | 3300049576 | Bacteria | 1871 |
| 1289 | Ga0501041_0020186 | 3300049577 | Bacteria | 3980 |
| 1290 | Ga0501041_0027866 | 3300049577 | Bacteria | 3406 |
| 1291 | Ga0501042_0017244 | 3300049578 | Bacteria | 4978 |
| 1292 | Ga0501042_0163828 | 3300049578 | Bacteria | 1604 |
| 1293 | Ga0501043_0011878 | 3300049579 | Bacteria | 6821 |
| 1294 | Ga0501043_0015353 | 3300049579 | Bacteria | 5998 |
| 1295 | Ga0501043_0027415 | 3300049579 | Bacteria | 4472 |
| 1296 | Ga0501043_0045241 | 3300049579 | Bacteria | 3462 |
| 1297 | Ga0501043_0106392 | 3300049579 | Bacteria | 2203 |
| 1298 | Ga0501043_0198016 | 3300049579 | Bacteria | 1560 |
| 1299 | Ga0501046_0001006 | 3300049580 | Bacteria | 27557 |
| 1300 | Ga0501046_0007593 | 3300049580 | Bacteria | 9511 |
| 1301 | Ga0501046_0031213 | 3300049580 | Bacteria | 4321 |
| 1302 | Ga0501046_0155916 | 3300049580 | Bacteria | 1720 |
| 1303 | Ga0501047_0000036 | 3300049581 | Bacteria | 195504 |
| 1304 | Ga0501047_0003625 | 3300049581 | Bacteria | 14548 |
| 1305 | Ga0501047_0009898 | 3300049581 | Bacteria | 9012 |
| 1306 | Ga0501047_0031744 | 3300049581 | Bacteria | 5095 |
| 1307 | Ga0501047_0040722 | 3300049581 | Bacteria | 4492 |
| 1308 | Ga0501047_0075216 | 3300049581 | Bacteria | 3250 |
| 1309 | Ga0501047_0288475 | 3300049581 | Bacteria | 1485 |
| 1310 | Ga0501047_0295781 | 3300049581 | Bacteria | 1462 |
| 1311 | Ga0501048_0019782 | 3300049582 | Bacteria | 4937 |
| 1312 | Ga0501048_0053301 | 3300049582 | Bacteria | 2877 |
| 1313 | Ga0501048_0240324 | 3300049582 | Bacteria | 1285 |
| 1314 | Ga0501067_0001886 | 3300049583 | Bacteria | 11508 |
| 1315 | Ga0501068_0007938 | 3300049584 | Bacteria | 5884 |
| 1316 | Ga0501068_0032522 | 3300049584 | Bacteria | 3103 |
| 1317 | Ga0501069_0003811 | 3300049585 | Bacteria | 7758 |
| 1318 | Ga0501070_0038723 | 3300049586 | Bacteria | 3978 |
| 1319 | Ga0501071_0024811 | 3300049587 | Bacteria | 4194 |
| 1320 | Ga0501071_0071954 | 3300049587 | Bacteria | 2521 |
| 1321 | Ga0501072_0024579 | 3300049588 | Bacteria | 4688 |
| 1322 | Ga0501073_0003630 | 3300049589 | Bacteria | 11602 |
| 1323 | Ga0501073_0011234 | 3300049589 | Bacteria | 6550 |
| 1324 | Ga0501073_0036317 | 3300049589 | Bacteria | 3502 |
| 1325 | Ga0501073_0172633 | 3300049589 | Bacteria | 1497 |
| 1326 | Ga0501073_0239640 | 3300049589 | Bacteria | 1253 |
| 1327 | Ga0501073_0240221 | 3300049589 | Bacteria | 1251 |
| 1328 | Ga0501074_0002288 | 3300049590 | Bacteria | 13324 |
| 1329 | Ga0501074_0005080 | 3300049590 | Bacteria | 9445 |
| 1330 | Ga0501074_0089514 | 3300049590 | Bacteria | 2204 |
| 1331 | Ga0501075_0020312 | 3300049591 | Bacteria | 4830 |
| 1332 | Ga0501076_0022686 | 3300049592 | Bacteria | 4826 |
| 1333 | Ga0501076_0112372 | 3300049592 | Bacteria | 2203 |
| 1334 | Ga0501076_0370151 | 3300049592 | Bacteria | 1177 |
| 1335 | Ga0501243_001464 | 3300049675 | Bacteria | 3384 |
| 1336 | Ga0501257_001732 | 3300049686 | Bacteria | 4549 |
| 1337 | Ga0501079_0020833 | 3300049741 | Bacteria | 5013 |
| 1338 | Ga0501080_0016873 | 3300049742 | Bacteria | 6744 |
| 1339 | Ga0501080_0071579 | 3300049742 | Bacteria | 3225 |
| 1340 | Ga0501080_0203779 | 3300049742 | Bacteria | 1815 |
| 1341 | Ga0501081_0025728 | 3300049743 | Bacteria | 3962 |
| 1342 | Ga0501081_0252980 | 3300049743 | Bacteria | 1286 |
| 1343 | Ga0501083_0003958 | 3300049744 | Bacteria | 10404 |
| 1344 | Ga0501083_0016958 | 3300049744 | Bacteria | 5086 |
| 1345 | Ga0501241_000061 | 3300049758 | Bacteria | 27062 |
| 1346 | Ga0501269_001275 | 3300049766 | Bacteria | 3375 |
| 1347 | Ga0501280_001356 | 3300049776 | Bacteria | 4644 |
| 1348 | Ga0501035_0001192 | 3300049822 | Bacteria | 27078 |
| 1349 | Ga0501035_0003108 | 3300049822 | Bacteria | 15951 |
| 1350 | Ga0501035_0028985 | 3300049822 | Bacteria | 5049 |
| 1351 | Ga0501035_0039087 | 3300049822 | Bacteria | 4295 |
| 1352 | Ga0501035_0040698 | 3300049822 | Bacteria | 4198 |
| 1353 | Ga0501035_0373541 | 3300049822 | Bacteria | 1190 |
| 1354 | Ga0501044_0000915 | 3300049823 | Bacteria | 35537 |
| 1355 | Ga0501044_0009480 | 3300049823 | Bacteria | 10601 |
| 1356 | Ga0501044_0025273 | 3300049823 | Bacteria | 6294 |
| 1357 | Ga0501044_0055998 | 3300049823 | Bacteria | 4048 |
| 1358 | Ga0501044_0075136 | 3300049823 | Bacteria | 3431 |
| 1359 | Ga0501044_0093884 | 3300049823 | Bacteria | 3025 |
| 1360 | Ga0501044_0107928 | 3300049823 | Bacteria | 2794 |
| 1361 | Ga0501044_0139614 | 3300049823 | Bacteria | 2412 |
| 1362 | Ga0501044_0215945 | 3300049823 | Bacteria | 1870 |
| 1363 | Ga0501044_0227518 | 3300049823 | Bacteria | 1814 |
| 1364 | Ga0501044_0236557 | 3300049823 | Bacteria | 1772 |
| 1365 | Ga0501044_0240447 | 3300049823 | Bacteria | 1754 |
| 1366 | Ga0501044_0428002 | 3300049823 | Bacteria | 1233 |
| 1367 | Ga0501044_0487492 | 3300049823 | Bacteria | 1135 |
| 1368 | Ga0501045_0035056 | 3300049824 | Bacteria | 3643 |
| 1369 | Ga0501045_0081085 | 3300049824 | Bacteria | 2392 |
| 1370 | Ga0501045_0160260 | 3300049824 | Bacteria | 1674 |
| 1371 | nmdc:mga03683_12240_c1 | 3300050489 | Bacteria | 3129 |
| 1372 | nmdc:mga03683_174_c1 | 3300050489 | Bacteria | 15592 |
| 1373 | nmdc:mga03683_9790_c1 | 3300050489 | Bacteria | 3419 |
| 1374 | nmdc:mga03n38_11270_c1 | 3300050490 | Bacteria | 3324 |
| 1375 | nmdc:mga03n38_155138_c1 | 3300050490 | Bacteria | 1155 |
| 1376 | nmdc:mga03n38_265_c1 | 3300050490 | Bacteria | 12400 |
| 1377 | nmdc:mga00v17_11359_c1 | 3300050491 | Bacteria | 4894 |
| 1378 | nmdc:mga00v17_141113_c1 | 3300050491 | Bacteria | 1545 |
| 1379 | nmdc:mga00v17_195_c1 | 3300050491 | Bacteria | 36325 |
| 1380 | nmdc:mga00v17_2323_c1 | 3300050491 | Bacteria | 9739 |
| 1381 | nmdc:mga00v17_37683_c1 | 3300050491 | Bacteria | 2888 |
| 1382 | nmdc:mga00v17_6863_c1 | 3300050491 | Bacteria | 6052 |
| 1383 | nmdc:mga00v17_6918_c1 | 3300050491 | Bacteria | 6029 |
| 1384 | nmdc:mga00v17_85329_c1 | 3300050491 | Bacteria | 1977 |
| 1385 | nmdc:mga0yw44_1997_c1 | 3300050492 | Bacteria | 8478 |
| 1386 | nmdc:mga0yw44_21739_c1 | 3300050492 | Bacteria | 3585 |
| 1387 | nmdc:mga0yw44_224_c1 | 3300050492 | Bacteria | 19415 |
| 1388 | nmdc:mga0yw44_32929_c1 | 3300050492 | Bacteria | 3024 |
| 1389 | nmdc:mga0yw44_48330_c1 | 3300050492 | Bacteria | 2565 |
| 1390 | nmdc:mga0k408_2031_c1 | 3300050493 | Bacteria | 10832 |
| 1391 | nmdc:mga0k408_29312_c1 | 3300050493 | Bacteria | 3132 |
| 1392 | nmdc:mga0k408_3752_c1 | 3300050493 | Bacteria | 8057 |
| 1393 | nmdc:mga06z11_23022_c1 | 3300050494 | Bacteria | 2920 |
| 1394 | nmdc:mga06z11_27245_c1 | 3300050494 | Bacteria | 2731 |
| 1395 | nmdc:mga06z11_566_c1 | 3300050494 | Bacteria | 13548 |
| 1396 | nmdc:mga06z11_66994_c1 | 3300050494 | Bacteria | 1889 |
| 1397 | nmdc:mga04h51_16705_c1 | 3300050495 | Bacteria | 2134 |
| 1398 | nmdc:mga07m45_1348_c1 | 3300050496 | Bacteria | 11186 |
| 1399 | nmdc:mga07m45_28397_c1 | 3300050496 | Bacteria | 3088 |
| 1400 | nmdc:mga07m45_4378_c1 | 3300050496 | Bacteria | 6912 |
| 1401 | nmdc:mga0qj67_247037_c1 | 3300050509 | Bacteria | 1448 |
| 1402 | nmdc:mga0n895_7312_c1 | 3300050512 | Bacteria | 9465 |
| 1403 | nmdc:mga0rr50_23734_c1 | 3300050513 | Bacteria | 4236 |
| 1404 | nmdc:mga08x19_16585_c1 | 3300050514 | Bacteria | 4494 |
| 1405 | nmdc:mga0sz30_10786_c1 | 3300050516 | Bacteria | 3509 |
| 1406 | nmdc:mga0sz30_46130_c1 | 3300050516 | Bacteria | 1839 |
| 1407 | Ga0495601_0000136 | 3300053077 | Bacteria | 41775 |
| 1408 | Ga0495601_0000631 | 3300053077 | Bacteria | 18818 |
| 1409 | Ga0495601_0039665 | 3300053077 | Bacteria | 2949 |
| 1410 | Ga0495601_0107814 | 3300053077 | Bacteria | 1802 |
| 1411 | Ga0495612_0009485 | 3300053078 | Bacteria | 3947 |
| 1412 | Ga0500610_0000020 | 3300053079 | Bacteria | 68771 |
| 1413 | Ga0495655_0005623 | 3300053083 | Bacteria | 2226 |
| 1414 | Ga0495655_0024373 | 3300053083 | Bacteria | 1405 |
| 1415 | Ga0500643_000006 | 3300053087 | Bacteria | 479605 |
| 1416 | Ga0500643_000288 | 3300053087 | Bacteria | 43145 |
| 1417 | Ga0500643_000806 | 3300053087 | Bacteria | 20226 |
| 1418 | Ga0500643_047016 | 3300053087 | Bacteria | 1245 |
| 1419 | Ga0500644_0024613 | 3300053088 | Bacteria | 1843 |
| 1420 | Ga0500646_0000243 | 3300053090 | Bacteria | 16708 |
| 1421 | Ga0500583_0004080 | 3300053092 | Bacteria | 4705 |
| 1422 | Ga0500660_058423 | 3300053100 | Bacteria | 1870 |
| 1423 | Ga0500553_077520 | 3300053101 | Bacteria | 1507 |
| 1424 | Ga0500556_0000694 | 3300053104 | Bacteria | 20691 |
| 1425 | Ga0500556_0001563 | 3300053104 | Bacteria | 9298 |
| 1426 | Ga0500562_000274 | 3300053108 | Bacteria | 12749 |
| 1427 | Ga0500593_000390 | 3300053117 | Bacteria | 17526 |
| 1428 | Ga0500628_001979 | 3300053129 | Bacteria | 3443 |
| 1429 | Ga0500658_0011791 | 3300053134 | Bacteria | 3221 |
| 1430 | Ga0500559_0000539 | 3300053136 | Bacteria | 26232 |
| 1431 | Ga0500559_0088021 | 3300053136 | Bacteria | 1419 |
| 1432 | Ga0500561_0004018 | 3300053137 | Bacteria | 2625 |
| 1433 | Ga0500579_047035 | 3300053143 | Bacteria | 2666 |
| 1434 | Ga0500588_0017800 | 3300053146 | Bacteria | 1862 |
| 1435 | Ga0500588_0029193 | 3300053146 | Bacteria | 1571 |
| 1436 | Ga0500600_0036492 | 3300053149 | Bacteria | 2857 |
| 1437 | Ga0500616_0000090 | 3300053153 | Bacteria | 187734 |
| 1438 | Ga0500616_0000366 | 3300053153 | Bacteria | 63761 |
| 1439 | Ga0500616_0006429 | 3300053153 | Bacteria | 7695 |
| 1440 | Ga0500624_003000 | 3300053157 | Bacteria | 2229 |
| 1441 | Ga0500627_0097501 | 3300053158 | Bacteria | 1318 |
| 1442 | Ga0500633_0003880 | 3300053160 | Bacteria | 3340 |
| 1443 | Ga0500638_000052 | 3300053162 | Bacteria | 26431 |
| 1444 | Ga0500636_0053914 | 3300053177 | Bacteria | 2359 |
| 1445 | Ga0500645_013100 | 3300053730 | Bacteria | 2668 |
| 1446 | Ga0500656_000664 | 3300053732 | Bacteria | 2661 |
| 1447 | Ga0500565_000835 | 3300053734 | Bacteria | 1860 |
| 1448 | Ga0500587_001296 | 3300053739 | Bacteria | 3503 |
| 1449 | Ga0501084_0003841 | 3300054114 | Bacteria | 12227 |
| 1450 | Ga0501084_0006423 | 3300054114 | Bacteria | 9662 |
| 1451 | Ga0501084_0153371 | 3300054114 | Unclassified | 1942 |
| 1452 | Ga0501082_0007219 | 3300060353 | Bacteria | 9578 |
| 1453 | Ga0501082_0077527 | 3300060353 | Bacteria | 2865 |
| 1454 | Ga0466962_0002590 | 3300061719 | Bacteria | 8589 |
| 1455 | Ga0466962_0003058 | 3300061719 | Bacteria | 7970 |
| 1456 | Ga0466962_0065263 | 3300061719 | Bacteria | 1738 |
| 1457 | Ga0466962_0103894 | 3300061719 | Bacteria | 1365 |
| 1458 | Ga0530510_0034331 | 3300061734 | Bacteria | 3653 |
| 1459 | 2506866591 | 2506783011 | Bacteria | 5323186 |
| 1460 | 2508676500 | 2508501039 | Bacteria | 9978592 |
| 1461 | 2511265326 | 2511231006 | Bacteria | 6794709 |
| 1462 | 2511271868 | 2511231007 | Bacteria | 6306603 |
| 1463 | 2511290386 | 2511231010 | Bacteria | 6373152 |
| 1464 | 2511300026 | 2511231012 | Bacteria | 6738011 |
| 1465 | 2511314516 | 2511231014 | Bacteria | 6462302 |
| 1466 | 2511322094 | 2511231015 | Bacteria | 6598026 |
| 1467 | 2511322662 | 2511231015 | Bacteria | 6598026 |
| 1468 | 2511331900 | 2511231017 | Bacteria | 6503007 |
| 1469 | 2511347854 | 2511231020 | Bacteria | 6115223 |
| 1470 | 2511348960 | 2511231020 | Bacteria | 6115223 |
| 1471 | 2511354147 | 2511231021 | Bacteria | 7302637 |
| 1472 | 2513962115 | 2513237151 | Bacteria | 6309801 |
| 1473 | 2515687836 | 2515154123 | Bacteria | 6387382 |
| 1474 | 2516021844 | 2515154189 | Bacteria | 9629850 |
| 1475 | 2517763276 | 2517572101 | Bacteria | 6884336 |
| 1476 | 2524613814 | 2524023250 | Bacteria | 5457705 |
| 1477 | 2547374727 | 2547132103 | Bacteria | 5115736 |
| 1478 | 2548697399 | 2547132424 | Bacteria | 8348532 |
| 1479 | 2559431727 | 2558860280 | Bacteria | 11429938 |
| 1480 | 2563056847 | 2562617112 | Bacteria | 10918404 |
| 1481 | 2563057937 | 2562617112 | Bacteria | 10918404 |
| 1482 | 2566997100 | 2565956761 | Bacteria | 6601618 |
| 1483 | 2585312308 | 2582581314 | Bacteria | 11452267 |
| 1484 | 2588109337 | 2585428157 | Bacteria | 3018951 |
| 1485 | 2599408945 | 2599185169 | Bacteria | 5441380 |
| 1486 | 2600023000 | 2599185316 | Bacteria | 6320029 |
| 1487 | 2600076368 | 2599185325 | Bacteria | 6324919 |
| 1488 | 2600815086 | 2600255067 | Bacteria | 6795583 |
| 1489 | 2601522538 | 2600255254 | Bacteria | 5281859 |
| 1490 | 2601527565 | 2600255255 | Bacteria | 5282785 |
| 1491 | 2601614396 | 2600255280 | Bacteria | 5292309 |
| 1492 | 2601619116 | 2600255281 | Bacteria | 5288753 |
| 1493 | 2601642264 | 2600255287 | Bacteria | 5210468 |
| 1494 | 2601647126 | 2600255288 | Bacteria | 5282738 |
| 1495 | 2601652543 | 2600255289 | Bacteria | 5281907 |
| 1496 | 2601657869 | 2600255290 | Bacteria | 5282218 |
| 1497 | 2601662087 | 2600255291 | Bacteria | 5217298 |
| 1498 | 2601695045 | 2600255298 | Bacteria | 5215185 |
| 1499 | 2601699717 | 2600255299 | Bacteria | 5218662 |
| 1500 | 2601706388 | 2600255300 | Bacteria | 5287774 |
| 1501 | 2601710694 | 2600255301 | Bacteria | 5280532 |
| 1502 | 2601715708 | 2600255302 | Bacteria | 5288235 |
| 1503 | 2601720068 | 2600255303 | Bacteria | 5219315 |
| 1504 | 2601726114 | 2600255304 | Bacteria | 5283973 |
| 1505 | 2601730655 | 2600255305 | Bacteria | 5282329 |
| 1506 | 2601735671 | 2600255306 | Bacteria | 5281613 |
| 1507 | 2601740939 | 2600255307 | Bacteria | 5439064 |
| 1508 | 2601750869 | 2600255309 | Bacteria | 5431045 |
| 1509 | 2602018123 | 2600255392 | Bacteria | 5437392 |
| 1510 | 2603659449 | 2602042052 | Bacteria | 5215873 |
| 1511 | 2603664724 | 2602042053 | Bacteria | 5214361 |
| 1512 | 2603838047 | 2602042103 | Bacteria | 5284714 |
| 1513 | 2603843125 | 2602042104 | Bacteria | 5281639 |
| 1514 | 2603848198 | 2602042105 | Bacteria | 5282303 |
| 1515 | 2603853273 | 2602042106 | Bacteria | 5282744 |
| 1516 | 2603871324 | 2602042110 | Bacteria | 5283285 |
| 1517 | 2603876255 | 2602042111 | Bacteria | 5212080 |
| 1518 | 2606048517 | 2603880178 | Bacteria | 5283018 |
| 1519 | 2606069151 | 2603880184 | Bacteria | 5217896 |
| 1520 | 2606144973 | 2603880202 | Bacteria | 5284684 |
| 1521 | 2606175918 | 2603880211 | Bacteria | 5284226 |
| 1522 | 2616900590 | 2616644941 | Bacteria | 8510691 |
| 1523 | 2621299508 | 2619619299 | Bacteria | 6649820 |
| 1524 | 2621300473 | 2619619299 | Bacteria | 6649820 |
| 1525 | 2623498752 | 2622736605 | Bacteria | 4992138 |
| 1526 | 2623500936 | 2622736605 | Bacteria | 4992138 |
| 1527 | 2624479896 | 2623620443 | Bacteria | 6427864 |
| 1528 | 2637224820 | 2636415599 | Bacteria | 5718434 |
| 1529 | 2643766676 | 2643221549 | Bacteria | 4042819 |
| 1530 | 2643811030 | 2643221558 | Bacteria | 5460675 |
| 1531 | 2643824625 | 2643221561 | Bacteria | 4984412 |
| 1532 | 2643846924 | 2643221566 | Bacteria | 3460379 |
| 1533 | 2643900950 | 2643221578 | Bacteria | 9213798 |
| 1534 | 2643999425 | 2643221598 | Bacteria | 4578346 |
| 1535 | 2644032370 | 2643221604 | Bacteria | 5014917 |
| 1536 | 2644038347 | 2643221605 | Bacteria | 4772303 |
| 1537 | 2644092067 | 2643221615 | Bacteria | 5487866 |
| 1538 | 2644158927 | 2643221628 | Bacteria | 5745828 |
| 1539 | 2644172031 | 2643221630 | Bacteria | 3601215 |
| 1540 | 2644278126 | 2643221649 | Bacteria | 3867359 |
| 1541 | 2644321870 | 2643221657 | Bacteria | 5490246 |
| 1542 | 2644407096 | 2643221673 | Bacteria | 9196637 |
| 1543 | 2644489758 | 2643221687 | Bacteria | 6500351 |
| 1544 | 2644535877 | 2643221696 | Bacteria | 5431823 |
| 1545 | 2676200598 | 2675902999 | Bacteria | 9438463 |
| 1546 | 2676406085 | 2675903046 | Bacteria | 5451247 |
| 1547 | 2686538252 | 2684623035 | Bacteria | 8032739 |
| 1548 | 2686539124 | 2684623035 | Bacteria | 8032739 |
| 1549 | 2689956911 | 2687453737 | Bacteria | 11203906 |
| 1550 | 2689994600 | 2687453743 | Bacteria | 8361025 |
| 1551 | 2689996405 | 2687453743 | Bacteria | 8361025 |
| 1552 | 2713473360 | 2711768613 | Bacteria | 11048459 |
| 1553 | 2713481141 | 2711768613 | Bacteria | 11048459 |
| 1554 | 2723640571 | 2721755702 | Bacteria | 4373124 |
| 1555 | 2723848337 | 2721755755 | Bacteria | 8322773 |
| 1556 | 2738673137 | 2738541265 | Bacteria | 6594665 |
| 1557 | 2738694628 | 2738541272 | Bacteria | 6848551 |
| 1558 | 2738751530 | 2738541282 | Bacteria | 6593925 |
| 1559 | 2738860571 | 2738541303 | Bacteria | 6591772 |
| 1560 | 2738886481 | 2738541307 | Bacteria | 8606193 |
| 1561 | 2738893014 | 2738541308 | Bacteria | 7020677 |
| 1562 | 2739205899 | 2738543005 | Bacteria | 5278128 |
| 1563 | 2739236131 | 2738543011 | Bacteria | 5731169 |
| 1564 | 2739257939 | 2738543015 | Bacteria | 6750701 |
| 1565 | 2739261348 | 2738543015 | Bacteria | 6750701 |
| 1566 | 2739332531 | 2738543028 | Bacteria | 6917070 |
| 1567 | 2739363401 | 2738543034 | Bacteria | 6084756 |
| 1568 | 2744957679 | 2744054611 | Bacteria | 5611514 |
| 1569 | 2753040036 | 2751185725 | Bacteria | 5740550 |
| 1570 | 2753328546 | 2751185792 | Bacteria | 5739090 |
| 1571 | 2753568354 | 2751185846 | Bacteria | 7242164 |
| 1572 | 2753764942 | 2751185897 | Bacteria | 5322941 |
| 1573 | 2774396166 | 2773857762 | Bacteria | 5971770 |
| 1574 | 2774845176 | 2773857921 | Bacteria | 9435764 |
| 1575 | 2774903118 | 2773857933 | Bacteria | 5818019 |
| 1576 | 2775658984 | 2775506735 | Bacteria | 4556596 |
| 1577 | 2776376818 | 2775506925 | Bacteria | 7237746 |
| 1578 | 2777022155 | 2775507074 | Bacteria | 5532402 |
| 1579 | 2785338952 | 2784746763 | Bacteria | 9783172 |
| 1580 | 2786666593 | 2786546132 | Bacteria | 10419719 |
| 1581 | 2786675103 | 2786546132 | Bacteria | 10419719 |
| 1582 | 2792837774 | 2791355137 | Bacteria | 9654227 |
| 1583 | 2793080200 | |||
| 1584 | 2808848596 | 2808606359 | Bacteria | 9866990 |
| 1585 | 2808899371 | 2808606372 | Bacteria | 4649509 |
| 1586 | 2808900092 | 2808606372 | Bacteria | 4649509 |
| 1587 | 2809145039 | 2808606418 | Bacteria | 6724496 |
| 1588 | 2809197803 | 2808606439 | Bacteria | 5952208 |
| 1589 | 2812330890 | 2811994874 | Bacteria | 5367947 |
| 1590 | 2812347706 | 2811994878 | Bacteria | 5992952 |
| 1591 | 2812358301 | 2811994879 | Bacteria | 9313447 |
| 1592 | 2817490452 | 2816332298 | Bacteria | 6852809 |
| 1593 | 2817490871 | 2816332298 | Bacteria | 6852809 |
| 1594 | 2819689309 | 2818991462 | Bacteria | 4320267 |
| 1595 | 2834645108 | 2834641062 | Bacteria | 5559922 |
| 1596 | 2843693297 | 2843690924 | Bacteria | 5169057 |
| 1597 | 2852108231 | 2852103415 | Bacteria | 5193810 |
| 1598 | 2855387397 | 2855386786 | Bacteria | 4752232 |
| 1599 | 2858692522 | 2858688981 | Bacteria | 8184122 |
| 1600 | 2862385394 | 2862382967 | Bacteria | 10317375 |
| 1601 | 2862385739 | 2862382967 | Bacteria | 10317375 |
| 1602 | 2862575659 | 2862574272 | Bacteria | 10567477 |
| 1603 | 2863072772 | 2863067949 | Bacteria | 8541735 |
| 1604 | 2867347023 | 2867346516 | Bacteria | 7608576 |
| 1605 | 2870628179 | 2870628048 | Bacteria | 3696012 |
| 1606 | 2873315454 | 2873314349 | Bacteria | 8512634 |
| 1607 | 2874611376 | 2874604998 | Bacteria | 7834745 |
| 1608 | 2877684670 | 2877676314 | Bacteria | 9512378 |
| 1609 | 2881104882 | 2881101125 | Bacteria | 4590519 |
| 1610 | 2885267480 | 2885266251 | Bacteria | 4796748 |
| 1611 | 2889304499 | 2889300758 | Bacteria | 5690814 |
| 1612 | 2891052136 | 2891048133 | Bacteria | 4447501 |
| 1613 | 2891968884 | 2891968417 | Bacteria | 5821697 |
| 1614 | 2895428621 | 2895427314 | Bacteria | 13147766 |
| 1615 | 2895887647 | 2895880812 | Bacteria | 11255272 |
| 1616 | 2900642698 | 2900634093 | Bacteria | 10263517 |
| 1617 | 2902794389 | 2902792274 | Bacteria | 7270173 |
| 1618 | 2902838784 | 2902837492 | Bacteria | 6697721 |
| 1619 | 2904514292 | 2904513164 | Bacteria | 5476410 |
| 1620 | 2904536690 | 2904535858 | Bacteria | 6308016 |
| 1621 | 2904545693 | 2904541872 | Bacteria | 8915136 |
| 1622 | 2904549507 | 2904541872 | Bacteria | 8915136 |
| 1623 | 2904619292 | 2904615490 | Bacteria | 10047340 |
| 1624 | 2904766414 | 2904765812 | Bacteria | 5369154 |
| 1625 | 2904770311 | 2904765812 | Bacteria | 5369154 |
| 1626 | 2904770426 | 2904765812 | Bacteria | 5369154 |
| 1627 | 2904772477 | 2904770941 | Bacteria | 5580202 |
| 1628 | 2908816357 | 2908811453 | Bacteria | 5478616 |
| 1629 | 2912728671 | 2912723979 | Bacteria | 8557534 |
| 1630 | 2915358969 | 2915358134 | Bacteria | 6050864 |
| 1631 | 2919054981 | 2919051321 | Bacteria | 4210889 |
| 1632 | 2919140844 | 2919138771 | Bacteria | 5281312 |
| 1633 | 2919156355 | 2919155634 | Bacteria | 4860545 |
| 1634 | 2919421155 | 2919420072 | Bacteria | 5390363 |
| 1635 | 2919422313 | 2919420072 | Bacteria | 5390363 |
| 1636 | 2919422327 | 2919420072 | Bacteria | 5390363 |
| 1637 | 2919433087 | 2919432681 | Bacteria | 5390474 |
| 1638 | 2919435420 | 2919432681 | Bacteria | 5390474 |
| 1639 | 2919435434 | 2919432681 | Bacteria | 5390474 |
| 1640 | 2919720169 | 2919713450 | Bacteria | 7431245 |
| 1641 | 2922555139 | 2922554459 | Bacteria | 6683962 |
| 1642 | 2928143647 | 2928142448 | Bacteria | 5288925 |
| 1643 | 2929168348 | 2929160207 | Bacteria | 9075316 |
| 1644 | 2929214030 | 2929212328 | Bacteria | 7708288 |
| 1645 | 2929217851 | 2929212328 | Bacteria | 7708288 |
| 1646 | 2935393775 | 2935390628 | Bacteria | 7043367 |
| 1647 | 2935410066 | 2935409751 | Bacteria | 4179611 |
| 1648 | 2939575007 | 2939573065 | Bacteria | 4926053 |
| 1649 | 2939674789 | 2939674588 | Bacteria | 4844420 |
| 1650 | 2939745103 | 2939743619 | Bacteria | 5762299 |
| 1651 | 2941489122 | 2941485952 | Bacteria | 3591484 |
| 1652 | 2945914585 | 2945909444 | Bacteria | 7065066 |
| 1653 | 2945990014 | 2945984333 | Bacteria | 7358892 |
| 1654 | 2946073377 | 2946072368 | Bacteria | 8999607 |
| 1655 | 2954680273 | 2954673503 | Bacteria | 9685905 |
| 1656 | 2954681684 | 2954673503 | Bacteria | 9685905 |
| 1657 | 2954683878 | 2954682443 | Bacteria | 9862841 |
| 1658 | 2954711922 | 2954711539 | Bacteria | 10867210 |
| 1659 | 2954721856 | 2954721474 | Bacteria | 10456478 |
| 1660 | 2954739993 | 2954731030 | Bacteria | 10243860 |
| 1661 | 2954740752 | 2954740390 | Bacteria | 10229294 |
| 1662 | 2954758811 | 2954749733 | Bacteria | 10366972 |
| 1663 | 2954759762 | 2954759201 | Bacteria | 9358192 |
| 1664 | 2969081800 | 2969079654 | Bacteria | 5439582 |
| 1665 | 2984564225 | 2984559226 | Bacteria | 5683096 |
| 1666 | 2984580488 | 2984576629 | Bacteria | 4248407 |
| 1667 | 2984596960 | 2984595703 | Bacteria | 5682994 |
| 1668 | 2990067775 | 2990059506 | Bacteria | 9321252 |
| 1669 | 2990258180 | 2990256926 | Bacteria | 4252839 |
| 1670 | 3003002588 | 3002998708 | Bacteria | 11715108 |
| 1671 | 3006494426 | 3006493962 | Bacteria | 8825450 |
| 1672 | 3007719907 | 3007718800 | Bacteria | 5971527 |
| 1673 | 642595293 | 642555112 | Bacteria | 8676562 |
| 1674 | 8002787277 | 8002784119 | Bacteria | 9788632 |
| 1675 | 8004212912 | 8004212874 | Bacteria | 2861420 |
| 1676 | 8006989693 | 8006984368 | Bacteria | 9651211 |
| 1677 | 8008559210 | 8008558824 | Bacteria | 10610750 |
| 1678 | 8008560778 | 8008558824 | Bacteria | 10610750 |
| 1679 | 8015691598 | 8015687852 | Bacteria | 6613826 |
| 1680 | 8033688493 | 8033684223 | Bacteria | 6906479 |
| 1681 | 8047712035 | 8047710418 | Bacteria | 11023148 |
| 1682 | 8048364369 | 8048356638 | Bacteria | 11044339 |
| 1683 | 8048371700 | 8048369669 | Bacteria | 11666822 |
| 1684 | 8048380633 | 8048379754 | Bacteria | 11877923 |
| 1685 | 8048408705 | 8048406513 | Bacteria | 8936924 |
| 1686 | 8048747391 | 8048746797 | Bacteria | 3557226 |
| 1687 | 8054002910 | 8054002106 | Bacteria | 7987183 |
| 1688 | 8054609905 | 8054609563 | Bacteria | 5170090 |
| 1689 | 8055883933 | 8055878733 | Bacteria | 5907058 |
| 1690 | 8056174141 | 8056172158 | Bacteria | 6133900 |
| 1691 | 8056174155 | 8056172158 | Bacteria | 6133900 |
| 1692 | Ga0453683_0019366 | |||
| 1693 | LJQas_1006075 | |||
| 1694 | JGI24736J21556_1001110 | |||
| 1695 | JGI24741J21665_1000113 | |||
| 1696 | JGI24740J21852_10000711 | |||
| 1697 | JGI24740J21852_10002626 | |||
| 1698 | JGI24740J21852_10002683 | |||
| 1699 | JGI24740J21852_10004751 | |||
| 1700 | JGI24740J21852_10009903 | |||
| 1701 | JGI24739J22299_10004028 | |||
| 1702 | JGI24739J22299_10004360 | |||
| 1703 | JGI24739J22299_10014764 | |||
| 1704 | JGI24737J22298_10007873 | |||
| 1705 | JGI24737J22298_10013837 | |||
| 1706 | JGI24735J21928_10011021 | |||
| 1707 | JGI24735J21928_10017697 | |||
| 1708 | JGI24750J21931_1002100 | |||
| 1709 | JGI24745J21846_1001283 | |||
| 1710 | JGI24738J21930_10000132 | |||
| 1711 | JGI24738J21930_10004974 | |||
| 1712 | JGI24749J21850_1004251 | |||
| 1713 | JGI24749J21850_1006511 | |||
| 1714 | JGI24744J21845_10000214 | |||
| 1715 | JGI24742J22300_10000517 | |||
| 1716 | JGI24751J29686_10012933 | |||
| 1717 | JGI24751J29686_10017101 | |||
| 1718 | JGI25154J39366_1000680 | |||
| 1719 | JGI25151J46595_10006212 | |||
| 1720 | JGI25406J46586_10004639 | |||
| 1721 | rootH1_10005611 | |||
| 1722 | rootL2_10011255 | |||
| 1723 | rootL2_10024094 | |||
| 1724 | rootH1_10007244 | |||
| 1725 | rootH1_10018354 | |||
| 1726 | Ga0006562J51391_1047977 | |||
| 1727 | Ga0006562J51391_1047978 | |||
| 1728 | Ga0055534_1008400 | |||
| 1729 | Ga0055530_10000093 | |||
| 1730 | Ga0055530_10000104 | |||
| 1731 | Ga0055530_10006899 | |||
| 1732 | Ga0055530_10013286 | |||
| 1733 | Ga0055540_1000104 | |||
| 1734 | Ga0055540_1000335 | |||
| 1735 | Ga0055540_1000374 | |||
| 1736 | Ga0055531_10000432 | |||
| 1737 | Ga0055531_10000475 | |||
| 1738 | Ga0055531_10000798 | |||
| 1739 | Ga0065714_10002253 | |||
| 1740 | Ga0065714_10002318 | |||
| 1741 | Ga0065714_10071256 | |||
| 1742 | Ga0065714_10072687 | |||
| 1743 | Ga0065707_10158656 | |||
| 1744 | Ga0070658_10002591 | |||
| 1745 | Ga0070658_10006024 | |||
| 1746 | Ga0070658_10085040 | |||
| 1747 | Ga0070683_100058031 | |||
| 1748 | Ga0070670_100035314 | |||
| 1749 | Ga0068869_100058671 | |||
| 1750 | Ga0070666_10038372 | |||
| 1751 | Ga0070680_100089435 | |||
| 1752 | Ga0070682_100177234 | |||
| 1753 | Ga0068868_100096800 | |||
| 1754 | Ga0068868_100211149 | |||
| 1755 | Ga0070660_100019900 | |||
| 1756 | Ga0070660_100068276 | |||
| 1757 | Ga0070687_100036621 | |||
| 1758 | Ga0070661_100017643 | |||
| 1759 | Ga0070661_100037246 | |||
| 1760 | Ga0070692_10040316 | |||
| 1761 | Ga0070668_100012270 | |||
| 1762 | Ga0070668_100298556 | |||
| 1763 | Ga0070669_100153879 | |||
| 1764 | Ga0070673_100066340 | |||
| 1765 | Ga0070659_100014358 | |||
| 1766 | Ga0070659_100016108 | |||
| 1767 | Ga0070659_100040971 | |||
| 1768 | Ga0070659_100097415 | |||
| 1769 | Ga0070667_100001179 | |||
| 1770 | Ga0070667_100143708 | |||
| 1771 | Ga0070667_100459785 | |||
| 1772 | Ga0070709_10013047 | |||
| 1773 | Ga0070709_10039557 | |||
| 1774 | Ga0070709_10074903 | |||
| 1775 | Ga0070714_100010158 | |||
| 1776 | Ga0070714_100061288 | |||
| 1777 | Ga0070714_100126052 | |||
| 1778 | Ga0070713_100086281 | |||
| 1779 | Ga0070713_100091314 | |||
| 1780 | Ga0070711_100017440 | |||
| 1781 | Ga0070711_100196943 | |||
| 1782 | Ga0070700_100233018 | |||
| 1783 | Ga0070708_100109310 | |||
| 1784 | Ga0070663_100001457 | |||
| 1785 | Ga0070663_100005366 | |||
| 1786 | Ga0070663_100171543 | |||
| 1787 | Ga0070662_100002546 | |||
| 1788 | Ga0070662_100040010 | |||
| 1789 | Ga0070662_100068871 | |||
| 1790 | Ga0070662_100109535 | |||
| 1791 | Ga0070662_100127245 | |||
| 1792 | Ga0070681_10023386 | |||
| 1793 | Ga0070706_100017747 | |||
| 1794 | Ga0070698_100024948 | |||
| 1795 | Ga0070698_100052415 | |||
| 1796 | Ga0070698_100094493 | |||
| 1797 | Ga0070679_100005894 | |||
| 1798 | Ga0070679_100389841 | |||
| 1799 | Ga0070679_100441610 | |||
| 1800 | Ga0070684_100042291 | |||
| 1801 | Ga0068853_100034643 | |||
| 1802 | Ga0068853_100094831 | |||
| 1803 | Ga0068853_100101111 | |||
| 1804 | Ga0068853_100120002 | |||
| 1805 | Ga0068853_100496487 | |||
| 1806 | Ga0070672_100240562 | |||
| 1807 | Ga0070686_100068812 | |||
| 1808 | Ga0070695_100022082 | |||
| 1809 | Ga0070665_100005167 | |||
| 1810 | Ga0070665_100096194 | |||
| 1811 | Ga0070665_100405076 | |||
| 1812 | Ga0070704_100052742 | |||
| 1813 | Ga0068855_100017817 | |||
| 1814 | Ga0068855_100073278 | |||
| 1815 | Ga0068855_100178472 | |||
| 1816 | Ga0068855_100639185 | |||
| 1817 | Ga0068857_100010913 | |||
| 1818 | Ga0068857_100070185 | |||
| 1819 | Ga0068854_100001955 | |||
| 1820 | Ga0068854_100010954 | |||
| 1821 | Ga0068854_100209882 | |||
| 1822 | Ga0068856_100001670 | |||
| 1823 | Ga0068856_100001903 | |||
| 1824 | Ga0068856_100004825 | |||
| 1825 | Ga0068856_100031379 | |||
| 1826 | Ga0068856_100124584 | |||
| 1827 | Ga0068852_100004005 | |||
| 1828 | Ga0068852_100010518 | |||
| 1829 | Ga0068852_100062126 | |||
| 1830 | Ga0068859_100062248 | |||
| 1831 | Ga0068859_100410724 | |||
| 1832 | Ga0068861_100162040 | |||
| 1833 | Ga0068851_10012360 | |||
| 1834 | Ga0068851_10014265 | |||
| 1835 | Ga0068851_10015819 | |||
| 1836 | Ga0068851_10046099 | |||
| 1837 | Ga0068863_100000884 | |||
| 1838 | Ga0068858_100000071 | |||
| 1839 | Ga0068858_100194908 | |||
| 1840 | Ga0068860_100002624 | |||
| 1841 | Ga0068862_100001916 | |||
| 1842 | Ga0068862_100081877 | |||
| 1843 | Ga0068862_100518719 | |||
| 1844 | Ga0081455_10000072 | |||
| 1845 | Ga0081455_10000942 | |||
| 1846 | Ga0081455_10049061 | |||
| 1847 | Ga0081455_10061316 | |||
| 1848 | Ga0081538_10005332 | |||
| 1849 | Ga0081540_1000803 | |||
| 1850 | Ga0081540_1056346 | |||
| 1851 | Ga0081540_1063790 | |||
| 1852 | Ga0081539_10000926 | |||
| 1853 | Ga0081539_10001862 | |||
| 1854 | Ga0081539_10002207 | |||
| 1855 | Ga0081539_10057026 | |||
| 1856 | Ga0081539_10102173 | |||
| 1857 | Ga0070717_10003368 | |||
| 1858 | Ga0075365_10000382 | |||
| 1859 | Ga0075365_10007998 | |||
| 1860 | Ga0075365_10009039 | |||
| 1861 | Ga0075365_10021267 | |||
| 1862 | Ga0075365_10024844 | |||
| 1863 | Ga0075365_10048223 | |||
| 1864 | Ga0075365_10240302 | |||
| 1865 | Ga0075368_10029108 | |||
| 1866 | Ga0075363_100019796 | |||
| 1867 | Ga0075363_100028448 | |||
| 1868 | Ga0075363_100033837 | |||
| 1869 | Ga0075363_100062426 | |||
| 1870 | Ga0075364_10001406 | |||
| 1871 | Ga0075364_10027911 | |||
| 1872 | Ga0075364_10033429 | |||
| 1873 | Ga0075364_10035089 | |||
| 1874 | Ga0075364_10050527 | |||
| 1875 | Ga0075364_10086976 | |||
| 1876 | Ga0075364_10137730 | |||
| 1877 | Ga0075432_10000250 | |||
| 1878 | Ga0075432_10064286 | |||
| 1879 | Ga0070715_10001319 | |||
| 1880 | Ga0070716_100002397 | |||
| 1881 | Ga0070712_100005544 | |||
| 1882 | Ga0070712_100022764 | |||
| 1883 | Ga0070712_100079503 | |||
| 1884 | Ga0075362_10000258 | |||
| 1885 | Ga0075362_10033344 | |||
| 1886 | Ga0075362_10037781 | |||
| 1887 | Ga0075362_10053428 | |||
| 1888 | Ga0075362_10094356 | |||
| 1889 | Ga0075367_10000249 | |||
| 1890 | Ga0075367_10000257 | |||
| 1891 | Ga0075367_10003322 | |||
| 1892 | Ga0075367_10053919 | |||
| 1893 | Ga0075367_10164293 | |||
| 1894 | Ga0075369_10003467 | |||
| 1895 | Ga0075369_10027436 | |||
| 1896 | Ga0075369_10051857 | |||
| 1897 | Ga0075369_10079529 | |||
| 1898 | Ga0075369_10083844 | |||
| 1899 | Ga0075366_10000691 | |||
| 1900 | Ga0075366_10002546 | |||
| 1901 | Ga0075366_10108758 | |||
| 1902 | Ga0075370_10000455 | |||
| 1903 | Ga0075370_10000589 | |||
| 1904 | Ga0075370_10000848 | |||
| 1905 | Ga0075370_10001354 | |||
| 1906 | Ga0075428_100000014 | |||
| 1907 | Ga0075430_100032200 | |||
| 1908 | Ga0075430_100090235 | |||
| 1909 | Ga0075430_100094610 | |||
| 1910 | Ga0075434_100010087 | |||
| 1911 | Ga0075434_100220638 | |||
| 1912 | Ga0075429_100203733 | |||
| 1913 | Ga0075436_100021640 | |||
| 1914 | Ga0097620_100062248 | |||
| 1915 | Ga0097620_100410757 | |||
| 1916 | Ga0079104_1002857 | |||
| 1917 | Ga0079104_1003799 | |||
| 1918 | Ga0079104_1023539 | |||
| 1919 | Ga0099826_10011905 | |||
| 1920 | Ga0075435_100015300 | |||
| 1921 | Ga0105251_10046942 | |||
| 1922 | Ga0105251_10066983 | |||
| 1923 | Ga0105244_10000488 | |||
| 1924 | Ga0105244_10009031 | |||
| 1925 | Ga0105244_10023365 | |||
| 1926 | Ga0105250_10000052 | |||
| 1927 | Ga0105250_10030697 | |||
| 1928 | Ga0105240_10001140 | |||
| 1929 | Ga0105240_10018798 | |||
| 1930 | Ga0105240_10021903 | |||
| 1931 | Ga0105240_10023949 | |||
| 1932 | Ga0105240_10076538 | |||
| 1933 | Ga0105240_10077435 | |||
| 1934 | Ga0105240_10086545 | |||
| 1935 | Ga0105240_10093850 | |||
| 1936 | Ga0105240_10100206 | |||
| 1937 | Ga0105240_10103573 | |||
| 1938 | Ga0105240_10144154 | |||
| 1939 | Ga0105240_10160150 | |||
| 1940 | Ga0105240_10326952 | |||
| 1941 | Ga0111539_10000019 | |||
| 1942 | Ga0111539_10275603 | |||
| 1943 | Ga0105245_10603499 | |||
| 1944 | Ga0114129_10019234 | |||
| 1945 | Ga0105243_10003676 | |||
| 1946 | Ga0105243_10013641 | |||
| 1947 | Ga0105243_10224913 | |||
| 1948 | Ga0105241_10000004 | |||
| 1949 | Ga0105241_10000897 | |||
| 1950 | Ga0105241_10004450 | |||
| 1951 | Ga0105241_10023205 | |||
| 1952 | Ga0105241_10103152 | |||
| 1953 | Ga0105241_10111705 | |||
| 1954 | Ga0105242_10128315 | |||
| 1955 | Ga0105248_10000450 | |||
| 1956 | Ga0105237_10000874 | |||
| 1957 | Ga0105237_10001013 | |||
| 1958 | Ga0105237_10001636 | |||
| 1959 | Ga0105237_10019441 | |||
| 1960 | Ga0105237_10028483 | |||
| 1961 | Ga0105237_10036578 | |||
| 1962 | Ga0105237_10042233 | |||
| 1963 | Ga0105237_10055888 | |||
| 1964 | Ga0105237_10168910 | |||
| 1965 | Ga0105237_10329919 | |||
| 1966 | Ga0105238_10000514 | |||
| 1967 | Ga0105238_10011534 | |||
| 1968 | Ga0105238_10019463 | |||
| 1969 | Ga0105238_10022891 | |||
| 1970 | Ga0105238_10030906 | |||
| 1971 | Ga0105238_10056949 | |||
| 1972 | Ga0105238_10159496 | |||
| 1973 | Ga0105238_10168284 | |||
| 1974 | Ga0105249_10000439 | |||
| 1975 | Ga0105249_10014870 | |||
| 1976 | Ga0105249_10019951 | |||
| 1977 | Ga0105249_10132765 | |||
| 1978 | Ga0105239_10000113 | |||
| 1979 | Ga0105239_10000626 | |||
| 1980 | Ga0105239_10001157 | |||
| 1981 | Ga0105239_10003283 | |||
| 1982 | Ga0105239_10006533 | |||
| 1983 | Ga0105239_10007549 | |||
| 1984 | Ga0105239_10011168 | |||
| 1985 | Ga0105239_10019695 | |||
| 1986 | Ga0105239_10021350 | |||
| 1987 | Ga0105239_10031465 | |||
| 1988 | Ga0105239_10037487 | |||
| 1989 | Ga0105239_10040307 | |||
| 1990 | Ga0105239_10153076 | |||
| 1991 | Ga0105239_10166869 | |||
| 1992 | Ga0105239_10360114 | |||
| 1993 | Ga0105246_10033362 | |||
| 1994 | Ga0105246_10062811 | |||
| 1995 | Ga0157373_10002444 | |||
| 1996 | Ga0157373_10004285 | |||
| 1997 | Ga0157371_10000776 | |||
| 1998 | Ga0157371_10006002 | |||
| 1999 | Ga0157370_10004423 | |||
| 2000 | Ga0157370_10009299 | |||
| 2001 | Ga0157370_10016479 | |||
| 2002 | Ga0157370_10017127 | |||
| 2003 | Ga0157369_10008980 | |||
| 2004 | Ga0157369_10073351 | |||
| 2005 | Ga0157369_10264853 | |||
| 2006 | Ga0157374_10142773 | |||
| 2007 | Ga0163162_10319926 | |||
| 2008 | Ga0157372_10002002 | |||
| 2009 | Ga0157372_10004609 | |||
| 2010 | Ga0157372_10021286 | |||
| 2011 | Ga0157372_10045106 | |||
| 2012 | Ga0157372_10653592 | |||
| 2013 | Ga0157375_10000312 | |||
| 2014 | Ga0157375_10107544 | |||
| 2015 | Ga0157375_10145300 | |||
| 2016 | Ga0163163_10000004 | |||
| 2017 | Ga0163163_10171930 | |||
| 2018 | Ga0163163_10300813 | |||
| 2019 | Ga0157380_10266818 | |||
| 2020 | Ga0157380_10339860 | |||
| 2021 | Ga0182008_10000353 | |||
| 2022 | Ga0182008_10001321 | |||
| 2023 | Ga0157379_10000015 | |||
| 2024 | Ga0157379_10000284 | |||
| 2025 | Ga0157379_10106140 | |||
| 2026 | Ga0157376_10044652 | |||
| 2027 | Ga0182006_1001200 | |||
| 2028 | Ga0163161_10000201 | |||
| 2029 | Ga0163161_10002299 | |||
| 2030 | Ga0163161_10018606 | |||
| 2031 | Ga0163161_10024418 | |||
| 2032 | Ga0163161_10048305 | |||
| 2033 | Ga0163161_10055743 | |||
| 2034 | Ga0206354_11589331 | |||
| 2035 | Ga0213872_10004853 | |||
| 2036 | Ga0209147_100156 | |||
| 2037 | Ga0209147_100430 | |||
| 2038 | Ga0209646_1000049 | |||
| 2039 | Ga0209673_1028864 | |||
| 2040 | Ga0209675_1000132 | |||
| 2041 | Ga0209676_1000118 | |||
| 2042 | Ga0209676_1000779 | |||
| 2043 | Ga0209676_1006141 | |||
| 2044 | Ga0209676_1035842 | |||
| 2045 | Ga0209025_1000029 | |||
| 2046 | Ga0209050_1000115 | |||
| 2047 | Ga0209050_1000148 | |||
| 2048 | Ga0209050_1000412 | |||
| 2049 | Ga0209050_1001181 | |||
| 2050 | Ga0207426_1006425 | |||
| 2051 | Ga0209051_1000150 | |||
| 2052 | Ga0209051_1000231 | |||
| 2053 | Ga0209051_1000294 | |||
| 2054 | Ga0209051_1005966 | |||
| 2055 | Ga0209051_1013164 | |||
| 2056 | Ga0209051_1045640 | |||
| 2057 | Ga0209257_1000160 | |||
| 2058 | Ga0209257_1000275 | |||
| 2059 | Ga0207656_10002772 | |||
| 2060 | Ga0207656_10010781 | |||
| 2061 | Ga0207696_1000003 | |||
| 2062 | Ga0207655_1000022 | |||
| 2063 | Ga0207655_1006740 | |||
| 2064 | Ga0207655_1022408 | |||
| 2065 | Ga0207655_1029269 | |||
| 2066 | Ga0207655_1035585 | |||
| 2067 | Ga0207713_1000093 | |||
| 2068 | Ga0207692_10023138 | |||
| 2069 | Ga0207642_10038024 | |||
| 2070 | Ga0207710_10039827 | |||
| 2071 | Ga0207688_10015128 | |||
| 2072 | Ga0207688_10016838 | |||
| 2073 | Ga0207680_10017843 | |||
| 2074 | Ga0207647_10001831 | |||
| 2075 | Ga0207647_10003420 | |||
| 2076 | Ga0207647_10015326 | |||
| 2077 | Ga0207647_10023664 | |||
| 2078 | Ga0207685_10014285 | |||
| 2079 | Ga0207699_10023992 | |||
| 2080 | Ga0207699_10024826 | |||
| 2081 | Ga0207699_10115784 | |||
| 2082 | Ga0207645_10006008 | |||
| 2083 | Ga0207643_10088240 | |||
| 2084 | Ga0207705_10008265 | |||
| 2085 | Ga0207705_10070773 | |||
| 2086 | Ga0207684_10055485 | |||
| 2087 | Ga0207654_10000006 | |||
| 2088 | Ga0207654_10000069 | |||
| 2089 | Ga0207654_10000383 | |||
| 2090 | Ga0207654_10006919 | |||
| 2091 | Ga0207654_10028403 | |||
| 2092 | Ga0207654_10045006 | |||
| 2093 | Ga0207707_10077753 | |||
| 2094 | Ga0207695_10000936 | |||
| 2095 | Ga0207695_10008781 | |||
| 2096 | Ga0207695_10008866 | |||
| 2097 | Ga0207695_10020466 | |||
| 2098 | Ga0207695_10032104 | |||
| 2099 | Ga0207695_10055228 | |||
| 2100 | Ga0207695_10056256 | |||
| 2101 | Ga0207695_10255339 | |||
| 2102 | Ga0207671_10000702 | |||
| 2103 | Ga0207671_10000759 | |||
| 2104 | Ga0207671_10001691 | |||
| 2105 | Ga0207671_10010953 | |||
| 2106 | Ga0207671_10156617 | |||
| 2107 | Ga0207693_10004892 | |||
| 2108 | Ga0207693_10004935 | |||
| 2109 | Ga0207693_10005274 | |||
| 2110 | Ga0207693_10106318 | |||
| 2111 | Ga0207663_10081169 | |||
| 2112 | Ga0207660_10046905 | |||
| 2113 | Ga0207662_10000254 | |||
| 2114 | Ga0207657_10013359 | |||
| 2115 | Ga0207657_10034449 | |||
| 2116 | Ga0207657_10036394 | |||
| 2117 | Ga0207657_10041494 | |||
| 2118 | Ga0207649_10039932 | |||
| 2119 | Ga0207694_10000120 | |||
| 2120 | Ga0207694_10000933 | |||
| 2121 | Ga0207694_10056955 | |||
| 2122 | Ga0207694_10091331 | |||
| 2123 | Ga0207694_10348615 | |||
| 2124 | Ga0207700_10004057 | |||
| 2125 | Ga0207700_10031541 | |||
| 2126 | Ga0207700_10048466 | |||
| 2127 | Ga0207664_10032588 | |||
| 2128 | Ga0207690_10036892 | |||
| 2129 | Ga0207690_10118527 | |||
| 2130 | Ga0207690_10149493 | |||
| 2131 | Ga0207706_10002971 | |||
| 2132 | Ga0207706_10005299 | |||
| 2133 | Ga0207706_10015662 | |||
| 2134 | Ga0207706_10028246 | |||
| 2135 | Ga0207706_10035172 | |||
| 2136 | Ga0207706_10059270 | |||
| 2137 | Ga0207706_10065155 | |||
| 2138 | Ga0207686_10003225 | |||
| 2139 | Ga0207709_10003334 | |||
| 2140 | Ga0207709_10009590 | |||
| 2141 | Ga0207709_10037084 | |||
| 2142 | Ga0207709_10055055 | |||
| 2143 | Ga0207709_10156514 | |||
| 2144 | Ga0207665_10000636 | |||
| 2145 | Ga0207665_10003419 | |||
| 2146 | Ga0207665_10055951 | |||
| 2147 | Ga0207691_10013126 | |||
| 2148 | Ga0207711_10001827 | |||
| 2149 | Ga0207689_10022570 | |||
| 2150 | Ga0207689_10284814 | |||
| 2151 | Ga0207679_10062252 | |||
| 2152 | Ga0207679_10288493 | |||
| 2153 | Ga0207667_10006732 | |||
| 2154 | Ga0207667_10007448 | |||
| 2155 | Ga0207667_10050218 | |||
| 2156 | Ga0207667_10169458 | |||
| 2157 | Ga0207712_10000334 | |||
| 2158 | Ga0207668_10035999 | |||
| 2159 | Ga0207640_10005679 | |||
| 2160 | Ga0207640_10007022 | |||
| 2161 | Ga0207640_10373902 | |||
| 2162 | Ga0207658_10000947 | |||
| 2163 | Ga0207658_10004952 | |||
| 2164 | Ga0207703_10000094 | |||
| 2165 | Ga0207639_10000438 | |||
| 2166 | Ga0207639_10001071 | |||
| 2167 | Ga0207639_10003561 | |||
| 2168 | Ga0207639_10013881 | |||
| 2169 | Ga0207639_10046183 | |||
| 2170 | Ga0207639_10443242 | |||
| 2171 | Ga0207678_10000022 | |||
| 2172 | Ga0207678_10000116 | |||
| 2173 | Ga0207678_10003208 | |||
| 2174 | Ga0207678_10012246 | |||
| 2175 | Ga0207678_10075496 | |||
| 2176 | Ga0207678_10180867 | |||
| 2177 | Ga0207708_10011471 | |||
| 2178 | Ga0207702_10000019 | |||
| 2179 | Ga0207702_10002429 | |||
| 2180 | Ga0207702_10003041 | |||
| 2181 | Ga0207702_10004744 | |||
| 2182 | Ga0207702_10012384 | |||
| 2183 | Ga0207702_10173590 | |||
| 2184 | Ga0207641_10002649 | |||
| 2185 | Ga0207641_10100637 | |||
| 2186 | Ga0207648_10015533 | |||
| 2187 | Ga0207674_10004606 | |||
| 2188 | Ga0207674_10151585 | |||
| 2189 | Ga0207674_10478449 | |||
| 2190 | Ga0207675_100018468 | |||
| 2191 | Ga0207675_100019177 | |||
| 2192 | Ga0207675_100062339 | |||
| 2193 | Ga0207683_10013203 | |||
| 2194 | Ga0207683_10100938 | |||
| 2195 | Ga0207683_10199936 | |||
| 2196 | Ga0207698_10002072 | |||
| 2197 | Ga0207698_10003380 | |||
| 2198 | Ga0209281_1000008 | |||
| 2199 | Ga0209371_1001588 | |||
| 2200 | Ga0207428_10004342 | |||
| 2201 | Ga0207428_10008192 | |||
| 2202 | Ga0207428_10028732 | |||
| 2203 | Ga0268266_10000948 | |||
| 2204 | Ga0268266_10020341 | |||
| 2205 | Ga0268266_10331744 | |||
| 2206 | Ga0268265_10000962 | |||
| 2207 | Ga0268265_10054223 | |||
| 2208 | Ga0268265_10224900 | |||
| 2209 | Ga0268264_10001094 | |||
| 2210 | Ga0268264_10001384 | |||
| 2211 | Ga0307517_10002656 | |||
| 2212 | Ga0307517_10078648 | |||
| 2213 | Ga0307517_10099582 | |||
| 2214 | Ga0307515_10003461 | |||
| 2215 | Ga0307515_10042191 | |||
| 2216 | Ga0307515_10100958 | |||
| 2217 | Ga0307515_10157547 | |||
| 2218 | Ga0307515_10264390 | |||
| 2219 | Ga0307515_10265026 | |||
| 2220 | Ga0307515_10279768 | |||
| 2221 | Ga0265338_10139736 | |||
| 2222 | Ga0268256_1001370 | |||
| 2223 | Ga0307511_10000050 | |||
| 2224 | Ga0307511_10000401 | |||
| 2225 | Ga0307511_10026796 | |||
| 2226 | Ga0307511_10034094 | |||
| 2227 | Ga0307512_10008551 | |||
| 2228 | Ga0307512_10022005 | |||
| 2229 | Ga0307512_10055026 | |||
| 2230 | Ga0316181_1154916 | |||
| 2231 | Ga0316182_1153087 | |||
| 2232 | Ga0265316_10005411 | |||
| 2233 | Ga0307513_10000219 | |||
| 2234 | Ga0307513_10001108 | |||
| 2235 | Ga0307513_10023992 | |||
| 2236 | Ga0307513_10037999 | |||
| 2237 | Ga0307513_10126960 | |||
| 2238 | Ga0307509_10001929 | |||
| 2239 | Ga0307509_10019317 | |||
| 2240 | Ga0307509_10028803 | |||
| 2241 | Ga0307509_10101119 | |||
| 2242 | Ga0307509_10102176 | |||
| 2243 | Ga0307408_100002141 | |||
| 2244 | Ga0307408_100012250 | |||
| 2245 | Ga0307408_100165109 | |||
| 2246 | Ga0307508_10001419 | |||
| 2247 | Ga0307508_10001653 | |||
| 2248 | Ga0307508_10002660 | |||
| 2249 | Ga0307508_10004136 | |||
| 2250 | Ga0307508_10030043 | |||
| 2251 | Ga0307508_10041918 | |||
| 2252 | Ga0307508_10089809 | |||
| 2253 | Ga0307514_10043511 | |||
| 2254 | Ga0307514_10070607 | |||
| 2255 | Ga0265314_10037140 | |||
| 2256 | Ga0307516_10004179 | |||
| 2257 | Ga0307516_10005739 | |||
| 2258 | Ga0307516_10026058 | |||
| 2259 | Ga0307516_10030738 | |||
| 2260 | Ga0307516_10105779 | |||
| 2261 | Ga0307405_10087645 | |||
| 2262 | Ga0307405_10349870 | |||
| 2263 | Ga0307413_10118980 | |||
| 2264 | Ga0307518_10001376 | |||
| 2265 | Ga0307518_10023205 | |||
| 2266 | Ga0307406_10003739 | |||
| 2267 | Ga0307412_10000304 | |||
| 2268 | Ga0307412_10040867 | |||
| 2269 | Ga0307412_10063625 | |||
| 2270 | Ga0307412_10109468 | |||
| 2271 | Ga0307412_10226929 | |||
| 2272 | Ga0307412_10232468 | |||
| 2273 | Ga0307409_100015488 | |||
| 2274 | Ga0307409_100359717 | |||
| 2275 | Ga0307409_100404966 | |||
| 2276 | Ga0307409_100415053 | |||
| 2277 | Ga0307416_100544319 | |||
| 2278 | Ga0307414_10002087 | |||
| 2279 | Ga0307414_10015307 | |||
| 2280 | Ga0307414_10015942 | |||
| 2281 | Ga0307414_10172545 | |||
| 2282 | Ga0307411_10064143 | |||
| 2283 | Ga0307411_10102079 | |||
| 2284 | Ga0307507_10000003 | |||
| 2285 | Ga0307507_10000031 | |||
| 2286 | Ga0307507_10011820 | |||
| 2287 | Ga0307510_10003088 | |||
| 2288 | Ga0307510_10009123 | |||
| 2289 | Ga0307510_10027972 | |||
| 2290 | Ga0316214_1001712 | |||
| 2291 | Ga0373952_0017907 | |||
| 2292 | Ga0373946_0024183 | |||
| 2293 | Ga0373931_0003665 | |||
| 2294 | Ga0373927_0000410 | |||
| 2295 | Ga0373947_0009173 | |||
| 2296 | Ga0373925_0000730 | |||
| 2297 | Ga0395899_0013724 | |||
| 2298 | Ga0395899_0023133 | |||
| 2299 | Ga0395899_0026758 | |||
| 2300 | Ga0395899_0102359 | |||
| 2301 | Ga0395900_0000474 | |||
| 2302 | Ga0395900_0001603 | |||
| 2303 | Ga0395900_0004209 | |||
| 2304 | Ga0395900_0074799 | |||
| 2305 | Ga0395900_0102275 | |||
| 2306 | Ga0395900_0153446 | |||
| 2307 | Ga0395900_0440889 | |||
| 2308 | Ga0395898_0000751 | |||
| 2309 | Ga0395898_0004678 | |||
| 2310 | Ga0395898_0012071 | |||
| 2311 | Ga0395898_0012419 | |||
| 2312 | Ga0395898_0019940 | |||
| 2313 | Ga0395898_0035174 | |||
| 2314 | Ga0395898_0164832 | |||
| 2315 | Ga0395898_0445558 | |||
| 2316 | Ga0395905_0005858 | |||
| 2317 | Ga0395905_0018917 | |||
| 2318 | Ga0395905_0050569 | |||
| 2319 | Ga0395905_0062684 | |||
| 2320 | Ga0395905_0066056 | |||
| 2321 | Ga0395905_0085393 | |||
| 2322 | Ga0395905_0212001 | |||
| 2323 | Ga0395901_0000077 | |||
| 2324 | Ga0395901_0000246 | |||
| 2325 | Ga0395901_0000908 | |||
| 2326 | Ga0395901_0026128 | |||
| 2327 | Ga0395901_0030832 | |||
| 2328 | Ga0395901_0043177 | |||
| 2329 | Ga0395901_0123752 | |||
| 2330 | Ga0395901_0130622 | |||
| 2331 | Ga0395901_0288605 | |||
| 2332 | Ga0237819_01112 | |||
| 2333 | Ga0400483_108750 | |||
| 2334 | Ga0400483_135484 | |||
| 2335 | Ga0400483_180197 | |||
| 2336 | Ga0400483_243671 | |||
| 2337 | Ga0436361_0108407 | |||
| 2338 | Ga0436361_0659434 | |||
| 2339 | Ga0436361_1220162 | |||
| 2340 | Ga0436363_1150514 | |||
| 2341 | Ga0439436_0013263 | |||
| 2342 | Ga0439436_0028606 | |||
| 2343 | Ga0439466_0003736 | |||
| 2344 | Ga0439465_0030638 | |||
| 2345 | Ga0451795_0226724 | |||
| 2346 | Ga0451839_0426667 | |||
| 2347 | Ga0439445_0024077 | |||
| 2348 | Ga0439448_0010380 | |||
| 2349 | Ga0439448_0019533 | |||
| 2350 | Ga0439448_0025958 | |||
| 2351 | Ga0439432_004797 | |||
| 2352 | Ga0439449_0018184 | |||
| 2353 | Ga0439449_0040347 | |||
| 2354 | Ga0439450_009204 | |||
| 2355 | Ga0439451_000125 | |||
| 2356 | Ga0439451_000134 | |||
| 2357 | Ga0439452_000130 | |||
| 2358 | Ga0439452_009390 | |||
| 2359 | Ga0439457_000234 | |||
| 2360 | Ga0439457_003788 | |||
| 2361 | Ga0439463_013229 | |||
| 2362 | Ga0450911_003786 | |||
| 2363 | Ga0450920_008457 | |||
| 2364 | Ga0450923_003270 | |||
| 2365 | Ga0450894_000475 | |||
| 2366 | Ga0450898_002595 | |||
| 2367 | Ga0450902_009804 | |||
| 2368 | Ga0450906_000347 | |||
| 2369 | Ga0450907_002519 | |||
| 2370 | Ga0439458_0003190 | |||
| 2371 | Ga0450908_000522 | |||
| 2372 | Ga0439434_0003886 | |||
| 2373 | Ga0439464_0005925 | |||
| 2374 | Ga0439460_0008127 | |||
| 2375 | Ga0451577_0089587 | |||
| 2376 | Ga0466969_0009500 | |||
| 2377 | Ga0466969_0018605 | |||
| 2378 | Ga0466969_0039455 | |||
| 2379 | Ga0466972_0000462 | |||
| 2380 | Ga0466972_0007761 | |||
| 2381 | Ga0466972_0015619 | |||
| 2382 | Ga0466972_0111947 | |||
| 2383 | Ga0466965_0004793 | |||
| 2384 | Ga0466965_0010740 | |||
| 2385 | Ga0466965_0017187 | |||
| 2386 | Ga0466965_0038068 | |||
| 2387 | Ga0466966_0000927 | |||
| 2388 | Ga0466966_0001156 | |||
| 2389 | Ga0466966_0001664 | |||
| 2390 | Ga0466966_0009048 | |||
| 2391 | Ga0466966_0075818 | |||
| 2392 | Ga0466966_0109047 | |||
| 2393 | Ga0466961_0005318 | |||
| 2394 | Ga0466961_0012135 | |||
| 2395 | Ga0466961_0034753 | |||
| 2396 | Ga0466963_0001264 | |||
| 2397 | Ga0466963_0002989 | |||
| 2398 | Ga0466964_0006530 | |||
| 2399 | Ga0453684_0259954 | |||
| 2400 | Ga0453684_0297449 | |||
| 2401 | Ga0466971_0001070 | |||
| 2402 | Ga0466971_0024430 | |||
| 2403 | Ga0466971_0098252 | |||
| 2404 | Ga0466968_0013336 | |||
| 2405 | Ga0466970_0004934 | |||
| 2406 | Ga0466970_0026319 | |||
| 2407 | Ga0466957_0000029 | |||
| 2408 | Ga0466957_0001270 | |||
| 2409 | Ga0466957_0123522 | |||
| 2410 | Ga0466957_0143405 | |||
| 2411 | Ga0466960_0024039 | |||
| 2412 | Ga0466959_0006518 | |||
| 2413 | Ga0466959_0007787 | |||
| 2414 | Ga0466959_0019614 | |||
| 2415 | Ga0466959_0077580 | |||
| 2416 | Ga0451576_0008986 | |||
| 2417 | Ga0451576_0027926 | |||
| 2418 | Ga0466958_0000352 | |||
| 2419 | Ga0466958_0004427 | |||
| 2420 | Ga0466958_0020230 | |||
| 2421 | Ga0466958_0114456 | |||
| 2422 | Ga0466967_0022489 | |||
| 2423 | Ga0466967_0040101 | |||
| 2424 | Ga0466967_0378902 | |||
| 2425 | Ga0495617_000642 | |||
| 2426 | Ga0495617_006827 | |||
| 2427 | Ga0495617_010652 | |||
| 2428 | Ga0495617_014761 | |||
| 2429 | Ga0495617_028167 | |||
| 2430 | Ga0495617_052606 | |||
| 2431 | Ga0495627_000254 | |||
| 2432 | Ga0495627_001072 | |||
| 2433 | Ga0495627_026424 | |||
| 2434 | Ga0495592_0012672 | |||
| 2435 | Ga0495592_0015756 | |||
| 2436 | Ga0495603_0002962 | |||
| 2437 | Ga0495603_0007336 | |||
| 2438 | Ga0495603_0015983 | |||
| 2439 | Ga0495603_0019131 | |||
| 2440 | Ga0495590_0000965 | |||
| 2441 | Ga0495590_0007568 | |||
| 2442 | Ga0495590_0015204 | |||
| 2443 | Ga0495590_0044467 | |||
| 2444 | Ga0495591_000005 | |||
| 2445 | Ga0495591_000088 | |||
| 2446 | Ga0495591_003293 | |||
| 2447 | Ga0495591_009522 | |||
| 2448 | Ga0495629_0008564 | |||
| 2449 | Ga0495629_0010005 | |||
| 2450 | Ga0495629_0019619 | |||
| 2451 | Ga0495629_0072821 | |||
| 2452 | Ga0495629_0124042 | |||
| 2453 | Ga0495638_0001071 | |||
| 2454 | Ga0495638_0003500 | |||
| 2455 | Ga0495638_0004007 | |||
| 2456 | Ga0495638_0011558 | |||
| 2457 | Ga0495638_0017740 | |||
| 2458 | Ga0495638_0040011 | |||
| 2459 | Ga0495638_0042721 | |||
| 2460 | Ga0495638_0064128 | |||
| 2461 | Ga0495638_0110876 | |||
| 2462 | Ga0495653_0001089 | |||
| 2463 | Ga0495653_0004894 | |||
| 2464 | Ga0495653_0036548 | |||
| 2465 | Ga0495653_0045911 | |||
| 2466 | Ga0495650_0001499 | |||
| 2467 | Ga0495650_0001536 | |||
| 2468 | Ga0495650_0001808 | |||
| 2469 | Ga0495650_0002221 | |||
| 2470 | Ga0495650_0002985 | |||
| 2471 | Ga0495650_0005447 | |||
| 2472 | Ga0495650_0019653 | |||
| 2473 | Ga0495580_0010092 | |||
| 2474 | Ga0495580_0015860 | |||
| 2475 | Ga0495605_0000195 | |||
| 2476 | Ga0495605_0000199 | |||
| 2477 | Ga0495605_0000257 | |||
| 2478 | Ga0495605_0001546 | |||
| 2479 | Ga0495605_0007942 | |||
| 2480 | Ga0495605_0019276 | |||
| 2481 | Ga0495639_0003285 | |||
| 2482 | Ga0495662_0008243 | |||
| 2483 | Ga0495664_0003557 | |||
| 2484 | Ga0495664_0032744 | |||
| 2485 | Ga0495664_0097429 | |||
| 2486 | Ga0495584_0001017 | |||
| 2487 | Ga0495584_0002370 | |||
| 2488 | Ga0495584_0024427 | |||
| 2489 | Ga0495584_0030071 | |||
| 2490 | Ga0495584_0118609 | |||
| 2491 | Ga0495585_0000142 | |||
| 2492 | Ga0495585_0000577 | |||
| 2493 | Ga0495585_0000795 | |||
| 2494 | Ga0495585_0002260 | |||
| 2495 | Ga0495585_0012745 | |||
| 2496 | Ga0495585_0035019 | |||
| 2497 | Ga0495585_0080431 | |||
| 2498 | Ga0495585_0092144 | |||
| 2499 | Ga0495594_0091268 | |||
| 2500 | Ga0495596_0000061 | |||
| 2501 | Ga0495596_0001643 | |||
| 2502 | Ga0495607_0000138 | |||
| 2503 | Ga0495607_0000394 | |||
| 2504 | Ga0495607_0001084 | |||
| 2505 | Ga0495607_0001219 | |||
| 2506 | Ga0495607_0001489 | |||
| 2507 | Ga0495607_0003744 | |||
| 2508 | Ga0495607_0006485 | |||
| 2509 | Ga0495607_0013896 | |||
| 2510 | Ga0495607_0025057 | |||
| 2511 | Ga0495607_0033723 | |||
| 2512 | Ga0495607_0035928 | |||
| 2513 | Ga0495583_0002568 | |||
| 2514 | Ga0495583_0071013 | |||
| 2515 | Ga0495583_0084457 | |||
| 2516 | Ga0495606_0000081 | |||
| 2517 | Ga0495606_0000525 | |||
| 2518 | Ga0495606_0005029 | |||
| 2519 | Ga0495606_0005176 | |||
| 2520 | Ga0495606_0005506 | |||
| 2521 | Ga0495606_0009409 | |||
| 2522 | Ga0495606_0025173 | |||
| 2523 | Ga0495606_0028965 | |||
| 2524 | Ga0495606_0034505 | |||
| 2525 | Ga0495608_0073290 | |||
| 2526 | Ga0495610_0000198 | |||
| 2527 | Ga0495610_0000963 | |||
| 2528 | Ga0495610_0008811 | |||
| 2529 | Ga0495610_0057593 | |||
| 2530 | Ga0495610_0068188 | |||
| 2531 | Ga0495616_0002680 | |||
| 2532 | Ga0495616_0006038 | |||
| 2533 | Ga0495616_0008012 | |||
| 2534 | Ga0495616_0014248 | |||
| 2535 | Ga0495616_0024064 | |||
| 2536 | Ga0495616_0033012 | |||
| 2537 | Ga0495616_0037408 | |||
| 2538 | Ga0495620_0000035 | |||
| 2539 | Ga0495620_0031909 | |||
| 2540 | Ga0495628_0046359 | |||
| 2541 | Ga0495628_0064348 | |||
| 2542 | Ga0495630_0002568 | |||
| 2543 | Ga0495630_0006537 | |||
| 2544 | Ga0495630_0063736 | |||
| 2545 | Ga0495631_0000063 | |||
| 2546 | Ga0495631_0000122 | |||
| 2547 | Ga0495631_0001230 | |||
| 2548 | Ga0495631_0017620 | |||
| 2549 | Ga0495632_0000058 | |||
| 2550 | Ga0495632_0000395 | |||
| 2551 | Ga0495632_0000518 | |||
| 2552 | Ga0495632_0000908 | |||
| 2553 | Ga0495632_0000983 | |||
| 2554 | Ga0495632_0003288 | |||
| 2555 | Ga0495632_0005029 | |||
| 2556 | Ga0495632_0008756 | |||
| 2557 | Ga0495632_0014772 | |||
| 2558 | Ga0495632_0019335 | |||
| 2559 | Ga0495632_0027861 | |||
| 2560 | Ga0495637_0000113 | |||
| 2561 | Ga0495637_0000315 | |||
| 2562 | Ga0495637_0000473 | |||
| 2563 | Ga0495637_0001685 | |||
| 2564 | Ga0495637_0007094 | |||
| 2565 | Ga0495637_0023097 | |||
| 2566 | Ga0495637_0023593 | |||
| 2567 | Ga0495637_0046766 | |||
| 2568 | Ga0495643_0000044 | |||
| 2569 | Ga0495643_0000880 | |||
| 2570 | Ga0495643_0002862 | |||
| 2571 | Ga0495643_0003493 | |||
| 2572 | Ga0495643_0006532 | |||
| 2573 | Ga0495643_0018596 | |||
| 2574 | Ga0495643_0021770 | |||
| 2575 | Ga0495643_0070273 | |||
| 2576 | Ga0495644_0001098 | |||
| 2577 | Ga0495644_0021452 | |||
| 2578 | Ga0495648_0000241 | |||
| 2579 | Ga0495648_0002312 | |||
| 2580 | Ga0495648_0016866 | |||
| 2581 | Ga0495648_0017766 | |||
| 2582 | Ga0495648_0026949 | |||
| 2583 | Ga0495648_0031424 | |||
| 2584 | Ga0495663_0000394 | |||
| 2585 | Ga0495666_0000069 | |||
| 2586 | Ga0495666_0000092 | |||
| 2587 | Ga0495666_0002984 | |||
| 2588 | Ga0495666_0004604 | |||
| 2589 | Ga0495666_0005780 | |||
| 2590 | Ga0495666_0009363 | |||
| 2591 | Ga0495666_0038050 | |||
| 2592 | Ga0495666_0062478 | |||
| 2593 | Ga0495642_0000003 | |||
| 2594 | Ga0495642_0076951 | |||
| 2595 | Ga0495642_0090933 | |||
| 2596 | Ga0495652_0000784 | |||
| 2597 | Ga0495652_0034602 | |||
| 2598 | Ga0495654_0000799 | |||
| 2599 | Ga0495654_0001139 | |||
| 2600 | Ga0495654_0002457 | |||
| 2601 | Ga0495654_0002606 | |||
| 2602 | Ga0495654_0002865 | |||
| 2603 | Ga0495654_0017248 | |||
| 2604 | Ga0495654_0064580 | |||
| 2605 | Ga0495665_0002959 | |||
| 2606 | Ga0495665_0033485 | |||
| 2607 | Ga0495640_0016046 | |||
| 2608 | Ga0495586_0014575 | |||
| 2609 | Ga0495586_0042300 | |||
| 2610 | Ga0495587_0001318 | |||
| 2611 | Ga0495609_0000490 | |||
| 2612 | Ga0495597_0000216 | |||
| 2613 | Ga0495597_0000253 | |||
| 2614 | Ga0495597_0002240 | |||
| 2615 | Ga0495597_0002886 | |||
| 2616 | Ga0495597_0007992 | |||
| 2617 | Ga0495645_0011206 | |||
| 2618 | Ga0495645_0017315 | |||
| 2619 | Ga0495622_0006141 | |||
| 2620 | Ga0495622_0011238 | |||
| 2621 | Ga0495622_0019278 | |||
| 2622 | Ga0495633_0006427 | |||
| 2623 | Ga0495633_0010354 | |||
| 2624 | Ga0495633_0067193 | |||
| 2625 | Ga0495667_0059961 | |||
| 2626 | Ga0495656_0000104 | |||
| 2627 | Ga0495656_0003267 | |||
| 2628 | Ga0495668_0000140 | |||
| 2629 | Ga0495668_0001118 | |||
| 2630 | Ga0495668_0043700 | |||
| 2631 | Ga0495668_0080318 | |||
| 2632 | Ga0495634_0016136 | |||
| 2633 | Ga0495634_0239724 | |||
| 2634 | Ga0495611_0001324 | |||
| 2635 | Ga0495611_0025688 | |||
| 2636 | Ga0495625_0000056 | |||
| 2637 | Ga0495625_0000095 | |||
| 2638 | Ga0495625_0001135 | |||
| 2639 | Ga0495625_0001678 | |||
| 2640 | Ga0495625_0012504 | |||
| 2641 | Ga0495625_0014369 | |||
| 2642 | Ga0495625_0018924 | |||
| 2643 | Ga0495625_0031487 | |||
| 2644 | Ga0495625_0032310 | |||
| 2645 | Ga0495625_0059375 | |||
| 2646 | Ga0495659_0000116 | |||
| 2647 | Ga0495661_0000010 | |||
| 2648 | Ga0495661_0000049 | |||
| 2649 | Ga0495661_0000085 | |||
| 2650 | Ga0495661_0013544 | |||
| 2651 | Ga0495661_0017164 | |||
| 2652 | Ga0495661_0031376 | |||
| 2653 | Ga0495661_0060608 | |||
| 2654 | Ga0495588_0023820 | |||
| 2655 | Ga0495657_0059057 | |||
| 2656 | Ga0495599_0001037 | |||
| 2657 | Ga0495623_0001804 | |||
| 2658 | Ga0495623_0003834 | |||
| 2659 | Ga0495623_0030607 | |||
| 2660 | Ga0495623_0202603 | |||
| 2661 | Ga0495646_0000390 | |||
| 2662 | Ga0495669_0000263 | |||
| 2663 | Ga0495669_0002053 | |||
| 2664 | Ga0495613_0005666 | |||
| 2665 | Ga0495613_0109142 | |||
| 2666 | Ga0495613_0111465 | |||
| 2667 | Ga0495613_0128580 | |||
| 2668 | Ga0495613_0283440 | |||
| 2669 | Ga0495624_0011630 | |||
| 2670 | Ga0495624_0063046 | |||
| 2671 | Ga0495670_0008981 | |||
| 2672 | Ga0495670_0024495 | |||
| 2673 | Ga0495671_0001083 | |||
| 2674 | Ga0495671_0001728 | |||
| 2675 | Ga0495671_0001868 | |||
| 2676 | Ga0495671_0002038 | |||
| 2677 | Ga0495671_0005199 | |||
| 2678 | Ga0495671_0034418 | |||
| 2679 | Ga0495671_0103777 | |||
| 2680 | Ga0495649_0000039 | |||
| 2681 | Ga0495649_0000083 | |||
| 2682 | Ga0495649_0005034 | |||
| 2683 | Ga0495649_0013467 | |||
| 2684 | Ga0495649_0019649 | |||
| 2685 | Ga0495649_0022739 | |||
| 2686 | Ga0495649_0029073 | |||
| 2687 | Ga0495649_0066989 | |||
| 2688 | Ga0495589_0000549 | |||
| 2689 | Ga0495589_0005805 | |||
| 2690 | Ga0495589_0006501 | |||
| 2691 | Ga0495589_0025127 | |||
| 2692 | Ga0495589_0034424 | |||
| 2693 | Ga0495600_0001254 | |||
| 2694 | Ga0495600_0006329 | |||
| 2695 | Ga0495660_0000287 | |||
| 2696 | Ga0495660_0000388 | |||
| 2697 | Ga0495660_0000392 | |||
| 2698 | Ga0495660_0000454 | |||
| 2699 | Ga0495660_0000517 | |||
| 2700 | Ga0495660_0002257 | |||
| 2701 | Ga0495660_0020177 | |||
| 2702 | Ga0495660_0021034 | |||
| 2703 | Ga0495660_0026115 | |||
| 2704 | Ga0495660_0027303 | |||
| 2705 | Ga0495660_0045561 | |||
| 2706 | Ga0495660_0051545 | |||
| 2707 | Ga0495581_0016932 | |||
| 2708 | Ga0495581_0069012 | |||
| 2709 | Ga0495581_0103882 | |||
| 2710 | Ga0495581_0104411 | |||
| 2711 | Ga0495604_0001552 | |||
| 2712 | Ga0495604_0003658 | |||
| 2713 | Ga0495604_0034809 | |||
| 2714 | Ga0495604_0075169 | |||
| 2715 | Ga0495604_0108577 | |||
| 2716 | Ga0495636_0002723 | |||
| 2717 | Ga0495636_0005002 | |||
| 2718 | Ga0495636_0066331 | |||
| 2719 | Ga0495636_0083151 | |||
| 2720 | Ga0495674_0006435 | |||
| 2721 | Ga0495674_0007194 | |||
| 2722 | Ga0495674_0023541 | |||
| 2723 | Ga0495674_0070938 | |||
| 2724 | Ga0495672_0000006 | |||
| 2725 | Ga0495672_0000190 | |||
| 2726 | Ga0495672_0000213 | |||
| 2727 | Ga0495672_0000442 | |||
| 2728 | Ga0495672_0001989 | |||
| 2729 | Ga0495672_0002680 | |||
| 2730 | Ga0495672_0003117 | |||
| 2731 | Ga0495672_0007520 | |||
| 2732 | Ga0495672_0080258 | |||
| 2733 | Ga0495676_0000393 | |||
| 2734 | Ga0495676_0007316 | |||
| 2735 | Ga0495676_0010140 | |||
| 2736 | Ga0495676_0030011 | |||
| 2737 | Ga0495676_0036507 | |||
| 2738 | Ga0495676_0067182 | |||
| 2739 | Ga0495680_0000543 | |||
| 2740 | Ga0495680_0000608 | |||
| 2741 | Ga0495680_0000992 | |||
| 2742 | Ga0495680_0001350 | |||
| 2743 | Ga0495680_0002710 | |||
| 2744 | Ga0495680_0004753 | |||
| 2745 | Ga0495680_0046210 | |||
| 2746 | Ga0495683_0000245 | |||
| 2747 | Ga0495683_0000253 | |||
| 2748 | Ga0495683_0000416 | |||
| 2749 | Ga0495683_0003035 | |||
| 2750 | Ga0495683_0003458 | |||
| 2751 | Ga0495683_0014751 | |||
| 2752 | Ga0495683_0018717 | |||
| 2753 | Ga0495687_000308 | |||
| 2754 | Ga0495687_000389 | |||
| 2755 | Ga0495687_000495 | |||
| 2756 | Ga0495687_000724 | |||
| 2757 | Ga0495687_000845 | |||
| 2758 | Ga0495687_002228 | |||
| 2759 | Ga0495687_003776 | |||
| 2760 | Ga0495687_003894 | |||
| 2761 | Ga0495687_029428 | |||
| 2762 | Ga0495687_036191 | |||
| 2763 | Ga0495687_036601 | |||
| 2764 | Ga0495687_039781 | |||
| 2765 | Ga0495675_0000123 | |||
| 2766 | Ga0495675_0001415 | |||
| 2767 | Ga0495675_0001577 | |||
| 2768 | Ga0495675_0007815 | |||
| 2769 | Ga0495675_0024018 | |||
| 2770 | Ga0495675_0230393 | |||
| 2771 | Ga0495677_0000047 | |||
| 2772 | Ga0495679_000672 | |||
| 2773 | Ga0495679_021500 | |||
| 2774 | Ga0495685_000850 | |||
| 2775 | Ga0495685_007619 | |||
| 2776 | Ga0495685_041402 | |||
| 2777 | Ga0495673_0000025 | |||
| 2778 | Ga0495673_0000155 | |||
| 2779 | Ga0495673_0000178 | |||
| 2780 | Ga0495673_0000221 | |||
| 2781 | Ga0495673_0000922 | |||
| 2782 | Ga0495673_0001024 | |||
| 2783 | Ga0495673_0001183 | |||
| 2784 | Ga0495673_0002914 | |||
| 2785 | Ga0495673_0008706 | |||
| 2786 | Ga0495673_0016529 | |||
| 2787 | Ga0495673_0018987 | |||
| 2788 | Ga0495681_0000026 | |||
| 2789 | Ga0495681_0000198 | |||
| 2790 | Ga0495681_0002726 | |||
| 2791 | Ga0495681_0003820 | |||
| 2792 | Ga0495681_0004705 | |||
| 2793 | Ga0495681_0012414 | |||
| 2794 | Ga0495681_0014290 | |||
| 2795 | Ga0495684_0002582 | |||
| 2796 | Ga0495686_0098785 | |||
| 2797 | Ga0495593_0002886 | |||
| 2798 | Ga0495593_0004344 | |||
| 2799 | Ga0495602_0005230 | |||
| 2800 | Ga0495602_0006180 | |||
| 2801 | Ga0495614_0005431 | |||
| 2802 | Ga0495614_0005865 | |||
| 2803 | Ga0495614_0020059 | |||
| 2804 | Ga0495626_0000033 | |||
| 2805 | Ga0495626_0000132 | |||
| 2806 | Ga0495626_0000522 | |||
| 2807 | Ga0495626_0000528 | |||
| 2808 | Ga0495626_0000760 | |||
| 2809 | Ga0495626_0002344 | |||
| 2810 | Ga0495626_0005636 | |||
| 2811 | Ga0495626_0014908 | |||
| 2812 | Ga0496100_0008351 | |||
| 2813 | Ga0496100_0009196 | |||
| 2814 | Ga0496100_0063090 | |||
| 2815 | Ga0496100_0154789 | |||
| 2816 | Ga0496101_0006713 | |||
| 2817 | Ga0496101_0052905 | |||
| 2818 | Ga0496102_0000640 | |||
| 2819 | Ga0496102_0001362 | |||
| 2820 | Ga0496102_0004150 | |||
| 2821 | Ga0496102_0017432 | |||
| 2822 | Ga0496102_0046800 | |||
| 2823 | Ga0496102_0115949 | |||
| 2824 | Ga0496103_0000197 | |||
| 2825 | Ga0496103_0003193 | |||
| 2826 | Ga0496103_0004050 | |||
| 2827 | Ga0496103_0008193 | |||
| 2828 | Ga0496104_0016732 | |||
| 2829 | Ga0496104_0020106 | |||
| 2830 | Ga0496104_0034365 | |||
| 2831 | Ga0496104_0078834 | |||
| 2832 | Ga0496104_0276725 | |||
| 2833 | Ga0496105_0005813 | |||
| 2834 | Ga0496105_0043486 | |||
| 2835 | Ga0496105_0063948 | |||
| 2836 | Ga0496105_0128627 | |||
| 2837 | Ga0496106_0048984 | |||
| 2838 | Ga0496106_0100261 | |||
| 2839 | Ga0496106_0135009 | |||
| 2840 | Ga0496106_0142053 | |||
| 2841 | Ga0496108_0147251 | |||
| 2842 | Ga0496109_0128879 | |||
| 2843 | Ga0496109_0160594 | |||
| 2844 | Ga0496109_0207237 | |||
| 2845 | Ga0496109_0444592 | |||
| 2846 | Ga0496110_0004506 | |||
| 2847 | Ga0496110_0019584 | |||
| 2848 | Ga0496110_0042373 | |||
| 2849 | Ga0496110_0291118 | |||
| 2850 | Ga0496111_0049764 | |||
| 2851 | Ga0496111_0168151 | |||
| 2852 | Ga0496111_0295995 | |||
| 2853 | Ga0496112_0019536 | |||
| 2854 | Ga0496113_0000915 | |||
| 2855 | Ga0496113_0006120 | |||
| 2856 | Ga0496113_0019641 | |||
| 2857 | Ga0496113_0027368 | |||
| 2858 | Ga0496113_0072833 | |||
| 2859 | Ga0496114_0008420 | |||
| 2860 | Ga0496114_0051083 | |||
| 2861 | Ga0496114_0169692 | |||
| 2862 | Ga0496114_0327104 | |||
| 2863 | Ga0496116_0000014 | |||
| 2864 | Ga0496116_0001609 | |||
| 2865 | Ga0496117_0000467 | |||
| 2866 | Ga0496117_0008128 | |||
| 2867 | Ga0496118_0000459 | |||
| 2868 | Ga0496118_0003112 | |||
| 2869 | Ga0496118_0008803 | |||
| 2870 | Ga0496118_0029338 | |||
| 2871 | Ga0496118_0109992 | |||
| 2872 | Ga0496119_0000119 | |||
| 2873 | Ga0496119_0000346 | |||
| 2874 | Ga0496119_0051837 | |||
| 2875 | Ga0496120_0031371 | |||
| 2876 | Ga0496121_0000079 | |||
| 2877 | Ga0496121_0000382 | |||
| 2878 | Ga0496121_0000511 | |||
| 2879 | Ga0496121_0002155 | |||
| 2880 | Ga0496121_0009162 | |||
| 2881 | Ga0496122_0000310 | |||
| 2882 | Ga0496122_0000552 | |||
| 2883 | Ga0496122_0000662 | |||
| 2884 | Ga0496122_0001487 | |||
| 2885 | Ga0496122_0027018 | |||
| 2886 | Ga0496122_0085809 | |||
| 2887 | Ga0496123_0000478 | |||
| 2888 | Ga0496123_0000815 | |||
| 2889 | Ga0496123_0001031 | |||
| 2890 | Ga0496123_0007781 | |||
| 2891 | Ga0496123_0060403 | |||
| 2892 | Ga0496123_0126229 | |||
| 2893 | Ga0496124_0000499 | |||
| 2894 | Ga0496124_0000569 | |||
| 2895 | Ga0496124_0006777 | |||
| 2896 | Ga0496124_0008365 | |||
| 2897 | Ga0496124_0043380 | |||
| 2898 | Ga0496124_0278695 | |||
| 2899 | Ga0496125_0000122 | |||
| 2900 | Ga0496125_0000395 | |||
| 2901 | Ga0496125_0001860 | |||
| 2902 | Ga0496125_0003943 | |||
| 2903 | Ga0496125_0005275 | |||
| 2904 | Ga0496125_0008770 | |||
| 2905 | Ga0496125_0029798 | |||
| 2906 | Ga0496125_0202191 | |||
| 2907 | Ga0496126_0006618 | |||
| 2908 | Ga0496126_0020454 | |||
| 2909 | Ga0496126_0151825 | |||
| 2910 | Ga0496126_0186830 | |||
| 2911 | Ga0495678_001207 | |||
| 2912 | Ga0495678_002246 | |||
| 2913 | Ga0495678_003338 | |||
| 2914 | Ga0495678_009079 | |||
| 2915 | Ga0495678_015185 | |||
| 2916 | Ga0495678_015883 | |||
| 2917 | Ga0495678_036129 | |||
| 2918 | Ga0495678_052718 | |||
| 2919 | Ga0495678_073908 | |||
| 2920 | Ga0495682_0000039 | |||
| 2921 | Ga0495682_0000410 | |||
| 2922 | Ga0495682_0000749 | |||
| 2923 | Ga0495682_0000926 | |||
| 2924 | Ga0495682_0013509 | |||
| 2925 | Ga0501031_0010394 | |||
| 2926 | Ga0501031_0010803 | |||
| 2927 | Ga0501031_0013109 | |||
| 2928 | Ga0501031_0024216 | |||
| 2929 | Ga0501031_0092593 | |||
| 2930 | Ga0501031_0147415 | |||
| 2931 | Ga0501031_0168856 | |||
| 2932 | Ga0501032_0002092 | |||
| 2933 | Ga0501032_0003209 | |||
| 2934 | Ga0501032_0006722 | |||
| 2935 | Ga0501032_0010214 | |||
| 2936 | Ga0501032_0014996 | |||
| 2937 | Ga0501032_0093180 | |||
| 2938 | Ga0501033_0001171 | |||
| 2939 | Ga0501033_0002171 | |||
| 2940 | Ga0501033_0022401 | |||
| 2941 | Ga0501033_0042082 | |||
| 2942 | Ga0501033_0162376 | |||
| 2943 | Ga0501034_0000106 | |||
| 2944 | Ga0501034_0008467 | |||
| 2945 | Ga0501034_0020595 | |||
| 2946 | Ga0501034_0055155 | |||
| 2947 | Ga0501034_0121765 | |||
| 2948 | Ga0501036_0003079 | |||
| 2949 | Ga0501036_0012260 | |||
| 2950 | Ga0501036_0021057 | |||
| 2951 | Ga0501036_0044297 | |||
| 2952 | Ga0501036_0075491 | |||
| 2953 | Ga0501036_0188381 | |||
| 2954 | Ga0501037_0007407 | |||
| 2955 | Ga0501037_0010386 | |||
| 2956 | Ga0501037_0019972 | |||
| 2957 | Ga0501037_0110019 | |||
| 2958 | Ga0501037_0122942 | |||
| 2959 | Ga0501037_0253784 | |||
| 2960 | Ga0501037_0347067 | |||
| 2961 | Ga0501038_0002634 | |||
| 2962 | Ga0501038_0003415 | |||
| 2963 | Ga0501038_0010728 | |||
| 2964 | Ga0501038_0014617 | |||
| 2965 | Ga0501038_0018815 | |||
| 2966 | Ga0501038_0072181 | |||
| 2967 | Ga0501038_0094812 | |||
| 2968 | Ga0501038_0196611 | |||
| 2969 | Ga0501038_0243660 | |||
| 2970 | Ga0501038_0261647 | |||
| 2971 | Ga0501039_0000282 | |||
| 2972 | Ga0501039_0002340 | |||
| 2973 | Ga0501039_0024041 | |||
| 2974 | Ga0501039_0109677 | |||
| 2975 | Ga0501040_0004628 | |||
| 2976 | Ga0501040_0011583 | |||
| 2977 | Ga0501040_0116572 | |||
| 2978 | Ga0501041_0020186 | |||
| 2979 | Ga0501041_0027866 | |||
| 2980 | Ga0501042_0017244 | |||
| 2981 | Ga0501042_0163828 | |||
| 2982 | Ga0501043_0011878 | |||
| 2983 | Ga0501043_0015353 | |||
| 2984 | Ga0501043_0027415 | |||
| 2985 | Ga0501043_0045241 | |||
| 2986 | Ga0501043_0106392 | |||
| 2987 | Ga0501043_0198016 | |||
| 2988 | Ga0501046_0001006 | |||
| 2989 | Ga0501046_0007593 | |||
| 2990 | Ga0501046_0031213 | |||
| 2991 | Ga0501046_0155916 | |||
| 2992 | Ga0501047_0000036 | |||
| 2993 | Ga0501047_0003625 | |||
| 2994 | Ga0501047_0009898 | |||
| 2995 | Ga0501047_0031744 | |||
| 2996 | Ga0501047_0040722 | |||
| 2997 | Ga0501047_0075216 | |||
| 2998 | Ga0501047_0288475 | |||
| 2999 | Ga0501047_0295781 | |||
| 3000 | Ga0501048_0019782 | |||
| 3001 | Ga0501048_0053301 | |||
| 3002 | Ga0501048_0240324 | |||
| 3003 | Ga0501067_0001886 | |||
| 3004 | Ga0501068_0007938 | |||
| 3005 | Ga0501068_0032522 | |||
| 3006 | Ga0501069_0003811 | |||
| 3007 | Ga0501070_0038723 | |||
| 3008 | Ga0501071_0024811 | |||
| 3009 | Ga0501071_0071954 | |||
| 3010 | Ga0501072_0024579 | |||
| 3011 | Ga0501073_0003630 | |||
| 3012 | Ga0501073_0011234 | |||
| 3013 | Ga0501073_0036317 | |||
| 3014 | Ga0501073_0172633 | |||
| 3015 | Ga0501073_0239640 | |||
| 3016 | Ga0501073_0240221 | |||
| 3017 | Ga0501074_0002288 | |||
| 3018 | Ga0501074_0005080 | |||
| 3019 | Ga0501074_0089514 | |||
| 3020 | Ga0501075_0020312 | |||
| 3021 | Ga0501076_0022686 | |||
| 3022 | Ga0501076_0112372 | |||
| 3023 | Ga0501076_0370151 | |||
| 3024 | Ga0501243_001464 | |||
| 3025 | Ga0501257_001732 | |||
| 3026 | Ga0501079_0020833 | |||
| 3027 | Ga0501080_0016873 | |||
| 3028 | Ga0501080_0071579 | |||
| 3029 | Ga0501080_0203779 | |||
| 3030 | Ga0501081_0025728 | |||
| 3031 | Ga0501081_0252980 | |||
| 3032 | Ga0501083_0003958 | |||
| 3033 | Ga0501083_0016958 | |||
| 3034 | Ga0501241_000061 | |||
| 3035 | Ga0501269_001275 | |||
| 3036 | Ga0501280_001356 | |||
| 3037 | Ga0501035_0001192 | |||
| 3038 | Ga0501035_0003108 | |||
| 3039 | Ga0501035_0028985 | |||
| 3040 | Ga0501035_0039087 | |||
| 3041 | Ga0501035_0040698 | |||
| 3042 | Ga0501035_0373541 | |||
| 3043 | Ga0501044_0000915 | |||
| 3044 | Ga0501044_0009480 | |||
| 3045 | Ga0501044_0025273 | |||
| 3046 | Ga0501044_0055998 | |||
| 3047 | Ga0501044_0075136 | |||
| 3048 | Ga0501044_0093884 | |||
| 3049 | Ga0501044_0107928 | |||
| 3050 | Ga0501044_0139614 | |||
| 3051 | Ga0501044_0215945 | |||
| 3052 | Ga0501044_0227518 | |||
| 3053 | Ga0501044_0236557 | |||
| 3054 | Ga0501044_0240447 | |||
| 3055 | Ga0501044_0428002 | |||
| 3056 | Ga0501044_0487492 | |||
| 3057 | Ga0501045_0035056 | |||
| 3058 | Ga0501045_0081085 | |||
| 3059 | Ga0501045_0160260 | |||
| 3060 | nmdc:mga03683_12240_c1 | |||
| 3061 | nmdc:mga03683_174_c1 | |||
| 3062 | nmdc:mga03683_9790_c1 | |||
| 3063 | nmdc:mga03n38_11270_c1 | |||
| 3064 | nmdc:mga03n38_155138_c1 | |||
| 3065 | nmdc:mga03n38_265_c1 | |||
| 3066 | nmdc:mga00v17_11359_c1 | |||
| 3067 | nmdc:mga00v17_141113_c1 | |||
| 3068 | nmdc:mga00v17_195_c1 | |||
| 3069 | nmdc:mga00v17_2323_c1 | |||
| 3070 | nmdc:mga00v17_37683_c1 | |||
| 3071 | nmdc:mga00v17_6863_c1 | |||
| 3072 | nmdc:mga00v17_6918_c1 | |||
| 3073 | nmdc:mga00v17_85329_c1 | |||
| 3074 | nmdc:mga0yw44_1997_c1 | |||
| 3075 | nmdc:mga0yw44_21739_c1 | |||
| 3076 | nmdc:mga0yw44_224_c1 | |||
| 3077 | nmdc:mga0yw44_32929_c1 | |||
| 3078 | nmdc:mga0yw44_48330_c1 | |||
| 3079 | nmdc:mga0k408_2031_c1 | |||
| 3080 | nmdc:mga0k408_29312_c1 | |||
| 3081 | nmdc:mga0k408_3752_c1 | |||
| 3082 | nmdc:mga06z11_23022_c1 | |||
| 3083 | nmdc:mga06z11_27245_c1 | |||
| 3084 | nmdc:mga06z11_566_c1 | |||
| 3085 | nmdc:mga06z11_66994_c1 | |||
| 3086 | nmdc:mga04h51_16705_c1 | |||
| 3087 | nmdc:mga07m45_1348_c1 | |||
| 3088 | nmdc:mga07m45_28397_c1 | |||
| 3089 | nmdc:mga07m45_4378_c1 | |||
| 3090 | nmdc:mga0qj67_247037_c1 | |||
| 3091 | nmdc:mga0n895_7312_c1 | |||
| 3092 | nmdc:mga0rr50_23734_c1 | |||
| 3093 | nmdc:mga08x19_16585_c1 | |||
| 3094 | nmdc:mga0sz30_10786_c1 | |||
| 3095 | nmdc:mga0sz30_46130_c1 | |||
| 3096 | Ga0495601_0000136 | |||
| 3097 | Ga0495601_0000631 | |||
| 3098 | Ga0495601_0039665 | |||
| 3099 | Ga0495601_0107814 | |||
| 3100 | Ga0495612_0009485 | |||
| 3101 | Ga0500610_0000020 | |||
| 3102 | Ga0495655_0005623 | |||
| 3103 | Ga0495655_0024373 | |||
| 3104 | Ga0500643_000006 | |||
| 3105 | Ga0500643_000288 | |||
| 3106 | Ga0500643_000806 | |||
| 3107 | Ga0500643_047016 | |||
| 3108 | Ga0500644_0024613 | |||
| 3109 | Ga0500646_0000243 | |||
| 3110 | Ga0500583_0004080 | |||
| 3111 | Ga0500660_058423 | |||
| 3112 | Ga0500553_077520 | |||
| 3113 | Ga0500556_0000694 | |||
| 3114 | Ga0500556_0001563 | |||
| 3115 | Ga0500562_000274 | |||
| 3116 | Ga0500593_000390 | |||
| 3117 | Ga0500628_001979 | |||
| 3118 | Ga0500658_0011791 | |||
| 3119 | Ga0500559_0000539 | |||
| 3120 | Ga0500559_0088021 | |||
| 3121 | Ga0500561_0004018 | |||
| 3122 | Ga0500579_047035 | |||
| 3123 | Ga0500588_0017800 | |||
| 3124 | Ga0500588_0029193 | |||
| 3125 | Ga0500600_0036492 | |||
| 3126 | Ga0500616_0000090 | |||
| 3127 | Ga0500616_0000366 | |||
| 3128 | Ga0500616_0006429 | |||
| 3129 | Ga0500624_003000 | |||
| 3130 | Ga0500627_0097501 | |||
| 3131 | Ga0500633_0003880 | |||
| 3132 | Ga0500638_000052 | |||
| 3133 | Ga0500636_0053914 | |||
| 3134 | Ga0500645_013100 | |||
| 3135 | Ga0500656_000664 | |||
| 3136 | Ga0500565_000835 | |||
| 3137 | Ga0500587_001296 | |||
| 3138 | Ga0501084_0003841 | |||
| 3139 | Ga0501084_0006423 | |||
| 3140 | Ga0501084_0153371 | |||
| 3141 | Ga0501082_0007219 | |||
| 3142 | Ga0501082_0077527 | |||
| 3143 | Ga0466962_0002590 | |||
| 3144 | Ga0466962_0003058 | |||
| 3145 | Ga0466962_0065263 | |||
| 3146 | Ga0466962_0103894 | |||
| 3147 | Ga0530510_0034331 | |||
| 3148 | 2506866591 | |||
| 3149 | 2508676500 | |||
| 3150 | 2511265326 | |||
| 3151 | 2511271868 | |||
| 3152 | 2511290386 | |||
| 3153 | 2511300026 | |||
| 3154 | 2511314516 | |||
| 3155 | 2511322094 | |||
| 3156 | 2511322662 | |||
| 3157 | 2511331900 | |||
| 3158 | 2511347854 | |||
| 3159 | 2511348960 | |||
| 3160 | 2511354147 | |||
| 3161 | 2513962115 | |||
| 3162 | 2515687836 | |||
| 3163 | 2516021844 | |||
| 3164 | 2517763276 | |||
| 3165 | 2524613814 | |||
| 3166 | 2547374727 | |||
| 3167 | 2548697399 | |||
| 3168 | 2559431727 | |||
| 3169 | 2563056847 | |||
| 3170 | 2563057937 | |||
| 3171 | 2566997100 | |||
| 3172 | 2585312308 | |||
| 3173 | 2588109337 | |||
| 3174 | 2599408945 | |||
| 3175 | 2600023000 | |||
| 3176 | 2600076368 | |||
| 3177 | 2600815086 | |||
| 3178 | 2601522538 | |||
| 3179 | 2601527565 | |||
| 3180 | 2601614396 | |||
| 3181 | 2601619116 | |||
| 3182 | 2601642264 | |||
| 3183 | 2601647126 | |||
| 3184 | 2601652543 | |||
| 3185 | 2601657869 | |||
| 3186 | 2601662087 | |||
| 3187 | 2601695045 | |||
| 3188 | 2601699717 | |||
| 3189 | 2601706388 | |||
| 3190 | 2601710694 | |||
| 3191 | 2601715708 | |||
| 3192 | 2601720068 | |||
| 3193 | 2601726114 | |||
| 3194 | 2601730655 | |||
| 3195 | 2601735671 | |||
| 3196 | 2601740939 | |||
| 3197 | 2601750869 | |||
| 3198 | 2602018123 | |||
| 3199 | 2603659449 | |||
| 3200 | 2603664724 | |||
| 3201 | 2603838047 | |||
| 3202 | 2603843125 | |||
| 3203 | 2603848198 | |||
| 3204 | 2603853273 | |||
| 3205 | 2603871324 | |||
| 3206 | 2603876255 | |||
| 3207 | 2606048517 | |||
| 3208 | 2606069151 | |||
| 3209 | 2606144973 | |||
| 3210 | 2606175918 | |||
| 3211 | 2616900590 | |||
| 3212 | 2621299508 | |||
| 3213 | 2621300473 | |||
| 3214 | 2623498752 | |||
| 3215 | 2623500936 | |||
| 3216 | 2624479896 | |||
| 3217 | 2637224820 | |||
| 3218 | 2643766676 | |||
| 3219 | 2643811030 | |||
| 3220 | 2643824625 | |||
| 3221 | 2643846924 | |||
| 3222 | 2643900950 | |||
| 3223 | 2643999425 | |||
| 3224 | 2644032370 | |||
| 3225 | 2644038347 | |||
| 3226 | 2644092067 | |||
| 3227 | 2644158927 | |||
| 3228 | 2644172031 | |||
| 3229 | 2644278126 | |||
| 3230 | 2644321870 | |||
| 3231 | 2644407096 | |||
| 3232 | 2644489758 | |||
| 3233 | 2644535877 | |||
| 3234 | 2676200598 | |||
| 3235 | 2676406085 | |||
| 3236 | 2686538252 | |||
| 3237 | 2686539124 | |||
| 3238 | 2689956911 | |||
| 3239 | 2689994600 | |||
| 3240 | 2689996405 | |||
| 3241 | 2713473360 | |||
| 3242 | 2713481141 | |||
| 3243 | 2723640571 | |||
| 3244 | 2723848337 | |||
| 3245 | 2738673137 | |||
| 3246 | 2738694628 | |||
| 3247 | 2738751530 | |||
| 3248 | 2738860571 | |||
| 3249 | 2738886481 | |||
| 3250 | 2738893014 | |||
| 3251 | 2739205899 | |||
| 3252 | 2739236131 | |||
| 3253 | 2739257939 | |||
| 3254 | 2739261348 | |||
| 3255 | 2739332531 | |||
| 3256 | 2739363401 | |||
| 3257 | 2744957679 | |||
| 3258 | 2753040036 | |||
| 3259 | 2753328546 | |||
| 3260 | 2753568354 | |||
| 3261 | 2753764942 | |||
| 3262 | 2774396166 | |||
| 3263 | 2774845176 | |||
| 3264 | 2774903118 | |||
| 3265 | 2775658984 | |||
| 3266 | 2776376818 | |||
| 3267 | 2777022155 | |||
| 3268 | 2785338952 | |||
| 3269 | 2786666593 | |||
| 3270 | 2786675103 | |||
| 3271 | 2792837774 | |||
| 3272 | 2793080200 | |||
| 3273 | 2808848596 | |||
| 3274 | 2808899371 | |||
| 3275 | 2808900092 | |||
| 3276 | 2809145039 | |||
| 3277 | 2809197803 | |||
| 3278 | 2812330890 | |||
| 3279 | 2812347706 | |||
| 3280 | 2812358301 | |||
| 3281 | 2817490452 | |||
| 3282 | 2817490871 | |||
| 3283 | 2819689309 | |||
| 3284 | 2834645108 | |||
| 3285 | 2843693297 | |||
| 3286 | 2852108231 | |||
| 3287 | 2855387397 | |||
| 3288 | 2858692522 | |||
| 3289 | 2862385394 | |||
| 3290 | 2862385739 | |||
| 3291 | 2862575659 | |||
| 3292 | 2863072772 | |||
| 3293 | 2867347023 | |||
| 3294 | 2870628179 | |||
| 3295 | 2873315454 | |||
| 3296 | 2874611376 | |||
| 3297 | 2877684670 | |||
| 3298 | 2881104882 | |||
| 3299 | 2885267480 | |||
| 3300 | 2889304499 | |||
| 3301 | 2891052136 | |||
| 3302 | 2891968884 | |||
| 3303 | 2895428621 | |||
| 3304 | 2895887647 | |||
| 3305 | 2900642698 | |||
| 3306 | 2902794389 | |||
| 3307 | 2902838784 | |||
| 3308 | 2904514292 | |||
| 3309 | 2904536690 | |||
| 3310 | 2904545693 | |||
| 3311 | 2904549507 | |||
| 3312 | 2904619292 | |||
| 3313 | 2904766414 | |||
| 3314 | 2904770311 | |||
| 3315 | 2904770426 | |||
| 3316 | 2904772477 | |||
| 3317 | 2908816357 | |||
| 3318 | 2912728671 | |||
| 3319 | 2915358969 | |||
| 3320 | 2919054981 | |||
| 3321 | 2919140844 | |||
| 3322 | 2919156355 | |||
| 3323 | 2919421155 | |||
| 3324 | 2919422313 | |||
| 3325 | 2919422327 | |||
| 3326 | 2919433087 | |||
| 3327 | 2919435420 | |||
| 3328 | 2919435434 | |||
| 3329 | 2919720169 | |||
| 3330 | 2922555139 | |||
| 3331 | 2928143647 | |||
| 3332 | 2929168348 | |||
| 3333 | 2929214030 | |||
| 3334 | 2929217851 | |||
| 3335 | 2935393775 | |||
| 3336 | 2935410066 | |||
| 3337 | 2939575007 | |||
| 3338 | 2939674789 | |||
| 3339 | 2939745103 | |||
| 3340 | 2941489122 | |||
| 3341 | 2945914585 | |||
| 3342 | 2945990014 | |||
| 3343 | 2946073377 | |||
| 3344 | 2954680273 | |||
| 3345 | 2954681684 | |||
| 3346 | 2954683878 | |||
| 3347 | 2954711922 | |||
| 3348 | 2954721856 | |||
| 3349 | 2954739993 | |||
| 3350 | 2954740752 | |||
| 3351 | 2954758811 | |||
| 3352 | 2954759762 | |||
| 3353 | 2969081800 | |||
| 3354 | 2984564225 | |||
| 3355 | 2984580488 | |||
| 3356 | 2984596960 | |||
| 3357 | 2990067775 | |||
| 3358 | 2990258180 | |||
| 3359 | 3003002588 | |||
| 3360 | 3006494426 | |||
| 3361 | 3007719907 | |||
| 3362 | 642595293 | |||
| 3363 | 8002787277 | |||
| 3364 | 8004212912 | |||
| 3365 | 8006989693 | |||
| 3366 | 8008559210 | |||
| 3367 | 8008560778 | |||
| 3368 | 8015691598 | |||
| 3369 | 8033688493 | |||
| 3370 | 8047712035 | |||
| 3371 | 8048364369 | |||
| 3372 | 8048371700 | |||
| 3373 | 8048380633 | |||
| 3374 | 8048408705 | |||
| 3375 | 8048747391 | |||
| 3376 | 8054002910 | |||
| 3377 | 8054609905 | |||
| 3378 | 8055883933 | |||
| 3379 | 8056174141 | |||
| 3380 | 8056174155 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1nvm-assembly1.cif.gz_A | crystal structure of a bifunctional aldolase-dehydrogenase : sequestering a reactive and volatile intermediate | 0.9925 | 3 | 335 |
| 4lrs-assembly1.cif.gz_A | crystal and solution structures of the bifunctional enzyme (aldolase/aldehyde dehydrogenase) from thermomonospora curvata, reveal a cofactor-binding domain motion during nad+ and coa accommodation whithin the shared cofactor-binding site | 0.9845 | 3 | 337 |
| 4jn6-assembly1.cif.gz_A | crystal structure of the aldolase-dehydrogenase complex from mycobacterium tuberculosis hrv37 | 0.9794 | 1 | 338 |
| 4jn6-assembly1.cif.gz_A | crystal structure of the aldolase-dehydrogenase complex from mycobacterium tuberculosis hrv37 | 0.9766 | 1 | 338 |
| 4lrs-assembly1.cif.gz_A | crystal and solution structures of the bifunctional enzyme (aldolase/aldehyde dehydrogenase) from thermomonospora curvata, reveal a cofactor-binding domain motion during nad+ and coa accommodation whithin the shared cofactor-binding site | 0.9759 | 3 | 337 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1nvmE01 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9965 | 3 | 265 | 3.20.20.70 |
| 1nvmG02 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; | 0.9916 | 273 | 335 | 1.10.8.60 |
| af_P51020_275_337_1.10.8.60 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; | 0.9909 | 273 | 334 | 1.10.8.60 |
| 1nvmE02 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; | 0.9903 | 273 | 333 | 1.10.8.60 |
| af_O06334_8_264_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9769 | 3 | 260 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6P1I588-F1-model_v4 | 4-hydroxy-2-oxovalerate aldolase (EC 4.1.3.39) | 1.003 | 84 | 233 |
GO:0003852
GO:0008701 GO:0009098 |
| AF-A0A4Q2QN03-F1-model_v4 | 4-hydroxy-2-oxovalerate aldolase | 1.003 | 82 | 209 |
GO:0003852
GO:0009098 |
| AF-A0A6B3D2C3-F1-model_v4 | 4-hydroxy-2-oxovalerate aldolase | 1.003 | 62 | 163 |
GO:0003824
|
| AF-A0A3D9TR18-F1-model_v4 | deleted | 1.002 | 136 | 275 |
|
| AF-A0A6M1I1J8-F1-model_v4 | deleted | 1.002 | 99 | 228 |
|