F495355

General Info

Members Datasets Scaffolds Average Seq Length
1691 813 3382 99

Family's Representative Sequence

Representative Sequence 3300046809|Ga0495600_0000832|Ga0495600_0000832_5187_5477
Length 96
Sequence MNLSPREKDKLLISMAAIVARRRLDRGVKLNHPEAIAIISDFILEGRTVAELMQSGAQVLSRDQVMPGIPEMIHDIQVEATFPDGTKLVTVHEPIR

Samples

Sample ID Description Type Environment
1 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
2 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
3 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
8 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
9 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
10 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
11 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
12 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
13 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
14 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
15 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
16 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
17 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
18 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
19 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
20 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
21 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
22 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
23 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
24 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
25 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
26 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
27 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
28 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
29 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
30 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
31 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
32 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
35 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
38 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
39 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
40 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
41 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
42 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
43 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
44 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
45 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
46 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
47 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
48 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
49 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
50 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
51 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
52 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
53 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
54 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
55 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
56 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
57 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
58 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
59 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
60 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
61 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
62 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
63 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
64 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
65 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
66 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
67 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
68 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
69 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
70 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
71 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
72 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
73 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
74 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
75 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
76 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
77 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
78 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
79 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
80 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
81 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
82 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
83 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
84 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
85 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
86 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
87 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
88 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
89 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
90 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
91 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
92 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
93 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
94 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
95 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
97 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
98 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
99 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
100 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
101 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
102 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
103 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
104 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
105 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
106 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
107 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
108 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
109 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
110 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
111 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
112 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
113 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
114 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
115 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
116 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
117 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
118 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
119 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
120 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
121 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
122 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
123 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
124 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
125 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
126 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
127 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
128 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
129 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
130 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
131 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
132 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
133 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
134 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
135 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
136 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
137 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
138 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
139 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
140 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
141 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
142 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
143 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
144 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
145 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
146 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
147 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
148 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
149 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
150 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
151 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
152 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
153 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
154 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
155 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
156 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
157 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
159 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
160 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
161 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
162 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
163 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
164 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
165 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
166 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
167 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
168 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
169 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
170 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
171 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
172 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
173 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
174 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
175 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
176 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
177 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
235 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
236 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
237 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
238 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
239 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
241 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
242 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
246 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
247 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
248 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
249 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
250 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
251 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
252 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
253 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
254 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
255 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
256 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
257 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
258 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
259 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
260 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
261 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
262 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
263 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
264 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
265 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
266 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
267 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
268 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
269 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
270 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
271 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
272 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
273 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
274 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
275 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
276 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
277 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
278 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
279 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
280 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
281 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
282 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
283 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
284 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
285 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
286 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
287 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
288 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
289 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
290 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
291 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
292 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
293 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
294 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
295 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
296 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
297 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
298 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
299 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
300 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
301 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
302 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
303 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
304 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
305 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
306 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
307 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
308 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
309 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
310 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
311 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
312 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
313 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
314 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
315 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
316 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
317 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
318 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
319 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
320 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
321 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
322 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
323 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
324 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
325 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
326 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
327 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
328 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
329 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
330 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
331 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
332 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
333 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
334 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
335 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
336 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
337 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
338 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
339 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
340 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
341 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
342 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
343 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
344 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
345 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
346 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
347 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
348 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
349 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
350 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
351 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
352 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
353 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
354 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
355 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
356 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
357 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
358 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
359 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
360 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
361 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
362 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
363 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
364 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
365 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
366 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
367 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
368 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
369 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
370 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
371 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
372 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
373 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
374 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
375 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
376 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
377 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
378 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
379 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
380 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
381 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
382 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
383 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
384 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
385 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
386 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
387 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
388 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
389 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
390 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
391 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
392 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
393 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
394 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
395 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
396 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
397 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
398 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
399 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
400 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
401 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
402 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
403 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
404 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
405 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
406 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
407 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
408 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
409 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
410 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
411 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
412 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
413 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
414 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
415 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
416 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
417 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
418 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
419 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
420 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
421 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
422 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
423 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
424 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
425 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
426 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
427 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
428 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
429 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
430 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
431 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
432 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
433 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
434 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
435 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
436 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
437 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
438 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
439 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
440 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
441 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
442 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
443 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
444 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
445 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
446 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
447 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
448 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
449 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
450 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
451 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
452 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
453 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
454 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
455 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
456 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
457 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
458 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
459 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
460 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
461 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
462 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
463 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
464 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
465 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
466 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
467 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
468 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
469 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
470 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
471 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
472 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
473 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
474 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
475 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
476 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
477 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
478 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
479 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
480 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
481 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
482 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
483 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
484 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
485 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
486 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
487 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
488 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
489 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
490 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
491 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
492 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
493 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
494 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
495 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
496 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
497 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
498 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
499 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
500 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
501 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
502 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
503 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
504 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
505 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
506 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
507 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
508 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
509 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
510 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
511 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
512 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
513 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
514 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
515 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
516 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
517 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
518 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
519 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
520 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
521 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
522 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
523 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
524 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
525 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
526 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
527 3300053114 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 endosphere Metagenome Endosphere
528 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
529 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
530 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
531 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
532 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
533 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
534 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
535 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
536 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
537 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
538 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
539 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
540 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
541 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
542 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
543 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
544 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
545 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
546 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
547 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
548 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
549 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
550 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
551 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
552 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
553 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
554 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
555 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
556 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
557 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
558 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
559 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
560 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
561 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
562 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
563 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
564 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
565 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
566 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
567 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
568 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
569 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
570 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
571 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
572 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
573 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
574 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
575 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
576 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
577 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
578 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
579 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
580 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
581 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
582 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
583 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
584 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
585 2516143018 Ensifer sp. BR816 Isolate Nodule
586 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
587 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
588 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
589 2534681786 Brucella suis 92/29 Isolate Unclassified
590 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
591 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
592 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
593 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
594 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
595 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
596 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
597 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
598 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
599 2643221557 Ensifer sp. Root558 Isolate Unclassified
600 2643221607 Rhizobium sp. Root73 Isolate Unclassified
601 2643221610 Ensifer sp. Root74 Isolate Unclassified
602 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
603 2643221659 Ensifer sp. Root127 Isolate Unclassified
604 2643221668 Ensifer sp. Root423 Isolate Unclassified
605 2643221675 Ensifer sp. Root1298 Isolate Unclassified
606 2643221680 Ensifer sp. Root1312 Isolate Unclassified
607 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
608 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
609 2643221698 Ensifer sp. Root142 Isolate Unclassified
610 2643221723 Ensifer sp. Root278 Isolate Unclassified
611 2643221726 Ensifer sp. Root954 Isolate Unclassified
612 2713897090 Paracoccus sphaerophysae HAMBI 3106 Isolate Nodule
613 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
614 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
615 2751185800 Brucella pituitosa AA2 Isolate Unclassified
616 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
617 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
618 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
619 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
620 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
621 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
622 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
623 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
624 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
625 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
626 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
627 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
628 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
629 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
630 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
631 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
632 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
633 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
634 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
635 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
636 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
637 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
638 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
639 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
640 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
641 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
642 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
643 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
644 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
645 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
646 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
647 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
648 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
649 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
650 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
651 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
652 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
653 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
654 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
655 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
656 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
657 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
658 2842775625 Roseomonas sp. R-71825 Isolate Unclassified
659 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
660 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
661 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
662 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
663 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
664 2854681122 Luteovulum sphaeroides SCJ Isolate Unclassified
665 2854911287 Brucella lupini LUP21 Isolate Unclassified
666 2855020534 Paracoccus endophyticus SYSUP0003 Isolate Stem Tuber
667 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
668 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
669 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
670 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
671 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
672 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
673 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
674 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
675 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
676 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
677 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
678 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
679 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
680 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
681 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
682 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
683 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
684 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
685 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
686 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
687 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
688 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
689 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
690 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
691 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
692 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
693 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
694 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
695 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
696 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
697 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
698 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
699 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
700 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
701 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
702 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
703 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
704 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
705 2922368715
706 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
707 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
708 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
709 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
710 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
711 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
712 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
713 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
714 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
715 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
716 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
717 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
718 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
719 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
720 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
721 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
722 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
723 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
724 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
725 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
726 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
727 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
728 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
729 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
730 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
731 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
732 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
733 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
734 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
735 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
736 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
737 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
738 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
739 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
740 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
741 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
742 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
743 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
744 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
745 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
746 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
747 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
748 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
749 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
750 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
751 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
752 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
753 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
754 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
755 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
756 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
757 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
758 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
759 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
760 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
761 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
762 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
763 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
764 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
765 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
766 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
767 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
768 3000017691 Rhodobacteraceae bacterium GH2-2 Isolate Rhizosphere
769 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
770 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
771 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
772 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
773 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
774 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
775 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
776 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
777 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
778 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
779 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
780 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
781 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
782 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
783 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
784 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
785 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
786 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
787 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
788 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
789 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
790 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
791 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
792 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
793 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
794 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
795 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
796 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
797 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
798 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
799 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
800 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
801 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
802 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
803 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
804 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
805 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
806 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
807 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
808 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
809 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
810 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified
811 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
812 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
813 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 85.33
Metatranscriptomes 0.24
Isolates 14.44

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.55
Nodule 9.34
Rhizoplane 4.38
Rhizosphere 58.84
Stem 0
Stem Tuber 0.06
Unclassified 0.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495600_0000832 3300046809 Bacteria 16425
2 RicEn_FSXC74732_b1 2010549000 Bacteria 829
3 JGI25155J39150_1000066 3300002704 Bacteria 69429
4 JGI25156J39149_1000075 3300002705 Bacteria 76505
5 JGI25154J39366_1000075 3300002738 Bacteria 91249
6 JGI25157J39369_1000051 3300002741 Bacteria 111770
7 JGI25157J39369_1000077 3300002741 Bacteria 86251
8 JGI25159J45721_1000008 3300002987 Bacteria 172667
9 JGI25151J46595_10012676 3300003187 Bacteria 3826
10 JGI25406J46586_10000225 3300003203 Bacteria 24945
11 JGI25406J46586_10063975 3300003203 Bacteria 1177
12 JGI25165J46597_1028180 3300003214 Bacteria 725
13 JGI25153J46596_10000082 3300003215 Bacteria 112797
14 JGI25153J46596_10000595 3300003215 Bacteria 22097
15 JGI25153J46596_10000982 3300003215 Bacteria 17303
16 JGI25153J46596_10022500 3300003215 Bacteria 2321
17 JGI25153J46596_10039071 3300003215 Bacteria 1487
18 JGI25153J46596_10046251 3300003215 Bacteria 1291
19 JGI25160J50197_1000033 3300003354 Bacteria 172667
20 JGI25160J50197_1002442 3300003354 Bacteria 8653
21 JGI25160J50197_1009191 3300003354 Bacteria 3689
22 JGI25161J50226_1001354 3300003374 Bacteria 7530
23 Ga0006562J51391_1011312 3300003578 Bacteria 3280
24 Ga0006562J51391_1011313 3300003578 Bacteria 650
25 JGI25404J52841_10026631 3300003659 Bacteria 1244
26 JGI25404J52841_10107003 3300003659 Unclassified 587
27 Ga0055542_1042663 3300003762 Bacteria 529
28 Ga0055526_1005670 3300003771 Bacteria 7088
29 Ga0055524_1002859 3300003775 Bacteria 8655
30 Ga0055536_1039786 3300003781 Bacteria 1125
31 Ga0055531_10011991 3300003794 Bacteria 4118
32 Ga0055531_10017995 3300003794 Bacteria 2946
33 Ga0055531_10028449 3300003794 Bacteria 1927
34 Ga0055543_1000026 3300004625 Bacteria 136177
35 Ga0055543_1001915 3300004625 Bacteria 7463
36 Ga0065165_1000178 3300005262 Bacteria 113319
37 Ga0065165_1001462 3300005262 Bacteria 25451
38 Ga0065165_1006394 3300005262 Bacteria 6198
39 Ga0065165_1008164 3300005262 Bacteria 4974
40 Ga0070658_10125525 3300005327 Bacteria 2136
41 Ga0070658_10269850 3300005327 Bacteria 1447
42 Ga0070683_100400476 3300005329 Bacteria 1309
43 Ga0070670_100027526 3300005331 Bacteria 4890
44 Ga0070670_100648980 3300005331 Bacteria 947
45 Ga0068869_100462861 3300005334 Bacteria 1053
46 Ga0070666_10000938 3300005335 Bacteria 17706
47 Ga0070666_10002179 3300005335 Bacteria 11900
48 Ga0070666_10461914 3300005335 Bacteria 918
49 Ga0070666_10792504 3300005335 Bacteria 698
50 Ga0070682_100793374 3300005337 Bacteria 769
51 Ga0068868_100120833 3300005338 Bacteria 2136
52 Ga0068868_100207269 3300005338 Bacteria 1637
53 Ga0068868_100435331 3300005338 Bacteria 1138
54 Ga0068868_100624510 3300005338 Bacteria 957
55 Ga0068868_100754263 3300005338 Bacteria 875
56 Ga0070660_100498844 3300005339 Bacteria 1013
57 Ga0070660_101002077 3300005339 Bacteria 706
58 Ga0070660_101071775 3300005339 Bacteria 682
59 Ga0070660_101625457 3300005339 Bacteria 550
60 Ga0070687_100898497 3300005343 Bacteria 635
61 Ga0070661_100091190 3300005344 Bacteria 2257
62 Ga0070661_100103251 3300005344 Bacteria 2123
63 Ga0070661_100475049 3300005344 Bacteria 998
64 Ga0070668_100076460 3300005347 Bacteria 2615
65 Ga0070668_100668251 3300005347 Unclassified 914
66 Ga0070669_100546943 3300005353 Bacteria 965
67 Ga0070675_100691069 3300005354 Bacteria 929
68 Ga0070671_100066518 3300005355 Bacteria 3004
69 Ga0070671_100118451 3300005355 Bacteria 2227
70 Ga0070671_100419795 3300005355 Bacteria 1146
71 Ga0070671_100629849 3300005355 Bacteria 928
72 Ga0070674_100279621 3300005356 Bacteria 1322
73 Ga0070673_100061322 3300005364 Bacteria 2984
74 Ga0070659_101505210 3300005366 Bacteria 600
75 Ga0070667_100103589 3300005367 Bacteria 2460
76 Ga0070667_101453161 3300005367 Bacteria 643
77 Ga0070709_10001415 3300005434 Bacteria 13010
78 Ga0070709_10384768 3300005434 Bacteria 1044
79 Ga0070714_100013698 3300005435 Bacteria 6502
80 Ga0070714_100043813 3300005435 Bacteria 3786
81 Ga0070714_100516305 3300005435 Bacteria 1141
82 Ga0070714_100812592 3300005435 Bacteria 906
83 Ga0070713_100029447 3300005436 Bacteria 4350
84 Ga0070713_100035173 3300005436 Bacteria 4030
85 Ga0070713_101332407 3300005436 Bacteria 696
86 Ga0070710_10001980 3300005437 Bacteria 9709
87 Ga0070710_10793071 3300005437 Bacteria 676
88 Ga0070711_100048152 3300005439 Bacteria 2913
89 Ga0070705_100281784 3300005440 Bacteria 1182
90 Ga0070705_101244621 3300005440 Bacteria 615
91 Ga0070694_100026298 3300005444 Bacteria 3770
92 Ga0070663_100076650 3300005455 Bacteria 2446
93 Ga0070663_100134033 3300005455 Bacteria 1884
94 Ga0070663_100231387 3300005455 Bacteria 1455
95 Ga0070663_100280610 3300005455 Bacteria 1327
96 Ga0070663_100564845 3300005455 Bacteria 953
97 Ga0070663_101246216 3300005455 Bacteria 655
98 Ga0070663_101523805 3300005455 Bacteria 595
99 Ga0070678_101125746 3300005456 Bacteria 726
100 Ga0070678_101141721 3300005456 Bacteria 721
101 Ga0070662_100204055 3300005457 Bacteria 1570
102 Ga0070662_100375822 3300005457 Bacteria 1169
103 Ga0070662_100608571 3300005457 Bacteria 919
104 Ga0068867_101064157 3300005459 Bacteria 737
105 Ga0068867_101705279 3300005459 Bacteria 591
106 Ga0068867_102045715 3300005459 Bacteria 542
107 Ga0070685_10001247 3300005466 Bacteria 13509
108 Ga0070685_10629391 3300005466 Bacteria 775
109 Ga0070706_100087842 3300005467 Bacteria 2882
110 Ga0070706_101442302 3300005467 Bacteria 630
111 Ga0070698_100830490 3300005471 Bacteria 868
112 Ga0070679_100416155 3300005530 Bacteria 1290
113 Ga0070679_100839175 3300005530 Bacteria 862
114 Ga0070684_100523659 3300005535 Bacteria 1099
115 Ga0070684_100585244 3300005535 Bacteria 1037
116 Ga0070697_101073120 3300005536 Bacteria 716
117 Ga0068853_100000598 3300005539 Bacteria 24767
118 Ga0068853_100093391 3300005539 Bacteria 2649
119 Ga0068853_100838175 3300005539 Bacteria 881
120 Ga0068853_101173642 3300005539 Bacteria 741
121 Ga0068853_101518320 3300005539 Bacteria 649
122 Ga0068853_101738571 3300005539 Bacteria 605
123 Ga0070672_100777139 3300005543 Bacteria 842
124 Ga0070686_100138269 3300005544 Bacteria 1693
125 Ga0070686_100255065 3300005544 Bacteria 1283
126 Ga0070695_100061578 3300005545 Bacteria 2435
127 Ga0070695_100968165 3300005545 Bacteria 690
128 Ga0070696_100475766 3300005546 Bacteria 990
129 Ga0070665_100000144 3300005548 Bacteria 132302
130 Ga0070665_100002074 3300005548 Bacteria 22481
131 Ga0070665_100011926 3300005548 Bacteria 8776
132 Ga0070665_100013246 3300005548 Bacteria 8306
133 Ga0070665_100032040 3300005548 Bacteria 5291
134 Ga0070665_100112798 3300005548 Bacteria 2721
135 Ga0070665_100336078 3300005548 Bacteria 1515
136 Ga0070665_100775174 3300005548 Bacteria 972
137 Ga0070704_100128764 3300005549 Bacteria 1958
138 Ga0068855_100115416 3300005563 Bacteria 3078
139 Ga0068855_100282797 3300005563 Bacteria 1841
140 Ga0068855_100302799 3300005563 Bacteria 1770
141 Ga0068855_100693099 3300005563 Bacteria 1091
142 Ga0070664_100457086 3300005564 Bacteria 1173
143 Ga0068857_100136620 3300005577 Bacteria 2214
144 Ga0068857_100159120 3300005577 Bacteria 2049
145 Ga0068857_100607937 3300005577 Bacteria 1034
146 Ga0068854_100009801 3300005578 Bacteria 6194
147 Ga0068854_100012342 3300005578 Bacteria 5593
148 Ga0068854_100056101 3300005578 Bacteria 2838
149 Ga0068856_100096137 3300005614 Bacteria 2951
150 Ga0068856_100211790 3300005614 Bacteria 1953
151 Ga0068856_100414149 3300005614 Bacteria 1368
152 Ga0068856_102107612 3300005614 Bacteria 573
153 Ga0068852_100001361 3300005616 Bacteria 16410
154 Ga0068852_100116660 3300005616 Bacteria 2436
155 Ga0068852_100254911 3300005616 Bacteria 1682
156 Ga0068852_100737597 3300005616 Bacteria 997
157 Ga0068852_101485771 3300005616 Bacteria 700
158 Ga0068852_101731291 3300005616 Bacteria 647
159 Ga0068859_100068675 3300005617 Bacteria 3578
160 Ga0068859_100564979 3300005617 Bacteria 1232
161 Ga0068864_100007889 3300005618 Bacteria 8774
162 Ga0068864_100364109 3300005618 Bacteria 1367
163 Ga0068864_100448473 3300005618 Bacteria 1234
164 Ga0068851_10088483 3300005834 Bacteria 1627
165 Ga0068851_10112180 3300005834 Bacteria 1457
166 Ga0068863_100000037 3300005841 Bacteria 162638
167 Ga0068863_100037516 3300005841 Bacteria 4614
168 Ga0068863_100046659 3300005841 Bacteria 4113
169 Ga0068863_100223536 3300005841 Bacteria 1814
170 Ga0068863_101056514 3300005841 Bacteria 816
171 Ga0068863_101619949 3300005841 Bacteria 656
172 Ga0068858_100000029 3300005842 Bacteria 144691
173 Ga0068858_100000416 3300005842 Bacteria 44232
174 Ga0068858_100471729 3300005842 Bacteria 1211
175 Ga0068858_100895420 3300005842 Bacteria 868
176 Ga0068858_102580495 3300005842 Bacteria 502
177 Ga0068860_100000610 3300005843 Bacteria 42430
178 Ga0068860_100114286 3300005843 Bacteria 2581
179 Ga0068860_101776018 3300005843 Bacteria 639
180 Ga0068860_102665158 3300005843 Bacteria 519
181 Ga0068862_100005038 3300005844 Bacteria 11117
182 Ga0068862_100514950 3300005844 Bacteria 1138
183 Ga0068862_100650609 3300005844 Bacteria 1017
184 Ga0081455_10016776 3300005937 Bacteria 7048
185 Ga0081455_10026682 3300005937 Bacteria 5305
186 Ga0081455_10031500 3300005937 Bacteria 4796
187 Ga0081455_10323019 3300005937 Bacteria 1098
188 Ga0081538_10074861 3300005981 Bacteria 1841
189 Ga0081540_1000162 3300005983 Bacteria 68999
190 Ga0081540_1000379 3300005983 Bacteria 44561
191 Ga0081540_1004532 3300005983 Bacteria 10538
192 Ga0081540_1014174 3300005983 Bacteria 5128
193 Ga0081540_1033731 3300005983 Bacteria 2774
194 Ga0081540_1066967 3300005983 Bacteria 1680
195 Ga0081540_1091642 3300005983 Bacteria 1336
196 Ga0081540_1106176 3300005983 Unclassified 1198
197 Ga0081539_10000801 3300005985 Bacteria 61178
198 Ga0081539_10010210 3300005985 Bacteria 7683
199 Ga0070717_10044908 3300006028 Bacteria 3611
200 Ga0070717_10215363 3300006028 Bacteria 1687
201 Ga0070717_10538852 3300006028 Bacteria 1057
202 Ga0075365_10094039 3300006038 Bacteria 2045
203 Ga0075365_10122863 3300006038 Bacteria 1792
204 Ga0075365_10159918 3300006038 Bacteria 1569
205 Ga0075365_10191892 3300006038 Bacteria 1430
206 Ga0075365_10248735 3300006038 Bacteria 1249
207 Ga0075365_10361365 3300006038 Bacteria 1023
208 Ga0075368_10029782 3300006042 Bacteria 2111
209 Ga0075368_10340335 3300006042 Bacteria 652
210 Ga0075363_100252495 3300006048 Bacteria 1016
211 Ga0075363_100359214 3300006048 Bacteria 852
212 Ga0075363_100408291 3300006048 Bacteria 799
213 Ga0075363_101013450 3300006048 Bacteria 512
214 Ga0075364_10114922 3300006051 Bacteria 1798
215 Ga0075364_10307839 3300006051 Bacteria 1079
216 Ga0075364_10994487 3300006051 Bacteria 570
217 Ga0075432_10011455 3300006058 Bacteria 3012
218 Ga0070715_10100755 3300006163 Bacteria 1347
219 Ga0070716_100739097 3300006173 Bacteria 756
220 Ga0070712_100011824 3300006175 Bacteria 5545
221 Ga0070712_100213292 3300006175 Bacteria 1524
222 Ga0075362_10054161 3300006177 Bacteria 1802
223 Ga0075362_10224348 3300006177 Bacteria 919
224 Ga0075362_10308810 3300006177 Bacteria 786
225 Ga0075367_10715338 3300006178 Bacteria 637
226 Ga0075369_10011029 3300006186 Bacteria 3545
227 Ga0075369_10028654 3300006186 Bacteria 2335
228 Ga0075369_10030461 3300006186 Bacteria 2273
229 Ga0075369_10348003 3300006186 Bacteria 695
230 Ga0075369_10433177 3300006186 Bacteria 622
231 Ga0075369_10453428 3300006186 Bacteria 607
232 Ga0075366_10419043 3300006195 Bacteria 825
233 Ga0075366_10441905 3300006195 Bacteria 802
234 Ga0097621_100211422 3300006237 Bacteria 1688
235 Ga0097621_100542758 3300006237 Bacteria 1057
236 Ga0097621_100648202 3300006237 Bacteria 969
237 Ga0075370_10097196 3300006353 Bacteria 1702
238 Ga0075370_10223380 3300006353 Bacteria 1113
239 Ga0075370_10223785 3300006353 Bacteria 1112
240 Ga0075370_10424475 3300006353 Bacteria 799
241 Ga0075370_10468635 3300006353 Bacteria 759
242 Ga0075370_10991942 3300006353 Bacteria 515
243 Ga0075370_10995286 3300006353 Bacteria 514
244 Ga0068871_100617986 3300006358 Bacteria 987
245 Ga0075428_100557058 3300006844 Bacteria 1225
246 Ga0075428_100778824 3300006844 Bacteria 1017
247 Ga0075428_102305845 3300006844 Bacteria 554
248 Ga0075430_100601900 3300006846 Bacteria 907
249 Ga0075430_100777212 3300006846 Bacteria 789
250 Ga0075430_100810030 3300006846 Bacteria 772
251 Ga0075431_100169253 3300006847 Bacteria 2246
252 Ga0075431_100815083 3300006847 Bacteria 906
253 Ga0075429_100228293 3300006880 Bacteria 1630
254 Ga0075429_101208563 3300006880 Bacteria 660
255 Ga0075436_100176200 3300006914 Bacteria 1510
256 Ga0075436_100314759 3300006914 Bacteria 1124
257 Ga0097620_100068675 3300006931 Bacteria 3578
258 Ga0097620_100564988 3300006931 Bacteria 1232
259 Ga0099824_1020962 3300006942 Bacteria 4670
260 Ga0099823_1023273 3300006944 Bacteria 5681
261 Ga0079104_1065654 3300006946 Bacteria 772
262 Ga0075435_100078555 3300007076 Bacteria 2707
263 Ga0075435_100558593 3300007076 Bacteria 992
264 Ga0075435_101285133 3300007076 Bacteria 641
265 Ga0075435_101302718 3300007076 Bacteria 636
266 Ga0099795_10091163 3300007788 Bacteria 1182
267 Ga0099795_10323616 3300007788 Bacteria 683
268 Ga0105251_10069762 3300009011 Bacteria 1638
269 Ga0105250_10462498 3300009092 Bacteria 571
270 Ga0105250_10490571 3300009092 Bacteria 556
271 Ga0105240_10000906 3300009093 Bacteria 52979
272 Ga0105240_10020715 3300009093 Bacteria 8761
273 Ga0105240_10190889 3300009093 Bacteria 2409
274 Ga0105240_10391068 3300009093 Bacteria 1568
275 Ga0105240_10507292 3300009093 Bacteria 1340
276 Ga0105240_10721265 3300009093 Bacteria 1086
277 Ga0105240_11045775 3300009093 Bacteria 871
278 Ga0105240_11344387 3300009093 Bacteria 752
279 Ga0111539_10016502 3300009094 Bacteria 9157
280 Ga0111539_11095602 3300009094 Bacteria 925
281 Ga0111539_11642657 3300009094 Bacteria 745
282 Ga0105245_10099561 3300009098 Bacteria 2688
283 Ga0105245_10120596 3300009098 Bacteria 2449
284 Ga0105245_10326876 3300009098 Bacteria 1512
285 Ga0105247_10262534 3300009101 Bacteria 1184
286 Ga0105247_10922932 3300009101 Bacteria 676
287 Ga0105247_11239282 3300009101 Bacteria 596
288 Ga0114129_10065857 3300009147 Bacteria 5055
289 Ga0114129_10554633 3300009147 Bacteria 1494
290 Ga0114129_10707709 3300009147 Bacteria 1294
291 Ga0114129_10708763 3300009147 Bacteria 1293
292 Ga0114129_11676250 3300009147 Bacteria 776
293 Ga0114129_12766504 3300009147 Bacteria 584
294 Ga0105243_10085767 3300009148 Bacteria 2581
295 Ga0105243_10142913 3300009148 Bacteria 2044
296 Ga0105243_11700857 3300009148 Bacteria 660
297 Ga0105241_10058129 3300009174 Bacteria 2969
298 Ga0105241_10081720 3300009174 Bacteria 2532
299 Ga0105241_10214916 3300009174 Bacteria 1613
300 Ga0105241_10358587 3300009174 Bacteria 1268
301 Ga0105241_10606121 3300009174 Bacteria 990
302 Ga0105241_10974794 3300009174 Bacteria 792
303 Ga0105241_11952100 3300009174 Bacteria 576
304 Ga0105241_12120477 3300009174 Bacteria 556
305 Ga0105242_10248285 3300009176 Bacteria 1602
306 Ga0105242_10316963 3300009176 Bacteria 1429
307 Ga0105242_11482615 3300009176 Bacteria 708
308 Ga0105242_12029122 3300009176 Bacteria 618
309 Ga0105248_10121106 3300009177 Bacteria 2951
310 Ga0105248_10311374 3300009177 Bacteria 1773
311 Ga0105248_10425081 3300009177 Bacteria 1496
312 Ga0105248_11133207 3300009177 Bacteria 884
313 Ga0105237_10000768 3300009545 Bacteria 43904
314 Ga0105237_10034618 3300009545 Bacteria 5113
315 Ga0105237_10105484 3300009545 Bacteria 2809
316 Ga0105237_10185435 3300009545 Bacteria 2081
317 Ga0105237_10353218 3300009545 Bacteria 1474
318 Ga0105237_10390180 3300009545 Bacteria 1397
319 Ga0105237_10394759 3300009545 Bacteria 1388
320 Ga0105237_10780348 3300009545 Bacteria 962
321 Ga0105237_11197889 3300009545 Bacteria 766
322 Ga0105237_12099693 3300009545 Bacteria 574
323 Ga0105237_12511515 3300009545 Bacteria 526
324 Ga0105238_10037476 3300009551 Bacteria 4929
325 Ga0105238_10054946 3300009551 Bacteria 3998
326 Ga0105238_10059189 3300009551 Bacteria 3838
327 Ga0105238_10060050 3300009551 Bacteria 3807
328 Ga0105238_10063273 3300009551 Bacteria 3700
329 Ga0105238_10086639 3300009551 Bacteria 3119
330 Ga0105238_10135292 3300009551 Bacteria 2442
331 Ga0105238_10227960 3300009551 Bacteria 1840
332 Ga0105238_10497883 3300009551 Bacteria 1219
333 Ga0105238_10511163 3300009551 Bacteria 1203
334 Ga0105238_10946299 3300009551 Bacteria 881
335 Ga0105238_11526223 3300009551 Bacteria 697
336 Ga0105238_12174350 3300009551 Bacteria 589
337 Ga0105249_10013373 3300009553 Bacteria 7248
338 Ga0105249_10454865 3300009553 Bacteria 1319
339 Ga0099796_10090755 3300010159 Bacteria 1135
340 Ga0099796_10138296 3300010159 Bacteria 950
341 Ga0105239_10000846 3300010375 Bacteria 43563
342 Ga0105239_10009303 3300010375 Bacteria 11107
343 Ga0105239_10014928 3300010375 Bacteria 8611
344 Ga0105239_10097555 3300010375 Bacteria 3248
345 Ga0105239_10288032 3300010375 Bacteria 1849
346 Ga0105239_10327199 3300010375 Bacteria 1729
347 Ga0105239_10390393 3300010375 Bacteria 1574
348 Ga0105239_10398331 3300010375 Bacteria 1558
349 Ga0105239_10458925 3300010375 Bacteria 1446
350 Ga0105239_10799132 3300010375 Bacteria 1081
351 Ga0105239_11023502 3300010375 Bacteria 950
352 Ga0105239_11185436 3300010375 Bacteria 880
353 Ga0105239_11675732 3300010375 Bacteria 736
354 Ga0105239_11840572 3300010375 Bacteria 702
355 Ga0105239_12685967 3300010375 Bacteria 581
356 Ga0105246_10088471 3300011119 Bacteria 2225
357 Ga0105246_11564809 3300011119 Bacteria 622
358 Ga0105246_11686401 3300011119 Bacteria 602
359 Ga0105246_12258735 3300011119 Bacteria 531
360 Ga0157342_1057251 3300012507 Bacteria 563
361 Ga0157373_10838269 3300013100 Bacteria 679
362 Ga0157371_10022848 3300013102 Bacteria 4576
363 Ga0157371_10341159 3300013102 Bacteria 1090
364 Ga0157370_10007830 3300013104 Bacteria 11578
365 Ga0157370_10409387 3300013104 Bacteria 1248
366 Ga0157370_10678802 3300013104 Bacteria 941
367 Ga0157369_10422318 3300013105 Bacteria 1382
368 Ga0171463_1007 3300013249 Bacteria 301198
369 Ga0157374_10072574 3300013296 Bacteria 3248
370 Ga0157374_10313533 3300013296 Bacteria 1553
371 Ga0157374_10410884 3300013296 Bacteria 1351
372 Ga0157378_10015322 3300013297 Bacteria 6715
373 Ga0157378_10357821 3300013297 Bacteria 1428
374 Ga0157378_10411110 3300013297 Bacteria 1335
375 Ga0157378_11292257 3300013297 Bacteria 771
376 Ga0163162_10101266 3300013306 Bacteria 2972
377 Ga0163162_10224326 3300013306 Bacteria 2009
378 Ga0163162_11608189 3300013306 Bacteria 741
379 Ga0163162_12279075 3300013306 Bacteria 622
380 Ga0157372_10254990 3300013307 Bacteria 2037
381 Ga0157372_10440349 3300013307 Bacteria 1519
382 Ga0157375_11117528 3300013308 Bacteria 923
383 Ga0157375_11825182 3300013308 Bacteria 721
384 Ga0157375_13323844 3300013308 Bacteria 536
385 Ga0163163_10047824 3300014325 Bacteria 4205
386 Ga0163163_10060022 3300014325 Bacteria 3764
387 Ga0163163_10169415 3300014325 Bacteria 2230
388 Ga0163163_10217856 3300014325 Bacteria 1958
389 Ga0163163_10314559 3300014325 Bacteria 1619
390 Ga0157380_10881439 3300014326 Bacteria 919
391 Ga0182008_10166788 3300014497 Bacteria 1110
392 Ga0182008_10466190 3300014497 Bacteria 689
393 Ga0157379_10034956 3300014968 Bacteria 4480
394 Ga0157379_10314220 3300014968 Bacteria 1430
395 Ga0157379_11197775 3300014968 Bacteria 730
396 Ga0157376_11156297 3300014969 Bacteria 801
397 Ga0157376_12647181 3300014969 Bacteria 541
398 Ga0157376_13053723 3300014969 Bacteria 507
399 Ga0183363_1259 3300015690 Bacteria 8664
400 Ga0163161_10522430 3300017792 Bacteria 969
401 Ga0197907_10317020 3300020069 Bacteria 681
402 Ga0206353_10434026 3300020082 Bacteria 952
403 Ga0214544_1000011 3300021320 Bacteria 262952
404 Ga0214542_1000009 3300021321 Bacteria 262861
405 Ga0214545_1000007 3300021324 Bacteria 262984
406 Ga0214543_1000020 3300021327 Bacteria 262861
407 Ga0213873_10012381 3300021358 Bacteria 1849
408 Ga0213873_10015537 3300021358 Bacteria 1706
409 Ga0213873_10179808 3300021358 Bacteria 649
410 Ga0213872_10004352 3300021361 Bacteria 7541
411 Ga0213872_10035915 3300021361 Bacteria 2266
412 Ga0213872_10126948 3300021361 Bacteria 1125
413 Ga0213872_10240571 3300021361 Bacteria 765
414 Ga0213872_10470543 3300021361 Bacteria 503
415 Ga0213874_10200151 3300021377 Bacteria 718
416 Ga0213876_10015403 3300021384 Bacteria 4047
417 Ga0213871_10031702 3300021441 Bacteria 1382
418 Ga0209435_100005 3300025206 Bacteria 573745
419 Ga0209436_101180 3300025208 Bacteria 9609
420 Ga0209563_100718 3300025230 Bacteria 10324
421 Ga0209258_128199 3300025242 Bacteria 536
422 Ga0209646_1000011 3300025246 Bacteria 573745
423 Ga0209026_1000008 3300025250 Bacteria 573745
424 Ga0209026_1012371 3300025250 Bacteria 1491
425 Ga0209026_1028587 3300025250 Bacteria 832
426 Ga0209026_1032988 3300025250 Bacteria 764
427 Ga0209677_100400 3300025253 Bacteria 26165
428 Ga0209677_103245 3300025253 Bacteria 5419
429 Ga0209148_1000321 3300025254 Bacteria 66604
430 Ga0209148_1001029 3300025254 Bacteria 17506
431 Ga0209759_1000004 3300025256 Bacteria 573745
432 Ga0209233_1003560 3300025261 Bacteria 5476
433 Ga0209233_1009331 3300025261 Bacteria 2991
434 Ga0209233_1024852 3300025261 Bacteria 1491
435 Ga0209233_1027633 3300025261 Bacteria 1372
436 Ga0209233_1038593 3300025261 Bacteria 1052
437 Ga0209233_1049905 3300025261 Bacteria 857
438 Ga0209455_1002441 3300025272 Bacteria 7201
439 Ga0209455_1013650 3300025272 Bacteria 1875
440 Ga0209673_1060114 3300025273 Bacteria 954
441 Ga0209130_1000017 3300025284 Bacteria 388431
442 Ga0209676_1006987 3300025292 Bacteria 5425
443 Ga0209025_1000153 3300025294 Bacteria 170548
444 Ga0209025_1040142 3300025294 Bacteria 2029
445 Ga0209564_1000013 3300025295 Bacteria 775755
446 Ga0209564_1018331 3300025295 Bacteria 2674
447 Ga0209564_1078132 3300025295 Bacteria 657
448 Ga0209758_1000119 3300025297 Bacteria 195545
449 Ga0209758_1000206 3300025297 Bacteria 130177
450 Ga0209758_1000536 3300025297 Bacteria 60374
451 Ga0209758_1001853 3300025297 Bacteria 23209
452 Ga0209758_1002042 3300025297 Bacteria 21647
453 Ga0209758_1006010 3300025297 Bacteria 8972
454 Ga0209758_1016012 3300025297 Bacteria 3834
455 Ga0209758_1036437 3300025297 Bacteria 1919
456 Ga0209758_1044493 3300025297 Bacteria 1622
457 Ga0209050_1000029 3300025298 Bacteria 465801
458 Ga0209050_1005510 3300025298 Bacteria 7913
459 Ga0209050_1013688 3300025298 Bacteria 3576
460 Ga0209256_1000211 3300025299 Bacteria 110131
461 Ga0209256_1004227 3300025299 Bacteria 9205
462 Ga0209256_1005602 3300025299 Bacteria 7133
463 Ga0209256_1096731 3300025299 Bacteria 618
464 Ga0207426_1000006 3300025302 Bacteria 1025969
465 Ga0207426_1000870 3300025302 Bacteria 31492
466 Ga0207426_1003803 3300025302 Bacteria 7826
467 Ga0207426_1004991 3300025302 Bacteria 6247
468 Ga0207426_1068848 3300025302 Bacteria 994
469 Ga0209051_1048380 3300025303 Bacteria 1442
470 Ga0209257_1000271 3300025304 Bacteria 118632
471 Ga0209257_1000301 3300025304 Bacteria 108454
472 Ga0209257_1000394 3300025304 Bacteria 86654
473 Ga0209257_1011550 3300025304 Bacteria 4235
474 Ga0209257_1020690 3300025304 Bacteria 2419
475 Ga0209257_1030953 3300025304 Bacteria 1718
476 Ga0209257_1082005 3300025304 Bacteria 825
477 Ga0209257_1130115 3300025304 Bacteria 577
478 Ga0207697_10184810 3300025315 Bacteria 914
479 Ga0207656_10051320 3300025321 Bacteria 1784
480 Ga0207656_10055558 3300025321 Bacteria 1724
481 Ga0207692_10012356 3300025898 Bacteria 3666
482 Ga0207692_10072441 3300025898 Bacteria 1820
483 Ga0207692_10118555 3300025898 Bacteria 1479
484 Ga0207710_10183941 3300025900 Bacteria 1026
485 Ga0207710_10342768 3300025900 Bacteria 760
486 Ga0207710_10544739 3300025900 Bacteria 604
487 Ga0207688_10265382 3300025901 Bacteria 1043
488 Ga0207680_10001600 3300025903 Bacteria 10705
489 Ga0207680_10003166 3300025903 Bacteria 7732
490 Ga0207680_10120654 3300025903 Bacteria 1714
491 Ga0207680_11363288 3300025903 Bacteria 503
492 Ga0207647_10001114 3300025904 Bacteria 20682
493 Ga0207647_10016170 3300025904 Bacteria 5094
494 Ga0207685_10028515 3300025905 Bacteria 1967
495 Ga0207685_10273612 3300025905 Bacteria 826
496 Ga0207699_10000352 3300025906 Bacteria 24405
497 Ga0207699_10107452 3300025906 Bacteria 1782
498 Ga0207699_10411699 3300025906 Bacteria 964
499 Ga0207645_10206179 3300025907 Bacteria 1294
500 Ga0207705_10070467 3300025909 Bacteria 2534
501 Ga0207654_10033099 3300025911 Bacteria 2863
502 Ga0207654_10143253 3300025911 Bacteria 1526
503 Ga0207654_10254110 3300025911 Bacteria 1179
504 Ga0207654_10300211 3300025911 Bacteria 1092
505 Ga0207654_10401781 3300025911 Bacteria 953
506 Ga0207654_10497670 3300025911 Bacteria 860
507 Ga0207707_10353100 3300025912 Bacteria 1267
508 Ga0207695_10000040 3300025913 Bacteria 452787
509 Ga0207695_10025575 3300025913 Bacteria 6605
510 Ga0207695_10027614 3300025913 Bacteria 6315
511 Ga0207695_10161780 3300025913 Bacteria 2170
512 Ga0207695_10425339 3300025913 Bacteria 1212
513 Ga0207695_10652637 3300025913 Bacteria 933
514 Ga0207695_10826123 3300025913 Bacteria 807
515 Ga0207695_10922875 3300025913 Bacteria 753
516 Ga0207695_11148006 3300025913 Bacteria 657
517 Ga0207671_10000361 3300025914 Bacteria 64792
518 Ga0207671_10015883 3300025914 Bacteria 5873
519 Ga0207671_10083610 3300025914 Bacteria 2397
520 Ga0207671_10227144 3300025914 Bacteria 1464
521 Ga0207671_10245203 3300025914 Bacteria 1408
522 Ga0207671_10262805 3300025914 Bacteria 1358
523 Ga0207671_10522646 3300025914 Bacteria 946
524 Ga0207693_10024896 3300025915 Bacteria 4747
525 Ga0207663_10002073 3300025916 Bacteria 9553
526 Ga0207663_10010518 3300025916 Bacteria 4930
527 Ga0207663_10742139 3300025916 Bacteria 779
528 Ga0207663_11020323 3300025916 Bacteria 664
529 Ga0207663_11321817 3300025916 Bacteria 581
530 Ga0207660_10488825 3300025917 Bacteria 998
531 Ga0207657_10251288 3300025919 Bacteria 1409
532 Ga0207657_10530903 3300025919 Bacteria 920
533 Ga0207657_10818198 3300025919 Bacteria 720
534 Ga0207649_10018924 3300025920 Bacteria 3928
535 Ga0207649_10071728 3300025920 Bacteria 2213
536 Ga0207649_10177173 3300025920 Bacteria 1490
537 Ga0207649_10309295 3300025920 Bacteria 1158
538 Ga0207649_10688860 3300025920 Bacteria 792
539 Ga0207681_11155970 3300025923 Bacteria 650
540 Ga0207694_10001195 3300025924 Bacteria 22509
541 Ga0207694_10002483 3300025924 Bacteria 15006
542 Ga0207694_10030886 3300025924 Bacteria 4091
543 Ga0207694_10034603 3300025924 Bacteria 3874
544 Ga0207694_10120291 3300025924 Bacteria 2096
545 Ga0207694_10127691 3300025924 Bacteria 2036
546 Ga0207694_10219474 3300025924 Bacteria 1550
547 Ga0207694_10449401 3300025924 Bacteria 1076
548 Ga0207694_10471166 3300025924 Bacteria 1050
549 Ga0207694_10566684 3300025924 Bacteria 954
550 Ga0207694_10968306 3300025924 Bacteria 720
551 Ga0207694_11743758 3300025924 Bacteria 524
552 Ga0207650_10021597 3300025925 Bacteria 4548
553 Ga0207650_10517836 3300025925 Bacteria 998
554 Ga0207650_10758429 3300025925 Bacteria 821
555 Ga0207650_10946865 3300025925 Bacteria 732
556 Ga0207659_10737055 3300025926 Bacteria 845
557 Ga0207687_10155441 3300025927 Bacteria 1749
558 Ga0207700_10031588 3300025928 Bacteria 3764
559 Ga0207700_10167948 3300025928 Bacteria 1828
560 Ga0207700_11085087 3300025928 Bacteria 716
561 Ga0207700_11400064 3300025928 Bacteria 622
562 Ga0207664_10044956 3300025929 Bacteria 3461
563 Ga0207664_10073306 3300025929 Bacteria 2763
564 Ga0207664_10894476 3300025929 Bacteria 797
565 Ga0207644_10212348 3300025931 Bacteria 1531
566 Ga0207644_10477105 3300025931 Bacteria 1027
567 Ga0207644_11006629 3300025931 Bacteria 699
568 Ga0207644_11058168 3300025931 Bacteria 681
569 Ga0207644_11566838 3300025931 Bacteria 553
570 Ga0207690_10676498 3300025932 Bacteria 847
571 Ga0207706_10188835 3300025933 Bacteria 1809
572 Ga0207706_10198515 3300025933 Bacteria 1760
573 Ga0207706_10380681 3300025933 Bacteria 1225
574 Ga0207686_10156225 3300025934 Bacteria 1594
575 Ga0207709_11062388 3300025935 Bacteria 664
576 Ga0207670_10801955 3300025936 Bacteria 784
577 Ga0207670_10881774 3300025936 Bacteria 749
578 Ga0207670_11516482 3300025936 Bacteria 570
579 Ga0207669_10898035 3300025937 Bacteria 740
580 Ga0207669_11705851 3300025937 Bacteria 538
581 Ga0207665_10156483 3300025939 Bacteria 1636
582 Ga0207665_10174443 3300025939 Bacteria 1554
583 Ga0207665_10177685 3300025939 Bacteria 1540
584 Ga0207665_11201030 3300025939 Bacteria 605
585 Ga0207665_11586644 3300025939 Bacteria 519
586 Ga0207691_10276597 3300025940 Bacteria 1445
587 Ga0207691_11063922 3300025940 Bacteria 674
588 Ga0207711_10066476 3300025941 Bacteria 3118
589 Ga0207711_10604005 3300025941 Bacteria 1024
590 Ga0207711_11185576 3300025941 Bacteria 705
591 Ga0207711_11186868 3300025941 Bacteria 705
592 Ga0207661_10523945 3300025944 Bacteria 1084
593 Ga0207679_11334797 3300025945 Bacteria 658
594 Ga0207679_11359299 3300025945 Bacteria 652
595 Ga0207667_10169996 3300025949 Bacteria 2240
596 Ga0207667_10182625 3300025949 Bacteria 2154
597 Ga0207667_10283454 3300025949 Bacteria 1693
598 Ga0207667_10718834 3300025949 Bacteria 1000
599 Ga0207667_11200819 3300025949 Bacteria 738
600 Ga0207667_11291788 3300025949 Bacteria 706
601 Ga0207651_10032659 3300025960 Bacteria 3347
602 Ga0207651_11517973 3300025960 Bacteria 603
603 Ga0207712_10324405 3300025961 Bacteria 1272
604 Ga0207668_10077230 3300025972 Bacteria 2400
605 Ga0207640_10018949 3300025981 Bacteria 4054
606 Ga0207640_10101491 3300025981 Bacteria 2019
607 Ga0207640_10115178 3300025981 Bacteria 1914
608 Ga0207640_11608913 3300025981 Bacteria 585
609 Ga0207640_12140402 3300025981 Bacteria 507
610 Ga0207640_12187397 3300025981 Bacteria 502
611 Ga0207658_10003350 3300025986 Bacteria 11365
612 Ga0207658_10083678 3300025986 Bacteria 2453
613 Ga0207658_11677434 3300025986 Bacteria 581
614 Ga0207658_11907967 3300025986 Bacteria 541
615 Ga0207658_12017879 3300025986 Bacteria 525
616 Ga0207677_10187579 3300026023 Bacteria 1633
617 Ga0207677_10331893 3300026023 Bacteria 1268
618 Ga0207677_11814911 3300026023 Bacteria 566
619 Ga0207703_10000429 3300026035 Bacteria 44242
620 Ga0207703_10001132 3300026035 Bacteria 25162
621 Ga0207703_10081368 3300026035 Bacteria 2700
622 Ga0207703_10853229 3300026035 Bacteria 871
623 Ga0207703_11646875 3300026035 Bacteria 617
624 Ga0207639_10000308 3300026041 Bacteria 34625
625 Ga0207639_10000858 3300026041 Bacteria 20623
626 Ga0207639_11170875 3300026041 Bacteria 721
627 Ga0207678_10074670 3300026067 Bacteria 2905
628 Ga0207678_10091454 3300026067 Bacteria 2600
629 Ga0207678_10093155 3300026067 Bacteria 2574
630 Ga0207678_10285644 3300026067 Bacteria 1417
631 Ga0207678_10325731 3300026067 Bacteria 1322
632 Ga0207678_10683875 3300026067 Bacteria 902
633 Ga0207678_10694369 3300026067 Bacteria 895
634 Ga0207678_10908163 3300026067 Bacteria 779
635 Ga0207678_10963984 3300026067 Bacteria 755
636 Ga0207678_11922870 3300026067 Bacteria 516
637 Ga0207702_10001580 3300026078 Bacteria 22559
638 Ga0207702_10099364 3300026078 Bacteria 2565
639 Ga0207702_10126406 3300026078 Bacteria 2296
640 Ga0207702_10152645 3300026078 Bacteria 2102
641 Ga0207702_10393248 3300026078 Bacteria 1335
642 Ga0207702_10625891 3300026078 Bacteria 1057
643 Ga0207641_10000034 3300026088 Bacteria 217752
644 Ga0207641_10008638 3300026088 Bacteria 8410
645 Ga0207641_10708877 3300026088 Bacteria 991
646 Ga0207641_11525582 3300026088 Bacteria 670
647 Ga0207641_12459991 3300026088 Bacteria 519
648 Ga0207648_10105574 3300026089 Bacteria 2471
649 Ga0207648_10159531 3300026089 Bacteria 1992
650 Ga0207676_10000202 3300026095 Bacteria 51825
651 Ga0207676_10003773 3300026095 Bacteria 10707
652 Ga0207676_10143239 3300026095 Bacteria 2049
653 Ga0207676_10404232 3300026095 Bacteria 1277
654 Ga0207676_11983090 3300026095 Bacteria 581
655 Ga0207674_10037382 3300026116 Bacteria 5050
656 Ga0207674_10393199 3300026116 Bacteria 1340
657 Ga0207674_10454657 3300026116 Bacteria 1238
658 Ga0207674_10486232 3300026116 Bacteria 1193
659 Ga0207674_10890276 3300026116 Bacteria 858
660 Ga0207675_100316872 3300026118 Bacteria 1522
661 Ga0207675_102712301 3300026118 Bacteria 504
662 Ga0207683_10304083 3300026121 Bacteria 1459
663 Ga0207683_10520202 3300026121 Bacteria 1099
664 Ga0207683_10823559 3300026121 Bacteria 862
665 Ga0207698_10005879 3300026142 Bacteria 7624
666 Ga0207698_10009260 3300026142 Bacteria 6267
667 Ga0207698_10194806 3300026142 Bacteria 1809
668 Ga0207698_10347305 3300026142 Bacteria 1400
669 Ga0207698_10664838 3300026142 Bacteria 1033
670 Ga0207698_10780659 3300026142 Bacteria 956
671 Ga0207698_11654014 3300026142 Bacteria 656
672 Ga0207698_11949232 3300026142 Bacteria 602
673 Ga0209281_1070928 3300027111 Bacteria 510
674 Ga0209389_1000034 3300027296 Bacteria 127289
675 Ga0209389_1000039 3300027296 Bacteria 124545
676 Ga0209589_1000038 3300027357 Bacteria 127285
677 Ga0209489_100023 3300027361 Bacteria 198829
678 Ga0209489_100087 3300027361 Bacteria 124545
679 Ga0209700_100090 3300027363 Bacteria 124545
680 Ga0209179_1047920 3300027512 Bacteria 911
681 Ga0209813_10158514 3300027866 Bacteria 815
682 Ga0209813_10262334 3300027866 Bacteria 660
683 Ga0207428_10051956 3300027907 Bacteria 3275
684 Ga0207428_10068908 3300027907 Bacteria 2782
685 Ga0268266_10000003 3300028379 Bacteria 1701703
686 Ga0268266_10000008 3300028379 Bacteria 1161875
687 Ga0268266_10000086 3300028379 Bacteria 199443
688 Ga0268266_10033319 3300028379 Bacteria 4379
689 Ga0268266_10047500 3300028379 Bacteria 3678
690 Ga0268266_10199386 3300028379 Bacteria 1831
691 Ga0268266_10320253 3300028379 Bacteria 1451
692 Ga0268265_10011219 3300028380 Bacteria 6057
693 Ga0268265_10312136 3300028380 Bacteria 1420
694 Ga0268265_11056938 3300028380 Bacteria 804
695 Ga0268264_10000194 3300028381 Bacteria 125395
696 Ga0268264_10848359 3300028381 Bacteria 915
697 Ga0268264_10991337 3300028381 Bacteria 846
698 Ga0268264_11732992 3300028381 Bacteria 635
699 Ga0268264_11954783 3300028381 Bacteria 596
700 Ga0265337_1004679 3300028556 Bacteria 5626
701 Ga0265326_10001084 3300028558 Bacteria 9692
702 Ga0265319_1004856 3300028563 Bacteria 6578
703 Ga0265319_1065409 3300028563 Bacteria 1172
704 Ga0265334_10003918 3300028573 Bacteria 6703
705 Ga0265318_10029465 3300028577 Bacteria 2140
706 Ga0265318_10069342 3300028577 Bacteria 1307
707 Ga0265318_10167416 3300028577 Bacteria 805
708 Ga0265323_10001297 3300028653 Bacteria 12481
709 Ga0265322_10074888 3300028654 Bacteria 960
710 Ga0265336_10000620 3300028666 Bacteria 19526
711 Ga0307517_10000200 3300028786 Bacteria 101130
712 Ga0307517_10377461 3300028786 Bacteria 759
713 Ga0307517_10466557 3300028786 Bacteria 650
714 Ga0307515_10000017 3300028794 Bacteria 550465
715 Ga0307515_10001155 3300028794 Bacteria 60447
716 Ga0307515_10009128 3300028794 Bacteria 19231
717 Ga0265338_10001434 3300028800 Bacteria 38730
718 Ga0265338_10109509 3300028800 Bacteria 2229
719 Ga0265338_10972480 3300028800 Bacteria 576
720 Ga0265324_10002184 3300029957 Bacteria 10245
721 Ga0265324_10108124 3300029957 Bacteria 945
722 Ga0307512_10112280 3300030522 Bacteria 1789
723 Ga0265332_10200301 3300031238 Bacteria 830
724 Ga0265332_10289098 3300031238 Bacteria 677
725 Ga0265328_10155256 3300031239 Bacteria 862
726 Ga0265328_10271102 3300031239 Bacteria 652
727 Ga0265320_10075795 3300031240 Bacteria 1577
728 Ga0265325_10006538 3300031241 Bacteria 7070
729 Ga0265325_10009438 3300031241 Bacteria 5694
730 Ga0265325_10227246 3300031241 Bacteria 852
731 Ga0265329_10058269 3300031242 Bacteria 1224
732 Ga0265329_10166878 3300031242 Bacteria 717
733 Ga0265340_10001678 3300031247 Bacteria 12726
734 Ga0265340_10032481 3300031247 Bacteria 2606
735 Ga0265340_10075438 3300031247 Bacteria 1593
736 Ga0265340_10114786 3300031247 Bacteria 1242
737 Ga0265331_10021780 3300031250 Bacteria 3275
738 Ga0265331_10064808 3300031250 Bacteria 1719
739 Ga0265331_10135888 3300031250 Bacteria 1120
740 Ga0265331_10141382 3300031250 Bacteria 1095
741 Ga0265327_10003183 3300031251 Bacteria 16061
742 Ga0265327_10027477 3300031251 Bacteria 3274
743 Ga0265327_10156539 3300031251 Bacteria 1055
744 Ga0265316_10265257 3300031344 Bacteria 1258
745 Ga0265316_10343827 3300031344 Bacteria 1081
746 Ga0265316_10418871 3300031344 Bacteria 963
747 Ga0265316_11268221 3300031344 Bacteria 509
748 Ga0307513_10000852 3300031456 Bacteria 44393
749 Ga0307513_10002169 3300031456 Bacteria 27467
750 Ga0307513_10084803 3300031456 Bacteria 3253
751 Ga0307513_10132190 3300031456 Bacteria 2439
752 Ga0307513_11085111 3300031456 Bacteria 512
753 Ga0307509_10000115 3300031507 Bacteria 116444
754 Ga0307509_10605560 3300031507 Bacteria 768
755 Ga0307408_100076769 3300031548 Bacteria 2486
756 Ga0307408_100888614 3300031548 Bacteria 815
757 Ga0307408_101269491 3300031548 Bacteria 689
758 Ga0265313_10031074 3300031595 Bacteria 2740
759 Ga0265313_10194519 3300031595 Bacteria 846
760 Ga0307508_10011570 3300031616 Bacteria 8061
761 Ga0307508_10049419 3300031616 Bacteria 3746
762 Ga0307508_10075275 3300031616 Bacteria 2953
763 Ga0307508_10271173 3300031616 Bacteria 1291
764 Ga0316575_10074038 3300031665 Bacteria 1370
765 Ga0265314_10065760 3300031711 Bacteria 2448
766 Ga0265314_10101750 3300031711 Bacteria 1845
767 Ga0265314_10135802 3300031711 Bacteria 1527
768 Ga0265314_10198905 3300031711 Bacteria 1186
769 Ga0265342_10105466 3300031712 Bacteria 1601
770 Ga0265342_10205207 3300031712 Bacteria 1069
771 Ga0265342_10547188 3300031712 Bacteria 587
772 Ga0316576_10537020 3300031727 Bacteria 858
773 Ga0307516_10000029 3300031730 Bacteria 159762
774 Ga0307516_10366324 3300031730 Bacteria 1105
775 Ga0307516_10445344 3300031730 Bacteria 952
776 Ga0307410_11155952 3300031852 Bacteria 673
777 Ga0307407_10167016 3300031903 Bacteria 1446
778 Ga0307407_11387629 3300031903 Bacteria 553
779 Ga0307409_100249540 3300031995 Bacteria 1622
780 Ga0307409_102956189 3300031995 Bacteria 502
781 Ga0307416_100473599 3300032002 Bacteria 1311
782 Ga0307416_101874870 3300032002 Bacteria 703
783 Ga0307411_11053823 3300032005 Bacteria 731
784 Ga0316583_10058542 3300032133 Bacteria 1352
785 Ga0307510_10051340 3300033180 Bacteria 4361
786 Ga0307510_10105648 3300033180 Bacteria 2583
787 Ga0307510_10356649 3300033180 Bacteria 912
788 Ga0307510_10492470 3300033180 Bacteria 668
789 Ga0373938_0245460 3300034957 Bacteria 510
790 Ga0373926_0085038 3300035083 Bacteria 1173
791 Ga0373926_0271087 3300035083 Bacteria 660
792 Ga0373928_0245085 3300035084 Bacteria 532
793 Ga0373940_0026875 3300035088 Bacteria 1509
794 Ga0373940_0305113 3300035088 Bacteria 549
795 Ga0373944_0003979 3300035089 Bacteria 3826
796 Ga0373951_0177728 3300035091 Bacteria 610
797 Ga0373932_0138135 3300035112 Bacteria 827
798 Ga0373936_0332489 3300035113 Bacteria 690
799 Ga0373939_0045189 3300035114 Bacteria 1343
800 Ga0373941_0315002 3300035115 Bacteria 628
801 Ga0373953_0127756 3300035117 Bacteria 1082
802 Ga0373954_0104993 3300035118 Bacteria 1364
803 Ga0373957_0008983 3300035120 Bacteria 3258
804 Ga0373943_0085914 3300035170 Bacteria 1621
805 Ga0373943_0186214 3300035170 Bacteria 1143
806 Ga0373943_0195356 3300035170 Bacteria 1118
807 Ga0373946_0067975 3300035171 Bacteria 1531
808 Ga0373961_0190804 3300035241 Bacteria 718
809 Ga0373962_0306855 3300035242 Bacteria 564
810 Ga0316574_0000161 3300035398 Bacteria 21995
811 Ga0373931_0005928 3300035691 Bacteria 5681
812 Ga0373931_0519344 3300035691 Bacteria 770
813 Ga0373931_0726162 3300035691 Bacteria 658
814 Ga0373935_0218330 3300035692 Bacteria 1323
815 Ga0373927_0000155 3300035695 Bacteria 53529
816 Ga0373927_0090786 3300035695 Bacteria 1984
817 Ga0373927_0218513 3300035695 Bacteria 1252
818 Ga0373947_0120662 3300035725 Bacteria 1665
819 Ga0373947_0233356 3300035725 Bacteria 1212
820 Ga0373947_0518297 3300035725 Bacteria 811
821 Ga0373947_0796061 3300035725 Bacteria 645
822 Ga0373937_0002250 3300036401 Bacteria 16098
823 Ga0373937_0094799 3300036401 Bacteria 2768
824 Ga0373937_1607474 3300036401 Bacteria 597
825 Ga0316582_0163544 3300036647 Bacteria 1508
826 Ga0316584_0008065 3300036712 Bacteria 7234
827 Ga0373925_0000050 3300037068 Bacteria 127678
828 Ga0373925_0633260 3300037068 Bacteria 881
829 Ga0395899_0049253 3300037312 Bacteria 3133
830 Ga0395899_0106177 3300037312 Bacteria 2022
831 Ga0395899_0480008 3300037312 Bacteria 809
832 Ga0395899_0733907 3300037312 Bacteria 616
833 Ga0395900_0003044 3300037418 Bacteria 18262
834 Ga0395900_0049001 3300037418 Bacteria 4351
835 Ga0395900_0229886 3300037418 Bacteria 1866
836 Ga0395900_0374247 3300037418 Bacteria 1393
837 Ga0395900_0608026 3300037418 Bacteria 1033
838 Ga0395900_0877385 3300037418 Bacteria 821
839 Ga0395900_1369596 3300037418 Bacteria 621
840 Ga0395898_0003078 3300037466 Bacteria 18893
841 Ga0395898_0116788 3300037466 Bacteria 2557
842 Ga0395898_0117951 3300037466 Bacteria 2542
843 Ga0395898_0357161 3300037466 Bacteria 1393
844 Ga0395898_1021522 3300037466 Bacteria 762
845 Ga0395898_1390515 3300037466 Bacteria 630
846 Ga0395905_0001273 3300037471 Bacteria 31107
847 Ga0395905_0178258 3300037471 Bacteria 1995
848 Ga0395905_0182365 3300037471 Bacteria 1971
849 Ga0395905_0221863 3300037471 Bacteria 1769
850 Ga0395905_1452281 3300037471 Bacteria 590
851 Ga0395905_1818690 3300037471 Bacteria 515
852 Ga0395905_1877897 3300037471 Bacteria 505
853 Ga0436364_0407990 3300037853 Bacteria 2315
854 Ga0436364_0561975 3300037853 Bacteria 620
855 Ga0436364_1280483 3300037853 Bacteria 1989
856 Ga0436364_1290587 3300037853 Bacteria 895
857 Ga0436364_1382664 3300037853 Bacteria 2494
858 Ga0395901_0022715 3300038443 Bacteria 6432
859 Ga0395901_0261930 3300038443 Bacteria 1799
860 Ga0395901_0787307 3300038443 Bacteria 941
861 Ga0400483_113437 3300039062 Bacteria 1041
862 Ga0436365_0071066 3300039437 Bacteria 581
863 Ga0436365_0089719 3300039437 Bacteria 1008
864 Ga0436365_0097049 3300039437 Bacteria 899
865 Ga0436365_0176700 3300039437 Bacteria 1585
866 Ga0436365_0478528 3300039437 Bacteria 5695
867 Ga0436365_0652448 3300039437 Bacteria 556
868 Ga0436365_0987719 3300039437 Bacteria 770
869 Ga0436365_1901637 3300039437 Bacteria 583
870 Ga0436365_1912355 3300039437 Bacteria 4392
871 Ga0436360_0107966 3300039438 Bacteria 572
872 Ga0436360_0560001 3300039438 Bacteria 657
873 Ga0436360_0659897 3300039438 Bacteria 1740
874 Ga0436360_1276140 3300039438 Bacteria 1346
875 Ga0436360_1336701 3300039438 Bacteria 4083
876 Ga0436361_0123394 3300039447 Bacteria 3946
877 Ga0436361_0126524 3300039447 Bacteria 9724
878 Ga0436361_0259266 3300039447 Bacteria 1573
879 Ga0436361_0275557 3300039447 Bacteria 617
880 Ga0436361_0344369 3300039447 Bacteria 1789
881 Ga0436361_0433996 3300039447 Bacteria 8268
882 Ga0436361_0564472 3300039447 Bacteria 5234
883 Ga0436361_0585344 3300039447 Bacteria 1873
884 Ga0436361_0590022 3300039447 Bacteria 892
885 Ga0436361_1147896 3300039447 Bacteria 513
886 Ga0436363_0659025 3300039450 Bacteria 787
887 Ga0436363_0766421 3300039450 Bacteria 999
888 Ga0436363_0786529 3300039450 Bacteria 1039
889 Ga0436363_0903263 3300039450 Bacteria 621
890 Ga0436363_1146700 3300039450 Bacteria 3781
891 Ga0436363_1592292 3300039450 Bacteria 1616
892 Ga0436362_0242406 3300039453 Bacteria 619
893 Ga0436362_0466387 3300039453 Bacteria 2355
894 Ga0436362_1077664 3300039453 Bacteria 2635
895 Ga0439436_0003632 3300041404 Bacteria 4700
896 Ga0439438_031950 3300041405 Bacteria 1398
897 Ga0439439_0227969 3300041406 Bacteria 547
898 Ga0439447_017777 3300041407 Bacteria 1932
899 Ga0439465_0003746 3300041413 Bacteria 4957
900 Ga0439465_0099729 3300041413 Bacteria 1002
901 Ga0439465_0378543 3300041413 Bacteria 537
902 Ga0451789_1302564 3300041443 Bacteria 1214
903 Ga0451793_0870755 3300041452 Bacteria 718
904 Ga0451802_0383790 3300041460 Bacteria 622
905 Ga0451833_0407321 3300041491 Bacteria 1503
906 Ga0451833_0737184 3300041491 Bacteria 575
907 Ga0451833_1325230 3300041491 Bacteria 515
908 Ga0451833_1417654 3300041491 Bacteria 744
909 Ga0451847_0260825 3300041503 Bacteria 528
910 Ga0451849_0406743 3300041505 Bacteria 1026
911 Ga0451849_0912448 3300041505 Bacteria 577
912 Ga0451853_0820542 3300041512 Bacteria 591
913 Ga0451853_2029874 3300041512 Bacteria 551
914 Ga0451853_4114360 3300041512 Bacteria 650
915 Ga0439445_0034436 3300042004 Bacteria 1327
916 Ga0439445_0201410 3300042004 Bacteria 588
917 Ga0439432_061721 3300042006 Bacteria 1155
918 Ga0439449_0020329 3300042007 Bacteria 2488
919 Ga0439462_0029571 3300042015 Bacteria 1449
920 Ga0450912_026150 3300042116 Bacteria 587
921 Ga0450920_006886 3300042122 Bacteria 2050
922 Ga0450906_005298 3300042145 Bacteria 2660
923 Ga0450907_014165 3300042146 Bacteria 1330
924 Ga0450910_051659 3300042147 Bacteria 681
925 Ga0439458_0147696 3300042157 Bacteria 629
926 Ga0450918_002227 3300042531 Bacteria 3685
927 Ga0451577_1361144 3300042876 Bacteria 630
928 Ga0466969_0134804 3300044656 Bacteria 1144
929 Ga0466972_0000053 3300044658 Bacteria 112876
930 Ga0466972_0004635 3300044658 Bacteria 6883
931 Ga0466972_0304231 3300044658 Bacteria 745
932 Ga0466965_0106903 3300044683 Bacteria 1435
933 Ga0466965_0395966 3300044683 Bacteria 762
934 Ga0466965_0583269 3300044683 Bacteria 634
935 Ga0466966_0003689 3300044684 Bacteria 10107
936 Ga0466966_0494001 3300044684 Bacteria 736
937 Ga0466961_0004648 3300044693 Bacteria 8621
938 Ga0466961_0426019 3300044693 Bacteria 804
939 Ga0466963_0870803 3300044694 Bacteria 635
940 Ga0466963_1045763 3300044694 Bacteria 575
941 Ga0466964_0054370 3300044706 Bacteria 1650
942 Ga0466964_0854536 3300044706 Bacteria 518
943 Ga0453684_0508793 3300044712 Bacteria 1332
944 Ga0466971_0432648 3300044719 Bacteria 644
945 Ga0466968_0001220 3300044735 Bacteria 9109
946 Ga0466970_0101279 3300044765 Bacteria 1569
947 Ga0466970_0230458 3300044765 Bacteria 1035
948 Ga0466957_0395124 3300044842 Bacteria 945
949 Ga0466957_0503763 3300044842 Bacteria 840
950 Ga0466960_0009742 3300044901 Bacteria 3973
951 Ga0466960_0013395 3300044901 Bacteria 3484
952 Ga0466960_0793258 3300044901 Bacteria 573
953 Ga0466959_0002926 3300045049 Bacteria 11013
954 Ga0466959_0195198 3300045049 Bacteria 1411
955 Ga0451576_0000194 3300045051 Bacteria 154080
956 Ga0451576_1630076 3300045051 Bacteria 669
957 Ga0466958_0192720 3300045836 Bacteria 1296
958 Ga0466967_0139418 3300045976 Bacteria 2258
959 Ga0466967_0638282 3300045976 Bacteria 1052
960 Ga0466967_0773688 3300045976 Bacteria 952
961 Ga0466967_1465549 3300045976 Bacteria 680
962 Ga0495627_123321 3300046453 Bacteria 731
963 Ga0495592_0043578 3300046454 Bacteria 3357
964 Ga0495592_0087729 3300046454 Bacteria 2237
965 Ga0495603_0070143 3300046455 Bacteria 2060
966 Ga0495590_0217065 3300046457 Bacteria 706
967 Ga0495629_0003885 3300046459 Bacteria 11256
968 Ga0495638_0002872 3300046460 Bacteria 13794
969 Ga0495638_0058306 3300046460 Bacteria 2393
970 Ga0495638_0409065 3300046460 Bacteria 702
971 Ga0495651_0005311 3300046462 Bacteria 9823
972 Ga0495651_0026825 3300046462 Bacteria 4486
973 Ga0495653_0284276 3300046463 Bacteria 1084
974 Ga0495650_0336504 3300046471 Bacteria 501
975 Ga0495580_0204314 3300046472 Bacteria 1360
976 Ga0495605_0285771 3300046474 Bacteria 700
977 Ga0495664_0166292 3300046477 Bacteria 1338
978 Ga0495664_0728822 3300046477 Bacteria 585
979 Ga0495596_0130914 3300046500 Bacteria 974
980 Ga0495607_0091356 3300046501 Bacteria 1649
981 Ga0495606_0076424 3300046507 Bacteria 2093
982 Ga0495606_0137801 3300046507 Bacteria 1444
983 Ga0495606_0192182 3300046507 Bacteria 1169
984 Ga0495606_0209552 3300046507 Bacteria 1105
985 Ga0495606_0219766 3300046507 Bacteria 1071
986 Ga0495610_0291090 3300046512 Bacteria 633
987 Ga0495616_0201254 3300046513 Bacteria 875
988 Ga0495618_0035880 3300046514 Bacteria 3112
989 Ga0495620_0054254 3300046515 Bacteria 1694
990 Ga0495628_0103744 3300046516 Bacteria 2192
991 Ga0495628_0684683 3300046516 Bacteria 725
992 Ga0495643_0127233 3300046522 Bacteria 1282
993 Ga0495643_0143795 3300046522 Bacteria 1187
994 Ga0495648_0055521 3300046524 Bacteria 2387
995 Ga0495648_0237903 3300046524 Bacteria 887
996 Ga0495666_0179598 3300046526 Bacteria 978
997 Ga0495666_0527791 3300046526 Bacteria 527
998 Ga0495652_0082534 3300046529 Bacteria 2648
999 Ga0495652_0095736 3300046529 Bacteria 2419
1000 Ga0495652_0218829 3300046529 Bacteria 1432
1001 Ga0495654_0321195 3300046530 Bacteria 628
1002 Ga0495640_0019349 3300046533 Bacteria 5027
1003 Ga0495640_0032240 3300046533 Bacteria 3733
1004 Ga0495586_0856004 3300046535 Bacteria 524
1005 Ga0495587_0185731 3300046536 Bacteria 1178
1006 Ga0495587_0297556 3300046536 Bacteria 903
1007 Ga0495609_0092136 3300046538 Bacteria 1318
1008 Ga0495609_0184469 3300046538 Bacteria 877
1009 Ga0495609_0267792 3300046538 Bacteria 701
1010 Ga0495609_0290807 3300046538 Bacteria 667
1011 Ga0495597_0027670 3300046542 Bacteria 2599
1012 Ga0495597_0171342 3300046542 Bacteria 881
1013 Ga0495645_0384559 3300046543 Bacteria 897
1014 Ga0495622_0016703 3300046557 Bacteria 3418
1015 Ga0495622_0049422 3300046557 Bacteria 1952
1016 Ga0495622_0053966 3300046557 Bacteria 1865
1017 Ga0495633_0208489 3300046558 Bacteria 896
1018 Ga0495667_0202232 3300046559 Bacteria 1271
1019 Ga0495668_0068816 3300046616 Bacteria 1947
1020 Ga0495668_0207226 3300046616 Bacteria 1073
1021 Ga0495668_0259317 3300046616 Bacteria 952
1022 Ga0495668_0765814 3300046616 Bacteria 534
1023 Ga0495634_0107967 3300046642 Bacteria 1792
1024 Ga0495611_0096248 3300046648 Bacteria 1371
1025 Ga0495611_0330549 3300046648 Bacteria 701
1026 Ga0495625_0052558 3300046660 Bacteria 2917
1027 Ga0495625_0210390 3300046660 Bacteria 1279
1028 Ga0495625_0221718 3300046660 Bacteria 1239
1029 Ga0495625_0226986 3300046660 Bacteria 1221
1030 Ga0495635_0009411 3300046663 Bacteria 6832
1031 Ga0495661_0038077 3300046665 Bacteria 2999
1032 Ga0495661_0442437 3300046665 Bacteria 627
1033 Ga0495588_0032954 3300046674 Bacteria 2614
1034 Ga0495588_0681564 3300046674 Bacteria 538
1035 Ga0495657_0011877 3300046675 Bacteria 6491
1036 Ga0495599_0046793 3300046678 Bacteria 2712
1037 Ga0495599_0579137 3300046678 Bacteria 655
1038 Ga0495623_0202565 3300046679 Bacteria 1140
1039 Ga0495623_0271605 3300046679 Bacteria 946
1040 Ga0495646_0261083 3300046680 Bacteria 925
1041 Ga0495646_0373711 3300046680 Bacteria 744
1042 Ga0495658_0972039 3300046683 Bacteria 542
1043 Ga0495613_0033862 3300046689 Bacteria 3794
1044 Ga0495613_0041620 3300046689 Bacteria 3402
1045 Ga0495624_0150720 3300046690 Bacteria 1422
1046 Ga0495649_0028321 3300046694 Bacteria 3105
1047 Ga0495649_0065029 3300046694 Bacteria 1958
1048 Ga0495589_0178156 3300046794 Bacteria 1009
1049 Ga0495600_0711700 3300046809 Bacteria 603
1050 Ga0495581_0074513 3300047315 Bacteria 1964
1051 Ga0495604_0010490 3300047317 Bacteria 7344
1052 Ga0495604_0100979 3300047317 Bacteria 2120
1053 Ga0495604_0296360 3300047317 Bacteria 1087
1054 Ga0495674_0042102 3300047319 Bacteria 4076
1055 Ga0495674_0122217 3300047319 Bacteria 2199
1056 Ga0495672_0046408 3300047320 Bacteria 2591
1057 Ga0495672_0150739 3300047320 Bacteria 1206
1058 Ga0495672_0155635 3300047320 Bacteria 1181
1059 Ga0495672_0338301 3300047320 Bacteria 702
1060 Ga0495672_0366175 3300047320 Bacteria 666
1061 Ga0495676_0022307 3300047321 Bacteria 5511
1062 Ga0495680_0035033 3300047322 Bacteria 4047
1063 Ga0495680_0169272 3300047322 Bacteria 1582
1064 Ga0495683_0178119 3300047323 Bacteria 973
1065 Ga0495687_005686 3300047443 Bacteria 7869
1066 Ga0495687_091885 3300047443 Bacteria 1160
1067 Ga0495675_0026947 3300047444 Bacteria 3664
1068 Ga0495673_0276378 3300047469 Bacteria 607
1069 Ga0495681_0164783 3300047470 Bacteria 921
1070 Ga0495684_0213402 3300047471 Bacteria 1418
1071 Ga0495684_1036722 3300047471 Bacteria 519
1072 Ga0495686_0103802 3300047472 Bacteria 1712
1073 Ga0495686_0578539 3300047472 Bacteria 584
1074 Ga0495593_0222005 3300047673 Bacteria 948
1075 Ga0495602_0092771 3300048088 Bacteria 2500
1076 Ga0495602_0125194 3300048088 Bacteria 2060
1077 Ga0495626_0162916 3300048091 Bacteria 934
1078 Ga0496100_0203336 3300048903 Bacteria 1445
1079 Ga0496100_0464065 3300048903 Bacteria 972
1080 Ga0496100_1182217 3300048903 Bacteria 603
1081 Ga0496101_0076663 3300048904 Bacteria 2463
1082 Ga0496101_0443713 3300048904 Bacteria 1024
1083 Ga0496101_0980585 3300048904 Bacteria 665
1084 Ga0496102_0052325 3300048905 Bacteria 3720
1085 Ga0496102_1182874 3300048905 Bacteria 684
1086 Ga0496102_1844263 3300048905 Bacteria 522
1087 Ga0496103_0009918 3300048906 Bacteria 5633
1088 Ga0496103_0435099 3300048906 Bacteria 842
1089 Ga0496103_0524638 3300048906 Unclassified 757
1090 Ga0496103_0725685 3300048906 Bacteria 629
1091 Ga0496104_0055763 3300048907 Bacteria 3736
1092 Ga0496104_0058115 3300048907 Bacteria 3660
1093 Ga0496104_0167280 3300048907 Bacteria 2108
1094 Ga0496104_0831400 3300048907 Bacteria 829
1095 Ga0496104_1336728 3300048907 Bacteria 620
1096 Ga0496104_1559141 3300048907 Bacteria 563
1097 Ga0496105_0107446 3300048908 Bacteria 2303
1098 Ga0496105_0413947 3300048908 Bacteria 1068
1099 Ga0496106_0105098 3300048909 Bacteria 2194
1100 Ga0496106_0441862 3300048909 Bacteria 1045
1101 Ga0496106_1570368 3300048909 Bacteria 505
1102 Ga0496107_0751530 3300048910 Bacteria 715
1103 Ga0496108_0005061 3300048911 Bacteria 10650
1104 Ga0496108_0141180 3300048911 Bacteria 2075
1105 Ga0496108_0215381 3300048911 Bacteria 1668
1106 Ga0496108_0731870 3300048911 Bacteria 856
1107 Ga0496108_0936967 3300048911 Bacteria 742
1108 Ga0496108_0959533 3300048911 Bacteria 732
1109 Ga0496108_1084318 3300048911 Bacteria 681
1110 Ga0496108_1393577 3300048911 Bacteria 587
1111 Ga0496109_0003617 3300048912 Bacteria 12923
1112 Ga0496109_0021676 3300048912 Bacteria 5685
1113 Ga0496109_0061636 3300048912 Bacteria 3430
1114 Ga0496109_0090763 3300048912 Bacteria 2826
1115 Ga0496109_0140646 3300048912 Bacteria 2257
1116 Ga0496109_0513538 3300048912 Bacteria 1131
1117 Ga0496109_0742063 3300048912 Bacteria 920
1118 Ga0496110_0001002 3300048913 Bacteria 19876
1119 Ga0496110_0058619 3300048913 Bacteria 3391
1120 Ga0496110_0138102 3300048913 Bacteria 2204
1121 Ga0496110_0900981 3300048913 Bacteria 790
1122 Ga0496110_1017474 3300048913 Bacteria 736
1123 Ga0496111_0004762 3300048914 Bacteria 8612
1124 Ga0496111_0009201 3300048914 Bacteria 6578
1125 Ga0496111_0061999 3300048914 Bacteria 2711
1126 Ga0496111_0114914 3300048914 Bacteria 1984
1127 Ga0496111_1140738 3300048914 Bacteria 554
1128 Ga0496112_0035998 3300048915 Bacteria 4825
1129 Ga0496112_0089073 3300048915 Bacteria 3054
1130 Ga0496112_0275470 3300048915 Bacteria 1630
1131 Ga0496112_0291893 3300048915 Bacteria 1577
1132 Ga0496112_0912800 3300048915 Unclassified 800
1133 Ga0496112_1029678 3300048915 Bacteria 743
1134 Ga0496112_1338460 3300048915 Bacteria 631
1135 Ga0496113_0008012 3300048916 Bacteria 6851
1136 Ga0496113_0125164 3300048916 Bacteria 2012
1137 Ga0496113_0211221 3300048916 Bacteria 1545
1138 Ga0496113_0286936 3300048916 Bacteria 1316
1139 Ga0496113_0300593 3300048916 Bacteria 1285
1140 Ga0496114_1302464 3300048917 Bacteria 613
1141 Ga0496115_0003355 3300048918 Bacteria 11493
1142 Ga0496115_0029999 3300048918 Bacteria 4275
1143 Ga0496115_0130548 3300048918 Bacteria 2070
1144 Ga0496115_0708547 3300048918 Bacteria 791
1145 Ga0496116_0015598 3300048919 Bacteria 5999
1146 Ga0496116_0161594 3300048919 Bacteria 1228
1147 Ga0496116_0394696 3300048919 Bacteria 615
1148 Ga0496117_0128935 3300048920 Bacteria 1537
1149 Ga0496117_0512698 3300048920 Bacteria 579
1150 Ga0496118_0033503 3300048921 Bacteria 4213
1151 Ga0496118_0090210 3300048921 Bacteria 2113
1152 Ga0496118_0135239 3300048921 Bacteria 1574
1153 Ga0496118_0415208 3300048921 Bacteria 694
1154 Ga0496118_0581071 3300048921 Bacteria 540
1155 Ga0496119_0008748 3300048922 Bacteria 8833
1156 Ga0496119_0016625 3300048922 Bacteria 5584
1157 Ga0496119_0035070 3300048922 Bacteria 3293
1158 Ga0496119_0049830 3300048922 Bacteria 2586
1159 Ga0496119_0090351 3300048922 Bacteria 1742
1160 Ga0496119_0379680 3300048922 Bacteria 678
1161 Ga0496120_0012617 3300048923 Bacteria 5736
1162 Ga0496120_0238343 3300048923 Bacteria 860
1163 Ga0496120_0246130 3300048923 Bacteria 841
1164 Ga0496120_0317461 3300048923 Bacteria 709
1165 Ga0496121_0024927 3300048924 Bacteria 5700
1166 Ga0496121_0033653 3300048924 Bacteria 4633
1167 Ga0496121_0048784 3300048924 Bacteria 3598
1168 Ga0496121_0102047 3300048924 Bacteria 2211
1169 Ga0496121_0172983 3300048924 Bacteria 1566
1170 Ga0496121_0257936 3300048924 Bacteria 1205
1171 Ga0496121_0461130 3300048924 Bacteria 816
1172 Ga0496121_0480331 3300048924 Bacteria 794
1173 Ga0496121_0632691 3300048924 Bacteria 655
1174 Ga0496121_0687822 3300048924 Bacteria 617
1175 Ga0496122_0040874 3300048925 Bacteria 3677
1176 Ga0496122_0075619 3300048925 Bacteria 2374
1177 Ga0496122_0079731 3300048925 Bacteria 2286
1178 Ga0496123_0014393 3300048926 Bacteria 6560
1179 Ga0496123_0017468 3300048926 Bacteria 5769
1180 Ga0496123_0053073 3300048926 Bacteria 2683
1181 Ga0496124_0080375 3300048927 Bacteria 2683
1182 Ga0496124_0259342 3300048927 Bacteria 1280
1183 Ga0496124_0437364 3300048927 Bacteria 896
1184 Ga0496124_0451706 3300048927 Bacteria 876
1185 Ga0496124_0617234 3300048927 Bacteria 702
1186 Ga0496124_0697112 3300048927 Bacteria 644
1187 Ga0496124_0726809 3300048927 Bacteria 626
1188 Ga0496125_0000262 3300048928 Bacteria 108389
1189 Ga0496125_0017545 3300048928 Bacteria 6819
1190 Ga0496125_0038460 3300048928 Bacteria 4140
1191 Ga0496125_0067626 3300048928 Bacteria 2814
1192 Ga0496125_0088917 3300048928 Bacteria 2325
1193 Ga0496125_0198145 3300048928 Bacteria 1318
1194 Ga0496125_0276647 3300048928 Bacteria 1043
1195 Ga0496125_0391537 3300048928 Bacteria 815
1196 Ga0496125_0489596 3300048928 Bacteria 695
1197 Ga0496126_0018560 3300048929 Bacteria 6886
1198 Ga0496126_0089962 3300048929 Bacteria 2701
1199 Ga0496126_0125076 3300048929 Bacteria 2226
1200 Ga0496126_0357788 3300048929 Bacteria 1193
1201 Ga0496126_0389176 3300048929 Bacteria 1133
1202 Ga0496126_0657462 3300048929 Bacteria 819
1203 Ga0496126_0916301 3300048929 Bacteria 663
1204 Ga0495682_0093547 3300049460 Bacteria 1079
1205 Ga0501031_0608411 3300049568 Bacteria 703
1206 Ga0501031_0706409 3300049568 Bacteria 647
1207 Ga0501032_0037931 3300049569 Bacteria 3284
1208 Ga0501032_0351675 3300049569 Bacteria 949
1209 Ga0501033_0006182 3300049570 Bacteria 9389
1210 Ga0501033_0047501 3300049570 Bacteria 3191
1211 Ga0501033_0226086 3300049570 Bacteria 1331
1212 Ga0501034_0017794 3300049571 Bacteria 7290
1213 Ga0501034_0126282 3300049571 Bacteria 2543
1214 Ga0501034_0158857 3300049571 Bacteria 2233
1215 Ga0501034_0172394 3300049571 Bacteria 2130
1216 Ga0501034_0191807 3300049571 Bacteria 2005
1217 Ga0501034_0326680 3300049571 Bacteria 1466
1218 Ga0501034_0575975 3300049571 Bacteria 1033
1219 Ga0501036_0418738 3300049572 Bacteria 1117
1220 Ga0501036_1036953 3300049572 Bacteria 671
1221 Ga0501037_0046610 3300049573 Bacteria 3179
1222 Ga0501037_0347326 3300049573 Bacteria 1024
1223 Ga0501038_0064990 3300049574 Bacteria 3110
1224 Ga0501038_1086840 3300049574 Bacteria 584
1225 Ga0501039_0203717 3300049575 Bacteria 1556
1226 Ga0501039_0210449 3300049575 Bacteria 1529
1227 Ga0501039_1163142 3300049575 Bacteria 597
1228 Ga0501040_0766934 3300049576 Bacteria 698
1229 Ga0501041_0147011 3300049577 Bacteria 1471
1230 Ga0501043_0033643 3300049579 Bacteria 4033
1231 Ga0501043_0806277 3300049579 Bacteria 679
1232 Ga0501043_1178112 3300049579 Bacteria 539
1233 Ga0501046_0207259 3300049580 Bacteria 1457
1234 Ga0501046_0522620 3300049580 Bacteria 848
1235 Ga0501047_0015697 3300049581 Bacteria 7216
1236 Ga0501047_0062863 3300049581 Bacteria 3581
1237 Ga0501047_0080773 3300049581 Bacteria 3125
1238 Ga0501047_0711345 3300049581 Bacteria 822
1239 Ga0501048_1246599 3300049582 Bacteria 535
1240 Ga0501048_1273986 3300049582 Bacteria 528
1241 Ga0501067_0084863 3300049583 Bacteria 1757
1242 Ga0501067_0198979 3300049583 Bacteria 1116
1243 Ga0501067_0694980 3300049583 Bacteria 572
1244 Ga0501068_0432187 3300049584 Bacteria 851
1245 Ga0501069_0093494 3300049585 Bacteria 1701
1246 Ga0501070_0147792 3300049586 Bacteria 1939
1247 Ga0501070_0334908 3300049586 Bacteria 1230
1248 Ga0501071_0753297 3300049587 Bacteria 750
1249 Ga0501071_1051523 3300049587 Bacteria 629
1250 Ga0501072_0150759 3300049588 Bacteria 1854
1251 Ga0501072_0379381 3300049588 Bacteria 1122
1252 Ga0501073_0038796 3300049589 Bacteria 3377
1253 Ga0501073_0072139 3300049589 Bacteria 2405
1254 Ga0501073_0399628 3300049589 Bacteria 949
1255 Ga0501073_0752377 3300049589 Bacteria 672
1256 Ga0501073_0842418 3300049589 Bacteria 632
1257 Ga0501074_0129706 3300049590 Bacteria 1804
1258 Ga0501074_0326520 3300049590 Bacteria 1089
1259 Ga0501074_0414922 3300049590 Bacteria 955
1260 Ga0501075_0354297 3300049591 Bacteria 1118
1261 Ga0501076_0324897 3300049592 Bacteria 1262
1262 Ga0501076_0507557 3300049592 Bacteria 994
1263 Ga0501077_0522038 3300049593 Bacteria 762
1264 Ga0501079_0064820 3300049741 Bacteria 2818
1265 Ga0501079_0128929 3300049741 Bacteria 1968
1266 Ga0501079_0256692 3300049741 Bacteria 1366
1267 Ga0501079_1316417 3300049741 Bacteria 569
1268 Ga0501080_0253256 3300049742 Bacteria 1605
1269 Ga0501080_0513373 3300049742 Bacteria 1070
1270 Ga0501080_1092382 3300049742 Bacteria 689
1271 Ga0501081_0445796 3300049743 Bacteria 961
1272 Ga0501081_1251393 3300049743 Bacteria 562
1273 Ga0501083_0350641 3300049744 Bacteria 959
1274 Ga0501083_0423385 3300049744 Bacteria 866
1275 Ga0501035_0019546 3300049822 Bacteria 6224
1276 Ga0501035_0287033 3300049822 Bacteria 1389
1277 Ga0501035_0898876 3300049822 Bacteria 701
1278 Ga0501035_1067954 3300049822 Bacteria 632
1279 Ga0501044_0054329 3300049823 Bacteria 4118
1280 Ga0501044_0068818 3300049823 Bacteria 3605
1281 Ga0501044_0123225 3300049823 Bacteria 2591
1282 Ga0501044_0406082 3300049823 Bacteria 1274
1283 Ga0501044_1221377 3300049823 Bacteria 619
1284 Ga0501045_0063745 3300049824 Bacteria 2705
1285 Ga0501045_0730590 3300049824 Bacteria 730
1286 nmdc:mga03683_506215_c1 3300050489 Bacteria 585
1287 nmdc:mga03683_50712_c1 3300050489 Bacteria 1730
1288 nmdc:mga00v17_71250_c1 3300050491 Bacteria 2154
1289 nmdc:mga00v17_799101_c1 3300050491 Bacteria 601
1290 nmdc:mga00v17_874229_c1 3300050491 Bacteria 570
1291 nmdc:mga00v17_919217_c1 3300050491 Bacteria 553
1292 nmdc:mga0yw44_183525_c1 3300050492 Bacteria 1378
1293 nmdc:mga0yw44_273936_c1 3300050492 Bacteria 1127
1294 nmdc:mga0yw44_28850_c1 3300050492 Bacteria 3197
1295 nmdc:mga0yw44_432640_c1 3300050492 Bacteria 891
1296 nmdc:mga0yw44_550759_c1 3300050492 Bacteria 783
1297 nmdc:mga0yw44_561619_c1 3300050492 Bacteria 775
1298 nmdc:mga0yw44_710704_c1 3300050492 Bacteria 683
1299 nmdc:mga0yw44_771345_c1 3300050492 Bacteria 653
1300 nmdc:mga0yw44_98343_c1 3300050492 Bacteria 1860
1301 nmdc:mga0k408_190297_c2 3300050493 Bacteria 678
1302 nmdc:mga0k408_376202_c1 3300050493 Bacteria 846
1303 nmdc:mga06z11_129696_c1 3300050494 Bacteria 1415
1304 nmdc:mga06z11_896547_c1 3300050494 Bacteria 540
1305 nmdc:mga04h51_294259_c1 3300050495 Bacteria 660
1306 nmdc:mga07m45_206420_c1 3300050496 Bacteria 1143
1307 nmdc:mga07m45_490729_c1 3300050496 Bacteria 711
1308 nmdc:mga07m45_545750_c1 3300050496 Bacteria 670
1309 nmdc:mga07m45_88502_c1 3300050496 Bacteria 1098
1310 nmdc:mga05p37_1483277_c1 3300050507 Bacteria 677
1311 nmdc:mga05p37_1695717_c1 3300050507 Bacteria 616
1312 nmdc:mga05p37_209022_c1 3300050507 Bacteria 2360
1313 nmdc:mga05p37_580366_c1 3300050507 Bacteria 1270
1314 nmdc:mga09592_329002_c1 3300050508 Bacteria 1323
1315 nmdc:mga0qj67_1030041_c1 3300050509 Bacteria 645
1316 nmdc:mga0qj67_430678_c1 3300050509 Bacteria 1063
1317 nmdc:mga0qj67_598672_c1 3300050509 Bacteria 882
1318 nmdc:mga06r32_242332_c1 3300050510 Bacteria 1790
1319 nmdc:mga06r32_724741_c1 3300050510 Bacteria 959
1320 nmdc:mga08y16_111942_c1 3300050511 Bacteria 2842
1321 nmdc:mga08y16_252440_c1 3300050511 Bacteria 1822
1322 nmdc:mga08y16_729579_c1 3300050511 Bacteria 988
1323 nmdc:mga0n895_246685_c1 3300050512 Bacteria 1812
1324 nmdc:mga0rr50_1168712_c1 3300050513 Bacteria 654
1325 nmdc:mga0rr50_1407421_c1 3300050513 Bacteria 590
1326 nmdc:mga0rr50_315375_c1 3300050513 Bacteria 1310
1327 nmdc:mga0rr50_606100_c1 3300050513 Bacteria 934
1328 nmdc:mga08x19_281972_c1 3300050514 Bacteria 1151
1329 nmdc:mga08x19_47478_c1 3300050514 Bacteria 2748
1330 nmdc:mga0a205_1026640_c1 3300050515 Bacteria 672
1331 nmdc:mga0a205_91000_c1 3300050515 Bacteria 2947
1332 nmdc:mga0sz30_35679_c2 3300050516 Bacteria 1580
1333 nmdc:mga0sz30_54283_c1 3300050516 Bacteria 1704
1334 Ga0500635_0287500 3300053080 Bacteria 648
1335 Ga0495595_0127311 3300053084 Bacteria 1243
1336 Ga0495619_0569811 3300053085 Bacteria 776
1337 Ga0495619_0638249 3300053085 Bacteria 727
1338 Ga0495619_0877492 3300053085 Bacteria 604
1339 Ga0500578_0293019 3300053086 Bacteria 967
1340 Ga0500578_0492330 3300053086 Bacteria 691
1341 Ga0500578_0779076 3300053086 Bacteria 507
1342 Ga0500643_000168 3300053087 Bacteria 64858
1343 Ga0500643_086271 3300053087 Bacteria 859
1344 Ga0500643_088126 3300053087 Bacteria 848
1345 Ga0500644_0211214 3300053088 Bacteria 806
1346 Ga0500646_0081418 3300053090 Bacteria 988
1347 Ga0500646_0155112 3300053090 Bacteria 761
1348 Ga0500647_0035653 3300053091 Bacteria 2378
1349 Ga0500583_0116523 3300053092 Bacteria 1319
1350 Ga0500583_0292692 3300053092 Bacteria 798
1351 Ga0500651_0013928 3300053093 Bacteria 4911
1352 Ga0500651_0179768 3300053093 Bacteria 1257
1353 Ga0500566_0003871 3300053094 Bacteria 8930
1354 Ga0500566_0174286 3300053094 Bacteria 1109
1355 Ga0500640_029966 3300053095 Bacteria 2381
1356 Ga0500641_0003143 3300053096 Bacteria 5848
1357 Ga0500641_0092726 3300053096 Bacteria 1290
1358 Ga0500641_0137266 3300053096 Bacteria 1056
1359 Ga0500641_0326009 3300053096 Bacteria 623
1360 Ga0500650_0113406 3300053098 Bacteria 1265
1361 Ga0500654_101895 3300053099 Bacteria 1221
1362 Ga0500554_120981 3300053102 Bacteria 883
1363 Ga0500555_003109 3300053103 Bacteria 4736
1364 Ga0500555_004439 3300053103 Bacteria 3988
1365 Ga0500555_044617 3300053103 Bacteria 1227
1366 Ga0500555_049646 3300053103 Bacteria 1150
1367 Ga0500555_139884 3300053103 Bacteria 597
1368 Ga0500556_0014866 3300053104 Bacteria 2387
1369 Ga0500557_000032 3300053105 Bacteria 74032
1370 Ga0500569_001709 3300053109 Bacteria 4194
1371 Ga0500572_000255 3300053111 Bacteria 19104
1372 Ga0500582_298091 3300053114 Bacteria 500
1373 Ga0500594_0124609 3300053118 Bacteria 811
1374 Ga0500595_007298 3300053119 Bacteria 4589
1375 Ga0500595_050725 3300053119 Bacteria 1287
1376 Ga0500597_243867 3300053120 Bacteria 738
1377 Ga0500607_066935 3300053121 Bacteria 1862
1378 Ga0500614_204203 3300053123 Bacteria 610
1379 Ga0500628_049601 3300053129 Bacteria 992
1380 Ga0500642_0000191 3300053130 Bacteria 24993
1381 Ga0500642_0000197 3300053130 Bacteria 24598
1382 Ga0500642_0050847 3300053130 Bacteria 1829
1383 Ga0500652_106472 3300053131 Bacteria 1172
1384 Ga0500658_0060264 3300053134 Bacteria 1576
1385 Ga0500658_0065575 3300053134 Bacteria 1521
1386 Ga0500658_0077302 3300053134 Bacteria 1417
1387 Ga0500658_0083924 3300053134 Bacteria 1367
1388 Ga0500559_0000299 3300053136 Bacteria 38041
1389 Ga0500559_0321324 3300053136 Bacteria 725
1390 Ga0500564_197766 3300053138 Bacteria 827
1391 Ga0500568_0006561 3300053139 Bacteria 5824
1392 Ga0500568_0016564 3300053139 Bacteria 3272
1393 Ga0500568_0046228 3300053139 Bacteria 1729
1394 Ga0500568_0048140 3300053139 Bacteria 1686
1395 Ga0500568_0054363 3300053139 Bacteria 1566
1396 Ga0500573_0388452 3300053140 Bacteria 665
1397 Ga0500577_0014421 3300053142 Bacteria 2443
1398 Ga0500577_0021338 3300053142 Bacteria 2133
1399 Ga0500577_0445820 3300053142 Bacteria 566
1400 Ga0500588_0011981 3300053146 Bacteria 2138
1401 Ga0500588_0035735 3300053146 Bacteria 1464
1402 Ga0500588_0170826 3300053146 Bacteria 795
1403 Ga0500590_156609 3300053148 Bacteria 1020
1404 Ga0500603_107636 3300053150 Bacteria 834
1405 Ga0500604_0002113 3300053151 Bacteria 5467
1406 Ga0500604_0035106 3300053151 Bacteria 1491
1407 Ga0500604_0035372 3300053151 Bacteria 1486
1408 Ga0500604_0155353 3300053151 Bacteria 778
1409 Ga0500616_0000038 3300053153 Bacteria 386801
1410 Ga0500616_0000702 3300053153 Bacteria 38878
1411 Ga0500616_0002930 3300053153 Bacteria 13590
1412 Ga0500616_0005830 3300053153 Bacteria 8254
1413 Ga0500619_021892 3300053154 Bacteria 1848
1414 Ga0500622_0012455 3300053156 Bacteria 4604
1415 Ga0500624_020053 3300053157 Bacteria 1068
1416 Ga0500624_057038 3300053157 Bacteria 739
1417 Ga0500627_0132726 3300053158 Bacteria 1125
1418 Ga0500627_0136444 3300053158 Bacteria 1108
1419 Ga0500634_0000041 3300053161 Bacteria 59177
1420 Ga0500634_0260871 3300053161 Bacteria 713
1421 Ga0500638_029142 3300053162 Bacteria 2654
1422 Ga0500639_033573 3300053163 Bacteria 2712
1423 Ga0500636_0000659 3300053177 Bacteria 18582
1424 Ga0500636_0058573 3300053177 Bacteria 2251
1425 Ga0500636_0188920 3300053177 Bacteria 1099
1426 Ga0500636_0392719 3300053177 Bacteria 646
1427 Ga0500636_0402115 3300053177 Bacteria 635
1428 Ga0500637_0555206 3300053178 Bacteria 555
1429 Ga0500649_062485 3300053722 Bacteria 1551
1430 Ga0500567_218915 3300053723 Bacteria 608
1431 Ga0500576_033923 3300053725 Bacteria 2313
1432 Ga0500625_144533 3300053729 Bacteria 908
1433 Ga0500645_059279 3300053730 Bacteria 1108
1434 Ga0500609_000077 3300053731 Bacteria 12575
1435 Ga0500609_000771 3300053731 Bacteria 4796
1436 Ga0500609_001181 3300053731 Bacteria 3881
1437 Ga0500656_039060 3300053732 Bacteria 659
1438 Ga0500552_010701 3300053733 Bacteria 1137
1439 Ga0500596_036323 3300053735 Bacteria 776
1440 Ga0500601_000475 3300053737 Bacteria 6405
1441 Ga0500601_037002 3300053737 Bacteria 589
1442 Ga0501084_0566671 3300054114 Bacteria 960
1443 Ga0501084_0581516 3300054114 Bacteria 946
1444 Ga0501082_0103543 3300060353 Bacteria 2462
1445 Ga0501082_0585173 3300060353 Bacteria 976
1446 Ga0530510_0034341 3300061734 Bacteria 3653
1447 2507505971 2507262055 Bacteria 8048963
1448 2508540160 2508501009 Bacteria 7784016
1449 2508696234 2508501042 Bacteria 8719808
1450 2509148161 2508501128 Bacteria 8613869
1451 2511394577 2511231028 Bacteria 8046582
1452 2512034028 2511231221 Bacteria 6846400
1453 2513624879 2513237092 Bacteria 8341956
1454 2513649125 2513237095 Bacteria 8976980
1455 2513674984 2513237098 Bacteria 9902361
1456 2513700191 2513237102 Bacteria 7703324
1457 2513716140 2513237104 Bacteria 10034502
1458 2513877199 2513237139 Bacteria 8737671
1459 2513891561 2513237141 Bacteria 8496279
1460 2513997531 2513237159 Bacteria 6810126
1461 2514014568 2513237161 Bacteria 8871253
1462 2515628486 2515154112 Bacteria 8294334
1463 2516206031 2516143018 Bacteria 6951533
1464 2517103157 2517093001 Bacteria 9002274
1465 2524440790 2524023205 Bacteria 8918781
1466 2528850737 2528768022 Bacteria 10457665
1467 2535484045 2534681786 Bacteria 3308809
1468 2561469046 2558860983 Bacteria 4133860
1469 2585167596 2582581283 Bacteria 6030556
1470 2585265826 2582581306 Bacteria 6450535
1471 2585390016 2582581865 Bacteria 6644329
1472 2585395219 2582581866 Bacteria 6859583
1473 2599722270 2599185236 Bacteria 6875203
1474 2600196029 2599185352 Bacteria 7228948
1475 2617347854 2617270735 Bacteria 9163226
1476 2617374776 2617270741 Bacteria 8201522
1477 2643804429 2643221557 Bacteria 7184309
1478 2644052088 2643221607 Bacteria 6314006
1479 2644065199 2643221610 Bacteria 7480339
1480 2644204881 2643221636 Bacteria 6583769
1481 2644334068 2643221659 Bacteria 7890716
1482 2644377609 2643221668 Bacteria 7306521
1483 2644416871 2643221675 Bacteria 7473456
1484 2644449911 2643221680 Bacteria 7473610
1485 2644484831 2643221686 Bacteria 6310811
1486 2644500611 2643221689 Bacteria 6042950
1487 2644541665 2643221698 Bacteria 7756764
1488 2644672734 2643221723 Bacteria 7095460
1489 2644690046 2643221726 Bacteria 7455827
1490 2715499331 2713897090 Bacteria 3353799
1491 2738944232 2738541317 Bacteria 5340176
1492 2745076031 2744054633 Bacteria 8678936
1493 2753357282 2751185800 Bacteria 5467370
1494 2765464287 2765235802 Bacteria 5618596
1495 2776272581 2775506902 Bacteria 6208009
1496 2776284522 2775506904 Bacteria 5954060
1497 2776914339 2775507049 Bacteria 6284736
1498 2792747035 2791355123 Bacteria 8049106
1499 2793061495 2791355196 Bacteria 7323613
1500 2805916201 2802429603 Bacteria 8777136
1501 2818240516 2816332527 Bacteria 8933356
1502 2824603674 2824600985 Bacteria 8488197
1503 2824610740 2824609381 Bacteria 8672835
1504 2824625154 2824617872 Bacteria 8814715
1505 2824630964 2824626560 Bacteria 8813858
1506 2824642283 2824635225 Bacteria 8785348
1507 2824648301 2824644064 Bacteria 8743947
1508 2824657942 2824653114 Bacteria 8493680
1509 2824666878 2824661429 Bacteria 9877870
1510 2824674055 2824671348 Bacteria 8369588
1511 2824685801 2824679649 Bacteria 8248951
1512 2824690721 2824687955 Bacteria 8360029
1513 2824699942 2824696289 Bacteria 8335049
1514 2824709137 2824704595 Bacteria 9667483
1515 2824719481 2824714736 Bacteria 8717648
1516 2824729095 2824723954 Bacteria 8758240
1517 2824738525 2824732956 Bacteria 7810675
1518 2824753123 2824746037 Bacteria 7911610
1519 2824760313 2824753945 Bacteria 9787441
1520 2824772343 2824763712 Bacteria 9792355
1521 2824776372 2824773399 Bacteria 8360218
1522 2837680680 2837678835 Bacteria 5252418
1523 2838125038 2838122688 Bacteria 8803140
1524 2839994211 2839993093 Bacteria 5512535
1525 2840769398 2840764183 Bacteria 6358399
1526 2841945777 2841941048 Bacteria 8688029
1527 2841956876 2841949485 Bacteria 8680857
1528 2841963998 2841957949 Bacteria 8652217
1529 2841973564 2841966195 Bacteria 8673214
1530 2841981958 2841974524 Bacteria 8931498
1531 2841989452 2841983080 Bacteria 8395090
1532 2842044437 2842038055 Bacteria 8002051
1533 2842051574 2842045827 Bacteria 8006841
1534 2842338241 2842333319 Bacteria 8899485
1535 2842522227 2842521101 Bacteria 6569494
1536 2842779699 2842775625 Bacteria 5587290
1537 2842924495 2842922631 Bacteria 5824079
1538 2844316310 2844315083 Bacteria 8138177
1539 2847939389 2847930680 Bacteria 9342022
1540 2847941146 2847939898 Bacteria 8606328
1541 2849082134 2849076700 Bacteria 7039503
1542 2854685508 2854681122 Bacteria 4548679
1543 2854914136 2854911287 Bacteria 5582813
1544 2855022280 2855020534 Bacteria 3204685
1545 2857513388 2857509624 Bacteria 7472071
1546 2857530216 2857524615 Bacteria 6615449
1547 2874596293 2874590934 Bacteria 8299676
1548 2874616506 2874612657 Bacteria 8252029
1549 2874622524 2874620515 Bacteria 8290088
1550 2874633432 2874628541 Bacteria 8630250
1551 2874650280 2874645413 Bacteria 8214782
1552 2876763689 2876761206 Bacteria 10111113
1553 2876776758 2876771140 Bacteria 8287509
1554 2876824548 2876818435 Bacteria 8274608
1555 2879080895 2879074833 Bacteria 8279565
1556 2879087062 2879083081 Bacteria 8587928
1557 2879133740 2879127579 Bacteria 8294491
1558 2879148242 2879142872 Bacteria 8267021
1559 2881369551 2881364244 Bacteria 7710352
1560 2881669732 2881665667 Bacteria 8175609
1561 2885367802 2885366525 Bacteria 8326213
1562 2885380850 2885374607 Bacteria 8927485
1563 2885412951 2885409591 Bacteria 9235467
1564 2888387193 2888378607 Bacteria 9652610
1565 2888389885 2888388044 Bacteria 7304136
1566 2888421225 2888419890 Bacteria 7857137
1567 2891051061 2891048133 Bacteria 4447501
1568 2894655418 2894652903 Bacteria 4587256
1569 2903728355 2903727486 Bacteria 8281579
1570 2903774766 2903768456 Bacteria 9749579
1571 2904579121 2904578770 Bacteria 5302906
1572 2904671469 2904666416 Bacteria 8226587
1573 2904695100 2904690495 Bacteria 9412302
1574 2904719765 2904711408 Bacteria 9771557
1575 2906606495 2906602504 Bacteria 8295279
1576 2906631387 2906626472 Bacteria 8826946
1577 2906646734 2906643746 Bacteria 8722424
1578 2908756886 2908756301 Bacteria 8864324
1579 2908777257 2908775508 Bacteria 8092255
1580 2913308852 2913308742 Bacteria 5350706
1581 2919122054 2919119836 Bacteria 5208557
1582 2920825669 2920822456 Bacteria 6897201
1583 2922377369
1584 2922389419 2922386360 Bacteria 7017218
1585 2922398461 2922393267 Bacteria 8285685
1586 2929141181 2929138655 Bacteria 5810547
1587 2929204358 2929199973 Bacteria 7260745
1588 2929622162 2929615660 Bacteria 9193770
1589 2929630191 2929624759 Bacteria 9339455
1590 2932787881 2932784394 Bacteria 9704911
1591 2932795999 2932794094 Bacteria 7915132
1592 2932807576 2932801729 Bacteria 7987968
1593 2932835091 2932828146 Bacteria 9745859
1594 2933584223 2933577622 Bacteria 9116884
1595 2935614396 2935608549 Bacteria 8203142
1596 2935620468 2935616580 Bacteria 9032984
1597 2935640791 2935638405 Bacteria 10015038
1598 2935649425 2935648319 Bacteria 8801166
1599 2935657803 2935656913 Bacteria 8965014
1600 2935670294 2935665750 Bacteria 9571747
1601 2935679724 2935675223 Bacteria 9928132
1602 2935687293 2935684952 Bacteria 9590419
1603 2935696736 2935694250 Bacteria 9291695
1604 2935709172 2935703347 Bacteria 10242284
1605 2935718752 2935713505 Bacteria 9608509
1606 2935728404 2935722832 Bacteria 9608746
1607 2935736999 2935732158 Bacteria 9706831
1608 2935745998 2935741537 Bacteria 9707219
1609 2935753259 2935750917 Bacteria 9590372
1610 2935770261 2935769743 Bacteria 7878163
1611 2935777711 2935777560 Bacteria 8077691
1612 2935786686 2935785616 Bacteria 7962367
1613 2935794740 2935793552 Bacteria 8012592
1614 2935809030 2935801545 Bacteria 9301974
1615 2935813790 2935810662 Bacteria 9401221
1616 2935826614 2935819856 Bacteria 8261050
1617 2935832298 2935827899 Bacteria 10038562
1618 2935844003 2935837841 Bacteria 9454360
1619 2935851092 2935847175 Bacteria 8228321
1620 2935862794 2935855204 Bacteria 9035059
1621 2935864537 2935864058 Bacteria 9784707
1622 2935875111 2935873716 Bacteria 9632195
1623 2935887268 2935883170 Bacteria 7964738
1624 2935913142 2935908558 Bacteria 8568796
1625 2935922564 2935916978 Bacteria 9113783
1626 2935930933 2935926038 Bacteria 8601059
1627 2935939733 2935934488 Bacteria 8602579
1628 2935946682 2935942939 Bacteria 8599779
1629 2935956117 2935951376 Bacteria 8602333
1630 2935965022 2935959822 Bacteria 7869783
1631 2935972910 2935967501 Bacteria 8603075
1632 2935978175 2935975950 Bacteria 8347125
1633 2935985701 2935984226 Bacteria 8302647
1634 2935999271 2935992306 Bacteria 9802711
1635 2936005826 2936002035 Bacteria 9362176
1636 2936012022 2936011229 Bacteria 8801034
1637 2936020897 2936019824 Bacteria 8804134
1638 2936029315 2936028420 Bacteria 8965941
1639 2936039346 2936037263 Bacteria 9446081
1640 2936048361 2936046547 Bacteria 8903709
1641 2936056528 2936055302 Bacteria 8785755
1642 2940559172 2940556831 Bacteria 9590747
1643 2941534540 2941531003 Bacteria 7653939
1644 2941541866 2941538514 Bacteria 9402094
1645 2970492430 2970489779 Bacteria 6517260
1646 3000018829 3000017691 Bacteria 3772574
1647 3002142610 3002141150 Bacteria 5254435
1648 3005491119 3005483717 Bacteria 7877331
1649 3005510960 3005506211 Bacteria 6943378
1650 3005592126 3005587118 Bacteria 7794411
1651 3005595923 3005594810 Bacteria 8716512
1652 3005711859 3005710791 Bacteria 7622528
1653 3005719116 3005718088 Bacteria 8283608
1654 8006929759 8006926726 Bacteria 6749210
1655 8016517212 8016511872 Bacteria 9921665
1656 8016527031 8016522445 Bacteria 8156687
1657 8016532110 8016530956 Bacteria 8155261
1658 8016545322 8016539877 Bacteria 8155419
1659 8016556767 8016548790 Bacteria 8155074
1660 8016565122 8016557553 Bacteria 8154380
1661 8016570405 8016566248 Bacteria 8158151
1662 8016582942 8016575299 Bacteria 8154085
1663 8016585360 8016583857 Bacteria 10421953
1664 8016602769 8016595262 Bacteria 8149947
1665 8016605629 8016603502 Bacteria 8731218
1666 8016617544 8016613128 Bacteria 8794220
1667 8016624027 8016622563 Bacteria 7999408
1668 8016634837 8016630954 Bacteria 9217207
1669 8017059378 8017057580 Bacteria 10023680
1670 8019531931 8019530166 Bacteria 8155624
1671 8019539606 8019538911 Bacteria 7872763
1672 8019551051 8019547302 Bacteria 7996444
1673 8019560236 8019555841 Bacteria 9642137
1674 8019570336 8019565922 Bacteria 9639779
1675 8019576241 8019576017 Bacteria 10049540
1676 8019594118 8019586578 Bacteria 10212056
1677 8019607445 8019597564 Bacteria 10041141
1678 8019611065 8019608314 Bacteria 10042931
1679 8019621914 8019619141 Bacteria 9218857
1680 8019639204 8019638758 Bacteria 9062356
1681 8019651355 8019648815 Bacteria 10014479
1682 8019668217 8019659431 Bacteria 8577854
1683 8019677676 8019668869 Bacteria 8791617
1684 8019687269 8019678201 Bacteria 8863603
1685 8019693248 8019687851 Bacteria 8712826
1686 8055432250 8055431914 Bacteria 4551896
1687 8055743588 8055742211 Bacteria 9226248
1688 8055910676 8055909800 Bacteria 7278581
1689 8056678125 8056673599 Bacteria 7871253
1690 8056681662 8056681323 Bacteria 8472857
1691 8056974104 8056967851 Bacteria 9038162
1692 Ga0495600_0000832
1693 RicEn_FSXC74732_b1
1694 JGI25155J39150_1000066
1695 JGI25156J39149_1000075
1696 JGI25154J39366_1000075
1697 JGI25157J39369_1000051
1698 JGI25157J39369_1000077
1699 JGI25159J45721_1000008
1700 JGI25151J46595_10012676
1701 JGI25406J46586_10000225
1702 JGI25406J46586_10063975
1703 JGI25165J46597_1028180
1704 JGI25153J46596_10000082
1705 JGI25153J46596_10000595
1706 JGI25153J46596_10000982
1707 JGI25153J46596_10022500
1708 JGI25153J46596_10039071
1709 JGI25153J46596_10046251
1710 JGI25160J50197_1000033
1711 JGI25160J50197_1002442
1712 JGI25160J50197_1009191
1713 JGI25161J50226_1001354
1714 Ga0006562J51391_1011312
1715 Ga0006562J51391_1011313
1716 JGI25404J52841_10026631
1717 JGI25404J52841_10107003
1718 Ga0055542_1042663
1719 Ga0055526_1005670
1720 Ga0055524_1002859
1721 Ga0055536_1039786
1722 Ga0055531_10011991
1723 Ga0055531_10017995
1724 Ga0055531_10028449
1725 Ga0055543_1000026
1726 Ga0055543_1001915
1727 Ga0065165_1000178
1728 Ga0065165_1001462
1729 Ga0065165_1006394
1730 Ga0065165_1008164
1731 Ga0070658_10125525
1732 Ga0070658_10269850
1733 Ga0070683_100400476
1734 Ga0070670_100027526
1735 Ga0070670_100648980
1736 Ga0068869_100462861
1737 Ga0070666_10000938
1738 Ga0070666_10002179
1739 Ga0070666_10461914
1740 Ga0070666_10792504
1741 Ga0070682_100793374
1742 Ga0068868_100120833
1743 Ga0068868_100207269
1744 Ga0068868_100435331
1745 Ga0068868_100624510
1746 Ga0068868_100754263
1747 Ga0070660_100498844
1748 Ga0070660_101002077
1749 Ga0070660_101071775
1750 Ga0070660_101625457
1751 Ga0070687_100898497
1752 Ga0070661_100091190
1753 Ga0070661_100103251
1754 Ga0070661_100475049
1755 Ga0070668_100076460
1756 Ga0070668_100668251
1757 Ga0070669_100546943
1758 Ga0070675_100691069
1759 Ga0070671_100066518
1760 Ga0070671_100118451
1761 Ga0070671_100419795
1762 Ga0070671_100629849
1763 Ga0070674_100279621
1764 Ga0070673_100061322
1765 Ga0070659_101505210
1766 Ga0070667_100103589
1767 Ga0070667_101453161
1768 Ga0070709_10001415
1769 Ga0070709_10384768
1770 Ga0070714_100013698
1771 Ga0070714_100043813
1772 Ga0070714_100516305
1773 Ga0070714_100812592
1774 Ga0070713_100029447
1775 Ga0070713_100035173
1776 Ga0070713_101332407
1777 Ga0070710_10001980
1778 Ga0070710_10793071
1779 Ga0070711_100048152
1780 Ga0070705_100281784
1781 Ga0070705_101244621
1782 Ga0070694_100026298
1783 Ga0070663_100076650
1784 Ga0070663_100134033
1785 Ga0070663_100231387
1786 Ga0070663_100280610
1787 Ga0070663_100564845
1788 Ga0070663_101246216
1789 Ga0070663_101523805
1790 Ga0070678_101125746
1791 Ga0070678_101141721
1792 Ga0070662_100204055
1793 Ga0070662_100375822
1794 Ga0070662_100608571
1795 Ga0068867_101064157
1796 Ga0068867_101705279
1797 Ga0068867_102045715
1798 Ga0070685_10001247
1799 Ga0070685_10629391
1800 Ga0070706_100087842
1801 Ga0070706_101442302
1802 Ga0070698_100830490
1803 Ga0070679_100416155
1804 Ga0070679_100839175
1805 Ga0070684_100523659
1806 Ga0070684_100585244
1807 Ga0070697_101073120
1808 Ga0068853_100000598
1809 Ga0068853_100093391
1810 Ga0068853_100838175
1811 Ga0068853_101173642
1812 Ga0068853_101518320
1813 Ga0068853_101738571
1814 Ga0070672_100777139
1815 Ga0070686_100138269
1816 Ga0070686_100255065
1817 Ga0070695_100061578
1818 Ga0070695_100968165
1819 Ga0070696_100475766
1820 Ga0070665_100000144
1821 Ga0070665_100002074
1822 Ga0070665_100011926
1823 Ga0070665_100013246
1824 Ga0070665_100032040
1825 Ga0070665_100112798
1826 Ga0070665_100336078
1827 Ga0070665_100775174
1828 Ga0070704_100128764
1829 Ga0068855_100115416
1830 Ga0068855_100282797
1831 Ga0068855_100302799
1832 Ga0068855_100693099
1833 Ga0070664_100457086
1834 Ga0068857_100136620
1835 Ga0068857_100159120
1836 Ga0068857_100607937
1837 Ga0068854_100009801
1838 Ga0068854_100012342
1839 Ga0068854_100056101
1840 Ga0068856_100096137
1841 Ga0068856_100211790
1842 Ga0068856_100414149
1843 Ga0068856_102107612
1844 Ga0068852_100001361
1845 Ga0068852_100116660
1846 Ga0068852_100254911
1847 Ga0068852_100737597
1848 Ga0068852_101485771
1849 Ga0068852_101731291
1850 Ga0068859_100068675
1851 Ga0068859_100564979
1852 Ga0068864_100007889
1853 Ga0068864_100364109
1854 Ga0068864_100448473
1855 Ga0068851_10088483
1856 Ga0068851_10112180
1857 Ga0068863_100000037
1858 Ga0068863_100037516
1859 Ga0068863_100046659
1860 Ga0068863_100223536
1861 Ga0068863_101056514
1862 Ga0068863_101619949
1863 Ga0068858_100000029
1864 Ga0068858_100000416
1865 Ga0068858_100471729
1866 Ga0068858_100895420
1867 Ga0068858_102580495
1868 Ga0068860_100000610
1869 Ga0068860_100114286
1870 Ga0068860_101776018
1871 Ga0068860_102665158
1872 Ga0068862_100005038
1873 Ga0068862_100514950
1874 Ga0068862_100650609
1875 Ga0081455_10016776
1876 Ga0081455_10026682
1877 Ga0081455_10031500
1878 Ga0081455_10323019
1879 Ga0081538_10074861
1880 Ga0081540_1000162
1881 Ga0081540_1000379
1882 Ga0081540_1004532
1883 Ga0081540_1014174
1884 Ga0081540_1033731
1885 Ga0081540_1066967
1886 Ga0081540_1091642
1887 Ga0081540_1106176
1888 Ga0081539_10000801
1889 Ga0081539_10010210
1890 Ga0070717_10044908
1891 Ga0070717_10215363
1892 Ga0070717_10538852
1893 Ga0075365_10094039
1894 Ga0075365_10122863
1895 Ga0075365_10159918
1896 Ga0075365_10191892
1897 Ga0075365_10248735
1898 Ga0075365_10361365
1899 Ga0075368_10029782
1900 Ga0075368_10340335
1901 Ga0075363_100252495
1902 Ga0075363_100359214
1903 Ga0075363_100408291
1904 Ga0075363_101013450
1905 Ga0075364_10114922
1906 Ga0075364_10307839
1907 Ga0075364_10994487
1908 Ga0075432_10011455
1909 Ga0070715_10100755
1910 Ga0070716_100739097
1911 Ga0070712_100011824
1912 Ga0070712_100213292
1913 Ga0075362_10054161
1914 Ga0075362_10224348
1915 Ga0075362_10308810
1916 Ga0075367_10715338
1917 Ga0075369_10011029
1918 Ga0075369_10028654
1919 Ga0075369_10030461
1920 Ga0075369_10348003
1921 Ga0075369_10433177
1922 Ga0075369_10453428
1923 Ga0075366_10419043
1924 Ga0075366_10441905
1925 Ga0097621_100211422
1926 Ga0097621_100542758
1927 Ga0097621_100648202
1928 Ga0075370_10097196
1929 Ga0075370_10223380
1930 Ga0075370_10223785
1931 Ga0075370_10424475
1932 Ga0075370_10468635
1933 Ga0075370_10991942
1934 Ga0075370_10995286
1935 Ga0068871_100617986
1936 Ga0075428_100557058
1937 Ga0075428_100778824
1938 Ga0075428_102305845
1939 Ga0075430_100601900
1940 Ga0075430_100777212
1941 Ga0075430_100810030
1942 Ga0075431_100169253
1943 Ga0075431_100815083
1944 Ga0075429_100228293
1945 Ga0075429_101208563
1946 Ga0075436_100176200
1947 Ga0075436_100314759
1948 Ga0097620_100068675
1949 Ga0097620_100564988
1950 Ga0099824_1020962
1951 Ga0099823_1023273
1952 Ga0079104_1065654
1953 Ga0075435_100078555
1954 Ga0075435_100558593
1955 Ga0075435_101285133
1956 Ga0075435_101302718
1957 Ga0099795_10091163
1958 Ga0099795_10323616
1959 Ga0105251_10069762
1960 Ga0105250_10462498
1961 Ga0105250_10490571
1962 Ga0105240_10000906
1963 Ga0105240_10020715
1964 Ga0105240_10190889
1965 Ga0105240_10391068
1966 Ga0105240_10507292
1967 Ga0105240_10721265
1968 Ga0105240_11045775
1969 Ga0105240_11344387
1970 Ga0111539_10016502
1971 Ga0111539_11095602
1972 Ga0111539_11642657
1973 Ga0105245_10099561
1974 Ga0105245_10120596
1975 Ga0105245_10326876
1976 Ga0105247_10262534
1977 Ga0105247_10922932
1978 Ga0105247_11239282
1979 Ga0114129_10065857
1980 Ga0114129_10554633
1981 Ga0114129_10707709
1982 Ga0114129_10708763
1983 Ga0114129_11676250
1984 Ga0114129_12766504
1985 Ga0105243_10085767
1986 Ga0105243_10142913
1987 Ga0105243_11700857
1988 Ga0105241_10058129
1989 Ga0105241_10081720
1990 Ga0105241_10214916
1991 Ga0105241_10358587
1992 Ga0105241_10606121
1993 Ga0105241_10974794
1994 Ga0105241_11952100
1995 Ga0105241_12120477
1996 Ga0105242_10248285
1997 Ga0105242_10316963
1998 Ga0105242_11482615
1999 Ga0105242_12029122
2000 Ga0105248_10121106
2001 Ga0105248_10311374
2002 Ga0105248_10425081
2003 Ga0105248_11133207
2004 Ga0105237_10000768
2005 Ga0105237_10034618
2006 Ga0105237_10105484
2007 Ga0105237_10185435
2008 Ga0105237_10353218
2009 Ga0105237_10390180
2010 Ga0105237_10394759
2011 Ga0105237_10780348
2012 Ga0105237_11197889
2013 Ga0105237_12099693
2014 Ga0105237_12511515
2015 Ga0105238_10037476
2016 Ga0105238_10054946
2017 Ga0105238_10059189
2018 Ga0105238_10060050
2019 Ga0105238_10063273
2020 Ga0105238_10086639
2021 Ga0105238_10135292
2022 Ga0105238_10227960
2023 Ga0105238_10497883
2024 Ga0105238_10511163
2025 Ga0105238_10946299
2026 Ga0105238_11526223
2027 Ga0105238_12174350
2028 Ga0105249_10013373
2029 Ga0105249_10454865
2030 Ga0099796_10090755
2031 Ga0099796_10138296
2032 Ga0105239_10000846
2033 Ga0105239_10009303
2034 Ga0105239_10014928
2035 Ga0105239_10097555
2036 Ga0105239_10288032
2037 Ga0105239_10327199
2038 Ga0105239_10390393
2039 Ga0105239_10398331
2040 Ga0105239_10458925
2041 Ga0105239_10799132
2042 Ga0105239_11023502
2043 Ga0105239_11185436
2044 Ga0105239_11675732
2045 Ga0105239_11840572
2046 Ga0105239_12685967
2047 Ga0105246_10088471
2048 Ga0105246_11564809
2049 Ga0105246_11686401
2050 Ga0105246_12258735
2051 Ga0157342_1057251
2052 Ga0157373_10838269
2053 Ga0157371_10022848
2054 Ga0157371_10341159
2055 Ga0157370_10007830
2056 Ga0157370_10409387
2057 Ga0157370_10678802
2058 Ga0157369_10422318
2059 Ga0171463_1007
2060 Ga0157374_10072574
2061 Ga0157374_10313533
2062 Ga0157374_10410884
2063 Ga0157378_10015322
2064 Ga0157378_10357821
2065 Ga0157378_10411110
2066 Ga0157378_11292257
2067 Ga0163162_10101266
2068 Ga0163162_10224326
2069 Ga0163162_11608189
2070 Ga0163162_12279075
2071 Ga0157372_10254990
2072 Ga0157372_10440349
2073 Ga0157375_11117528
2074 Ga0157375_11825182
2075 Ga0157375_13323844
2076 Ga0163163_10047824
2077 Ga0163163_10060022
2078 Ga0163163_10169415
2079 Ga0163163_10217856
2080 Ga0163163_10314559
2081 Ga0157380_10881439
2082 Ga0182008_10166788
2083 Ga0182008_10466190
2084 Ga0157379_10034956
2085 Ga0157379_10314220
2086 Ga0157379_11197775
2087 Ga0157376_11156297
2088 Ga0157376_12647181
2089 Ga0157376_13053723
2090 Ga0183363_1259
2091 Ga0163161_10522430
2092 Ga0197907_10317020
2093 Ga0206353_10434026
2094 Ga0214544_1000011
2095 Ga0214542_1000009
2096 Ga0214545_1000007
2097 Ga0214543_1000020
2098 Ga0213873_10012381
2099 Ga0213873_10015537
2100 Ga0213873_10179808
2101 Ga0213872_10004352
2102 Ga0213872_10035915
2103 Ga0213872_10126948
2104 Ga0213872_10240571
2105 Ga0213872_10470543
2106 Ga0213874_10200151
2107 Ga0213876_10015403
2108 Ga0213871_10031702
2109 Ga0209435_100005
2110 Ga0209436_101180
2111 Ga0209563_100718
2112 Ga0209258_128199
2113 Ga0209646_1000011
2114 Ga0209026_1000008
2115 Ga0209026_1012371
2116 Ga0209026_1028587
2117 Ga0209026_1032988
2118 Ga0209677_100400
2119 Ga0209677_103245
2120 Ga0209148_1000321
2121 Ga0209148_1001029
2122 Ga0209759_1000004
2123 Ga0209233_1003560
2124 Ga0209233_1009331
2125 Ga0209233_1024852
2126 Ga0209233_1027633
2127 Ga0209233_1038593
2128 Ga0209233_1049905
2129 Ga0209455_1002441
2130 Ga0209455_1013650
2131 Ga0209673_1060114
2132 Ga0209130_1000017
2133 Ga0209676_1006987
2134 Ga0209025_1000153
2135 Ga0209025_1040142
2136 Ga0209564_1000013
2137 Ga0209564_1018331
2138 Ga0209564_1078132
2139 Ga0209758_1000119
2140 Ga0209758_1000206
2141 Ga0209758_1000536
2142 Ga0209758_1001853
2143 Ga0209758_1002042
2144 Ga0209758_1006010
2145 Ga0209758_1016012
2146 Ga0209758_1036437
2147 Ga0209758_1044493
2148 Ga0209050_1000029
2149 Ga0209050_1005510
2150 Ga0209050_1013688
2151 Ga0209256_1000211
2152 Ga0209256_1004227
2153 Ga0209256_1005602
2154 Ga0209256_1096731
2155 Ga0207426_1000006
2156 Ga0207426_1000870
2157 Ga0207426_1003803
2158 Ga0207426_1004991
2159 Ga0207426_1068848
2160 Ga0209051_1048380
2161 Ga0209257_1000271
2162 Ga0209257_1000301
2163 Ga0209257_1000394
2164 Ga0209257_1011550
2165 Ga0209257_1020690
2166 Ga0209257_1030953
2167 Ga0209257_1082005
2168 Ga0209257_1130115
2169 Ga0207697_10184810
2170 Ga0207656_10051320
2171 Ga0207656_10055558
2172 Ga0207692_10012356
2173 Ga0207692_10072441
2174 Ga0207692_10118555
2175 Ga0207710_10183941
2176 Ga0207710_10342768
2177 Ga0207710_10544739
2178 Ga0207688_10265382
2179 Ga0207680_10001600
2180 Ga0207680_10003166
2181 Ga0207680_10120654
2182 Ga0207680_11363288
2183 Ga0207647_10001114
2184 Ga0207647_10016170
2185 Ga0207685_10028515
2186 Ga0207685_10273612
2187 Ga0207699_10000352
2188 Ga0207699_10107452
2189 Ga0207699_10411699
2190 Ga0207645_10206179
2191 Ga0207705_10070467
2192 Ga0207654_10033099
2193 Ga0207654_10143253
2194 Ga0207654_10254110
2195 Ga0207654_10300211
2196 Ga0207654_10401781
2197 Ga0207654_10497670
2198 Ga0207707_10353100
2199 Ga0207695_10000040
2200 Ga0207695_10025575
2201 Ga0207695_10027614
2202 Ga0207695_10161780
2203 Ga0207695_10425339
2204 Ga0207695_10652637
2205 Ga0207695_10826123
2206 Ga0207695_10922875
2207 Ga0207695_11148006
2208 Ga0207671_10000361
2209 Ga0207671_10015883
2210 Ga0207671_10083610
2211 Ga0207671_10227144
2212 Ga0207671_10245203
2213 Ga0207671_10262805
2214 Ga0207671_10522646
2215 Ga0207693_10024896
2216 Ga0207663_10002073
2217 Ga0207663_10010518
2218 Ga0207663_10742139
2219 Ga0207663_11020323
2220 Ga0207663_11321817
2221 Ga0207660_10488825
2222 Ga0207657_10251288
2223 Ga0207657_10530903
2224 Ga0207657_10818198
2225 Ga0207649_10018924
2226 Ga0207649_10071728
2227 Ga0207649_10177173
2228 Ga0207649_10309295
2229 Ga0207649_10688860
2230 Ga0207681_11155970
2231 Ga0207694_10001195
2232 Ga0207694_10002483
2233 Ga0207694_10030886
2234 Ga0207694_10034603
2235 Ga0207694_10120291
2236 Ga0207694_10127691
2237 Ga0207694_10219474
2238 Ga0207694_10449401
2239 Ga0207694_10471166
2240 Ga0207694_10566684
2241 Ga0207694_10968306
2242 Ga0207694_11743758
2243 Ga0207650_10021597
2244 Ga0207650_10517836
2245 Ga0207650_10758429
2246 Ga0207650_10946865
2247 Ga0207659_10737055
2248 Ga0207687_10155441
2249 Ga0207700_10031588
2250 Ga0207700_10167948
2251 Ga0207700_11085087
2252 Ga0207700_11400064
2253 Ga0207664_10044956
2254 Ga0207664_10073306
2255 Ga0207664_10894476
2256 Ga0207644_10212348
2257 Ga0207644_10477105
2258 Ga0207644_11006629
2259 Ga0207644_11058168
2260 Ga0207644_11566838
2261 Ga0207690_10676498
2262 Ga0207706_10188835
2263 Ga0207706_10198515
2264 Ga0207706_10380681
2265 Ga0207686_10156225
2266 Ga0207709_11062388
2267 Ga0207670_10801955
2268 Ga0207670_10881774
2269 Ga0207670_11516482
2270 Ga0207669_10898035
2271 Ga0207669_11705851
2272 Ga0207665_10156483
2273 Ga0207665_10174443
2274 Ga0207665_10177685
2275 Ga0207665_11201030
2276 Ga0207665_11586644
2277 Ga0207691_10276597
2278 Ga0207691_11063922
2279 Ga0207711_10066476
2280 Ga0207711_10604005
2281 Ga0207711_11185576
2282 Ga0207711_11186868
2283 Ga0207661_10523945
2284 Ga0207679_11334797
2285 Ga0207679_11359299
2286 Ga0207667_10169996
2287 Ga0207667_10182625
2288 Ga0207667_10283454
2289 Ga0207667_10718834
2290 Ga0207667_11200819
2291 Ga0207667_11291788
2292 Ga0207651_10032659
2293 Ga0207651_11517973
2294 Ga0207712_10324405
2295 Ga0207668_10077230
2296 Ga0207640_10018949
2297 Ga0207640_10101491
2298 Ga0207640_10115178
2299 Ga0207640_11608913
2300 Ga0207640_12140402
2301 Ga0207640_12187397
2302 Ga0207658_10003350
2303 Ga0207658_10083678
2304 Ga0207658_11677434
2305 Ga0207658_11907967
2306 Ga0207658_12017879
2307 Ga0207677_10187579
2308 Ga0207677_10331893
2309 Ga0207677_11814911
2310 Ga0207703_10000429
2311 Ga0207703_10001132
2312 Ga0207703_10081368
2313 Ga0207703_10853229
2314 Ga0207703_11646875
2315 Ga0207639_10000308
2316 Ga0207639_10000858
2317 Ga0207639_11170875
2318 Ga0207678_10074670
2319 Ga0207678_10091454
2320 Ga0207678_10093155
2321 Ga0207678_10285644
2322 Ga0207678_10325731
2323 Ga0207678_10683875
2324 Ga0207678_10694369
2325 Ga0207678_10908163
2326 Ga0207678_10963984
2327 Ga0207678_11922870
2328 Ga0207702_10001580
2329 Ga0207702_10099364
2330 Ga0207702_10126406
2331 Ga0207702_10152645
2332 Ga0207702_10393248
2333 Ga0207702_10625891
2334 Ga0207641_10000034
2335 Ga0207641_10008638
2336 Ga0207641_10708877
2337 Ga0207641_11525582
2338 Ga0207641_12459991
2339 Ga0207648_10105574
2340 Ga0207648_10159531
2341 Ga0207676_10000202
2342 Ga0207676_10003773
2343 Ga0207676_10143239
2344 Ga0207676_10404232
2345 Ga0207676_11983090
2346 Ga0207674_10037382
2347 Ga0207674_10393199
2348 Ga0207674_10454657
2349 Ga0207674_10486232
2350 Ga0207674_10890276
2351 Ga0207675_100316872
2352 Ga0207675_102712301
2353 Ga0207683_10304083
2354 Ga0207683_10520202
2355 Ga0207683_10823559
2356 Ga0207698_10005879
2357 Ga0207698_10009260
2358 Ga0207698_10194806
2359 Ga0207698_10347305
2360 Ga0207698_10664838
2361 Ga0207698_10780659
2362 Ga0207698_11654014
2363 Ga0207698_11949232
2364 Ga0209281_1070928
2365 Ga0209389_1000034
2366 Ga0209389_1000039
2367 Ga0209589_1000038
2368 Ga0209489_100023
2369 Ga0209489_100087
2370 Ga0209700_100090
2371 Ga0209179_1047920
2372 Ga0209813_10158514
2373 Ga0209813_10262334
2374 Ga0207428_10051956
2375 Ga0207428_10068908
2376 Ga0268266_10000003
2377 Ga0268266_10000008
2378 Ga0268266_10000086
2379 Ga0268266_10033319
2380 Ga0268266_10047500
2381 Ga0268266_10199386
2382 Ga0268266_10320253
2383 Ga0268265_10011219
2384 Ga0268265_10312136
2385 Ga0268265_11056938
2386 Ga0268264_10000194
2387 Ga0268264_10848359
2388 Ga0268264_10991337
2389 Ga0268264_11732992
2390 Ga0268264_11954783
2391 Ga0265337_1004679
2392 Ga0265326_10001084
2393 Ga0265319_1004856
2394 Ga0265319_1065409
2395 Ga0265334_10003918
2396 Ga0265318_10029465
2397 Ga0265318_10069342
2398 Ga0265318_10167416
2399 Ga0265323_10001297
2400 Ga0265322_10074888
2401 Ga0265336_10000620
2402 Ga0307517_10000200
2403 Ga0307517_10377461
2404 Ga0307517_10466557
2405 Ga0307515_10000017
2406 Ga0307515_10001155
2407 Ga0307515_10009128
2408 Ga0265338_10001434
2409 Ga0265338_10109509
2410 Ga0265338_10972480
2411 Ga0265324_10002184
2412 Ga0265324_10108124
2413 Ga0307512_10112280
2414 Ga0265332_10200301
2415 Ga0265332_10289098
2416 Ga0265328_10155256
2417 Ga0265328_10271102
2418 Ga0265320_10075795
2419 Ga0265325_10006538
2420 Ga0265325_10009438
2421 Ga0265325_10227246
2422 Ga0265329_10058269
2423 Ga0265329_10166878
2424 Ga0265340_10001678
2425 Ga0265340_10032481
2426 Ga0265340_10075438
2427 Ga0265340_10114786
2428 Ga0265331_10021780
2429 Ga0265331_10064808
2430 Ga0265331_10135888
2431 Ga0265331_10141382
2432 Ga0265327_10003183
2433 Ga0265327_10027477
2434 Ga0265327_10156539
2435 Ga0265316_10265257
2436 Ga0265316_10343827
2437 Ga0265316_10418871
2438 Ga0265316_11268221
2439 Ga0307513_10000852
2440 Ga0307513_10002169
2441 Ga0307513_10084803
2442 Ga0307513_10132190
2443 Ga0307513_11085111
2444 Ga0307509_10000115
2445 Ga0307509_10605560
2446 Ga0307408_100076769
2447 Ga0307408_100888614
2448 Ga0307408_101269491
2449 Ga0265313_10031074
2450 Ga0265313_10194519
2451 Ga0307508_10011570
2452 Ga0307508_10049419
2453 Ga0307508_10075275
2454 Ga0307508_10271173
2455 Ga0316575_10074038
2456 Ga0265314_10065760
2457 Ga0265314_10101750
2458 Ga0265314_10135802
2459 Ga0265314_10198905
2460 Ga0265342_10105466
2461 Ga0265342_10205207
2462 Ga0265342_10547188
2463 Ga0316576_10537020
2464 Ga0307516_10000029
2465 Ga0307516_10366324
2466 Ga0307516_10445344
2467 Ga0307410_11155952
2468 Ga0307407_10167016
2469 Ga0307407_11387629
2470 Ga0307409_100249540
2471 Ga0307409_102956189
2472 Ga0307416_100473599
2473 Ga0307416_101874870
2474 Ga0307411_11053823
2475 Ga0316583_10058542
2476 Ga0307510_10051340
2477 Ga0307510_10105648
2478 Ga0307510_10356649
2479 Ga0307510_10492470
2480 Ga0373938_0245460
2481 Ga0373926_0085038
2482 Ga0373926_0271087
2483 Ga0373928_0245085
2484 Ga0373940_0026875
2485 Ga0373940_0305113
2486 Ga0373944_0003979
2487 Ga0373951_0177728
2488 Ga0373932_0138135
2489 Ga0373936_0332489
2490 Ga0373939_0045189
2491 Ga0373941_0315002
2492 Ga0373953_0127756
2493 Ga0373954_0104993
2494 Ga0373957_0008983
2495 Ga0373943_0085914
2496 Ga0373943_0186214
2497 Ga0373943_0195356
2498 Ga0373946_0067975
2499 Ga0373961_0190804
2500 Ga0373962_0306855
2501 Ga0316574_0000161
2502 Ga0373931_0005928
2503 Ga0373931_0519344
2504 Ga0373931_0726162
2505 Ga0373935_0218330
2506 Ga0373927_0000155
2507 Ga0373927_0090786
2508 Ga0373927_0218513
2509 Ga0373947_0120662
2510 Ga0373947_0233356
2511 Ga0373947_0518297
2512 Ga0373947_0796061
2513 Ga0373937_0002250
2514 Ga0373937_0094799
2515 Ga0373937_1607474
2516 Ga0316582_0163544
2517 Ga0316584_0008065
2518 Ga0373925_0000050
2519 Ga0373925_0633260
2520 Ga0395899_0049253
2521 Ga0395899_0106177
2522 Ga0395899_0480008
2523 Ga0395899_0733907
2524 Ga0395900_0003044
2525 Ga0395900_0049001
2526 Ga0395900_0229886
2527 Ga0395900_0374247
2528 Ga0395900_0608026
2529 Ga0395900_0877385
2530 Ga0395900_1369596
2531 Ga0395898_0003078
2532 Ga0395898_0116788
2533 Ga0395898_0117951
2534 Ga0395898_0357161
2535 Ga0395898_1021522
2536 Ga0395898_1390515
2537 Ga0395905_0001273
2538 Ga0395905_0178258
2539 Ga0395905_0182365
2540 Ga0395905_0221863
2541 Ga0395905_1452281
2542 Ga0395905_1818690
2543 Ga0395905_1877897
2544 Ga0436364_0407990
2545 Ga0436364_0561975
2546 Ga0436364_1280483
2547 Ga0436364_1290587
2548 Ga0436364_1382664
2549 Ga0395901_0022715
2550 Ga0395901_0261930
2551 Ga0395901_0787307
2552 Ga0400483_113437
2553 Ga0436365_0071066
2554 Ga0436365_0089719
2555 Ga0436365_0097049
2556 Ga0436365_0176700
2557 Ga0436365_0478528
2558 Ga0436365_0652448
2559 Ga0436365_0987719
2560 Ga0436365_1901637
2561 Ga0436365_1912355
2562 Ga0436360_0107966
2563 Ga0436360_0560001
2564 Ga0436360_0659897
2565 Ga0436360_1276140
2566 Ga0436360_1336701
2567 Ga0436361_0123394
2568 Ga0436361_0126524
2569 Ga0436361_0259266
2570 Ga0436361_0275557
2571 Ga0436361_0344369
2572 Ga0436361_0433996
2573 Ga0436361_0564472
2574 Ga0436361_0585344
2575 Ga0436361_0590022
2576 Ga0436361_1147896
2577 Ga0436363_0659025
2578 Ga0436363_0766421
2579 Ga0436363_0786529
2580 Ga0436363_0903263
2581 Ga0436363_1146700
2582 Ga0436363_1592292
2583 Ga0436362_0242406
2584 Ga0436362_0466387
2585 Ga0436362_1077664
2586 Ga0439436_0003632
2587 Ga0439438_031950
2588 Ga0439439_0227969
2589 Ga0439447_017777
2590 Ga0439465_0003746
2591 Ga0439465_0099729
2592 Ga0439465_0378543
2593 Ga0451789_1302564
2594 Ga0451793_0870755
2595 Ga0451802_0383790
2596 Ga0451833_0407321
2597 Ga0451833_0737184
2598 Ga0451833_1325230
2599 Ga0451833_1417654
2600 Ga0451847_0260825
2601 Ga0451849_0406743
2602 Ga0451849_0912448
2603 Ga0451853_0820542
2604 Ga0451853_2029874
2605 Ga0451853_4114360
2606 Ga0439445_0034436
2607 Ga0439445_0201410
2608 Ga0439432_061721
2609 Ga0439449_0020329
2610 Ga0439462_0029571
2611 Ga0450912_026150
2612 Ga0450920_006886
2613 Ga0450906_005298
2614 Ga0450907_014165
2615 Ga0450910_051659
2616 Ga0439458_0147696
2617 Ga0450918_002227
2618 Ga0451577_1361144
2619 Ga0466969_0134804
2620 Ga0466972_0000053
2621 Ga0466972_0004635
2622 Ga0466972_0304231
2623 Ga0466965_0106903
2624 Ga0466965_0395966
2625 Ga0466965_0583269
2626 Ga0466966_0003689
2627 Ga0466966_0494001
2628 Ga0466961_0004648
2629 Ga0466961_0426019
2630 Ga0466963_0870803
2631 Ga0466963_1045763
2632 Ga0466964_0054370
2633 Ga0466964_0854536
2634 Ga0453684_0508793
2635 Ga0466971_0432648
2636 Ga0466968_0001220
2637 Ga0466970_0101279
2638 Ga0466970_0230458
2639 Ga0466957_0395124
2640 Ga0466957_0503763
2641 Ga0466960_0009742
2642 Ga0466960_0013395
2643 Ga0466960_0793258
2644 Ga0466959_0002926
2645 Ga0466959_0195198
2646 Ga0451576_0000194
2647 Ga0451576_1630076
2648 Ga0466958_0192720
2649 Ga0466967_0139418
2650 Ga0466967_0638282
2651 Ga0466967_0773688
2652 Ga0466967_1465549
2653 Ga0495627_123321
2654 Ga0495592_0043578
2655 Ga0495592_0087729
2656 Ga0495603_0070143
2657 Ga0495590_0217065
2658 Ga0495629_0003885
2659 Ga0495638_0002872
2660 Ga0495638_0058306
2661 Ga0495638_0409065
2662 Ga0495651_0005311
2663 Ga0495651_0026825
2664 Ga0495653_0284276
2665 Ga0495650_0336504
2666 Ga0495580_0204314
2667 Ga0495605_0285771
2668 Ga0495664_0166292
2669 Ga0495664_0728822
2670 Ga0495596_0130914
2671 Ga0495607_0091356
2672 Ga0495606_0076424
2673 Ga0495606_0137801
2674 Ga0495606_0192182
2675 Ga0495606_0209552
2676 Ga0495606_0219766
2677 Ga0495610_0291090
2678 Ga0495616_0201254
2679 Ga0495618_0035880
2680 Ga0495620_0054254
2681 Ga0495628_0103744
2682 Ga0495628_0684683
2683 Ga0495643_0127233
2684 Ga0495643_0143795
2685 Ga0495648_0055521
2686 Ga0495648_0237903
2687 Ga0495666_0179598
2688 Ga0495666_0527791
2689 Ga0495652_0082534
2690 Ga0495652_0095736
2691 Ga0495652_0218829
2692 Ga0495654_0321195
2693 Ga0495640_0019349
2694 Ga0495640_0032240
2695 Ga0495586_0856004
2696 Ga0495587_0185731
2697 Ga0495587_0297556
2698 Ga0495609_0092136
2699 Ga0495609_0184469
2700 Ga0495609_0267792
2701 Ga0495609_0290807
2702 Ga0495597_0027670
2703 Ga0495597_0171342
2704 Ga0495645_0384559
2705 Ga0495622_0016703
2706 Ga0495622_0049422
2707 Ga0495622_0053966
2708 Ga0495633_0208489
2709 Ga0495667_0202232
2710 Ga0495668_0068816
2711 Ga0495668_0207226
2712 Ga0495668_0259317
2713 Ga0495668_0765814
2714 Ga0495634_0107967
2715 Ga0495611_0096248
2716 Ga0495611_0330549
2717 Ga0495625_0052558
2718 Ga0495625_0210390
2719 Ga0495625_0221718
2720 Ga0495625_0226986
2721 Ga0495635_0009411
2722 Ga0495661_0038077
2723 Ga0495661_0442437
2724 Ga0495588_0032954
2725 Ga0495588_0681564
2726 Ga0495657_0011877
2727 Ga0495599_0046793
2728 Ga0495599_0579137
2729 Ga0495623_0202565
2730 Ga0495623_0271605
2731 Ga0495646_0261083
2732 Ga0495646_0373711
2733 Ga0495658_0972039
2734 Ga0495613_0033862
2735 Ga0495613_0041620
2736 Ga0495624_0150720
2737 Ga0495649_0028321
2738 Ga0495649_0065029
2739 Ga0495589_0178156
2740 Ga0495600_0711700
2741 Ga0495581_0074513
2742 Ga0495604_0010490
2743 Ga0495604_0100979
2744 Ga0495604_0296360
2745 Ga0495674_0042102
2746 Ga0495674_0122217
2747 Ga0495672_0046408
2748 Ga0495672_0150739
2749 Ga0495672_0155635
2750 Ga0495672_0338301
2751 Ga0495672_0366175
2752 Ga0495676_0022307
2753 Ga0495680_0035033
2754 Ga0495680_0169272
2755 Ga0495683_0178119
2756 Ga0495687_005686
2757 Ga0495687_091885
2758 Ga0495675_0026947
2759 Ga0495673_0276378
2760 Ga0495681_0164783
2761 Ga0495684_0213402
2762 Ga0495684_1036722
2763 Ga0495686_0103802
2764 Ga0495686_0578539
2765 Ga0495593_0222005
2766 Ga0495602_0092771
2767 Ga0495602_0125194
2768 Ga0495626_0162916
2769 Ga0496100_0203336
2770 Ga0496100_0464065
2771 Ga0496100_1182217
2772 Ga0496101_0076663
2773 Ga0496101_0443713
2774 Ga0496101_0980585
2775 Ga0496102_0052325
2776 Ga0496102_1182874
2777 Ga0496102_1844263
2778 Ga0496103_0009918
2779 Ga0496103_0435099
2780 Ga0496103_0524638
2781 Ga0496103_0725685
2782 Ga0496104_0055763
2783 Ga0496104_0058115
2784 Ga0496104_0167280
2785 Ga0496104_0831400
2786 Ga0496104_1336728
2787 Ga0496104_1559141
2788 Ga0496105_0107446
2789 Ga0496105_0413947
2790 Ga0496106_0105098
2791 Ga0496106_0441862
2792 Ga0496106_1570368
2793 Ga0496107_0751530
2794 Ga0496108_0005061
2795 Ga0496108_0141180
2796 Ga0496108_0215381
2797 Ga0496108_0731870
2798 Ga0496108_0936967
2799 Ga0496108_0959533
2800 Ga0496108_1084318
2801 Ga0496108_1393577
2802 Ga0496109_0003617
2803 Ga0496109_0021676
2804 Ga0496109_0061636
2805 Ga0496109_0090763
2806 Ga0496109_0140646
2807 Ga0496109_0513538
2808 Ga0496109_0742063
2809 Ga0496110_0001002
2810 Ga0496110_0058619
2811 Ga0496110_0138102
2812 Ga0496110_0900981
2813 Ga0496110_1017474
2814 Ga0496111_0004762
2815 Ga0496111_0009201
2816 Ga0496111_0061999
2817 Ga0496111_0114914
2818 Ga0496111_1140738
2819 Ga0496112_0035998
2820 Ga0496112_0089073
2821 Ga0496112_0275470
2822 Ga0496112_0291893
2823 Ga0496112_0912800
2824 Ga0496112_1029678
2825 Ga0496112_1338460
2826 Ga0496113_0008012
2827 Ga0496113_0125164
2828 Ga0496113_0211221
2829 Ga0496113_0286936
2830 Ga0496113_0300593
2831 Ga0496114_1302464
2832 Ga0496115_0003355
2833 Ga0496115_0029999
2834 Ga0496115_0130548
2835 Ga0496115_0708547
2836 Ga0496116_0015598
2837 Ga0496116_0161594
2838 Ga0496116_0394696
2839 Ga0496117_0128935
2840 Ga0496117_0512698
2841 Ga0496118_0033503
2842 Ga0496118_0090210
2843 Ga0496118_0135239
2844 Ga0496118_0415208
2845 Ga0496118_0581071
2846 Ga0496119_0008748
2847 Ga0496119_0016625
2848 Ga0496119_0035070
2849 Ga0496119_0049830
2850 Ga0496119_0090351
2851 Ga0496119_0379680
2852 Ga0496120_0012617
2853 Ga0496120_0238343
2854 Ga0496120_0246130
2855 Ga0496120_0317461
2856 Ga0496121_0024927
2857 Ga0496121_0033653
2858 Ga0496121_0048784
2859 Ga0496121_0102047
2860 Ga0496121_0172983
2861 Ga0496121_0257936
2862 Ga0496121_0461130
2863 Ga0496121_0480331
2864 Ga0496121_0632691
2865 Ga0496121_0687822
2866 Ga0496122_0040874
2867 Ga0496122_0075619
2868 Ga0496122_0079731
2869 Ga0496123_0014393
2870 Ga0496123_0017468
2871 Ga0496123_0053073
2872 Ga0496124_0080375
2873 Ga0496124_0259342
2874 Ga0496124_0437364
2875 Ga0496124_0451706
2876 Ga0496124_0617234
2877 Ga0496124_0697112
2878 Ga0496124_0726809
2879 Ga0496125_0000262
2880 Ga0496125_0017545
2881 Ga0496125_0038460
2882 Ga0496125_0067626
2883 Ga0496125_0088917
2884 Ga0496125_0198145
2885 Ga0496125_0276647
2886 Ga0496125_0391537
2887 Ga0496125_0489596
2888 Ga0496126_0018560
2889 Ga0496126_0089962
2890 Ga0496126_0125076
2891 Ga0496126_0357788
2892 Ga0496126_0389176
2893 Ga0496126_0657462
2894 Ga0496126_0916301
2895 Ga0495682_0093547
2896 Ga0501031_0608411
2897 Ga0501031_0706409
2898 Ga0501032_0037931
2899 Ga0501032_0351675
2900 Ga0501033_0006182
2901 Ga0501033_0047501
2902 Ga0501033_0226086
2903 Ga0501034_0017794
2904 Ga0501034_0126282
2905 Ga0501034_0158857
2906 Ga0501034_0172394
2907 Ga0501034_0191807
2908 Ga0501034_0326680
2909 Ga0501034_0575975
2910 Ga0501036_0418738
2911 Ga0501036_1036953
2912 Ga0501037_0046610
2913 Ga0501037_0347326
2914 Ga0501038_0064990
2915 Ga0501038_1086840
2916 Ga0501039_0203717
2917 Ga0501039_0210449
2918 Ga0501039_1163142
2919 Ga0501040_0766934
2920 Ga0501041_0147011
2921 Ga0501043_0033643
2922 Ga0501043_0806277
2923 Ga0501043_1178112
2924 Ga0501046_0207259
2925 Ga0501046_0522620
2926 Ga0501047_0015697
2927 Ga0501047_0062863
2928 Ga0501047_0080773
2929 Ga0501047_0711345
2930 Ga0501048_1246599
2931 Ga0501048_1273986
2932 Ga0501067_0084863
2933 Ga0501067_0198979
2934 Ga0501067_0694980
2935 Ga0501068_0432187
2936 Ga0501069_0093494
2937 Ga0501070_0147792
2938 Ga0501070_0334908
2939 Ga0501071_0753297
2940 Ga0501071_1051523
2941 Ga0501072_0150759
2942 Ga0501072_0379381
2943 Ga0501073_0038796
2944 Ga0501073_0072139
2945 Ga0501073_0399628
2946 Ga0501073_0752377
2947 Ga0501073_0842418
2948 Ga0501074_0129706
2949 Ga0501074_0326520
2950 Ga0501074_0414922
2951 Ga0501075_0354297
2952 Ga0501076_0324897
2953 Ga0501076_0507557
2954 Ga0501077_0522038
2955 Ga0501079_0064820
2956 Ga0501079_0128929
2957 Ga0501079_0256692
2958 Ga0501079_1316417
2959 Ga0501080_0253256
2960 Ga0501080_0513373
2961 Ga0501080_1092382
2962 Ga0501081_0445796
2963 Ga0501081_1251393
2964 Ga0501083_0350641
2965 Ga0501083_0423385
2966 Ga0501035_0019546
2967 Ga0501035_0287033
2968 Ga0501035_0898876
2969 Ga0501035_1067954
2970 Ga0501044_0054329
2971 Ga0501044_0068818
2972 Ga0501044_0123225
2973 Ga0501044_0406082
2974 Ga0501044_1221377
2975 Ga0501045_0063745
2976 Ga0501045_0730590
2977 nmdc:mga03683_506215_c1
2978 nmdc:mga03683_50712_c1
2979 nmdc:mga00v17_71250_c1
2980 nmdc:mga00v17_799101_c1
2981 nmdc:mga00v17_874229_c1
2982 nmdc:mga00v17_919217_c1
2983 nmdc:mga0yw44_183525_c1
2984 nmdc:mga0yw44_273936_c1
2985 nmdc:mga0yw44_28850_c1
2986 nmdc:mga0yw44_432640_c1
2987 nmdc:mga0yw44_550759_c1
2988 nmdc:mga0yw44_561619_c1
2989 nmdc:mga0yw44_710704_c1
2990 nmdc:mga0yw44_771345_c1
2991 nmdc:mga0yw44_98343_c1
2992 nmdc:mga0k408_190297_c2
2993 nmdc:mga0k408_376202_c1
2994 nmdc:mga06z11_129696_c1
2995 nmdc:mga06z11_896547_c1
2996 nmdc:mga04h51_294259_c1
2997 nmdc:mga07m45_206420_c1
2998 nmdc:mga07m45_490729_c1
2999 nmdc:mga07m45_545750_c1
3000 nmdc:mga07m45_88502_c1
3001 nmdc:mga05p37_1483277_c1
3002 nmdc:mga05p37_1695717_c1
3003 nmdc:mga05p37_209022_c1
3004 nmdc:mga05p37_580366_c1
3005 nmdc:mga09592_329002_c1
3006 nmdc:mga0qj67_1030041_c1
3007 nmdc:mga0qj67_430678_c1
3008 nmdc:mga0qj67_598672_c1
3009 nmdc:mga06r32_242332_c1
3010 nmdc:mga06r32_724741_c1
3011 nmdc:mga08y16_111942_c1
3012 nmdc:mga08y16_252440_c1
3013 nmdc:mga08y16_729579_c1
3014 nmdc:mga0n895_246685_c1
3015 nmdc:mga0rr50_1168712_c1
3016 nmdc:mga0rr50_1407421_c1
3017 nmdc:mga0rr50_315375_c1
3018 nmdc:mga0rr50_606100_c1
3019 nmdc:mga08x19_281972_c1
3020 nmdc:mga08x19_47478_c1
3021 nmdc:mga0a205_1026640_c1
3022 nmdc:mga0a205_91000_c1
3023 nmdc:mga0sz30_35679_c2
3024 nmdc:mga0sz30_54283_c1
3025 Ga0500635_0287500
3026 Ga0495595_0127311
3027 Ga0495619_0569811
3028 Ga0495619_0638249
3029 Ga0495619_0877492
3030 Ga0500578_0293019
3031 Ga0500578_0492330
3032 Ga0500578_0779076
3033 Ga0500643_000168
3034 Ga0500643_086271
3035 Ga0500643_088126
3036 Ga0500644_0211214
3037 Ga0500646_0081418
3038 Ga0500646_0155112
3039 Ga0500647_0035653
3040 Ga0500583_0116523
3041 Ga0500583_0292692
3042 Ga0500651_0013928
3043 Ga0500651_0179768
3044 Ga0500566_0003871
3045 Ga0500566_0174286
3046 Ga0500640_029966
3047 Ga0500641_0003143
3048 Ga0500641_0092726
3049 Ga0500641_0137266
3050 Ga0500641_0326009
3051 Ga0500650_0113406
3052 Ga0500654_101895
3053 Ga0500554_120981
3054 Ga0500555_003109
3055 Ga0500555_004439
3056 Ga0500555_044617
3057 Ga0500555_049646
3058 Ga0500555_139884
3059 Ga0500556_0014866
3060 Ga0500557_000032
3061 Ga0500569_001709
3062 Ga0500572_000255
3063 Ga0500582_298091
3064 Ga0500594_0124609
3065 Ga0500595_007298
3066 Ga0500595_050725
3067 Ga0500597_243867
3068 Ga0500607_066935
3069 Ga0500614_204203
3070 Ga0500628_049601
3071 Ga0500642_0000191
3072 Ga0500642_0000197
3073 Ga0500642_0050847
3074 Ga0500652_106472
3075 Ga0500658_0060264
3076 Ga0500658_0065575
3077 Ga0500658_0077302
3078 Ga0500658_0083924
3079 Ga0500559_0000299
3080 Ga0500559_0321324
3081 Ga0500564_197766
3082 Ga0500568_0006561
3083 Ga0500568_0016564
3084 Ga0500568_0046228
3085 Ga0500568_0048140
3086 Ga0500568_0054363
3087 Ga0500573_0388452
3088 Ga0500577_0014421
3089 Ga0500577_0021338
3090 Ga0500577_0445820
3091 Ga0500588_0011981
3092 Ga0500588_0035735
3093 Ga0500588_0170826
3094 Ga0500590_156609
3095 Ga0500603_107636
3096 Ga0500604_0002113
3097 Ga0500604_0035106
3098 Ga0500604_0035372
3099 Ga0500604_0155353
3100 Ga0500616_0000038
3101 Ga0500616_0000702
3102 Ga0500616_0002930
3103 Ga0500616_0005830
3104 Ga0500619_021892
3105 Ga0500622_0012455
3106 Ga0500624_020053
3107 Ga0500624_057038
3108 Ga0500627_0132726
3109 Ga0500627_0136444
3110 Ga0500634_0000041
3111 Ga0500634_0260871
3112 Ga0500638_029142
3113 Ga0500639_033573
3114 Ga0500636_0000659
3115 Ga0500636_0058573
3116 Ga0500636_0188920
3117 Ga0500636_0392719
3118 Ga0500636_0402115
3119 Ga0500637_0555206
3120 Ga0500649_062485
3121 Ga0500567_218915
3122 Ga0500576_033923
3123 Ga0500625_144533
3124 Ga0500645_059279
3125 Ga0500609_000077
3126 Ga0500609_000771
3127 Ga0500609_001181
3128 Ga0500656_039060
3129 Ga0500552_010701
3130 Ga0500596_036323
3131 Ga0500601_000475
3132 Ga0500601_037002
3133 Ga0501084_0566671
3134 Ga0501084_0581516
3135 Ga0501082_0103543
3136 Ga0501082_0585173
3137 Ga0530510_0034341
3138 2507505971
3139 2508540160
3140 2508696234
3141 2509148161
3142 2511394577
3143 2512034028
3144 2513624879
3145 2513649125
3146 2513674984
3147 2513700191
3148 2513716140
3149 2513877199
3150 2513891561
3151 2513997531
3152 2514014568
3153 2515628486
3154 2516206031
3155 2517103157
3156 2524440790
3157 2528850737
3158 2535484045
3159 2561469046
3160 2585167596
3161 2585265826
3162 2585390016
3163 2585395219
3164 2599722270
3165 2600196029
3166 2617347854
3167 2617374776
3168 2643804429
3169 2644052088
3170 2644065199
3171 2644204881
3172 2644334068
3173 2644377609
3174 2644416871
3175 2644449911
3176 2644484831
3177 2644500611
3178 2644541665
3179 2644672734
3180 2644690046
3181 2715499331
3182 2738944232
3183 2745076031
3184 2753357282
3185 2765464287
3186 2776272581
3187 2776284522
3188 2776914339
3189 2792747035
3190 2793061495
3191 2805916201
3192 2818240516
3193 2824603674
3194 2824610740
3195 2824625154
3196 2824630964
3197 2824642283
3198 2824648301
3199 2824657942
3200 2824666878
3201 2824674055
3202 2824685801
3203 2824690721
3204 2824699942
3205 2824709137
3206 2824719481
3207 2824729095
3208 2824738525
3209 2824753123
3210 2824760313
3211 2824772343
3212 2824776372
3213 2837680680
3214 2838125038
3215 2839994211
3216 2840769398
3217 2841945777
3218 2841956876
3219 2841963998
3220 2841973564
3221 2841981958
3222 2841989452
3223 2842044437
3224 2842051574
3225 2842338241
3226 2842522227
3227 2842779699
3228 2842924495
3229 2844316310
3230 2847939389
3231 2847941146
3232 2849082134
3233 2854685508
3234 2854914136
3235 2855022280
3236 2857513388
3237 2857530216
3238 2874596293
3239 2874616506
3240 2874622524
3241 2874633432
3242 2874650280
3243 2876763689
3244 2876776758
3245 2876824548
3246 2879080895
3247 2879087062
3248 2879133740
3249 2879148242
3250 2881369551
3251 2881669732
3252 2885367802
3253 2885380850
3254 2885412951
3255 2888387193
3256 2888389885
3257 2888421225
3258 2891051061
3259 2894655418
3260 2903728355
3261 2903774766
3262 2904579121
3263 2904671469
3264 2904695100
3265 2904719765
3266 2906606495
3267 2906631387
3268 2906646734
3269 2908756886
3270 2908777257
3271 2913308852
3272 2919122054
3273 2920825669
3274 2922377369
3275 2922389419
3276 2922398461
3277 2929141181
3278 2929204358
3279 2929622162
3280 2929630191
3281 2932787881
3282 2932795999
3283 2932807576
3284 2932835091
3285 2933584223
3286 2935614396
3287 2935620468
3288 2935640791
3289 2935649425
3290 2935657803
3291 2935670294
3292 2935679724
3293 2935687293
3294 2935696736
3295 2935709172
3296 2935718752
3297 2935728404
3298 2935736999
3299 2935745998
3300 2935753259
3301 2935770261
3302 2935777711
3303 2935786686
3304 2935794740
3305 2935809030
3306 2935813790
3307 2935826614
3308 2935832298
3309 2935844003
3310 2935851092
3311 2935862794
3312 2935864537
3313 2935875111
3314 2935887268
3315 2935913142
3316 2935922564
3317 2935930933
3318 2935939733
3319 2935946682
3320 2935956117
3321 2935965022
3322 2935972910
3323 2935978175
3324 2935985701
3325 2935999271
3326 2936005826
3327 2936012022
3328 2936020897
3329 2936029315
3330 2936039346
3331 2936048361
3332 2936056528
3333 2940559172
3334 2941534540
3335 2941541866
3336 2970492430
3337 3000018829
3338 3002142610
3339 3005491119
3340 3005510960
3341 3005592126
3342 3005595923
3343 3005711859
3344 3005719116
3345 8006929759
3346 8016517212
3347 8016527031
3348 8016532110
3349 8016545322
3350 8016556767
3351 8016565122
3352 8016570405
3353 8016582942
3354 8016585360
3355 8016602769
3356 8016605629
3357 8016617544
3358 8016624027
3359 8016634837
3360 8017059378
3361 8019531931
3362 8019539606
3363 8019551051
3364 8019560236
3365 8019570336
3366 8019576241
3367 8019594118
3368 8019607445
3369 8019611065
3370 8019621914
3371 8019639204
3372 8019651355
3373 8019668217
3374 8019677676
3375 8019687269
3376 8019693248
3377 8055432250
3378 8055743588
3379 8055910676
3380 8056678125
3381 8056681662
3382 8056974104

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00547

Urease_gamma

Urease, gamma subunit

1

95

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6zo0-assembly1.cif.gz_AAA 2.23 a resolution 3,4-dimethylcatechol (3,4-dimethylbenzene-1,2-diol) inhibited sporosarcina pasteurii urease 0.9784 2 100
4fur-assembly1.cif.gz_A crystal structure of urease subunit gamma 2 from brucella melitensis biovar abortus 2308 0.9782 1 100
2fvh-assembly1.cif.gz_C crystal structure of rv1848, a urease gamma subunit urea (urea amidohydrolase), from mycobacterium tuberculosis 0.9773 2 100
2ubp-assembly1.cif.gz_A structure of native urease from bacillus pasteurii 0.9746 1 100
1a5k-assembly1.cif.gz_A k217e variant of klebsiella aerogenes urease 0.9707 1 100
ID Description Score Start End Superfamily
1a5kA00 Alpha Beta;2-Layer Sandwich;Urease; subunit A;Urease, gamma-like subunit 0.9707 1 100 3.30.280.10
4gy7A01 Alpha Beta;2-Layer Sandwich;Urease; subunit A;Urease, gamma-like subunit 0.9613 4 100 3.30.280.10
4gy7A01 Alpha Beta;2-Layer Sandwich;Urease; subunit A;Urease, gamma-like subunit 0.9242 4 100 3.30.280.10
4x28D02 Mainly Beta;Beta Barrel;Butyryl-CoA Dehydrogenase, subunit A; domain 2;Butyryl-CoA Dehydrogenase, subunit A, domain 2 0.7032 74 96 2.40.110.10
af_Q04457_5_543_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.6899 78 98 3.40.50.1820
ID Description Score Start End GO Terms
AF-T0ZPP4-F1-model_v4 Urease, gamma subunit region domain protein (EC 3.5.1.5) 1.006 40 100 GO:0009039
GO:0016151
GO:0043419
AF-A0A7X6IQS9-F1-model_v4 deleted 1.005 40 100
AF-A0A848Y6D5-F1-model_v4 Urease subunit gamma (EC 3.5.1.5) 1.003 12 100 GO:0005737
GO:0009039
GO:0016151
GO:0043419
AF-A0A6M0C757-F1-model_v4 Urease subunit gamma (EC 3.5.1.5) 1.003 29 100 GO:0005737
GO:0009039
GO:0016151
GO:0043419
AF-A0A2S9GPV6-F1-model_v4 Urease subunit gamma (EC 3.5.1.5) 1.003 22 93 GO:0005737
GO:0009039
GO:0016151
GO:0043419

Map