F495355
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1691 | 813 | 3382 | 99 |
Family's Representative Sequence
| Representative Sequence | 3300046809|Ga0495600_0000832|Ga0495600_0000832_5187_5477 |
| Length | 96 |
| Sequence | MNLSPREKDKLLISMAAIVARRRLDRGVKLNHPEAIAIISDFILEGRTVAELMQSGAQVLSRDQVMPGIPEMIHDIQVEATFPDGTKLVTVHEPIR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 2 | 2010549000 | Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes | Metagenome | Endosphere |
| 3 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 4 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 5 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 6 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 7 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 8 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 9 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 10 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 11 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 12 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 13 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 14 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 15 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 16 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 17 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 18 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 19 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 20 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 21 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 22 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 23 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 27 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 30 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 52 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 56 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 59 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 66 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 68 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 69 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 70 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 71 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 72 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 73 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 74 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 75 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 76 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 77 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 78 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 79 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 80 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 81 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 82 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 84 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 85 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 86 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 87 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 88 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 89 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 90 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 91 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 92 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 93 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 94 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 95 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 97 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 98 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 99 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 100 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 101 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 102 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 103 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 105 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 106 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 107 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 108 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 109 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 124 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 127 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013249 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 | Metagenome | Rhizosphere |
| 132 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 140 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 143 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 145 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 146 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 147 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 148 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 149 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 150 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 151 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 152 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 153 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 154 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 155 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 156 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 160 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 161 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 164 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 167 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 170 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 171 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 172 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 173 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 174 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 176 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 177 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 235 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 236 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 237 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 238 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 239 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 241 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 242 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 246 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 247 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 248 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 249 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 250 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 251 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 252 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 253 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 254 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 255 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 256 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 257 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 258 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 259 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 260 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 261 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 262 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 263 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 264 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 265 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 266 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 267 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 268 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 269 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 270 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 271 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 272 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 273 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 274 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 275 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 276 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 277 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 278 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 279 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 280 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 281 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 282 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 283 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 284 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 285 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 286 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 287 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 288 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 289 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 290 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 291 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 292 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 293 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 294 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 295 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 296 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 297 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 298 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 299 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 300 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 301 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 302 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 303 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 304 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 305 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 306 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 307 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 308 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 309 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 310 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 311 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 312 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 313 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 314 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 315 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 316 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 317 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 318 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 319 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 320 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 321 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 322 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 323 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 324 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 325 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 326 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 327 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 328 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 329 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 330 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 331 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 332 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 333 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 334 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 335 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 336 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 337 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 338 | 3300042116 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 | Metagenome | Rhizosphere |
| 339 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 340 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 341 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 342 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 343 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 344 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 345 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 346 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 347 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 348 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 349 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 350 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 351 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 352 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 353 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 354 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 355 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 356 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 357 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 358 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 359 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 360 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 361 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 362 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 363 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 430 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 431 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 432 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 433 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 434 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 435 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 436 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 437 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 438 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 439 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 440 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 441 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 442 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 443 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 444 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 445 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 446 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 447 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 448 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 449 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 450 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 451 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 452 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 453 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 454 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 455 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 456 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 458 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 459 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 460 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 461 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 462 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 463 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 464 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 465 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 466 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 467 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 468 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 469 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 470 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 471 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 472 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 473 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 474 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 475 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 476 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 477 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 478 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 479 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 480 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 481 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 482 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 483 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 484 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 485 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 486 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 487 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 488 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 489 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 490 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 491 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 492 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 493 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 494 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 495 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 496 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 497 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 498 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 499 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 500 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 501 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 502 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 503 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 504 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 505 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 506 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 507 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 508 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 509 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 510 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 511 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 512 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 513 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 514 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 515 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 516 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 517 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 518 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 519 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 520 | 3300053099 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere | Metagenome | Endosphere |
| 521 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 522 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 523 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 524 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 525 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 526 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 527 | 3300053114 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 endosphere | Metagenome | Endosphere |
| 528 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 529 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 530 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 531 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 532 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 533 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 534 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 535 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 536 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 537 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 538 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 539 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 540 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 541 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 542 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 543 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 544 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 545 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 546 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 547 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 548 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 549 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 550 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 551 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 552 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 553 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 554 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 555 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 556 | 3300053722 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere | Metagenome | Endosphere |
| 557 | 3300053723 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere | Metagenome | Endosphere |
| 558 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 559 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 560 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 561 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 562 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 563 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 564 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 565 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 566 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 567 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 568 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 569 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 570 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 571 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 572 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 573 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 574 | 2511231221 | Azospirillum lipoferum 4B | Isolate | Rhizosphere |
| 575 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 576 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 577 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 578 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 579 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 580 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 581 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 582 | 2513237159 | Rhizobium giardinii bv. giardinii H152 | Isolate | Nodule |
| 583 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 584 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 585 | 2516143018 | Ensifer sp. BR816 | Isolate | Nodule |
| 586 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 587 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 588 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 589 | 2534681786 | Brucella suis 92/29 | Isolate | Unclassified |
| 590 | 2558860983 | Allorhizobium undicola ATCC 700741 | Isolate | Rhizoplane |
| 591 | 2582581283 | Rhizobium sp. OK665 | Isolate | Rhizosphere |
| 592 | 2582581306 | Rhizobium sp. YR295 | Isolate | Rhizosphere |
| 593 | 2582581865 | Rhizobium sp. CF258 | Isolate | Rhizosphere |
| 594 | 2582581866 | Rhizobium sp. CF097 | Isolate | Rhizosphere |
| 595 | 2599185236 | Rhizobium sp. NFR07 | Isolate | Rhizoplane |
| 596 | 2599185352 | Sinorhizobium sp. NFACC03 | Isolate | Rhizoplane |
| 597 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 598 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 599 | 2643221557 | Ensifer sp. Root558 | Isolate | Unclassified |
| 600 | 2643221607 | Rhizobium sp. Root73 | Isolate | Unclassified |
| 601 | 2643221610 | Ensifer sp. Root74 | Isolate | Unclassified |
| 602 | 2643221636 | Rhizobium sp. Root1204 | Isolate | Unclassified |
| 603 | 2643221659 | Ensifer sp. Root127 | Isolate | Unclassified |
| 604 | 2643221668 | Ensifer sp. Root423 | Isolate | Unclassified |
| 605 | 2643221675 | Ensifer sp. Root1298 | Isolate | Unclassified |
| 606 | 2643221680 | Ensifer sp. Root1312 | Isolate | Unclassified |
| 607 | 2643221686 | Rhizobium sp. Root1334 | Isolate | Unclassified |
| 608 | 2643221689 | Rhizobium sp. Root483D2 | Isolate | Unclassified |
| 609 | 2643221698 | Ensifer sp. Root142 | Isolate | Unclassified |
| 610 | 2643221723 | Ensifer sp. Root278 | Isolate | Unclassified |
| 611 | 2643221726 | Ensifer sp. Root954 | Isolate | Unclassified |
| 612 | 2713897090 | Paracoccus sphaerophysae HAMBI 3106 | Isolate | Nodule |
| 613 | 2738541317 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 614 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 615 | 2751185800 | Brucella pituitosa AA2 | Isolate | Unclassified |
| 616 | 2765235802 | Phyllobacterium bourgognense 31-25a | Isolate | Rhizoplane |
| 617 | 2775506902 | Phyllobacterium zundukense Tri-48 | Isolate | Unclassified |
| 618 | 2775506904 | Phyllobacterium zundukense Tri-38 | Isolate | Unclassified |
| 619 | 2775507049 | Rhizobium sp. ACO-34A | Isolate | Unclassified |
| 620 | 2791355123 | Mesorhizobium sophorae ICMP 19535 | Isolate | Unclassified |
| 621 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 622 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 623 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 624 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 625 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 626 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 627 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 628 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 629 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 630 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 631 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 632 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 633 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 634 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 635 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 636 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 637 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 638 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 639 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 640 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 641 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 642 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 643 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 644 | 2837678835 | Jiella endophytica CBS5Q-3 | Isolate | Unclassified |
| 645 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 646 | 2839993093 | Phyllobacterium endophyticum PEPV15 | Isolate | Unclassified |
| 647 | 2840764183 | Phyllobacterium sophorae CCBAU 03422 | Isolate | Unclassified |
| 648 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 649 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 650 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 651 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 652 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 653 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 654 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 655 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 656 | 2842333319 | Skermanella aerolata SEMIA 4010 | Isolate | Nodule |
| 657 | 2842521101 | Rhizobium giardinii SEMIA 4084 | Isolate | Nodule |
| 658 | 2842775625 | Roseomonas sp. R-71825 | Isolate | Unclassified |
| 659 | 2842922631 | Pararhizobium sp. R-72066 | Isolate | Unclassified |
| 660 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 661 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 662 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 663 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 664 | 2854681122 | Luteovulum sphaeroides SCJ | Isolate | Unclassified |
| 665 | 2854911287 | Brucella lupini LUP21 | Isolate | Unclassified |
| 666 | 2855020534 | Paracoccus endophyticus SYSUP0003 | Isolate | Stem Tuber |
| 667 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 668 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 669 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 670 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 671 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 672 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 673 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 674 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 675 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 676 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 677 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 678 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 679 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 680 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 681 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 682 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 683 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 684 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 685 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 686 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 687 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 688 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 689 | 2891048133 | Martelella lutilitoris GH2-6 | Isolate | Rhizosphere |
| 690 | 2894652903 | Phyllobacterium sp. SYP-B3895 | Isolate | Rhizosphere |
| 691 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 692 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 693 | 2904578770 | Phyllobacterium sp. 586 | Isolate | Unclassified |
| 694 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 695 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 696 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 697 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 698 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 699 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 700 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 701 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 702 | 2913308742 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 703 | 2919119836 | Phyllobacterium sp. 1468 | Isolate | Rhizosphere |
| 704 | 2920822456 | Ensifer sesbaniae CCBAU 65729 | Isolate | Unclassified |
| 705 | 2922368715 | |||
| 706 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 707 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 708 | 2929138655 | Agrobacterium sp. R-72433 Hybrid assembly | Isolate | Unclassified |
| 709 | 2929199973 | Roseomonas sp. R-73070 Hybrid assembly | Isolate | Unclassified |
| 710 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 711 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 712 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 713 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 714 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 715 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 716 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 717 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 718 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 719 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 720 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 721 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 722 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 723 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 724 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 725 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 726 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 727 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 728 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 729 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 730 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 731 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 732 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 733 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 734 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 735 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 736 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 737 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 738 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 739 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 740 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 741 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 742 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 743 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 744 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 745 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 746 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 747 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 748 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 749 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 750 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 751 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 752 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 753 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 754 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 755 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 756 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 757 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 758 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 759 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 760 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 761 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 762 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 763 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 764 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 765 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 766 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 767 | 2970489779 | Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 | Isolate | Nodule |
| 768 | 3000017691 | Rhodobacteraceae bacterium GH2-2 | Isolate | Rhizosphere |
| 769 | 3002141150 | Phyllobacterium sp. 628 | Isolate | Unclassified |
| 770 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 771 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 772 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 773 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 774 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 775 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 776 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 777 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 778 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 779 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 780 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 781 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 782 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 783 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 784 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 785 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 786 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 787 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 788 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 789 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 790 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 791 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 792 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 793 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 794 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 795 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 796 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 797 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 798 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 799 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 800 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 801 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 802 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 803 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 804 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 805 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 806 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 807 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 808 | 8055431914 | Allorhizobium sonneratiae BGMRC 0089 | Isolate | Unclassified |
| 809 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 810 | 8055909800 | Plastoroseomonas hellenica LMG 31523 | Isolate | Unclassified |
| 811 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 812 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 813 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 85.33 |
| Metatranscriptomes | 0.24 |
| Isolates | 14.44 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 14.55 |
| Nodule | 9.34 |
| Rhizoplane | 4.38 |
| Rhizosphere | 58.84 |
| Stem | 0 |
| Stem Tuber | 0.06 |
| Unclassified | 0.3 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495600_0000832 | 3300046809 | Bacteria | 16425 |
| 2 | RicEn_FSXC74732_b1 | 2010549000 | Bacteria | 829 |
| 3 | JGI25155J39150_1000066 | 3300002704 | Bacteria | 69429 |
| 4 | JGI25156J39149_1000075 | 3300002705 | Bacteria | 76505 |
| 5 | JGI25154J39366_1000075 | 3300002738 | Bacteria | 91249 |
| 6 | JGI25157J39369_1000051 | 3300002741 | Bacteria | 111770 |
| 7 | JGI25157J39369_1000077 | 3300002741 | Bacteria | 86251 |
| 8 | JGI25159J45721_1000008 | 3300002987 | Bacteria | 172667 |
| 9 | JGI25151J46595_10012676 | 3300003187 | Bacteria | 3826 |
| 10 | JGI25406J46586_10000225 | 3300003203 | Bacteria | 24945 |
| 11 | JGI25406J46586_10063975 | 3300003203 | Bacteria | 1177 |
| 12 | JGI25165J46597_1028180 | 3300003214 | Bacteria | 725 |
| 13 | JGI25153J46596_10000082 | 3300003215 | Bacteria | 112797 |
| 14 | JGI25153J46596_10000595 | 3300003215 | Bacteria | 22097 |
| 15 | JGI25153J46596_10000982 | 3300003215 | Bacteria | 17303 |
| 16 | JGI25153J46596_10022500 | 3300003215 | Bacteria | 2321 |
| 17 | JGI25153J46596_10039071 | 3300003215 | Bacteria | 1487 |
| 18 | JGI25153J46596_10046251 | 3300003215 | Bacteria | 1291 |
| 19 | JGI25160J50197_1000033 | 3300003354 | Bacteria | 172667 |
| 20 | JGI25160J50197_1002442 | 3300003354 | Bacteria | 8653 |
| 21 | JGI25160J50197_1009191 | 3300003354 | Bacteria | 3689 |
| 22 | JGI25161J50226_1001354 | 3300003374 | Bacteria | 7530 |
| 23 | Ga0006562J51391_1011312 | 3300003578 | Bacteria | 3280 |
| 24 | Ga0006562J51391_1011313 | 3300003578 | Bacteria | 650 |
| 25 | JGI25404J52841_10026631 | 3300003659 | Bacteria | 1244 |
| 26 | JGI25404J52841_10107003 | 3300003659 | Unclassified | 587 |
| 27 | Ga0055542_1042663 | 3300003762 | Bacteria | 529 |
| 28 | Ga0055526_1005670 | 3300003771 | Bacteria | 7088 |
| 29 | Ga0055524_1002859 | 3300003775 | Bacteria | 8655 |
| 30 | Ga0055536_1039786 | 3300003781 | Bacteria | 1125 |
| 31 | Ga0055531_10011991 | 3300003794 | Bacteria | 4118 |
| 32 | Ga0055531_10017995 | 3300003794 | Bacteria | 2946 |
| 33 | Ga0055531_10028449 | 3300003794 | Bacteria | 1927 |
| 34 | Ga0055543_1000026 | 3300004625 | Bacteria | 136177 |
| 35 | Ga0055543_1001915 | 3300004625 | Bacteria | 7463 |
| 36 | Ga0065165_1000178 | 3300005262 | Bacteria | 113319 |
| 37 | Ga0065165_1001462 | 3300005262 | Bacteria | 25451 |
| 38 | Ga0065165_1006394 | 3300005262 | Bacteria | 6198 |
| 39 | Ga0065165_1008164 | 3300005262 | Bacteria | 4974 |
| 40 | Ga0070658_10125525 | 3300005327 | Bacteria | 2136 |
| 41 | Ga0070658_10269850 | 3300005327 | Bacteria | 1447 |
| 42 | Ga0070683_100400476 | 3300005329 | Bacteria | 1309 |
| 43 | Ga0070670_100027526 | 3300005331 | Bacteria | 4890 |
| 44 | Ga0070670_100648980 | 3300005331 | Bacteria | 947 |
| 45 | Ga0068869_100462861 | 3300005334 | Bacteria | 1053 |
| 46 | Ga0070666_10000938 | 3300005335 | Bacteria | 17706 |
| 47 | Ga0070666_10002179 | 3300005335 | Bacteria | 11900 |
| 48 | Ga0070666_10461914 | 3300005335 | Bacteria | 918 |
| 49 | Ga0070666_10792504 | 3300005335 | Bacteria | 698 |
| 50 | Ga0070682_100793374 | 3300005337 | Bacteria | 769 |
| 51 | Ga0068868_100120833 | 3300005338 | Bacteria | 2136 |
| 52 | Ga0068868_100207269 | 3300005338 | Bacteria | 1637 |
| 53 | Ga0068868_100435331 | 3300005338 | Bacteria | 1138 |
| 54 | Ga0068868_100624510 | 3300005338 | Bacteria | 957 |
| 55 | Ga0068868_100754263 | 3300005338 | Bacteria | 875 |
| 56 | Ga0070660_100498844 | 3300005339 | Bacteria | 1013 |
| 57 | Ga0070660_101002077 | 3300005339 | Bacteria | 706 |
| 58 | Ga0070660_101071775 | 3300005339 | Bacteria | 682 |
| 59 | Ga0070660_101625457 | 3300005339 | Bacteria | 550 |
| 60 | Ga0070687_100898497 | 3300005343 | Bacteria | 635 |
| 61 | Ga0070661_100091190 | 3300005344 | Bacteria | 2257 |
| 62 | Ga0070661_100103251 | 3300005344 | Bacteria | 2123 |
| 63 | Ga0070661_100475049 | 3300005344 | Bacteria | 998 |
| 64 | Ga0070668_100076460 | 3300005347 | Bacteria | 2615 |
| 65 | Ga0070668_100668251 | 3300005347 | Unclassified | 914 |
| 66 | Ga0070669_100546943 | 3300005353 | Bacteria | 965 |
| 67 | Ga0070675_100691069 | 3300005354 | Bacteria | 929 |
| 68 | Ga0070671_100066518 | 3300005355 | Bacteria | 3004 |
| 69 | Ga0070671_100118451 | 3300005355 | Bacteria | 2227 |
| 70 | Ga0070671_100419795 | 3300005355 | Bacteria | 1146 |
| 71 | Ga0070671_100629849 | 3300005355 | Bacteria | 928 |
| 72 | Ga0070674_100279621 | 3300005356 | Bacteria | 1322 |
| 73 | Ga0070673_100061322 | 3300005364 | Bacteria | 2984 |
| 74 | Ga0070659_101505210 | 3300005366 | Bacteria | 600 |
| 75 | Ga0070667_100103589 | 3300005367 | Bacteria | 2460 |
| 76 | Ga0070667_101453161 | 3300005367 | Bacteria | 643 |
| 77 | Ga0070709_10001415 | 3300005434 | Bacteria | 13010 |
| 78 | Ga0070709_10384768 | 3300005434 | Bacteria | 1044 |
| 79 | Ga0070714_100013698 | 3300005435 | Bacteria | 6502 |
| 80 | Ga0070714_100043813 | 3300005435 | Bacteria | 3786 |
| 81 | Ga0070714_100516305 | 3300005435 | Bacteria | 1141 |
| 82 | Ga0070714_100812592 | 3300005435 | Bacteria | 906 |
| 83 | Ga0070713_100029447 | 3300005436 | Bacteria | 4350 |
| 84 | Ga0070713_100035173 | 3300005436 | Bacteria | 4030 |
| 85 | Ga0070713_101332407 | 3300005436 | Bacteria | 696 |
| 86 | Ga0070710_10001980 | 3300005437 | Bacteria | 9709 |
| 87 | Ga0070710_10793071 | 3300005437 | Bacteria | 676 |
| 88 | Ga0070711_100048152 | 3300005439 | Bacteria | 2913 |
| 89 | Ga0070705_100281784 | 3300005440 | Bacteria | 1182 |
| 90 | Ga0070705_101244621 | 3300005440 | Bacteria | 615 |
| 91 | Ga0070694_100026298 | 3300005444 | Bacteria | 3770 |
| 92 | Ga0070663_100076650 | 3300005455 | Bacteria | 2446 |
| 93 | Ga0070663_100134033 | 3300005455 | Bacteria | 1884 |
| 94 | Ga0070663_100231387 | 3300005455 | Bacteria | 1455 |
| 95 | Ga0070663_100280610 | 3300005455 | Bacteria | 1327 |
| 96 | Ga0070663_100564845 | 3300005455 | Bacteria | 953 |
| 97 | Ga0070663_101246216 | 3300005455 | Bacteria | 655 |
| 98 | Ga0070663_101523805 | 3300005455 | Bacteria | 595 |
| 99 | Ga0070678_101125746 | 3300005456 | Bacteria | 726 |
| 100 | Ga0070678_101141721 | 3300005456 | Bacteria | 721 |
| 101 | Ga0070662_100204055 | 3300005457 | Bacteria | 1570 |
| 102 | Ga0070662_100375822 | 3300005457 | Bacteria | 1169 |
| 103 | Ga0070662_100608571 | 3300005457 | Bacteria | 919 |
| 104 | Ga0068867_101064157 | 3300005459 | Bacteria | 737 |
| 105 | Ga0068867_101705279 | 3300005459 | Bacteria | 591 |
| 106 | Ga0068867_102045715 | 3300005459 | Bacteria | 542 |
| 107 | Ga0070685_10001247 | 3300005466 | Bacteria | 13509 |
| 108 | Ga0070685_10629391 | 3300005466 | Bacteria | 775 |
| 109 | Ga0070706_100087842 | 3300005467 | Bacteria | 2882 |
| 110 | Ga0070706_101442302 | 3300005467 | Bacteria | 630 |
| 111 | Ga0070698_100830490 | 3300005471 | Bacteria | 868 |
| 112 | Ga0070679_100416155 | 3300005530 | Bacteria | 1290 |
| 113 | Ga0070679_100839175 | 3300005530 | Bacteria | 862 |
| 114 | Ga0070684_100523659 | 3300005535 | Bacteria | 1099 |
| 115 | Ga0070684_100585244 | 3300005535 | Bacteria | 1037 |
| 116 | Ga0070697_101073120 | 3300005536 | Bacteria | 716 |
| 117 | Ga0068853_100000598 | 3300005539 | Bacteria | 24767 |
| 118 | Ga0068853_100093391 | 3300005539 | Bacteria | 2649 |
| 119 | Ga0068853_100838175 | 3300005539 | Bacteria | 881 |
| 120 | Ga0068853_101173642 | 3300005539 | Bacteria | 741 |
| 121 | Ga0068853_101518320 | 3300005539 | Bacteria | 649 |
| 122 | Ga0068853_101738571 | 3300005539 | Bacteria | 605 |
| 123 | Ga0070672_100777139 | 3300005543 | Bacteria | 842 |
| 124 | Ga0070686_100138269 | 3300005544 | Bacteria | 1693 |
| 125 | Ga0070686_100255065 | 3300005544 | Bacteria | 1283 |
| 126 | Ga0070695_100061578 | 3300005545 | Bacteria | 2435 |
| 127 | Ga0070695_100968165 | 3300005545 | Bacteria | 690 |
| 128 | Ga0070696_100475766 | 3300005546 | Bacteria | 990 |
| 129 | Ga0070665_100000144 | 3300005548 | Bacteria | 132302 |
| 130 | Ga0070665_100002074 | 3300005548 | Bacteria | 22481 |
| 131 | Ga0070665_100011926 | 3300005548 | Bacteria | 8776 |
| 132 | Ga0070665_100013246 | 3300005548 | Bacteria | 8306 |
| 133 | Ga0070665_100032040 | 3300005548 | Bacteria | 5291 |
| 134 | Ga0070665_100112798 | 3300005548 | Bacteria | 2721 |
| 135 | Ga0070665_100336078 | 3300005548 | Bacteria | 1515 |
| 136 | Ga0070665_100775174 | 3300005548 | Bacteria | 972 |
| 137 | Ga0070704_100128764 | 3300005549 | Bacteria | 1958 |
| 138 | Ga0068855_100115416 | 3300005563 | Bacteria | 3078 |
| 139 | Ga0068855_100282797 | 3300005563 | Bacteria | 1841 |
| 140 | Ga0068855_100302799 | 3300005563 | Bacteria | 1770 |
| 141 | Ga0068855_100693099 | 3300005563 | Bacteria | 1091 |
| 142 | Ga0070664_100457086 | 3300005564 | Bacteria | 1173 |
| 143 | Ga0068857_100136620 | 3300005577 | Bacteria | 2214 |
| 144 | Ga0068857_100159120 | 3300005577 | Bacteria | 2049 |
| 145 | Ga0068857_100607937 | 3300005577 | Bacteria | 1034 |
| 146 | Ga0068854_100009801 | 3300005578 | Bacteria | 6194 |
| 147 | Ga0068854_100012342 | 3300005578 | Bacteria | 5593 |
| 148 | Ga0068854_100056101 | 3300005578 | Bacteria | 2838 |
| 149 | Ga0068856_100096137 | 3300005614 | Bacteria | 2951 |
| 150 | Ga0068856_100211790 | 3300005614 | Bacteria | 1953 |
| 151 | Ga0068856_100414149 | 3300005614 | Bacteria | 1368 |
| 152 | Ga0068856_102107612 | 3300005614 | Bacteria | 573 |
| 153 | Ga0068852_100001361 | 3300005616 | Bacteria | 16410 |
| 154 | Ga0068852_100116660 | 3300005616 | Bacteria | 2436 |
| 155 | Ga0068852_100254911 | 3300005616 | Bacteria | 1682 |
| 156 | Ga0068852_100737597 | 3300005616 | Bacteria | 997 |
| 157 | Ga0068852_101485771 | 3300005616 | Bacteria | 700 |
| 158 | Ga0068852_101731291 | 3300005616 | Bacteria | 647 |
| 159 | Ga0068859_100068675 | 3300005617 | Bacteria | 3578 |
| 160 | Ga0068859_100564979 | 3300005617 | Bacteria | 1232 |
| 161 | Ga0068864_100007889 | 3300005618 | Bacteria | 8774 |
| 162 | Ga0068864_100364109 | 3300005618 | Bacteria | 1367 |
| 163 | Ga0068864_100448473 | 3300005618 | Bacteria | 1234 |
| 164 | Ga0068851_10088483 | 3300005834 | Bacteria | 1627 |
| 165 | Ga0068851_10112180 | 3300005834 | Bacteria | 1457 |
| 166 | Ga0068863_100000037 | 3300005841 | Bacteria | 162638 |
| 167 | Ga0068863_100037516 | 3300005841 | Bacteria | 4614 |
| 168 | Ga0068863_100046659 | 3300005841 | Bacteria | 4113 |
| 169 | Ga0068863_100223536 | 3300005841 | Bacteria | 1814 |
| 170 | Ga0068863_101056514 | 3300005841 | Bacteria | 816 |
| 171 | Ga0068863_101619949 | 3300005841 | Bacteria | 656 |
| 172 | Ga0068858_100000029 | 3300005842 | Bacteria | 144691 |
| 173 | Ga0068858_100000416 | 3300005842 | Bacteria | 44232 |
| 174 | Ga0068858_100471729 | 3300005842 | Bacteria | 1211 |
| 175 | Ga0068858_100895420 | 3300005842 | Bacteria | 868 |
| 176 | Ga0068858_102580495 | 3300005842 | Bacteria | 502 |
| 177 | Ga0068860_100000610 | 3300005843 | Bacteria | 42430 |
| 178 | Ga0068860_100114286 | 3300005843 | Bacteria | 2581 |
| 179 | Ga0068860_101776018 | 3300005843 | Bacteria | 639 |
| 180 | Ga0068860_102665158 | 3300005843 | Bacteria | 519 |
| 181 | Ga0068862_100005038 | 3300005844 | Bacteria | 11117 |
| 182 | Ga0068862_100514950 | 3300005844 | Bacteria | 1138 |
| 183 | Ga0068862_100650609 | 3300005844 | Bacteria | 1017 |
| 184 | Ga0081455_10016776 | 3300005937 | Bacteria | 7048 |
| 185 | Ga0081455_10026682 | 3300005937 | Bacteria | 5305 |
| 186 | Ga0081455_10031500 | 3300005937 | Bacteria | 4796 |
| 187 | Ga0081455_10323019 | 3300005937 | Bacteria | 1098 |
| 188 | Ga0081538_10074861 | 3300005981 | Bacteria | 1841 |
| 189 | Ga0081540_1000162 | 3300005983 | Bacteria | 68999 |
| 190 | Ga0081540_1000379 | 3300005983 | Bacteria | 44561 |
| 191 | Ga0081540_1004532 | 3300005983 | Bacteria | 10538 |
| 192 | Ga0081540_1014174 | 3300005983 | Bacteria | 5128 |
| 193 | Ga0081540_1033731 | 3300005983 | Bacteria | 2774 |
| 194 | Ga0081540_1066967 | 3300005983 | Bacteria | 1680 |
| 195 | Ga0081540_1091642 | 3300005983 | Bacteria | 1336 |
| 196 | Ga0081540_1106176 | 3300005983 | Unclassified | 1198 |
| 197 | Ga0081539_10000801 | 3300005985 | Bacteria | 61178 |
| 198 | Ga0081539_10010210 | 3300005985 | Bacteria | 7683 |
| 199 | Ga0070717_10044908 | 3300006028 | Bacteria | 3611 |
| 200 | Ga0070717_10215363 | 3300006028 | Bacteria | 1687 |
| 201 | Ga0070717_10538852 | 3300006028 | Bacteria | 1057 |
| 202 | Ga0075365_10094039 | 3300006038 | Bacteria | 2045 |
| 203 | Ga0075365_10122863 | 3300006038 | Bacteria | 1792 |
| 204 | Ga0075365_10159918 | 3300006038 | Bacteria | 1569 |
| 205 | Ga0075365_10191892 | 3300006038 | Bacteria | 1430 |
| 206 | Ga0075365_10248735 | 3300006038 | Bacteria | 1249 |
| 207 | Ga0075365_10361365 | 3300006038 | Bacteria | 1023 |
| 208 | Ga0075368_10029782 | 3300006042 | Bacteria | 2111 |
| 209 | Ga0075368_10340335 | 3300006042 | Bacteria | 652 |
| 210 | Ga0075363_100252495 | 3300006048 | Bacteria | 1016 |
| 211 | Ga0075363_100359214 | 3300006048 | Bacteria | 852 |
| 212 | Ga0075363_100408291 | 3300006048 | Bacteria | 799 |
| 213 | Ga0075363_101013450 | 3300006048 | Bacteria | 512 |
| 214 | Ga0075364_10114922 | 3300006051 | Bacteria | 1798 |
| 215 | Ga0075364_10307839 | 3300006051 | Bacteria | 1079 |
| 216 | Ga0075364_10994487 | 3300006051 | Bacteria | 570 |
| 217 | Ga0075432_10011455 | 3300006058 | Bacteria | 3012 |
| 218 | Ga0070715_10100755 | 3300006163 | Bacteria | 1347 |
| 219 | Ga0070716_100739097 | 3300006173 | Bacteria | 756 |
| 220 | Ga0070712_100011824 | 3300006175 | Bacteria | 5545 |
| 221 | Ga0070712_100213292 | 3300006175 | Bacteria | 1524 |
| 222 | Ga0075362_10054161 | 3300006177 | Bacteria | 1802 |
| 223 | Ga0075362_10224348 | 3300006177 | Bacteria | 919 |
| 224 | Ga0075362_10308810 | 3300006177 | Bacteria | 786 |
| 225 | Ga0075367_10715338 | 3300006178 | Bacteria | 637 |
| 226 | Ga0075369_10011029 | 3300006186 | Bacteria | 3545 |
| 227 | Ga0075369_10028654 | 3300006186 | Bacteria | 2335 |
| 228 | Ga0075369_10030461 | 3300006186 | Bacteria | 2273 |
| 229 | Ga0075369_10348003 | 3300006186 | Bacteria | 695 |
| 230 | Ga0075369_10433177 | 3300006186 | Bacteria | 622 |
| 231 | Ga0075369_10453428 | 3300006186 | Bacteria | 607 |
| 232 | Ga0075366_10419043 | 3300006195 | Bacteria | 825 |
| 233 | Ga0075366_10441905 | 3300006195 | Bacteria | 802 |
| 234 | Ga0097621_100211422 | 3300006237 | Bacteria | 1688 |
| 235 | Ga0097621_100542758 | 3300006237 | Bacteria | 1057 |
| 236 | Ga0097621_100648202 | 3300006237 | Bacteria | 969 |
| 237 | Ga0075370_10097196 | 3300006353 | Bacteria | 1702 |
| 238 | Ga0075370_10223380 | 3300006353 | Bacteria | 1113 |
| 239 | Ga0075370_10223785 | 3300006353 | Bacteria | 1112 |
| 240 | Ga0075370_10424475 | 3300006353 | Bacteria | 799 |
| 241 | Ga0075370_10468635 | 3300006353 | Bacteria | 759 |
| 242 | Ga0075370_10991942 | 3300006353 | Bacteria | 515 |
| 243 | Ga0075370_10995286 | 3300006353 | Bacteria | 514 |
| 244 | Ga0068871_100617986 | 3300006358 | Bacteria | 987 |
| 245 | Ga0075428_100557058 | 3300006844 | Bacteria | 1225 |
| 246 | Ga0075428_100778824 | 3300006844 | Bacteria | 1017 |
| 247 | Ga0075428_102305845 | 3300006844 | Bacteria | 554 |
| 248 | Ga0075430_100601900 | 3300006846 | Bacteria | 907 |
| 249 | Ga0075430_100777212 | 3300006846 | Bacteria | 789 |
| 250 | Ga0075430_100810030 | 3300006846 | Bacteria | 772 |
| 251 | Ga0075431_100169253 | 3300006847 | Bacteria | 2246 |
| 252 | Ga0075431_100815083 | 3300006847 | Bacteria | 906 |
| 253 | Ga0075429_100228293 | 3300006880 | Bacteria | 1630 |
| 254 | Ga0075429_101208563 | 3300006880 | Bacteria | 660 |
| 255 | Ga0075436_100176200 | 3300006914 | Bacteria | 1510 |
| 256 | Ga0075436_100314759 | 3300006914 | Bacteria | 1124 |
| 257 | Ga0097620_100068675 | 3300006931 | Bacteria | 3578 |
| 258 | Ga0097620_100564988 | 3300006931 | Bacteria | 1232 |
| 259 | Ga0099824_1020962 | 3300006942 | Bacteria | 4670 |
| 260 | Ga0099823_1023273 | 3300006944 | Bacteria | 5681 |
| 261 | Ga0079104_1065654 | 3300006946 | Bacteria | 772 |
| 262 | Ga0075435_100078555 | 3300007076 | Bacteria | 2707 |
| 263 | Ga0075435_100558593 | 3300007076 | Bacteria | 992 |
| 264 | Ga0075435_101285133 | 3300007076 | Bacteria | 641 |
| 265 | Ga0075435_101302718 | 3300007076 | Bacteria | 636 |
| 266 | Ga0099795_10091163 | 3300007788 | Bacteria | 1182 |
| 267 | Ga0099795_10323616 | 3300007788 | Bacteria | 683 |
| 268 | Ga0105251_10069762 | 3300009011 | Bacteria | 1638 |
| 269 | Ga0105250_10462498 | 3300009092 | Bacteria | 571 |
| 270 | Ga0105250_10490571 | 3300009092 | Bacteria | 556 |
| 271 | Ga0105240_10000906 | 3300009093 | Bacteria | 52979 |
| 272 | Ga0105240_10020715 | 3300009093 | Bacteria | 8761 |
| 273 | Ga0105240_10190889 | 3300009093 | Bacteria | 2409 |
| 274 | Ga0105240_10391068 | 3300009093 | Bacteria | 1568 |
| 275 | Ga0105240_10507292 | 3300009093 | Bacteria | 1340 |
| 276 | Ga0105240_10721265 | 3300009093 | Bacteria | 1086 |
| 277 | Ga0105240_11045775 | 3300009093 | Bacteria | 871 |
| 278 | Ga0105240_11344387 | 3300009093 | Bacteria | 752 |
| 279 | Ga0111539_10016502 | 3300009094 | Bacteria | 9157 |
| 280 | Ga0111539_11095602 | 3300009094 | Bacteria | 925 |
| 281 | Ga0111539_11642657 | 3300009094 | Bacteria | 745 |
| 282 | Ga0105245_10099561 | 3300009098 | Bacteria | 2688 |
| 283 | Ga0105245_10120596 | 3300009098 | Bacteria | 2449 |
| 284 | Ga0105245_10326876 | 3300009098 | Bacteria | 1512 |
| 285 | Ga0105247_10262534 | 3300009101 | Bacteria | 1184 |
| 286 | Ga0105247_10922932 | 3300009101 | Bacteria | 676 |
| 287 | Ga0105247_11239282 | 3300009101 | Bacteria | 596 |
| 288 | Ga0114129_10065857 | 3300009147 | Bacteria | 5055 |
| 289 | Ga0114129_10554633 | 3300009147 | Bacteria | 1494 |
| 290 | Ga0114129_10707709 | 3300009147 | Bacteria | 1294 |
| 291 | Ga0114129_10708763 | 3300009147 | Bacteria | 1293 |
| 292 | Ga0114129_11676250 | 3300009147 | Bacteria | 776 |
| 293 | Ga0114129_12766504 | 3300009147 | Bacteria | 584 |
| 294 | Ga0105243_10085767 | 3300009148 | Bacteria | 2581 |
| 295 | Ga0105243_10142913 | 3300009148 | Bacteria | 2044 |
| 296 | Ga0105243_11700857 | 3300009148 | Bacteria | 660 |
| 297 | Ga0105241_10058129 | 3300009174 | Bacteria | 2969 |
| 298 | Ga0105241_10081720 | 3300009174 | Bacteria | 2532 |
| 299 | Ga0105241_10214916 | 3300009174 | Bacteria | 1613 |
| 300 | Ga0105241_10358587 | 3300009174 | Bacteria | 1268 |
| 301 | Ga0105241_10606121 | 3300009174 | Bacteria | 990 |
| 302 | Ga0105241_10974794 | 3300009174 | Bacteria | 792 |
| 303 | Ga0105241_11952100 | 3300009174 | Bacteria | 576 |
| 304 | Ga0105241_12120477 | 3300009174 | Bacteria | 556 |
| 305 | Ga0105242_10248285 | 3300009176 | Bacteria | 1602 |
| 306 | Ga0105242_10316963 | 3300009176 | Bacteria | 1429 |
| 307 | Ga0105242_11482615 | 3300009176 | Bacteria | 708 |
| 308 | Ga0105242_12029122 | 3300009176 | Bacteria | 618 |
| 309 | Ga0105248_10121106 | 3300009177 | Bacteria | 2951 |
| 310 | Ga0105248_10311374 | 3300009177 | Bacteria | 1773 |
| 311 | Ga0105248_10425081 | 3300009177 | Bacteria | 1496 |
| 312 | Ga0105248_11133207 | 3300009177 | Bacteria | 884 |
| 313 | Ga0105237_10000768 | 3300009545 | Bacteria | 43904 |
| 314 | Ga0105237_10034618 | 3300009545 | Bacteria | 5113 |
| 315 | Ga0105237_10105484 | 3300009545 | Bacteria | 2809 |
| 316 | Ga0105237_10185435 | 3300009545 | Bacteria | 2081 |
| 317 | Ga0105237_10353218 | 3300009545 | Bacteria | 1474 |
| 318 | Ga0105237_10390180 | 3300009545 | Bacteria | 1397 |
| 319 | Ga0105237_10394759 | 3300009545 | Bacteria | 1388 |
| 320 | Ga0105237_10780348 | 3300009545 | Bacteria | 962 |
| 321 | Ga0105237_11197889 | 3300009545 | Bacteria | 766 |
| 322 | Ga0105237_12099693 | 3300009545 | Bacteria | 574 |
| 323 | Ga0105237_12511515 | 3300009545 | Bacteria | 526 |
| 324 | Ga0105238_10037476 | 3300009551 | Bacteria | 4929 |
| 325 | Ga0105238_10054946 | 3300009551 | Bacteria | 3998 |
| 326 | Ga0105238_10059189 | 3300009551 | Bacteria | 3838 |
| 327 | Ga0105238_10060050 | 3300009551 | Bacteria | 3807 |
| 328 | Ga0105238_10063273 | 3300009551 | Bacteria | 3700 |
| 329 | Ga0105238_10086639 | 3300009551 | Bacteria | 3119 |
| 330 | Ga0105238_10135292 | 3300009551 | Bacteria | 2442 |
| 331 | Ga0105238_10227960 | 3300009551 | Bacteria | 1840 |
| 332 | Ga0105238_10497883 | 3300009551 | Bacteria | 1219 |
| 333 | Ga0105238_10511163 | 3300009551 | Bacteria | 1203 |
| 334 | Ga0105238_10946299 | 3300009551 | Bacteria | 881 |
| 335 | Ga0105238_11526223 | 3300009551 | Bacteria | 697 |
| 336 | Ga0105238_12174350 | 3300009551 | Bacteria | 589 |
| 337 | Ga0105249_10013373 | 3300009553 | Bacteria | 7248 |
| 338 | Ga0105249_10454865 | 3300009553 | Bacteria | 1319 |
| 339 | Ga0099796_10090755 | 3300010159 | Bacteria | 1135 |
| 340 | Ga0099796_10138296 | 3300010159 | Bacteria | 950 |
| 341 | Ga0105239_10000846 | 3300010375 | Bacteria | 43563 |
| 342 | Ga0105239_10009303 | 3300010375 | Bacteria | 11107 |
| 343 | Ga0105239_10014928 | 3300010375 | Bacteria | 8611 |
| 344 | Ga0105239_10097555 | 3300010375 | Bacteria | 3248 |
| 345 | Ga0105239_10288032 | 3300010375 | Bacteria | 1849 |
| 346 | Ga0105239_10327199 | 3300010375 | Bacteria | 1729 |
| 347 | Ga0105239_10390393 | 3300010375 | Bacteria | 1574 |
| 348 | Ga0105239_10398331 | 3300010375 | Bacteria | 1558 |
| 349 | Ga0105239_10458925 | 3300010375 | Bacteria | 1446 |
| 350 | Ga0105239_10799132 | 3300010375 | Bacteria | 1081 |
| 351 | Ga0105239_11023502 | 3300010375 | Bacteria | 950 |
| 352 | Ga0105239_11185436 | 3300010375 | Bacteria | 880 |
| 353 | Ga0105239_11675732 | 3300010375 | Bacteria | 736 |
| 354 | Ga0105239_11840572 | 3300010375 | Bacteria | 702 |
| 355 | Ga0105239_12685967 | 3300010375 | Bacteria | 581 |
| 356 | Ga0105246_10088471 | 3300011119 | Bacteria | 2225 |
| 357 | Ga0105246_11564809 | 3300011119 | Bacteria | 622 |
| 358 | Ga0105246_11686401 | 3300011119 | Bacteria | 602 |
| 359 | Ga0105246_12258735 | 3300011119 | Bacteria | 531 |
| 360 | Ga0157342_1057251 | 3300012507 | Bacteria | 563 |
| 361 | Ga0157373_10838269 | 3300013100 | Bacteria | 679 |
| 362 | Ga0157371_10022848 | 3300013102 | Bacteria | 4576 |
| 363 | Ga0157371_10341159 | 3300013102 | Bacteria | 1090 |
| 364 | Ga0157370_10007830 | 3300013104 | Bacteria | 11578 |
| 365 | Ga0157370_10409387 | 3300013104 | Bacteria | 1248 |
| 366 | Ga0157370_10678802 | 3300013104 | Bacteria | 941 |
| 367 | Ga0157369_10422318 | 3300013105 | Bacteria | 1382 |
| 368 | Ga0171463_1007 | 3300013249 | Bacteria | 301198 |
| 369 | Ga0157374_10072574 | 3300013296 | Bacteria | 3248 |
| 370 | Ga0157374_10313533 | 3300013296 | Bacteria | 1553 |
| 371 | Ga0157374_10410884 | 3300013296 | Bacteria | 1351 |
| 372 | Ga0157378_10015322 | 3300013297 | Bacteria | 6715 |
| 373 | Ga0157378_10357821 | 3300013297 | Bacteria | 1428 |
| 374 | Ga0157378_10411110 | 3300013297 | Bacteria | 1335 |
| 375 | Ga0157378_11292257 | 3300013297 | Bacteria | 771 |
| 376 | Ga0163162_10101266 | 3300013306 | Bacteria | 2972 |
| 377 | Ga0163162_10224326 | 3300013306 | Bacteria | 2009 |
| 378 | Ga0163162_11608189 | 3300013306 | Bacteria | 741 |
| 379 | Ga0163162_12279075 | 3300013306 | Bacteria | 622 |
| 380 | Ga0157372_10254990 | 3300013307 | Bacteria | 2037 |
| 381 | Ga0157372_10440349 | 3300013307 | Bacteria | 1519 |
| 382 | Ga0157375_11117528 | 3300013308 | Bacteria | 923 |
| 383 | Ga0157375_11825182 | 3300013308 | Bacteria | 721 |
| 384 | Ga0157375_13323844 | 3300013308 | Bacteria | 536 |
| 385 | Ga0163163_10047824 | 3300014325 | Bacteria | 4205 |
| 386 | Ga0163163_10060022 | 3300014325 | Bacteria | 3764 |
| 387 | Ga0163163_10169415 | 3300014325 | Bacteria | 2230 |
| 388 | Ga0163163_10217856 | 3300014325 | Bacteria | 1958 |
| 389 | Ga0163163_10314559 | 3300014325 | Bacteria | 1619 |
| 390 | Ga0157380_10881439 | 3300014326 | Bacteria | 919 |
| 391 | Ga0182008_10166788 | 3300014497 | Bacteria | 1110 |
| 392 | Ga0182008_10466190 | 3300014497 | Bacteria | 689 |
| 393 | Ga0157379_10034956 | 3300014968 | Bacteria | 4480 |
| 394 | Ga0157379_10314220 | 3300014968 | Bacteria | 1430 |
| 395 | Ga0157379_11197775 | 3300014968 | Bacteria | 730 |
| 396 | Ga0157376_11156297 | 3300014969 | Bacteria | 801 |
| 397 | Ga0157376_12647181 | 3300014969 | Bacteria | 541 |
| 398 | Ga0157376_13053723 | 3300014969 | Bacteria | 507 |
| 399 | Ga0183363_1259 | 3300015690 | Bacteria | 8664 |
| 400 | Ga0163161_10522430 | 3300017792 | Bacteria | 969 |
| 401 | Ga0197907_10317020 | 3300020069 | Bacteria | 681 |
| 402 | Ga0206353_10434026 | 3300020082 | Bacteria | 952 |
| 403 | Ga0214544_1000011 | 3300021320 | Bacteria | 262952 |
| 404 | Ga0214542_1000009 | 3300021321 | Bacteria | 262861 |
| 405 | Ga0214545_1000007 | 3300021324 | Bacteria | 262984 |
| 406 | Ga0214543_1000020 | 3300021327 | Bacteria | 262861 |
| 407 | Ga0213873_10012381 | 3300021358 | Bacteria | 1849 |
| 408 | Ga0213873_10015537 | 3300021358 | Bacteria | 1706 |
| 409 | Ga0213873_10179808 | 3300021358 | Bacteria | 649 |
| 410 | Ga0213872_10004352 | 3300021361 | Bacteria | 7541 |
| 411 | Ga0213872_10035915 | 3300021361 | Bacteria | 2266 |
| 412 | Ga0213872_10126948 | 3300021361 | Bacteria | 1125 |
| 413 | Ga0213872_10240571 | 3300021361 | Bacteria | 765 |
| 414 | Ga0213872_10470543 | 3300021361 | Bacteria | 503 |
| 415 | Ga0213874_10200151 | 3300021377 | Bacteria | 718 |
| 416 | Ga0213876_10015403 | 3300021384 | Bacteria | 4047 |
| 417 | Ga0213871_10031702 | 3300021441 | Bacteria | 1382 |
| 418 | Ga0209435_100005 | 3300025206 | Bacteria | 573745 |
| 419 | Ga0209436_101180 | 3300025208 | Bacteria | 9609 |
| 420 | Ga0209563_100718 | 3300025230 | Bacteria | 10324 |
| 421 | Ga0209258_128199 | 3300025242 | Bacteria | 536 |
| 422 | Ga0209646_1000011 | 3300025246 | Bacteria | 573745 |
| 423 | Ga0209026_1000008 | 3300025250 | Bacteria | 573745 |
| 424 | Ga0209026_1012371 | 3300025250 | Bacteria | 1491 |
| 425 | Ga0209026_1028587 | 3300025250 | Bacteria | 832 |
| 426 | Ga0209026_1032988 | 3300025250 | Bacteria | 764 |
| 427 | Ga0209677_100400 | 3300025253 | Bacteria | 26165 |
| 428 | Ga0209677_103245 | 3300025253 | Bacteria | 5419 |
| 429 | Ga0209148_1000321 | 3300025254 | Bacteria | 66604 |
| 430 | Ga0209148_1001029 | 3300025254 | Bacteria | 17506 |
| 431 | Ga0209759_1000004 | 3300025256 | Bacteria | 573745 |
| 432 | Ga0209233_1003560 | 3300025261 | Bacteria | 5476 |
| 433 | Ga0209233_1009331 | 3300025261 | Bacteria | 2991 |
| 434 | Ga0209233_1024852 | 3300025261 | Bacteria | 1491 |
| 435 | Ga0209233_1027633 | 3300025261 | Bacteria | 1372 |
| 436 | Ga0209233_1038593 | 3300025261 | Bacteria | 1052 |
| 437 | Ga0209233_1049905 | 3300025261 | Bacteria | 857 |
| 438 | Ga0209455_1002441 | 3300025272 | Bacteria | 7201 |
| 439 | Ga0209455_1013650 | 3300025272 | Bacteria | 1875 |
| 440 | Ga0209673_1060114 | 3300025273 | Bacteria | 954 |
| 441 | Ga0209130_1000017 | 3300025284 | Bacteria | 388431 |
| 442 | Ga0209676_1006987 | 3300025292 | Bacteria | 5425 |
| 443 | Ga0209025_1000153 | 3300025294 | Bacteria | 170548 |
| 444 | Ga0209025_1040142 | 3300025294 | Bacteria | 2029 |
| 445 | Ga0209564_1000013 | 3300025295 | Bacteria | 775755 |
| 446 | Ga0209564_1018331 | 3300025295 | Bacteria | 2674 |
| 447 | Ga0209564_1078132 | 3300025295 | Bacteria | 657 |
| 448 | Ga0209758_1000119 | 3300025297 | Bacteria | 195545 |
| 449 | Ga0209758_1000206 | 3300025297 | Bacteria | 130177 |
| 450 | Ga0209758_1000536 | 3300025297 | Bacteria | 60374 |
| 451 | Ga0209758_1001853 | 3300025297 | Bacteria | 23209 |
| 452 | Ga0209758_1002042 | 3300025297 | Bacteria | 21647 |
| 453 | Ga0209758_1006010 | 3300025297 | Bacteria | 8972 |
| 454 | Ga0209758_1016012 | 3300025297 | Bacteria | 3834 |
| 455 | Ga0209758_1036437 | 3300025297 | Bacteria | 1919 |
| 456 | Ga0209758_1044493 | 3300025297 | Bacteria | 1622 |
| 457 | Ga0209050_1000029 | 3300025298 | Bacteria | 465801 |
| 458 | Ga0209050_1005510 | 3300025298 | Bacteria | 7913 |
| 459 | Ga0209050_1013688 | 3300025298 | Bacteria | 3576 |
| 460 | Ga0209256_1000211 | 3300025299 | Bacteria | 110131 |
| 461 | Ga0209256_1004227 | 3300025299 | Bacteria | 9205 |
| 462 | Ga0209256_1005602 | 3300025299 | Bacteria | 7133 |
| 463 | Ga0209256_1096731 | 3300025299 | Bacteria | 618 |
| 464 | Ga0207426_1000006 | 3300025302 | Bacteria | 1025969 |
| 465 | Ga0207426_1000870 | 3300025302 | Bacteria | 31492 |
| 466 | Ga0207426_1003803 | 3300025302 | Bacteria | 7826 |
| 467 | Ga0207426_1004991 | 3300025302 | Bacteria | 6247 |
| 468 | Ga0207426_1068848 | 3300025302 | Bacteria | 994 |
| 469 | Ga0209051_1048380 | 3300025303 | Bacteria | 1442 |
| 470 | Ga0209257_1000271 | 3300025304 | Bacteria | 118632 |
| 471 | Ga0209257_1000301 | 3300025304 | Bacteria | 108454 |
| 472 | Ga0209257_1000394 | 3300025304 | Bacteria | 86654 |
| 473 | Ga0209257_1011550 | 3300025304 | Bacteria | 4235 |
| 474 | Ga0209257_1020690 | 3300025304 | Bacteria | 2419 |
| 475 | Ga0209257_1030953 | 3300025304 | Bacteria | 1718 |
| 476 | Ga0209257_1082005 | 3300025304 | Bacteria | 825 |
| 477 | Ga0209257_1130115 | 3300025304 | Bacteria | 577 |
| 478 | Ga0207697_10184810 | 3300025315 | Bacteria | 914 |
| 479 | Ga0207656_10051320 | 3300025321 | Bacteria | 1784 |
| 480 | Ga0207656_10055558 | 3300025321 | Bacteria | 1724 |
| 481 | Ga0207692_10012356 | 3300025898 | Bacteria | 3666 |
| 482 | Ga0207692_10072441 | 3300025898 | Bacteria | 1820 |
| 483 | Ga0207692_10118555 | 3300025898 | Bacteria | 1479 |
| 484 | Ga0207710_10183941 | 3300025900 | Bacteria | 1026 |
| 485 | Ga0207710_10342768 | 3300025900 | Bacteria | 760 |
| 486 | Ga0207710_10544739 | 3300025900 | Bacteria | 604 |
| 487 | Ga0207688_10265382 | 3300025901 | Bacteria | 1043 |
| 488 | Ga0207680_10001600 | 3300025903 | Bacteria | 10705 |
| 489 | Ga0207680_10003166 | 3300025903 | Bacteria | 7732 |
| 490 | Ga0207680_10120654 | 3300025903 | Bacteria | 1714 |
| 491 | Ga0207680_11363288 | 3300025903 | Bacteria | 503 |
| 492 | Ga0207647_10001114 | 3300025904 | Bacteria | 20682 |
| 493 | Ga0207647_10016170 | 3300025904 | Bacteria | 5094 |
| 494 | Ga0207685_10028515 | 3300025905 | Bacteria | 1967 |
| 495 | Ga0207685_10273612 | 3300025905 | Bacteria | 826 |
| 496 | Ga0207699_10000352 | 3300025906 | Bacteria | 24405 |
| 497 | Ga0207699_10107452 | 3300025906 | Bacteria | 1782 |
| 498 | Ga0207699_10411699 | 3300025906 | Bacteria | 964 |
| 499 | Ga0207645_10206179 | 3300025907 | Bacteria | 1294 |
| 500 | Ga0207705_10070467 | 3300025909 | Bacteria | 2534 |
| 501 | Ga0207654_10033099 | 3300025911 | Bacteria | 2863 |
| 502 | Ga0207654_10143253 | 3300025911 | Bacteria | 1526 |
| 503 | Ga0207654_10254110 | 3300025911 | Bacteria | 1179 |
| 504 | Ga0207654_10300211 | 3300025911 | Bacteria | 1092 |
| 505 | Ga0207654_10401781 | 3300025911 | Bacteria | 953 |
| 506 | Ga0207654_10497670 | 3300025911 | Bacteria | 860 |
| 507 | Ga0207707_10353100 | 3300025912 | Bacteria | 1267 |
| 508 | Ga0207695_10000040 | 3300025913 | Bacteria | 452787 |
| 509 | Ga0207695_10025575 | 3300025913 | Bacteria | 6605 |
| 510 | Ga0207695_10027614 | 3300025913 | Bacteria | 6315 |
| 511 | Ga0207695_10161780 | 3300025913 | Bacteria | 2170 |
| 512 | Ga0207695_10425339 | 3300025913 | Bacteria | 1212 |
| 513 | Ga0207695_10652637 | 3300025913 | Bacteria | 933 |
| 514 | Ga0207695_10826123 | 3300025913 | Bacteria | 807 |
| 515 | Ga0207695_10922875 | 3300025913 | Bacteria | 753 |
| 516 | Ga0207695_11148006 | 3300025913 | Bacteria | 657 |
| 517 | Ga0207671_10000361 | 3300025914 | Bacteria | 64792 |
| 518 | Ga0207671_10015883 | 3300025914 | Bacteria | 5873 |
| 519 | Ga0207671_10083610 | 3300025914 | Bacteria | 2397 |
| 520 | Ga0207671_10227144 | 3300025914 | Bacteria | 1464 |
| 521 | Ga0207671_10245203 | 3300025914 | Bacteria | 1408 |
| 522 | Ga0207671_10262805 | 3300025914 | Bacteria | 1358 |
| 523 | Ga0207671_10522646 | 3300025914 | Bacteria | 946 |
| 524 | Ga0207693_10024896 | 3300025915 | Bacteria | 4747 |
| 525 | Ga0207663_10002073 | 3300025916 | Bacteria | 9553 |
| 526 | Ga0207663_10010518 | 3300025916 | Bacteria | 4930 |
| 527 | Ga0207663_10742139 | 3300025916 | Bacteria | 779 |
| 528 | Ga0207663_11020323 | 3300025916 | Bacteria | 664 |
| 529 | Ga0207663_11321817 | 3300025916 | Bacteria | 581 |
| 530 | Ga0207660_10488825 | 3300025917 | Bacteria | 998 |
| 531 | Ga0207657_10251288 | 3300025919 | Bacteria | 1409 |
| 532 | Ga0207657_10530903 | 3300025919 | Bacteria | 920 |
| 533 | Ga0207657_10818198 | 3300025919 | Bacteria | 720 |
| 534 | Ga0207649_10018924 | 3300025920 | Bacteria | 3928 |
| 535 | Ga0207649_10071728 | 3300025920 | Bacteria | 2213 |
| 536 | Ga0207649_10177173 | 3300025920 | Bacteria | 1490 |
| 537 | Ga0207649_10309295 | 3300025920 | Bacteria | 1158 |
| 538 | Ga0207649_10688860 | 3300025920 | Bacteria | 792 |
| 539 | Ga0207681_11155970 | 3300025923 | Bacteria | 650 |
| 540 | Ga0207694_10001195 | 3300025924 | Bacteria | 22509 |
| 541 | Ga0207694_10002483 | 3300025924 | Bacteria | 15006 |
| 542 | Ga0207694_10030886 | 3300025924 | Bacteria | 4091 |
| 543 | Ga0207694_10034603 | 3300025924 | Bacteria | 3874 |
| 544 | Ga0207694_10120291 | 3300025924 | Bacteria | 2096 |
| 545 | Ga0207694_10127691 | 3300025924 | Bacteria | 2036 |
| 546 | Ga0207694_10219474 | 3300025924 | Bacteria | 1550 |
| 547 | Ga0207694_10449401 | 3300025924 | Bacteria | 1076 |
| 548 | Ga0207694_10471166 | 3300025924 | Bacteria | 1050 |
| 549 | Ga0207694_10566684 | 3300025924 | Bacteria | 954 |
| 550 | Ga0207694_10968306 | 3300025924 | Bacteria | 720 |
| 551 | Ga0207694_11743758 | 3300025924 | Bacteria | 524 |
| 552 | Ga0207650_10021597 | 3300025925 | Bacteria | 4548 |
| 553 | Ga0207650_10517836 | 3300025925 | Bacteria | 998 |
| 554 | Ga0207650_10758429 | 3300025925 | Bacteria | 821 |
| 555 | Ga0207650_10946865 | 3300025925 | Bacteria | 732 |
| 556 | Ga0207659_10737055 | 3300025926 | Bacteria | 845 |
| 557 | Ga0207687_10155441 | 3300025927 | Bacteria | 1749 |
| 558 | Ga0207700_10031588 | 3300025928 | Bacteria | 3764 |
| 559 | Ga0207700_10167948 | 3300025928 | Bacteria | 1828 |
| 560 | Ga0207700_11085087 | 3300025928 | Bacteria | 716 |
| 561 | Ga0207700_11400064 | 3300025928 | Bacteria | 622 |
| 562 | Ga0207664_10044956 | 3300025929 | Bacteria | 3461 |
| 563 | Ga0207664_10073306 | 3300025929 | Bacteria | 2763 |
| 564 | Ga0207664_10894476 | 3300025929 | Bacteria | 797 |
| 565 | Ga0207644_10212348 | 3300025931 | Bacteria | 1531 |
| 566 | Ga0207644_10477105 | 3300025931 | Bacteria | 1027 |
| 567 | Ga0207644_11006629 | 3300025931 | Bacteria | 699 |
| 568 | Ga0207644_11058168 | 3300025931 | Bacteria | 681 |
| 569 | Ga0207644_11566838 | 3300025931 | Bacteria | 553 |
| 570 | Ga0207690_10676498 | 3300025932 | Bacteria | 847 |
| 571 | Ga0207706_10188835 | 3300025933 | Bacteria | 1809 |
| 572 | Ga0207706_10198515 | 3300025933 | Bacteria | 1760 |
| 573 | Ga0207706_10380681 | 3300025933 | Bacteria | 1225 |
| 574 | Ga0207686_10156225 | 3300025934 | Bacteria | 1594 |
| 575 | Ga0207709_11062388 | 3300025935 | Bacteria | 664 |
| 576 | Ga0207670_10801955 | 3300025936 | Bacteria | 784 |
| 577 | Ga0207670_10881774 | 3300025936 | Bacteria | 749 |
| 578 | Ga0207670_11516482 | 3300025936 | Bacteria | 570 |
| 579 | Ga0207669_10898035 | 3300025937 | Bacteria | 740 |
| 580 | Ga0207669_11705851 | 3300025937 | Bacteria | 538 |
| 581 | Ga0207665_10156483 | 3300025939 | Bacteria | 1636 |
| 582 | Ga0207665_10174443 | 3300025939 | Bacteria | 1554 |
| 583 | Ga0207665_10177685 | 3300025939 | Bacteria | 1540 |
| 584 | Ga0207665_11201030 | 3300025939 | Bacteria | 605 |
| 585 | Ga0207665_11586644 | 3300025939 | Bacteria | 519 |
| 586 | Ga0207691_10276597 | 3300025940 | Bacteria | 1445 |
| 587 | Ga0207691_11063922 | 3300025940 | Bacteria | 674 |
| 588 | Ga0207711_10066476 | 3300025941 | Bacteria | 3118 |
| 589 | Ga0207711_10604005 | 3300025941 | Bacteria | 1024 |
| 590 | Ga0207711_11185576 | 3300025941 | Bacteria | 705 |
| 591 | Ga0207711_11186868 | 3300025941 | Bacteria | 705 |
| 592 | Ga0207661_10523945 | 3300025944 | Bacteria | 1084 |
| 593 | Ga0207679_11334797 | 3300025945 | Bacteria | 658 |
| 594 | Ga0207679_11359299 | 3300025945 | Bacteria | 652 |
| 595 | Ga0207667_10169996 | 3300025949 | Bacteria | 2240 |
| 596 | Ga0207667_10182625 | 3300025949 | Bacteria | 2154 |
| 597 | Ga0207667_10283454 | 3300025949 | Bacteria | 1693 |
| 598 | Ga0207667_10718834 | 3300025949 | Bacteria | 1000 |
| 599 | Ga0207667_11200819 | 3300025949 | Bacteria | 738 |
| 600 | Ga0207667_11291788 | 3300025949 | Bacteria | 706 |
| 601 | Ga0207651_10032659 | 3300025960 | Bacteria | 3347 |
| 602 | Ga0207651_11517973 | 3300025960 | Bacteria | 603 |
| 603 | Ga0207712_10324405 | 3300025961 | Bacteria | 1272 |
| 604 | Ga0207668_10077230 | 3300025972 | Bacteria | 2400 |
| 605 | Ga0207640_10018949 | 3300025981 | Bacteria | 4054 |
| 606 | Ga0207640_10101491 | 3300025981 | Bacteria | 2019 |
| 607 | Ga0207640_10115178 | 3300025981 | Bacteria | 1914 |
| 608 | Ga0207640_11608913 | 3300025981 | Bacteria | 585 |
| 609 | Ga0207640_12140402 | 3300025981 | Bacteria | 507 |
| 610 | Ga0207640_12187397 | 3300025981 | Bacteria | 502 |
| 611 | Ga0207658_10003350 | 3300025986 | Bacteria | 11365 |
| 612 | Ga0207658_10083678 | 3300025986 | Bacteria | 2453 |
| 613 | Ga0207658_11677434 | 3300025986 | Bacteria | 581 |
| 614 | Ga0207658_11907967 | 3300025986 | Bacteria | 541 |
| 615 | Ga0207658_12017879 | 3300025986 | Bacteria | 525 |
| 616 | Ga0207677_10187579 | 3300026023 | Bacteria | 1633 |
| 617 | Ga0207677_10331893 | 3300026023 | Bacteria | 1268 |
| 618 | Ga0207677_11814911 | 3300026023 | Bacteria | 566 |
| 619 | Ga0207703_10000429 | 3300026035 | Bacteria | 44242 |
| 620 | Ga0207703_10001132 | 3300026035 | Bacteria | 25162 |
| 621 | Ga0207703_10081368 | 3300026035 | Bacteria | 2700 |
| 622 | Ga0207703_10853229 | 3300026035 | Bacteria | 871 |
| 623 | Ga0207703_11646875 | 3300026035 | Bacteria | 617 |
| 624 | Ga0207639_10000308 | 3300026041 | Bacteria | 34625 |
| 625 | Ga0207639_10000858 | 3300026041 | Bacteria | 20623 |
| 626 | Ga0207639_11170875 | 3300026041 | Bacteria | 721 |
| 627 | Ga0207678_10074670 | 3300026067 | Bacteria | 2905 |
| 628 | Ga0207678_10091454 | 3300026067 | Bacteria | 2600 |
| 629 | Ga0207678_10093155 | 3300026067 | Bacteria | 2574 |
| 630 | Ga0207678_10285644 | 3300026067 | Bacteria | 1417 |
| 631 | Ga0207678_10325731 | 3300026067 | Bacteria | 1322 |
| 632 | Ga0207678_10683875 | 3300026067 | Bacteria | 902 |
| 633 | Ga0207678_10694369 | 3300026067 | Bacteria | 895 |
| 634 | Ga0207678_10908163 | 3300026067 | Bacteria | 779 |
| 635 | Ga0207678_10963984 | 3300026067 | Bacteria | 755 |
| 636 | Ga0207678_11922870 | 3300026067 | Bacteria | 516 |
| 637 | Ga0207702_10001580 | 3300026078 | Bacteria | 22559 |
| 638 | Ga0207702_10099364 | 3300026078 | Bacteria | 2565 |
| 639 | Ga0207702_10126406 | 3300026078 | Bacteria | 2296 |
| 640 | Ga0207702_10152645 | 3300026078 | Bacteria | 2102 |
| 641 | Ga0207702_10393248 | 3300026078 | Bacteria | 1335 |
| 642 | Ga0207702_10625891 | 3300026078 | Bacteria | 1057 |
| 643 | Ga0207641_10000034 | 3300026088 | Bacteria | 217752 |
| 644 | Ga0207641_10008638 | 3300026088 | Bacteria | 8410 |
| 645 | Ga0207641_10708877 | 3300026088 | Bacteria | 991 |
| 646 | Ga0207641_11525582 | 3300026088 | Bacteria | 670 |
| 647 | Ga0207641_12459991 | 3300026088 | Bacteria | 519 |
| 648 | Ga0207648_10105574 | 3300026089 | Bacteria | 2471 |
| 649 | Ga0207648_10159531 | 3300026089 | Bacteria | 1992 |
| 650 | Ga0207676_10000202 | 3300026095 | Bacteria | 51825 |
| 651 | Ga0207676_10003773 | 3300026095 | Bacteria | 10707 |
| 652 | Ga0207676_10143239 | 3300026095 | Bacteria | 2049 |
| 653 | Ga0207676_10404232 | 3300026095 | Bacteria | 1277 |
| 654 | Ga0207676_11983090 | 3300026095 | Bacteria | 581 |
| 655 | Ga0207674_10037382 | 3300026116 | Bacteria | 5050 |
| 656 | Ga0207674_10393199 | 3300026116 | Bacteria | 1340 |
| 657 | Ga0207674_10454657 | 3300026116 | Bacteria | 1238 |
| 658 | Ga0207674_10486232 | 3300026116 | Bacteria | 1193 |
| 659 | Ga0207674_10890276 | 3300026116 | Bacteria | 858 |
| 660 | Ga0207675_100316872 | 3300026118 | Bacteria | 1522 |
| 661 | Ga0207675_102712301 | 3300026118 | Bacteria | 504 |
| 662 | Ga0207683_10304083 | 3300026121 | Bacteria | 1459 |
| 663 | Ga0207683_10520202 | 3300026121 | Bacteria | 1099 |
| 664 | Ga0207683_10823559 | 3300026121 | Bacteria | 862 |
| 665 | Ga0207698_10005879 | 3300026142 | Bacteria | 7624 |
| 666 | Ga0207698_10009260 | 3300026142 | Bacteria | 6267 |
| 667 | Ga0207698_10194806 | 3300026142 | Bacteria | 1809 |
| 668 | Ga0207698_10347305 | 3300026142 | Bacteria | 1400 |
| 669 | Ga0207698_10664838 | 3300026142 | Bacteria | 1033 |
| 670 | Ga0207698_10780659 | 3300026142 | Bacteria | 956 |
| 671 | Ga0207698_11654014 | 3300026142 | Bacteria | 656 |
| 672 | Ga0207698_11949232 | 3300026142 | Bacteria | 602 |
| 673 | Ga0209281_1070928 | 3300027111 | Bacteria | 510 |
| 674 | Ga0209389_1000034 | 3300027296 | Bacteria | 127289 |
| 675 | Ga0209389_1000039 | 3300027296 | Bacteria | 124545 |
| 676 | Ga0209589_1000038 | 3300027357 | Bacteria | 127285 |
| 677 | Ga0209489_100023 | 3300027361 | Bacteria | 198829 |
| 678 | Ga0209489_100087 | 3300027361 | Bacteria | 124545 |
| 679 | Ga0209700_100090 | 3300027363 | Bacteria | 124545 |
| 680 | Ga0209179_1047920 | 3300027512 | Bacteria | 911 |
| 681 | Ga0209813_10158514 | 3300027866 | Bacteria | 815 |
| 682 | Ga0209813_10262334 | 3300027866 | Bacteria | 660 |
| 683 | Ga0207428_10051956 | 3300027907 | Bacteria | 3275 |
| 684 | Ga0207428_10068908 | 3300027907 | Bacteria | 2782 |
| 685 | Ga0268266_10000003 | 3300028379 | Bacteria | 1701703 |
| 686 | Ga0268266_10000008 | 3300028379 | Bacteria | 1161875 |
| 687 | Ga0268266_10000086 | 3300028379 | Bacteria | 199443 |
| 688 | Ga0268266_10033319 | 3300028379 | Bacteria | 4379 |
| 689 | Ga0268266_10047500 | 3300028379 | Bacteria | 3678 |
| 690 | Ga0268266_10199386 | 3300028379 | Bacteria | 1831 |
| 691 | Ga0268266_10320253 | 3300028379 | Bacteria | 1451 |
| 692 | Ga0268265_10011219 | 3300028380 | Bacteria | 6057 |
| 693 | Ga0268265_10312136 | 3300028380 | Bacteria | 1420 |
| 694 | Ga0268265_11056938 | 3300028380 | Bacteria | 804 |
| 695 | Ga0268264_10000194 | 3300028381 | Bacteria | 125395 |
| 696 | Ga0268264_10848359 | 3300028381 | Bacteria | 915 |
| 697 | Ga0268264_10991337 | 3300028381 | Bacteria | 846 |
| 698 | Ga0268264_11732992 | 3300028381 | Bacteria | 635 |
| 699 | Ga0268264_11954783 | 3300028381 | Bacteria | 596 |
| 700 | Ga0265337_1004679 | 3300028556 | Bacteria | 5626 |
| 701 | Ga0265326_10001084 | 3300028558 | Bacteria | 9692 |
| 702 | Ga0265319_1004856 | 3300028563 | Bacteria | 6578 |
| 703 | Ga0265319_1065409 | 3300028563 | Bacteria | 1172 |
| 704 | Ga0265334_10003918 | 3300028573 | Bacteria | 6703 |
| 705 | Ga0265318_10029465 | 3300028577 | Bacteria | 2140 |
| 706 | Ga0265318_10069342 | 3300028577 | Bacteria | 1307 |
| 707 | Ga0265318_10167416 | 3300028577 | Bacteria | 805 |
| 708 | Ga0265323_10001297 | 3300028653 | Bacteria | 12481 |
| 709 | Ga0265322_10074888 | 3300028654 | Bacteria | 960 |
| 710 | Ga0265336_10000620 | 3300028666 | Bacteria | 19526 |
| 711 | Ga0307517_10000200 | 3300028786 | Bacteria | 101130 |
| 712 | Ga0307517_10377461 | 3300028786 | Bacteria | 759 |
| 713 | Ga0307517_10466557 | 3300028786 | Bacteria | 650 |
| 714 | Ga0307515_10000017 | 3300028794 | Bacteria | 550465 |
| 715 | Ga0307515_10001155 | 3300028794 | Bacteria | 60447 |
| 716 | Ga0307515_10009128 | 3300028794 | Bacteria | 19231 |
| 717 | Ga0265338_10001434 | 3300028800 | Bacteria | 38730 |
| 718 | Ga0265338_10109509 | 3300028800 | Bacteria | 2229 |
| 719 | Ga0265338_10972480 | 3300028800 | Bacteria | 576 |
| 720 | Ga0265324_10002184 | 3300029957 | Bacteria | 10245 |
| 721 | Ga0265324_10108124 | 3300029957 | Bacteria | 945 |
| 722 | Ga0307512_10112280 | 3300030522 | Bacteria | 1789 |
| 723 | Ga0265332_10200301 | 3300031238 | Bacteria | 830 |
| 724 | Ga0265332_10289098 | 3300031238 | Bacteria | 677 |
| 725 | Ga0265328_10155256 | 3300031239 | Bacteria | 862 |
| 726 | Ga0265328_10271102 | 3300031239 | Bacteria | 652 |
| 727 | Ga0265320_10075795 | 3300031240 | Bacteria | 1577 |
| 728 | Ga0265325_10006538 | 3300031241 | Bacteria | 7070 |
| 729 | Ga0265325_10009438 | 3300031241 | Bacteria | 5694 |
| 730 | Ga0265325_10227246 | 3300031241 | Bacteria | 852 |
| 731 | Ga0265329_10058269 | 3300031242 | Bacteria | 1224 |
| 732 | Ga0265329_10166878 | 3300031242 | Bacteria | 717 |
| 733 | Ga0265340_10001678 | 3300031247 | Bacteria | 12726 |
| 734 | Ga0265340_10032481 | 3300031247 | Bacteria | 2606 |
| 735 | Ga0265340_10075438 | 3300031247 | Bacteria | 1593 |
| 736 | Ga0265340_10114786 | 3300031247 | Bacteria | 1242 |
| 737 | Ga0265331_10021780 | 3300031250 | Bacteria | 3275 |
| 738 | Ga0265331_10064808 | 3300031250 | Bacteria | 1719 |
| 739 | Ga0265331_10135888 | 3300031250 | Bacteria | 1120 |
| 740 | Ga0265331_10141382 | 3300031250 | Bacteria | 1095 |
| 741 | Ga0265327_10003183 | 3300031251 | Bacteria | 16061 |
| 742 | Ga0265327_10027477 | 3300031251 | Bacteria | 3274 |
| 743 | Ga0265327_10156539 | 3300031251 | Bacteria | 1055 |
| 744 | Ga0265316_10265257 | 3300031344 | Bacteria | 1258 |
| 745 | Ga0265316_10343827 | 3300031344 | Bacteria | 1081 |
| 746 | Ga0265316_10418871 | 3300031344 | Bacteria | 963 |
| 747 | Ga0265316_11268221 | 3300031344 | Bacteria | 509 |
| 748 | Ga0307513_10000852 | 3300031456 | Bacteria | 44393 |
| 749 | Ga0307513_10002169 | 3300031456 | Bacteria | 27467 |
| 750 | Ga0307513_10084803 | 3300031456 | Bacteria | 3253 |
| 751 | Ga0307513_10132190 | 3300031456 | Bacteria | 2439 |
| 752 | Ga0307513_11085111 | 3300031456 | Bacteria | 512 |
| 753 | Ga0307509_10000115 | 3300031507 | Bacteria | 116444 |
| 754 | Ga0307509_10605560 | 3300031507 | Bacteria | 768 |
| 755 | Ga0307408_100076769 | 3300031548 | Bacteria | 2486 |
| 756 | Ga0307408_100888614 | 3300031548 | Bacteria | 815 |
| 757 | Ga0307408_101269491 | 3300031548 | Bacteria | 689 |
| 758 | Ga0265313_10031074 | 3300031595 | Bacteria | 2740 |
| 759 | Ga0265313_10194519 | 3300031595 | Bacteria | 846 |
| 760 | Ga0307508_10011570 | 3300031616 | Bacteria | 8061 |
| 761 | Ga0307508_10049419 | 3300031616 | Bacteria | 3746 |
| 762 | Ga0307508_10075275 | 3300031616 | Bacteria | 2953 |
| 763 | Ga0307508_10271173 | 3300031616 | Bacteria | 1291 |
| 764 | Ga0316575_10074038 | 3300031665 | Bacteria | 1370 |
| 765 | Ga0265314_10065760 | 3300031711 | Bacteria | 2448 |
| 766 | Ga0265314_10101750 | 3300031711 | Bacteria | 1845 |
| 767 | Ga0265314_10135802 | 3300031711 | Bacteria | 1527 |
| 768 | Ga0265314_10198905 | 3300031711 | Bacteria | 1186 |
| 769 | Ga0265342_10105466 | 3300031712 | Bacteria | 1601 |
| 770 | Ga0265342_10205207 | 3300031712 | Bacteria | 1069 |
| 771 | Ga0265342_10547188 | 3300031712 | Bacteria | 587 |
| 772 | Ga0316576_10537020 | 3300031727 | Bacteria | 858 |
| 773 | Ga0307516_10000029 | 3300031730 | Bacteria | 159762 |
| 774 | Ga0307516_10366324 | 3300031730 | Bacteria | 1105 |
| 775 | Ga0307516_10445344 | 3300031730 | Bacteria | 952 |
| 776 | Ga0307410_11155952 | 3300031852 | Bacteria | 673 |
| 777 | Ga0307407_10167016 | 3300031903 | Bacteria | 1446 |
| 778 | Ga0307407_11387629 | 3300031903 | Bacteria | 553 |
| 779 | Ga0307409_100249540 | 3300031995 | Bacteria | 1622 |
| 780 | Ga0307409_102956189 | 3300031995 | Bacteria | 502 |
| 781 | Ga0307416_100473599 | 3300032002 | Bacteria | 1311 |
| 782 | Ga0307416_101874870 | 3300032002 | Bacteria | 703 |
| 783 | Ga0307411_11053823 | 3300032005 | Bacteria | 731 |
| 784 | Ga0316583_10058542 | 3300032133 | Bacteria | 1352 |
| 785 | Ga0307510_10051340 | 3300033180 | Bacteria | 4361 |
| 786 | Ga0307510_10105648 | 3300033180 | Bacteria | 2583 |
| 787 | Ga0307510_10356649 | 3300033180 | Bacteria | 912 |
| 788 | Ga0307510_10492470 | 3300033180 | Bacteria | 668 |
| 789 | Ga0373938_0245460 | 3300034957 | Bacteria | 510 |
| 790 | Ga0373926_0085038 | 3300035083 | Bacteria | 1173 |
| 791 | Ga0373926_0271087 | 3300035083 | Bacteria | 660 |
| 792 | Ga0373928_0245085 | 3300035084 | Bacteria | 532 |
| 793 | Ga0373940_0026875 | 3300035088 | Bacteria | 1509 |
| 794 | Ga0373940_0305113 | 3300035088 | Bacteria | 549 |
| 795 | Ga0373944_0003979 | 3300035089 | Bacteria | 3826 |
| 796 | Ga0373951_0177728 | 3300035091 | Bacteria | 610 |
| 797 | Ga0373932_0138135 | 3300035112 | Bacteria | 827 |
| 798 | Ga0373936_0332489 | 3300035113 | Bacteria | 690 |
| 799 | Ga0373939_0045189 | 3300035114 | Bacteria | 1343 |
| 800 | Ga0373941_0315002 | 3300035115 | Bacteria | 628 |
| 801 | Ga0373953_0127756 | 3300035117 | Bacteria | 1082 |
| 802 | Ga0373954_0104993 | 3300035118 | Bacteria | 1364 |
| 803 | Ga0373957_0008983 | 3300035120 | Bacteria | 3258 |
| 804 | Ga0373943_0085914 | 3300035170 | Bacteria | 1621 |
| 805 | Ga0373943_0186214 | 3300035170 | Bacteria | 1143 |
| 806 | Ga0373943_0195356 | 3300035170 | Bacteria | 1118 |
| 807 | Ga0373946_0067975 | 3300035171 | Bacteria | 1531 |
| 808 | Ga0373961_0190804 | 3300035241 | Bacteria | 718 |
| 809 | Ga0373962_0306855 | 3300035242 | Bacteria | 564 |
| 810 | Ga0316574_0000161 | 3300035398 | Bacteria | 21995 |
| 811 | Ga0373931_0005928 | 3300035691 | Bacteria | 5681 |
| 812 | Ga0373931_0519344 | 3300035691 | Bacteria | 770 |
| 813 | Ga0373931_0726162 | 3300035691 | Bacteria | 658 |
| 814 | Ga0373935_0218330 | 3300035692 | Bacteria | 1323 |
| 815 | Ga0373927_0000155 | 3300035695 | Bacteria | 53529 |
| 816 | Ga0373927_0090786 | 3300035695 | Bacteria | 1984 |
| 817 | Ga0373927_0218513 | 3300035695 | Bacteria | 1252 |
| 818 | Ga0373947_0120662 | 3300035725 | Bacteria | 1665 |
| 819 | Ga0373947_0233356 | 3300035725 | Bacteria | 1212 |
| 820 | Ga0373947_0518297 | 3300035725 | Bacteria | 811 |
| 821 | Ga0373947_0796061 | 3300035725 | Bacteria | 645 |
| 822 | Ga0373937_0002250 | 3300036401 | Bacteria | 16098 |
| 823 | Ga0373937_0094799 | 3300036401 | Bacteria | 2768 |
| 824 | Ga0373937_1607474 | 3300036401 | Bacteria | 597 |
| 825 | Ga0316582_0163544 | 3300036647 | Bacteria | 1508 |
| 826 | Ga0316584_0008065 | 3300036712 | Bacteria | 7234 |
| 827 | Ga0373925_0000050 | 3300037068 | Bacteria | 127678 |
| 828 | Ga0373925_0633260 | 3300037068 | Bacteria | 881 |
| 829 | Ga0395899_0049253 | 3300037312 | Bacteria | 3133 |
| 830 | Ga0395899_0106177 | 3300037312 | Bacteria | 2022 |
| 831 | Ga0395899_0480008 | 3300037312 | Bacteria | 809 |
| 832 | Ga0395899_0733907 | 3300037312 | Bacteria | 616 |
| 833 | Ga0395900_0003044 | 3300037418 | Bacteria | 18262 |
| 834 | Ga0395900_0049001 | 3300037418 | Bacteria | 4351 |
| 835 | Ga0395900_0229886 | 3300037418 | Bacteria | 1866 |
| 836 | Ga0395900_0374247 | 3300037418 | Bacteria | 1393 |
| 837 | Ga0395900_0608026 | 3300037418 | Bacteria | 1033 |
| 838 | Ga0395900_0877385 | 3300037418 | Bacteria | 821 |
| 839 | Ga0395900_1369596 | 3300037418 | Bacteria | 621 |
| 840 | Ga0395898_0003078 | 3300037466 | Bacteria | 18893 |
| 841 | Ga0395898_0116788 | 3300037466 | Bacteria | 2557 |
| 842 | Ga0395898_0117951 | 3300037466 | Bacteria | 2542 |
| 843 | Ga0395898_0357161 | 3300037466 | Bacteria | 1393 |
| 844 | Ga0395898_1021522 | 3300037466 | Bacteria | 762 |
| 845 | Ga0395898_1390515 | 3300037466 | Bacteria | 630 |
| 846 | Ga0395905_0001273 | 3300037471 | Bacteria | 31107 |
| 847 | Ga0395905_0178258 | 3300037471 | Bacteria | 1995 |
| 848 | Ga0395905_0182365 | 3300037471 | Bacteria | 1971 |
| 849 | Ga0395905_0221863 | 3300037471 | Bacteria | 1769 |
| 850 | Ga0395905_1452281 | 3300037471 | Bacteria | 590 |
| 851 | Ga0395905_1818690 | 3300037471 | Bacteria | 515 |
| 852 | Ga0395905_1877897 | 3300037471 | Bacteria | 505 |
| 853 | Ga0436364_0407990 | 3300037853 | Bacteria | 2315 |
| 854 | Ga0436364_0561975 | 3300037853 | Bacteria | 620 |
| 855 | Ga0436364_1280483 | 3300037853 | Bacteria | 1989 |
| 856 | Ga0436364_1290587 | 3300037853 | Bacteria | 895 |
| 857 | Ga0436364_1382664 | 3300037853 | Bacteria | 2494 |
| 858 | Ga0395901_0022715 | 3300038443 | Bacteria | 6432 |
| 859 | Ga0395901_0261930 | 3300038443 | Bacteria | 1799 |
| 860 | Ga0395901_0787307 | 3300038443 | Bacteria | 941 |
| 861 | Ga0400483_113437 | 3300039062 | Bacteria | 1041 |
| 862 | Ga0436365_0071066 | 3300039437 | Bacteria | 581 |
| 863 | Ga0436365_0089719 | 3300039437 | Bacteria | 1008 |
| 864 | Ga0436365_0097049 | 3300039437 | Bacteria | 899 |
| 865 | Ga0436365_0176700 | 3300039437 | Bacteria | 1585 |
| 866 | Ga0436365_0478528 | 3300039437 | Bacteria | 5695 |
| 867 | Ga0436365_0652448 | 3300039437 | Bacteria | 556 |
| 868 | Ga0436365_0987719 | 3300039437 | Bacteria | 770 |
| 869 | Ga0436365_1901637 | 3300039437 | Bacteria | 583 |
| 870 | Ga0436365_1912355 | 3300039437 | Bacteria | 4392 |
| 871 | Ga0436360_0107966 | 3300039438 | Bacteria | 572 |
| 872 | Ga0436360_0560001 | 3300039438 | Bacteria | 657 |
| 873 | Ga0436360_0659897 | 3300039438 | Bacteria | 1740 |
| 874 | Ga0436360_1276140 | 3300039438 | Bacteria | 1346 |
| 875 | Ga0436360_1336701 | 3300039438 | Bacteria | 4083 |
| 876 | Ga0436361_0123394 | 3300039447 | Bacteria | 3946 |
| 877 | Ga0436361_0126524 | 3300039447 | Bacteria | 9724 |
| 878 | Ga0436361_0259266 | 3300039447 | Bacteria | 1573 |
| 879 | Ga0436361_0275557 | 3300039447 | Bacteria | 617 |
| 880 | Ga0436361_0344369 | 3300039447 | Bacteria | 1789 |
| 881 | Ga0436361_0433996 | 3300039447 | Bacteria | 8268 |
| 882 | Ga0436361_0564472 | 3300039447 | Bacteria | 5234 |
| 883 | Ga0436361_0585344 | 3300039447 | Bacteria | 1873 |
| 884 | Ga0436361_0590022 | 3300039447 | Bacteria | 892 |
| 885 | Ga0436361_1147896 | 3300039447 | Bacteria | 513 |
| 886 | Ga0436363_0659025 | 3300039450 | Bacteria | 787 |
| 887 | Ga0436363_0766421 | 3300039450 | Bacteria | 999 |
| 888 | Ga0436363_0786529 | 3300039450 | Bacteria | 1039 |
| 889 | Ga0436363_0903263 | 3300039450 | Bacteria | 621 |
| 890 | Ga0436363_1146700 | 3300039450 | Bacteria | 3781 |
| 891 | Ga0436363_1592292 | 3300039450 | Bacteria | 1616 |
| 892 | Ga0436362_0242406 | 3300039453 | Bacteria | 619 |
| 893 | Ga0436362_0466387 | 3300039453 | Bacteria | 2355 |
| 894 | Ga0436362_1077664 | 3300039453 | Bacteria | 2635 |
| 895 | Ga0439436_0003632 | 3300041404 | Bacteria | 4700 |
| 896 | Ga0439438_031950 | 3300041405 | Bacteria | 1398 |
| 897 | Ga0439439_0227969 | 3300041406 | Bacteria | 547 |
| 898 | Ga0439447_017777 | 3300041407 | Bacteria | 1932 |
| 899 | Ga0439465_0003746 | 3300041413 | Bacteria | 4957 |
| 900 | Ga0439465_0099729 | 3300041413 | Bacteria | 1002 |
| 901 | Ga0439465_0378543 | 3300041413 | Bacteria | 537 |
| 902 | Ga0451789_1302564 | 3300041443 | Bacteria | 1214 |
| 903 | Ga0451793_0870755 | 3300041452 | Bacteria | 718 |
| 904 | Ga0451802_0383790 | 3300041460 | Bacteria | 622 |
| 905 | Ga0451833_0407321 | 3300041491 | Bacteria | 1503 |
| 906 | Ga0451833_0737184 | 3300041491 | Bacteria | 575 |
| 907 | Ga0451833_1325230 | 3300041491 | Bacteria | 515 |
| 908 | Ga0451833_1417654 | 3300041491 | Bacteria | 744 |
| 909 | Ga0451847_0260825 | 3300041503 | Bacteria | 528 |
| 910 | Ga0451849_0406743 | 3300041505 | Bacteria | 1026 |
| 911 | Ga0451849_0912448 | 3300041505 | Bacteria | 577 |
| 912 | Ga0451853_0820542 | 3300041512 | Bacteria | 591 |
| 913 | Ga0451853_2029874 | 3300041512 | Bacteria | 551 |
| 914 | Ga0451853_4114360 | 3300041512 | Bacteria | 650 |
| 915 | Ga0439445_0034436 | 3300042004 | Bacteria | 1327 |
| 916 | Ga0439445_0201410 | 3300042004 | Bacteria | 588 |
| 917 | Ga0439432_061721 | 3300042006 | Bacteria | 1155 |
| 918 | Ga0439449_0020329 | 3300042007 | Bacteria | 2488 |
| 919 | Ga0439462_0029571 | 3300042015 | Bacteria | 1449 |
| 920 | Ga0450912_026150 | 3300042116 | Bacteria | 587 |
| 921 | Ga0450920_006886 | 3300042122 | Bacteria | 2050 |
| 922 | Ga0450906_005298 | 3300042145 | Bacteria | 2660 |
| 923 | Ga0450907_014165 | 3300042146 | Bacteria | 1330 |
| 924 | Ga0450910_051659 | 3300042147 | Bacteria | 681 |
| 925 | Ga0439458_0147696 | 3300042157 | Bacteria | 629 |
| 926 | Ga0450918_002227 | 3300042531 | Bacteria | 3685 |
| 927 | Ga0451577_1361144 | 3300042876 | Bacteria | 630 |
| 928 | Ga0466969_0134804 | 3300044656 | Bacteria | 1144 |
| 929 | Ga0466972_0000053 | 3300044658 | Bacteria | 112876 |
| 930 | Ga0466972_0004635 | 3300044658 | Bacteria | 6883 |
| 931 | Ga0466972_0304231 | 3300044658 | Bacteria | 745 |
| 932 | Ga0466965_0106903 | 3300044683 | Bacteria | 1435 |
| 933 | Ga0466965_0395966 | 3300044683 | Bacteria | 762 |
| 934 | Ga0466965_0583269 | 3300044683 | Bacteria | 634 |
| 935 | Ga0466966_0003689 | 3300044684 | Bacteria | 10107 |
| 936 | Ga0466966_0494001 | 3300044684 | Bacteria | 736 |
| 937 | Ga0466961_0004648 | 3300044693 | Bacteria | 8621 |
| 938 | Ga0466961_0426019 | 3300044693 | Bacteria | 804 |
| 939 | Ga0466963_0870803 | 3300044694 | Bacteria | 635 |
| 940 | Ga0466963_1045763 | 3300044694 | Bacteria | 575 |
| 941 | Ga0466964_0054370 | 3300044706 | Bacteria | 1650 |
| 942 | Ga0466964_0854536 | 3300044706 | Bacteria | 518 |
| 943 | Ga0453684_0508793 | 3300044712 | Bacteria | 1332 |
| 944 | Ga0466971_0432648 | 3300044719 | Bacteria | 644 |
| 945 | Ga0466968_0001220 | 3300044735 | Bacteria | 9109 |
| 946 | Ga0466970_0101279 | 3300044765 | Bacteria | 1569 |
| 947 | Ga0466970_0230458 | 3300044765 | Bacteria | 1035 |
| 948 | Ga0466957_0395124 | 3300044842 | Bacteria | 945 |
| 949 | Ga0466957_0503763 | 3300044842 | Bacteria | 840 |
| 950 | Ga0466960_0009742 | 3300044901 | Bacteria | 3973 |
| 951 | Ga0466960_0013395 | 3300044901 | Bacteria | 3484 |
| 952 | Ga0466960_0793258 | 3300044901 | Bacteria | 573 |
| 953 | Ga0466959_0002926 | 3300045049 | Bacteria | 11013 |
| 954 | Ga0466959_0195198 | 3300045049 | Bacteria | 1411 |
| 955 | Ga0451576_0000194 | 3300045051 | Bacteria | 154080 |
| 956 | Ga0451576_1630076 | 3300045051 | Bacteria | 669 |
| 957 | Ga0466958_0192720 | 3300045836 | Bacteria | 1296 |
| 958 | Ga0466967_0139418 | 3300045976 | Bacteria | 2258 |
| 959 | Ga0466967_0638282 | 3300045976 | Bacteria | 1052 |
| 960 | Ga0466967_0773688 | 3300045976 | Bacteria | 952 |
| 961 | Ga0466967_1465549 | 3300045976 | Bacteria | 680 |
| 962 | Ga0495627_123321 | 3300046453 | Bacteria | 731 |
| 963 | Ga0495592_0043578 | 3300046454 | Bacteria | 3357 |
| 964 | Ga0495592_0087729 | 3300046454 | Bacteria | 2237 |
| 965 | Ga0495603_0070143 | 3300046455 | Bacteria | 2060 |
| 966 | Ga0495590_0217065 | 3300046457 | Bacteria | 706 |
| 967 | Ga0495629_0003885 | 3300046459 | Bacteria | 11256 |
| 968 | Ga0495638_0002872 | 3300046460 | Bacteria | 13794 |
| 969 | Ga0495638_0058306 | 3300046460 | Bacteria | 2393 |
| 970 | Ga0495638_0409065 | 3300046460 | Bacteria | 702 |
| 971 | Ga0495651_0005311 | 3300046462 | Bacteria | 9823 |
| 972 | Ga0495651_0026825 | 3300046462 | Bacteria | 4486 |
| 973 | Ga0495653_0284276 | 3300046463 | Bacteria | 1084 |
| 974 | Ga0495650_0336504 | 3300046471 | Bacteria | 501 |
| 975 | Ga0495580_0204314 | 3300046472 | Bacteria | 1360 |
| 976 | Ga0495605_0285771 | 3300046474 | Bacteria | 700 |
| 977 | Ga0495664_0166292 | 3300046477 | Bacteria | 1338 |
| 978 | Ga0495664_0728822 | 3300046477 | Bacteria | 585 |
| 979 | Ga0495596_0130914 | 3300046500 | Bacteria | 974 |
| 980 | Ga0495607_0091356 | 3300046501 | Bacteria | 1649 |
| 981 | Ga0495606_0076424 | 3300046507 | Bacteria | 2093 |
| 982 | Ga0495606_0137801 | 3300046507 | Bacteria | 1444 |
| 983 | Ga0495606_0192182 | 3300046507 | Bacteria | 1169 |
| 984 | Ga0495606_0209552 | 3300046507 | Bacteria | 1105 |
| 985 | Ga0495606_0219766 | 3300046507 | Bacteria | 1071 |
| 986 | Ga0495610_0291090 | 3300046512 | Bacteria | 633 |
| 987 | Ga0495616_0201254 | 3300046513 | Bacteria | 875 |
| 988 | Ga0495618_0035880 | 3300046514 | Bacteria | 3112 |
| 989 | Ga0495620_0054254 | 3300046515 | Bacteria | 1694 |
| 990 | Ga0495628_0103744 | 3300046516 | Bacteria | 2192 |
| 991 | Ga0495628_0684683 | 3300046516 | Bacteria | 725 |
| 992 | Ga0495643_0127233 | 3300046522 | Bacteria | 1282 |
| 993 | Ga0495643_0143795 | 3300046522 | Bacteria | 1187 |
| 994 | Ga0495648_0055521 | 3300046524 | Bacteria | 2387 |
| 995 | Ga0495648_0237903 | 3300046524 | Bacteria | 887 |
| 996 | Ga0495666_0179598 | 3300046526 | Bacteria | 978 |
| 997 | Ga0495666_0527791 | 3300046526 | Bacteria | 527 |
| 998 | Ga0495652_0082534 | 3300046529 | Bacteria | 2648 |
| 999 | Ga0495652_0095736 | 3300046529 | Bacteria | 2419 |
| 1000 | Ga0495652_0218829 | 3300046529 | Bacteria | 1432 |
| 1001 | Ga0495654_0321195 | 3300046530 | Bacteria | 628 |
| 1002 | Ga0495640_0019349 | 3300046533 | Bacteria | 5027 |
| 1003 | Ga0495640_0032240 | 3300046533 | Bacteria | 3733 |
| 1004 | Ga0495586_0856004 | 3300046535 | Bacteria | 524 |
| 1005 | Ga0495587_0185731 | 3300046536 | Bacteria | 1178 |
| 1006 | Ga0495587_0297556 | 3300046536 | Bacteria | 903 |
| 1007 | Ga0495609_0092136 | 3300046538 | Bacteria | 1318 |
| 1008 | Ga0495609_0184469 | 3300046538 | Bacteria | 877 |
| 1009 | Ga0495609_0267792 | 3300046538 | Bacteria | 701 |
| 1010 | Ga0495609_0290807 | 3300046538 | Bacteria | 667 |
| 1011 | Ga0495597_0027670 | 3300046542 | Bacteria | 2599 |
| 1012 | Ga0495597_0171342 | 3300046542 | Bacteria | 881 |
| 1013 | Ga0495645_0384559 | 3300046543 | Bacteria | 897 |
| 1014 | Ga0495622_0016703 | 3300046557 | Bacteria | 3418 |
| 1015 | Ga0495622_0049422 | 3300046557 | Bacteria | 1952 |
| 1016 | Ga0495622_0053966 | 3300046557 | Bacteria | 1865 |
| 1017 | Ga0495633_0208489 | 3300046558 | Bacteria | 896 |
| 1018 | Ga0495667_0202232 | 3300046559 | Bacteria | 1271 |
| 1019 | Ga0495668_0068816 | 3300046616 | Bacteria | 1947 |
| 1020 | Ga0495668_0207226 | 3300046616 | Bacteria | 1073 |
| 1021 | Ga0495668_0259317 | 3300046616 | Bacteria | 952 |
| 1022 | Ga0495668_0765814 | 3300046616 | Bacteria | 534 |
| 1023 | Ga0495634_0107967 | 3300046642 | Bacteria | 1792 |
| 1024 | Ga0495611_0096248 | 3300046648 | Bacteria | 1371 |
| 1025 | Ga0495611_0330549 | 3300046648 | Bacteria | 701 |
| 1026 | Ga0495625_0052558 | 3300046660 | Bacteria | 2917 |
| 1027 | Ga0495625_0210390 | 3300046660 | Bacteria | 1279 |
| 1028 | Ga0495625_0221718 | 3300046660 | Bacteria | 1239 |
| 1029 | Ga0495625_0226986 | 3300046660 | Bacteria | 1221 |
| 1030 | Ga0495635_0009411 | 3300046663 | Bacteria | 6832 |
| 1031 | Ga0495661_0038077 | 3300046665 | Bacteria | 2999 |
| 1032 | Ga0495661_0442437 | 3300046665 | Bacteria | 627 |
| 1033 | Ga0495588_0032954 | 3300046674 | Bacteria | 2614 |
| 1034 | Ga0495588_0681564 | 3300046674 | Bacteria | 538 |
| 1035 | Ga0495657_0011877 | 3300046675 | Bacteria | 6491 |
| 1036 | Ga0495599_0046793 | 3300046678 | Bacteria | 2712 |
| 1037 | Ga0495599_0579137 | 3300046678 | Bacteria | 655 |
| 1038 | Ga0495623_0202565 | 3300046679 | Bacteria | 1140 |
| 1039 | Ga0495623_0271605 | 3300046679 | Bacteria | 946 |
| 1040 | Ga0495646_0261083 | 3300046680 | Bacteria | 925 |
| 1041 | Ga0495646_0373711 | 3300046680 | Bacteria | 744 |
| 1042 | Ga0495658_0972039 | 3300046683 | Bacteria | 542 |
| 1043 | Ga0495613_0033862 | 3300046689 | Bacteria | 3794 |
| 1044 | Ga0495613_0041620 | 3300046689 | Bacteria | 3402 |
| 1045 | Ga0495624_0150720 | 3300046690 | Bacteria | 1422 |
| 1046 | Ga0495649_0028321 | 3300046694 | Bacteria | 3105 |
| 1047 | Ga0495649_0065029 | 3300046694 | Bacteria | 1958 |
| 1048 | Ga0495589_0178156 | 3300046794 | Bacteria | 1009 |
| 1049 | Ga0495600_0711700 | 3300046809 | Bacteria | 603 |
| 1050 | Ga0495581_0074513 | 3300047315 | Bacteria | 1964 |
| 1051 | Ga0495604_0010490 | 3300047317 | Bacteria | 7344 |
| 1052 | Ga0495604_0100979 | 3300047317 | Bacteria | 2120 |
| 1053 | Ga0495604_0296360 | 3300047317 | Bacteria | 1087 |
| 1054 | Ga0495674_0042102 | 3300047319 | Bacteria | 4076 |
| 1055 | Ga0495674_0122217 | 3300047319 | Bacteria | 2199 |
| 1056 | Ga0495672_0046408 | 3300047320 | Bacteria | 2591 |
| 1057 | Ga0495672_0150739 | 3300047320 | Bacteria | 1206 |
| 1058 | Ga0495672_0155635 | 3300047320 | Bacteria | 1181 |
| 1059 | Ga0495672_0338301 | 3300047320 | Bacteria | 702 |
| 1060 | Ga0495672_0366175 | 3300047320 | Bacteria | 666 |
| 1061 | Ga0495676_0022307 | 3300047321 | Bacteria | 5511 |
| 1062 | Ga0495680_0035033 | 3300047322 | Bacteria | 4047 |
| 1063 | Ga0495680_0169272 | 3300047322 | Bacteria | 1582 |
| 1064 | Ga0495683_0178119 | 3300047323 | Bacteria | 973 |
| 1065 | Ga0495687_005686 | 3300047443 | Bacteria | 7869 |
| 1066 | Ga0495687_091885 | 3300047443 | Bacteria | 1160 |
| 1067 | Ga0495675_0026947 | 3300047444 | Bacteria | 3664 |
| 1068 | Ga0495673_0276378 | 3300047469 | Bacteria | 607 |
| 1069 | Ga0495681_0164783 | 3300047470 | Bacteria | 921 |
| 1070 | Ga0495684_0213402 | 3300047471 | Bacteria | 1418 |
| 1071 | Ga0495684_1036722 | 3300047471 | Bacteria | 519 |
| 1072 | Ga0495686_0103802 | 3300047472 | Bacteria | 1712 |
| 1073 | Ga0495686_0578539 | 3300047472 | Bacteria | 584 |
| 1074 | Ga0495593_0222005 | 3300047673 | Bacteria | 948 |
| 1075 | Ga0495602_0092771 | 3300048088 | Bacteria | 2500 |
| 1076 | Ga0495602_0125194 | 3300048088 | Bacteria | 2060 |
| 1077 | Ga0495626_0162916 | 3300048091 | Bacteria | 934 |
| 1078 | Ga0496100_0203336 | 3300048903 | Bacteria | 1445 |
| 1079 | Ga0496100_0464065 | 3300048903 | Bacteria | 972 |
| 1080 | Ga0496100_1182217 | 3300048903 | Bacteria | 603 |
| 1081 | Ga0496101_0076663 | 3300048904 | Bacteria | 2463 |
| 1082 | Ga0496101_0443713 | 3300048904 | Bacteria | 1024 |
| 1083 | Ga0496101_0980585 | 3300048904 | Bacteria | 665 |
| 1084 | Ga0496102_0052325 | 3300048905 | Bacteria | 3720 |
| 1085 | Ga0496102_1182874 | 3300048905 | Bacteria | 684 |
| 1086 | Ga0496102_1844263 | 3300048905 | Bacteria | 522 |
| 1087 | Ga0496103_0009918 | 3300048906 | Bacteria | 5633 |
| 1088 | Ga0496103_0435099 | 3300048906 | Bacteria | 842 |
| 1089 | Ga0496103_0524638 | 3300048906 | Unclassified | 757 |
| 1090 | Ga0496103_0725685 | 3300048906 | Bacteria | 629 |
| 1091 | Ga0496104_0055763 | 3300048907 | Bacteria | 3736 |
| 1092 | Ga0496104_0058115 | 3300048907 | Bacteria | 3660 |
| 1093 | Ga0496104_0167280 | 3300048907 | Bacteria | 2108 |
| 1094 | Ga0496104_0831400 | 3300048907 | Bacteria | 829 |
| 1095 | Ga0496104_1336728 | 3300048907 | Bacteria | 620 |
| 1096 | Ga0496104_1559141 | 3300048907 | Bacteria | 563 |
| 1097 | Ga0496105_0107446 | 3300048908 | Bacteria | 2303 |
| 1098 | Ga0496105_0413947 | 3300048908 | Bacteria | 1068 |
| 1099 | Ga0496106_0105098 | 3300048909 | Bacteria | 2194 |
| 1100 | Ga0496106_0441862 | 3300048909 | Bacteria | 1045 |
| 1101 | Ga0496106_1570368 | 3300048909 | Bacteria | 505 |
| 1102 | Ga0496107_0751530 | 3300048910 | Bacteria | 715 |
| 1103 | Ga0496108_0005061 | 3300048911 | Bacteria | 10650 |
| 1104 | Ga0496108_0141180 | 3300048911 | Bacteria | 2075 |
| 1105 | Ga0496108_0215381 | 3300048911 | Bacteria | 1668 |
| 1106 | Ga0496108_0731870 | 3300048911 | Bacteria | 856 |
| 1107 | Ga0496108_0936967 | 3300048911 | Bacteria | 742 |
| 1108 | Ga0496108_0959533 | 3300048911 | Bacteria | 732 |
| 1109 | Ga0496108_1084318 | 3300048911 | Bacteria | 681 |
| 1110 | Ga0496108_1393577 | 3300048911 | Bacteria | 587 |
| 1111 | Ga0496109_0003617 | 3300048912 | Bacteria | 12923 |
| 1112 | Ga0496109_0021676 | 3300048912 | Bacteria | 5685 |
| 1113 | Ga0496109_0061636 | 3300048912 | Bacteria | 3430 |
| 1114 | Ga0496109_0090763 | 3300048912 | Bacteria | 2826 |
| 1115 | Ga0496109_0140646 | 3300048912 | Bacteria | 2257 |
| 1116 | Ga0496109_0513538 | 3300048912 | Bacteria | 1131 |
| 1117 | Ga0496109_0742063 | 3300048912 | Bacteria | 920 |
| 1118 | Ga0496110_0001002 | 3300048913 | Bacteria | 19876 |
| 1119 | Ga0496110_0058619 | 3300048913 | Bacteria | 3391 |
| 1120 | Ga0496110_0138102 | 3300048913 | Bacteria | 2204 |
| 1121 | Ga0496110_0900981 | 3300048913 | Bacteria | 790 |
| 1122 | Ga0496110_1017474 | 3300048913 | Bacteria | 736 |
| 1123 | Ga0496111_0004762 | 3300048914 | Bacteria | 8612 |
| 1124 | Ga0496111_0009201 | 3300048914 | Bacteria | 6578 |
| 1125 | Ga0496111_0061999 | 3300048914 | Bacteria | 2711 |
| 1126 | Ga0496111_0114914 | 3300048914 | Bacteria | 1984 |
| 1127 | Ga0496111_1140738 | 3300048914 | Bacteria | 554 |
| 1128 | Ga0496112_0035998 | 3300048915 | Bacteria | 4825 |
| 1129 | Ga0496112_0089073 | 3300048915 | Bacteria | 3054 |
| 1130 | Ga0496112_0275470 | 3300048915 | Bacteria | 1630 |
| 1131 | Ga0496112_0291893 | 3300048915 | Bacteria | 1577 |
| 1132 | Ga0496112_0912800 | 3300048915 | Unclassified | 800 |
| 1133 | Ga0496112_1029678 | 3300048915 | Bacteria | 743 |
| 1134 | Ga0496112_1338460 | 3300048915 | Bacteria | 631 |
| 1135 | Ga0496113_0008012 | 3300048916 | Bacteria | 6851 |
| 1136 | Ga0496113_0125164 | 3300048916 | Bacteria | 2012 |
| 1137 | Ga0496113_0211221 | 3300048916 | Bacteria | 1545 |
| 1138 | Ga0496113_0286936 | 3300048916 | Bacteria | 1316 |
| 1139 | Ga0496113_0300593 | 3300048916 | Bacteria | 1285 |
| 1140 | Ga0496114_1302464 | 3300048917 | Bacteria | 613 |
| 1141 | Ga0496115_0003355 | 3300048918 | Bacteria | 11493 |
| 1142 | Ga0496115_0029999 | 3300048918 | Bacteria | 4275 |
| 1143 | Ga0496115_0130548 | 3300048918 | Bacteria | 2070 |
| 1144 | Ga0496115_0708547 | 3300048918 | Bacteria | 791 |
| 1145 | Ga0496116_0015598 | 3300048919 | Bacteria | 5999 |
| 1146 | Ga0496116_0161594 | 3300048919 | Bacteria | 1228 |
| 1147 | Ga0496116_0394696 | 3300048919 | Bacteria | 615 |
| 1148 | Ga0496117_0128935 | 3300048920 | Bacteria | 1537 |
| 1149 | Ga0496117_0512698 | 3300048920 | Bacteria | 579 |
| 1150 | Ga0496118_0033503 | 3300048921 | Bacteria | 4213 |
| 1151 | Ga0496118_0090210 | 3300048921 | Bacteria | 2113 |
| 1152 | Ga0496118_0135239 | 3300048921 | Bacteria | 1574 |
| 1153 | Ga0496118_0415208 | 3300048921 | Bacteria | 694 |
| 1154 | Ga0496118_0581071 | 3300048921 | Bacteria | 540 |
| 1155 | Ga0496119_0008748 | 3300048922 | Bacteria | 8833 |
| 1156 | Ga0496119_0016625 | 3300048922 | Bacteria | 5584 |
| 1157 | Ga0496119_0035070 | 3300048922 | Bacteria | 3293 |
| 1158 | Ga0496119_0049830 | 3300048922 | Bacteria | 2586 |
| 1159 | Ga0496119_0090351 | 3300048922 | Bacteria | 1742 |
| 1160 | Ga0496119_0379680 | 3300048922 | Bacteria | 678 |
| 1161 | Ga0496120_0012617 | 3300048923 | Bacteria | 5736 |
| 1162 | Ga0496120_0238343 | 3300048923 | Bacteria | 860 |
| 1163 | Ga0496120_0246130 | 3300048923 | Bacteria | 841 |
| 1164 | Ga0496120_0317461 | 3300048923 | Bacteria | 709 |
| 1165 | Ga0496121_0024927 | 3300048924 | Bacteria | 5700 |
| 1166 | Ga0496121_0033653 | 3300048924 | Bacteria | 4633 |
| 1167 | Ga0496121_0048784 | 3300048924 | Bacteria | 3598 |
| 1168 | Ga0496121_0102047 | 3300048924 | Bacteria | 2211 |
| 1169 | Ga0496121_0172983 | 3300048924 | Bacteria | 1566 |
| 1170 | Ga0496121_0257936 | 3300048924 | Bacteria | 1205 |
| 1171 | Ga0496121_0461130 | 3300048924 | Bacteria | 816 |
| 1172 | Ga0496121_0480331 | 3300048924 | Bacteria | 794 |
| 1173 | Ga0496121_0632691 | 3300048924 | Bacteria | 655 |
| 1174 | Ga0496121_0687822 | 3300048924 | Bacteria | 617 |
| 1175 | Ga0496122_0040874 | 3300048925 | Bacteria | 3677 |
| 1176 | Ga0496122_0075619 | 3300048925 | Bacteria | 2374 |
| 1177 | Ga0496122_0079731 | 3300048925 | Bacteria | 2286 |
| 1178 | Ga0496123_0014393 | 3300048926 | Bacteria | 6560 |
| 1179 | Ga0496123_0017468 | 3300048926 | Bacteria | 5769 |
| 1180 | Ga0496123_0053073 | 3300048926 | Bacteria | 2683 |
| 1181 | Ga0496124_0080375 | 3300048927 | Bacteria | 2683 |
| 1182 | Ga0496124_0259342 | 3300048927 | Bacteria | 1280 |
| 1183 | Ga0496124_0437364 | 3300048927 | Bacteria | 896 |
| 1184 | Ga0496124_0451706 | 3300048927 | Bacteria | 876 |
| 1185 | Ga0496124_0617234 | 3300048927 | Bacteria | 702 |
| 1186 | Ga0496124_0697112 | 3300048927 | Bacteria | 644 |
| 1187 | Ga0496124_0726809 | 3300048927 | Bacteria | 626 |
| 1188 | Ga0496125_0000262 | 3300048928 | Bacteria | 108389 |
| 1189 | Ga0496125_0017545 | 3300048928 | Bacteria | 6819 |
| 1190 | Ga0496125_0038460 | 3300048928 | Bacteria | 4140 |
| 1191 | Ga0496125_0067626 | 3300048928 | Bacteria | 2814 |
| 1192 | Ga0496125_0088917 | 3300048928 | Bacteria | 2325 |
| 1193 | Ga0496125_0198145 | 3300048928 | Bacteria | 1318 |
| 1194 | Ga0496125_0276647 | 3300048928 | Bacteria | 1043 |
| 1195 | Ga0496125_0391537 | 3300048928 | Bacteria | 815 |
| 1196 | Ga0496125_0489596 | 3300048928 | Bacteria | 695 |
| 1197 | Ga0496126_0018560 | 3300048929 | Bacteria | 6886 |
| 1198 | Ga0496126_0089962 | 3300048929 | Bacteria | 2701 |
| 1199 | Ga0496126_0125076 | 3300048929 | Bacteria | 2226 |
| 1200 | Ga0496126_0357788 | 3300048929 | Bacteria | 1193 |
| 1201 | Ga0496126_0389176 | 3300048929 | Bacteria | 1133 |
| 1202 | Ga0496126_0657462 | 3300048929 | Bacteria | 819 |
| 1203 | Ga0496126_0916301 | 3300048929 | Bacteria | 663 |
| 1204 | Ga0495682_0093547 | 3300049460 | Bacteria | 1079 |
| 1205 | Ga0501031_0608411 | 3300049568 | Bacteria | 703 |
| 1206 | Ga0501031_0706409 | 3300049568 | Bacteria | 647 |
| 1207 | Ga0501032_0037931 | 3300049569 | Bacteria | 3284 |
| 1208 | Ga0501032_0351675 | 3300049569 | Bacteria | 949 |
| 1209 | Ga0501033_0006182 | 3300049570 | Bacteria | 9389 |
| 1210 | Ga0501033_0047501 | 3300049570 | Bacteria | 3191 |
| 1211 | Ga0501033_0226086 | 3300049570 | Bacteria | 1331 |
| 1212 | Ga0501034_0017794 | 3300049571 | Bacteria | 7290 |
| 1213 | Ga0501034_0126282 | 3300049571 | Bacteria | 2543 |
| 1214 | Ga0501034_0158857 | 3300049571 | Bacteria | 2233 |
| 1215 | Ga0501034_0172394 | 3300049571 | Bacteria | 2130 |
| 1216 | Ga0501034_0191807 | 3300049571 | Bacteria | 2005 |
| 1217 | Ga0501034_0326680 | 3300049571 | Bacteria | 1466 |
| 1218 | Ga0501034_0575975 | 3300049571 | Bacteria | 1033 |
| 1219 | Ga0501036_0418738 | 3300049572 | Bacteria | 1117 |
| 1220 | Ga0501036_1036953 | 3300049572 | Bacteria | 671 |
| 1221 | Ga0501037_0046610 | 3300049573 | Bacteria | 3179 |
| 1222 | Ga0501037_0347326 | 3300049573 | Bacteria | 1024 |
| 1223 | Ga0501038_0064990 | 3300049574 | Bacteria | 3110 |
| 1224 | Ga0501038_1086840 | 3300049574 | Bacteria | 584 |
| 1225 | Ga0501039_0203717 | 3300049575 | Bacteria | 1556 |
| 1226 | Ga0501039_0210449 | 3300049575 | Bacteria | 1529 |
| 1227 | Ga0501039_1163142 | 3300049575 | Bacteria | 597 |
| 1228 | Ga0501040_0766934 | 3300049576 | Bacteria | 698 |
| 1229 | Ga0501041_0147011 | 3300049577 | Bacteria | 1471 |
| 1230 | Ga0501043_0033643 | 3300049579 | Bacteria | 4033 |
| 1231 | Ga0501043_0806277 | 3300049579 | Bacteria | 679 |
| 1232 | Ga0501043_1178112 | 3300049579 | Bacteria | 539 |
| 1233 | Ga0501046_0207259 | 3300049580 | Bacteria | 1457 |
| 1234 | Ga0501046_0522620 | 3300049580 | Bacteria | 848 |
| 1235 | Ga0501047_0015697 | 3300049581 | Bacteria | 7216 |
| 1236 | Ga0501047_0062863 | 3300049581 | Bacteria | 3581 |
| 1237 | Ga0501047_0080773 | 3300049581 | Bacteria | 3125 |
| 1238 | Ga0501047_0711345 | 3300049581 | Bacteria | 822 |
| 1239 | Ga0501048_1246599 | 3300049582 | Bacteria | 535 |
| 1240 | Ga0501048_1273986 | 3300049582 | Bacteria | 528 |
| 1241 | Ga0501067_0084863 | 3300049583 | Bacteria | 1757 |
| 1242 | Ga0501067_0198979 | 3300049583 | Bacteria | 1116 |
| 1243 | Ga0501067_0694980 | 3300049583 | Bacteria | 572 |
| 1244 | Ga0501068_0432187 | 3300049584 | Bacteria | 851 |
| 1245 | Ga0501069_0093494 | 3300049585 | Bacteria | 1701 |
| 1246 | Ga0501070_0147792 | 3300049586 | Bacteria | 1939 |
| 1247 | Ga0501070_0334908 | 3300049586 | Bacteria | 1230 |
| 1248 | Ga0501071_0753297 | 3300049587 | Bacteria | 750 |
| 1249 | Ga0501071_1051523 | 3300049587 | Bacteria | 629 |
| 1250 | Ga0501072_0150759 | 3300049588 | Bacteria | 1854 |
| 1251 | Ga0501072_0379381 | 3300049588 | Bacteria | 1122 |
| 1252 | Ga0501073_0038796 | 3300049589 | Bacteria | 3377 |
| 1253 | Ga0501073_0072139 | 3300049589 | Bacteria | 2405 |
| 1254 | Ga0501073_0399628 | 3300049589 | Bacteria | 949 |
| 1255 | Ga0501073_0752377 | 3300049589 | Bacteria | 672 |
| 1256 | Ga0501073_0842418 | 3300049589 | Bacteria | 632 |
| 1257 | Ga0501074_0129706 | 3300049590 | Bacteria | 1804 |
| 1258 | Ga0501074_0326520 | 3300049590 | Bacteria | 1089 |
| 1259 | Ga0501074_0414922 | 3300049590 | Bacteria | 955 |
| 1260 | Ga0501075_0354297 | 3300049591 | Bacteria | 1118 |
| 1261 | Ga0501076_0324897 | 3300049592 | Bacteria | 1262 |
| 1262 | Ga0501076_0507557 | 3300049592 | Bacteria | 994 |
| 1263 | Ga0501077_0522038 | 3300049593 | Bacteria | 762 |
| 1264 | Ga0501079_0064820 | 3300049741 | Bacteria | 2818 |
| 1265 | Ga0501079_0128929 | 3300049741 | Bacteria | 1968 |
| 1266 | Ga0501079_0256692 | 3300049741 | Bacteria | 1366 |
| 1267 | Ga0501079_1316417 | 3300049741 | Bacteria | 569 |
| 1268 | Ga0501080_0253256 | 3300049742 | Bacteria | 1605 |
| 1269 | Ga0501080_0513373 | 3300049742 | Bacteria | 1070 |
| 1270 | Ga0501080_1092382 | 3300049742 | Bacteria | 689 |
| 1271 | Ga0501081_0445796 | 3300049743 | Bacteria | 961 |
| 1272 | Ga0501081_1251393 | 3300049743 | Bacteria | 562 |
| 1273 | Ga0501083_0350641 | 3300049744 | Bacteria | 959 |
| 1274 | Ga0501083_0423385 | 3300049744 | Bacteria | 866 |
| 1275 | Ga0501035_0019546 | 3300049822 | Bacteria | 6224 |
| 1276 | Ga0501035_0287033 | 3300049822 | Bacteria | 1389 |
| 1277 | Ga0501035_0898876 | 3300049822 | Bacteria | 701 |
| 1278 | Ga0501035_1067954 | 3300049822 | Bacteria | 632 |
| 1279 | Ga0501044_0054329 | 3300049823 | Bacteria | 4118 |
| 1280 | Ga0501044_0068818 | 3300049823 | Bacteria | 3605 |
| 1281 | Ga0501044_0123225 | 3300049823 | Bacteria | 2591 |
| 1282 | Ga0501044_0406082 | 3300049823 | Bacteria | 1274 |
| 1283 | Ga0501044_1221377 | 3300049823 | Bacteria | 619 |
| 1284 | Ga0501045_0063745 | 3300049824 | Bacteria | 2705 |
| 1285 | Ga0501045_0730590 | 3300049824 | Bacteria | 730 |
| 1286 | nmdc:mga03683_506215_c1 | 3300050489 | Bacteria | 585 |
| 1287 | nmdc:mga03683_50712_c1 | 3300050489 | Bacteria | 1730 |
| 1288 | nmdc:mga00v17_71250_c1 | 3300050491 | Bacteria | 2154 |
| 1289 | nmdc:mga00v17_799101_c1 | 3300050491 | Bacteria | 601 |
| 1290 | nmdc:mga00v17_874229_c1 | 3300050491 | Bacteria | 570 |
| 1291 | nmdc:mga00v17_919217_c1 | 3300050491 | Bacteria | 553 |
| 1292 | nmdc:mga0yw44_183525_c1 | 3300050492 | Bacteria | 1378 |
| 1293 | nmdc:mga0yw44_273936_c1 | 3300050492 | Bacteria | 1127 |
| 1294 | nmdc:mga0yw44_28850_c1 | 3300050492 | Bacteria | 3197 |
| 1295 | nmdc:mga0yw44_432640_c1 | 3300050492 | Bacteria | 891 |
| 1296 | nmdc:mga0yw44_550759_c1 | 3300050492 | Bacteria | 783 |
| 1297 | nmdc:mga0yw44_561619_c1 | 3300050492 | Bacteria | 775 |
| 1298 | nmdc:mga0yw44_710704_c1 | 3300050492 | Bacteria | 683 |
| 1299 | nmdc:mga0yw44_771345_c1 | 3300050492 | Bacteria | 653 |
| 1300 | nmdc:mga0yw44_98343_c1 | 3300050492 | Bacteria | 1860 |
| 1301 | nmdc:mga0k408_190297_c2 | 3300050493 | Bacteria | 678 |
| 1302 | nmdc:mga0k408_376202_c1 | 3300050493 | Bacteria | 846 |
| 1303 | nmdc:mga06z11_129696_c1 | 3300050494 | Bacteria | 1415 |
| 1304 | nmdc:mga06z11_896547_c1 | 3300050494 | Bacteria | 540 |
| 1305 | nmdc:mga04h51_294259_c1 | 3300050495 | Bacteria | 660 |
| 1306 | nmdc:mga07m45_206420_c1 | 3300050496 | Bacteria | 1143 |
| 1307 | nmdc:mga07m45_490729_c1 | 3300050496 | Bacteria | 711 |
| 1308 | nmdc:mga07m45_545750_c1 | 3300050496 | Bacteria | 670 |
| 1309 | nmdc:mga07m45_88502_c1 | 3300050496 | Bacteria | 1098 |
| 1310 | nmdc:mga05p37_1483277_c1 | 3300050507 | Bacteria | 677 |
| 1311 | nmdc:mga05p37_1695717_c1 | 3300050507 | Bacteria | 616 |
| 1312 | nmdc:mga05p37_209022_c1 | 3300050507 | Bacteria | 2360 |
| 1313 | nmdc:mga05p37_580366_c1 | 3300050507 | Bacteria | 1270 |
| 1314 | nmdc:mga09592_329002_c1 | 3300050508 | Bacteria | 1323 |
| 1315 | nmdc:mga0qj67_1030041_c1 | 3300050509 | Bacteria | 645 |
| 1316 | nmdc:mga0qj67_430678_c1 | 3300050509 | Bacteria | 1063 |
| 1317 | nmdc:mga0qj67_598672_c1 | 3300050509 | Bacteria | 882 |
| 1318 | nmdc:mga06r32_242332_c1 | 3300050510 | Bacteria | 1790 |
| 1319 | nmdc:mga06r32_724741_c1 | 3300050510 | Bacteria | 959 |
| 1320 | nmdc:mga08y16_111942_c1 | 3300050511 | Bacteria | 2842 |
| 1321 | nmdc:mga08y16_252440_c1 | 3300050511 | Bacteria | 1822 |
| 1322 | nmdc:mga08y16_729579_c1 | 3300050511 | Bacteria | 988 |
| 1323 | nmdc:mga0n895_246685_c1 | 3300050512 | Bacteria | 1812 |
| 1324 | nmdc:mga0rr50_1168712_c1 | 3300050513 | Bacteria | 654 |
| 1325 | nmdc:mga0rr50_1407421_c1 | 3300050513 | Bacteria | 590 |
| 1326 | nmdc:mga0rr50_315375_c1 | 3300050513 | Bacteria | 1310 |
| 1327 | nmdc:mga0rr50_606100_c1 | 3300050513 | Bacteria | 934 |
| 1328 | nmdc:mga08x19_281972_c1 | 3300050514 | Bacteria | 1151 |
| 1329 | nmdc:mga08x19_47478_c1 | 3300050514 | Bacteria | 2748 |
| 1330 | nmdc:mga0a205_1026640_c1 | 3300050515 | Bacteria | 672 |
| 1331 | nmdc:mga0a205_91000_c1 | 3300050515 | Bacteria | 2947 |
| 1332 | nmdc:mga0sz30_35679_c2 | 3300050516 | Bacteria | 1580 |
| 1333 | nmdc:mga0sz30_54283_c1 | 3300050516 | Bacteria | 1704 |
| 1334 | Ga0500635_0287500 | 3300053080 | Bacteria | 648 |
| 1335 | Ga0495595_0127311 | 3300053084 | Bacteria | 1243 |
| 1336 | Ga0495619_0569811 | 3300053085 | Bacteria | 776 |
| 1337 | Ga0495619_0638249 | 3300053085 | Bacteria | 727 |
| 1338 | Ga0495619_0877492 | 3300053085 | Bacteria | 604 |
| 1339 | Ga0500578_0293019 | 3300053086 | Bacteria | 967 |
| 1340 | Ga0500578_0492330 | 3300053086 | Bacteria | 691 |
| 1341 | Ga0500578_0779076 | 3300053086 | Bacteria | 507 |
| 1342 | Ga0500643_000168 | 3300053087 | Bacteria | 64858 |
| 1343 | Ga0500643_086271 | 3300053087 | Bacteria | 859 |
| 1344 | Ga0500643_088126 | 3300053087 | Bacteria | 848 |
| 1345 | Ga0500644_0211214 | 3300053088 | Bacteria | 806 |
| 1346 | Ga0500646_0081418 | 3300053090 | Bacteria | 988 |
| 1347 | Ga0500646_0155112 | 3300053090 | Bacteria | 761 |
| 1348 | Ga0500647_0035653 | 3300053091 | Bacteria | 2378 |
| 1349 | Ga0500583_0116523 | 3300053092 | Bacteria | 1319 |
| 1350 | Ga0500583_0292692 | 3300053092 | Bacteria | 798 |
| 1351 | Ga0500651_0013928 | 3300053093 | Bacteria | 4911 |
| 1352 | Ga0500651_0179768 | 3300053093 | Bacteria | 1257 |
| 1353 | Ga0500566_0003871 | 3300053094 | Bacteria | 8930 |
| 1354 | Ga0500566_0174286 | 3300053094 | Bacteria | 1109 |
| 1355 | Ga0500640_029966 | 3300053095 | Bacteria | 2381 |
| 1356 | Ga0500641_0003143 | 3300053096 | Bacteria | 5848 |
| 1357 | Ga0500641_0092726 | 3300053096 | Bacteria | 1290 |
| 1358 | Ga0500641_0137266 | 3300053096 | Bacteria | 1056 |
| 1359 | Ga0500641_0326009 | 3300053096 | Bacteria | 623 |
| 1360 | Ga0500650_0113406 | 3300053098 | Bacteria | 1265 |
| 1361 | Ga0500654_101895 | 3300053099 | Bacteria | 1221 |
| 1362 | Ga0500554_120981 | 3300053102 | Bacteria | 883 |
| 1363 | Ga0500555_003109 | 3300053103 | Bacteria | 4736 |
| 1364 | Ga0500555_004439 | 3300053103 | Bacteria | 3988 |
| 1365 | Ga0500555_044617 | 3300053103 | Bacteria | 1227 |
| 1366 | Ga0500555_049646 | 3300053103 | Bacteria | 1150 |
| 1367 | Ga0500555_139884 | 3300053103 | Bacteria | 597 |
| 1368 | Ga0500556_0014866 | 3300053104 | Bacteria | 2387 |
| 1369 | Ga0500557_000032 | 3300053105 | Bacteria | 74032 |
| 1370 | Ga0500569_001709 | 3300053109 | Bacteria | 4194 |
| 1371 | Ga0500572_000255 | 3300053111 | Bacteria | 19104 |
| 1372 | Ga0500582_298091 | 3300053114 | Bacteria | 500 |
| 1373 | Ga0500594_0124609 | 3300053118 | Bacteria | 811 |
| 1374 | Ga0500595_007298 | 3300053119 | Bacteria | 4589 |
| 1375 | Ga0500595_050725 | 3300053119 | Bacteria | 1287 |
| 1376 | Ga0500597_243867 | 3300053120 | Bacteria | 738 |
| 1377 | Ga0500607_066935 | 3300053121 | Bacteria | 1862 |
| 1378 | Ga0500614_204203 | 3300053123 | Bacteria | 610 |
| 1379 | Ga0500628_049601 | 3300053129 | Bacteria | 992 |
| 1380 | Ga0500642_0000191 | 3300053130 | Bacteria | 24993 |
| 1381 | Ga0500642_0000197 | 3300053130 | Bacteria | 24598 |
| 1382 | Ga0500642_0050847 | 3300053130 | Bacteria | 1829 |
| 1383 | Ga0500652_106472 | 3300053131 | Bacteria | 1172 |
| 1384 | Ga0500658_0060264 | 3300053134 | Bacteria | 1576 |
| 1385 | Ga0500658_0065575 | 3300053134 | Bacteria | 1521 |
| 1386 | Ga0500658_0077302 | 3300053134 | Bacteria | 1417 |
| 1387 | Ga0500658_0083924 | 3300053134 | Bacteria | 1367 |
| 1388 | Ga0500559_0000299 | 3300053136 | Bacteria | 38041 |
| 1389 | Ga0500559_0321324 | 3300053136 | Bacteria | 725 |
| 1390 | Ga0500564_197766 | 3300053138 | Bacteria | 827 |
| 1391 | Ga0500568_0006561 | 3300053139 | Bacteria | 5824 |
| 1392 | Ga0500568_0016564 | 3300053139 | Bacteria | 3272 |
| 1393 | Ga0500568_0046228 | 3300053139 | Bacteria | 1729 |
| 1394 | Ga0500568_0048140 | 3300053139 | Bacteria | 1686 |
| 1395 | Ga0500568_0054363 | 3300053139 | Bacteria | 1566 |
| 1396 | Ga0500573_0388452 | 3300053140 | Bacteria | 665 |
| 1397 | Ga0500577_0014421 | 3300053142 | Bacteria | 2443 |
| 1398 | Ga0500577_0021338 | 3300053142 | Bacteria | 2133 |
| 1399 | Ga0500577_0445820 | 3300053142 | Bacteria | 566 |
| 1400 | Ga0500588_0011981 | 3300053146 | Bacteria | 2138 |
| 1401 | Ga0500588_0035735 | 3300053146 | Bacteria | 1464 |
| 1402 | Ga0500588_0170826 | 3300053146 | Bacteria | 795 |
| 1403 | Ga0500590_156609 | 3300053148 | Bacteria | 1020 |
| 1404 | Ga0500603_107636 | 3300053150 | Bacteria | 834 |
| 1405 | Ga0500604_0002113 | 3300053151 | Bacteria | 5467 |
| 1406 | Ga0500604_0035106 | 3300053151 | Bacteria | 1491 |
| 1407 | Ga0500604_0035372 | 3300053151 | Bacteria | 1486 |
| 1408 | Ga0500604_0155353 | 3300053151 | Bacteria | 778 |
| 1409 | Ga0500616_0000038 | 3300053153 | Bacteria | 386801 |
| 1410 | Ga0500616_0000702 | 3300053153 | Bacteria | 38878 |
| 1411 | Ga0500616_0002930 | 3300053153 | Bacteria | 13590 |
| 1412 | Ga0500616_0005830 | 3300053153 | Bacteria | 8254 |
| 1413 | Ga0500619_021892 | 3300053154 | Bacteria | 1848 |
| 1414 | Ga0500622_0012455 | 3300053156 | Bacteria | 4604 |
| 1415 | Ga0500624_020053 | 3300053157 | Bacteria | 1068 |
| 1416 | Ga0500624_057038 | 3300053157 | Bacteria | 739 |
| 1417 | Ga0500627_0132726 | 3300053158 | Bacteria | 1125 |
| 1418 | Ga0500627_0136444 | 3300053158 | Bacteria | 1108 |
| 1419 | Ga0500634_0000041 | 3300053161 | Bacteria | 59177 |
| 1420 | Ga0500634_0260871 | 3300053161 | Bacteria | 713 |
| 1421 | Ga0500638_029142 | 3300053162 | Bacteria | 2654 |
| 1422 | Ga0500639_033573 | 3300053163 | Bacteria | 2712 |
| 1423 | Ga0500636_0000659 | 3300053177 | Bacteria | 18582 |
| 1424 | Ga0500636_0058573 | 3300053177 | Bacteria | 2251 |
| 1425 | Ga0500636_0188920 | 3300053177 | Bacteria | 1099 |
| 1426 | Ga0500636_0392719 | 3300053177 | Bacteria | 646 |
| 1427 | Ga0500636_0402115 | 3300053177 | Bacteria | 635 |
| 1428 | Ga0500637_0555206 | 3300053178 | Bacteria | 555 |
| 1429 | Ga0500649_062485 | 3300053722 | Bacteria | 1551 |
| 1430 | Ga0500567_218915 | 3300053723 | Bacteria | 608 |
| 1431 | Ga0500576_033923 | 3300053725 | Bacteria | 2313 |
| 1432 | Ga0500625_144533 | 3300053729 | Bacteria | 908 |
| 1433 | Ga0500645_059279 | 3300053730 | Bacteria | 1108 |
| 1434 | Ga0500609_000077 | 3300053731 | Bacteria | 12575 |
| 1435 | Ga0500609_000771 | 3300053731 | Bacteria | 4796 |
| 1436 | Ga0500609_001181 | 3300053731 | Bacteria | 3881 |
| 1437 | Ga0500656_039060 | 3300053732 | Bacteria | 659 |
| 1438 | Ga0500552_010701 | 3300053733 | Bacteria | 1137 |
| 1439 | Ga0500596_036323 | 3300053735 | Bacteria | 776 |
| 1440 | Ga0500601_000475 | 3300053737 | Bacteria | 6405 |
| 1441 | Ga0500601_037002 | 3300053737 | Bacteria | 589 |
| 1442 | Ga0501084_0566671 | 3300054114 | Bacteria | 960 |
| 1443 | Ga0501084_0581516 | 3300054114 | Bacteria | 946 |
| 1444 | Ga0501082_0103543 | 3300060353 | Bacteria | 2462 |
| 1445 | Ga0501082_0585173 | 3300060353 | Bacteria | 976 |
| 1446 | Ga0530510_0034341 | 3300061734 | Bacteria | 3653 |
| 1447 | 2507505971 | 2507262055 | Bacteria | 8048963 |
| 1448 | 2508540160 | 2508501009 | Bacteria | 7784016 |
| 1449 | 2508696234 | 2508501042 | Bacteria | 8719808 |
| 1450 | 2509148161 | 2508501128 | Bacteria | 8613869 |
| 1451 | 2511394577 | 2511231028 | Bacteria | 8046582 |
| 1452 | 2512034028 | 2511231221 | Bacteria | 6846400 |
| 1453 | 2513624879 | 2513237092 | Bacteria | 8341956 |
| 1454 | 2513649125 | 2513237095 | Bacteria | 8976980 |
| 1455 | 2513674984 | 2513237098 | Bacteria | 9902361 |
| 1456 | 2513700191 | 2513237102 | Bacteria | 7703324 |
| 1457 | 2513716140 | 2513237104 | Bacteria | 10034502 |
| 1458 | 2513877199 | 2513237139 | Bacteria | 8737671 |
| 1459 | 2513891561 | 2513237141 | Bacteria | 8496279 |
| 1460 | 2513997531 | 2513237159 | Bacteria | 6810126 |
| 1461 | 2514014568 | 2513237161 | Bacteria | 8871253 |
| 1462 | 2515628486 | 2515154112 | Bacteria | 8294334 |
| 1463 | 2516206031 | 2516143018 | Bacteria | 6951533 |
| 1464 | 2517103157 | 2517093001 | Bacteria | 9002274 |
| 1465 | 2524440790 | 2524023205 | Bacteria | 8918781 |
| 1466 | 2528850737 | 2528768022 | Bacteria | 10457665 |
| 1467 | 2535484045 | 2534681786 | Bacteria | 3308809 |
| 1468 | 2561469046 | 2558860983 | Bacteria | 4133860 |
| 1469 | 2585167596 | 2582581283 | Bacteria | 6030556 |
| 1470 | 2585265826 | 2582581306 | Bacteria | 6450535 |
| 1471 | 2585390016 | 2582581865 | Bacteria | 6644329 |
| 1472 | 2585395219 | 2582581866 | Bacteria | 6859583 |
| 1473 | 2599722270 | 2599185236 | Bacteria | 6875203 |
| 1474 | 2600196029 | 2599185352 | Bacteria | 7228948 |
| 1475 | 2617347854 | 2617270735 | Bacteria | 9163226 |
| 1476 | 2617374776 | 2617270741 | Bacteria | 8201522 |
| 1477 | 2643804429 | 2643221557 | Bacteria | 7184309 |
| 1478 | 2644052088 | 2643221607 | Bacteria | 6314006 |
| 1479 | 2644065199 | 2643221610 | Bacteria | 7480339 |
| 1480 | 2644204881 | 2643221636 | Bacteria | 6583769 |
| 1481 | 2644334068 | 2643221659 | Bacteria | 7890716 |
| 1482 | 2644377609 | 2643221668 | Bacteria | 7306521 |
| 1483 | 2644416871 | 2643221675 | Bacteria | 7473456 |
| 1484 | 2644449911 | 2643221680 | Bacteria | 7473610 |
| 1485 | 2644484831 | 2643221686 | Bacteria | 6310811 |
| 1486 | 2644500611 | 2643221689 | Bacteria | 6042950 |
| 1487 | 2644541665 | 2643221698 | Bacteria | 7756764 |
| 1488 | 2644672734 | 2643221723 | Bacteria | 7095460 |
| 1489 | 2644690046 | 2643221726 | Bacteria | 7455827 |
| 1490 | 2715499331 | 2713897090 | Bacteria | 3353799 |
| 1491 | 2738944232 | 2738541317 | Bacteria | 5340176 |
| 1492 | 2745076031 | 2744054633 | Bacteria | 8678936 |
| 1493 | 2753357282 | 2751185800 | Bacteria | 5467370 |
| 1494 | 2765464287 | 2765235802 | Bacteria | 5618596 |
| 1495 | 2776272581 | 2775506902 | Bacteria | 6208009 |
| 1496 | 2776284522 | 2775506904 | Bacteria | 5954060 |
| 1497 | 2776914339 | 2775507049 | Bacteria | 6284736 |
| 1498 | 2792747035 | 2791355123 | Bacteria | 8049106 |
| 1499 | 2793061495 | 2791355196 | Bacteria | 7323613 |
| 1500 | 2805916201 | 2802429603 | Bacteria | 8777136 |
| 1501 | 2818240516 | 2816332527 | Bacteria | 8933356 |
| 1502 | 2824603674 | 2824600985 | Bacteria | 8488197 |
| 1503 | 2824610740 | 2824609381 | Bacteria | 8672835 |
| 1504 | 2824625154 | 2824617872 | Bacteria | 8814715 |
| 1505 | 2824630964 | 2824626560 | Bacteria | 8813858 |
| 1506 | 2824642283 | 2824635225 | Bacteria | 8785348 |
| 1507 | 2824648301 | 2824644064 | Bacteria | 8743947 |
| 1508 | 2824657942 | 2824653114 | Bacteria | 8493680 |
| 1509 | 2824666878 | 2824661429 | Bacteria | 9877870 |
| 1510 | 2824674055 | 2824671348 | Bacteria | 8369588 |
| 1511 | 2824685801 | 2824679649 | Bacteria | 8248951 |
| 1512 | 2824690721 | 2824687955 | Bacteria | 8360029 |
| 1513 | 2824699942 | 2824696289 | Bacteria | 8335049 |
| 1514 | 2824709137 | 2824704595 | Bacteria | 9667483 |
| 1515 | 2824719481 | 2824714736 | Bacteria | 8717648 |
| 1516 | 2824729095 | 2824723954 | Bacteria | 8758240 |
| 1517 | 2824738525 | 2824732956 | Bacteria | 7810675 |
| 1518 | 2824753123 | 2824746037 | Bacteria | 7911610 |
| 1519 | 2824760313 | 2824753945 | Bacteria | 9787441 |
| 1520 | 2824772343 | 2824763712 | Bacteria | 9792355 |
| 1521 | 2824776372 | 2824773399 | Bacteria | 8360218 |
| 1522 | 2837680680 | 2837678835 | Bacteria | 5252418 |
| 1523 | 2838125038 | 2838122688 | Bacteria | 8803140 |
| 1524 | 2839994211 | 2839993093 | Bacteria | 5512535 |
| 1525 | 2840769398 | 2840764183 | Bacteria | 6358399 |
| 1526 | 2841945777 | 2841941048 | Bacteria | 8688029 |
| 1527 | 2841956876 | 2841949485 | Bacteria | 8680857 |
| 1528 | 2841963998 | 2841957949 | Bacteria | 8652217 |
| 1529 | 2841973564 | 2841966195 | Bacteria | 8673214 |
| 1530 | 2841981958 | 2841974524 | Bacteria | 8931498 |
| 1531 | 2841989452 | 2841983080 | Bacteria | 8395090 |
| 1532 | 2842044437 | 2842038055 | Bacteria | 8002051 |
| 1533 | 2842051574 | 2842045827 | Bacteria | 8006841 |
| 1534 | 2842338241 | 2842333319 | Bacteria | 8899485 |
| 1535 | 2842522227 | 2842521101 | Bacteria | 6569494 |
| 1536 | 2842779699 | 2842775625 | Bacteria | 5587290 |
| 1537 | 2842924495 | 2842922631 | Bacteria | 5824079 |
| 1538 | 2844316310 | 2844315083 | Bacteria | 8138177 |
| 1539 | 2847939389 | 2847930680 | Bacteria | 9342022 |
| 1540 | 2847941146 | 2847939898 | Bacteria | 8606328 |
| 1541 | 2849082134 | 2849076700 | Bacteria | 7039503 |
| 1542 | 2854685508 | 2854681122 | Bacteria | 4548679 |
| 1543 | 2854914136 | 2854911287 | Bacteria | 5582813 |
| 1544 | 2855022280 | 2855020534 | Bacteria | 3204685 |
| 1545 | 2857513388 | 2857509624 | Bacteria | 7472071 |
| 1546 | 2857530216 | 2857524615 | Bacteria | 6615449 |
| 1547 | 2874596293 | 2874590934 | Bacteria | 8299676 |
| 1548 | 2874616506 | 2874612657 | Bacteria | 8252029 |
| 1549 | 2874622524 | 2874620515 | Bacteria | 8290088 |
| 1550 | 2874633432 | 2874628541 | Bacteria | 8630250 |
| 1551 | 2874650280 | 2874645413 | Bacteria | 8214782 |
| 1552 | 2876763689 | 2876761206 | Bacteria | 10111113 |
| 1553 | 2876776758 | 2876771140 | Bacteria | 8287509 |
| 1554 | 2876824548 | 2876818435 | Bacteria | 8274608 |
| 1555 | 2879080895 | 2879074833 | Bacteria | 8279565 |
| 1556 | 2879087062 | 2879083081 | Bacteria | 8587928 |
| 1557 | 2879133740 | 2879127579 | Bacteria | 8294491 |
| 1558 | 2879148242 | 2879142872 | Bacteria | 8267021 |
| 1559 | 2881369551 | 2881364244 | Bacteria | 7710352 |
| 1560 | 2881669732 | 2881665667 | Bacteria | 8175609 |
| 1561 | 2885367802 | 2885366525 | Bacteria | 8326213 |
| 1562 | 2885380850 | 2885374607 | Bacteria | 8927485 |
| 1563 | 2885412951 | 2885409591 | Bacteria | 9235467 |
| 1564 | 2888387193 | 2888378607 | Bacteria | 9652610 |
| 1565 | 2888389885 | 2888388044 | Bacteria | 7304136 |
| 1566 | 2888421225 | 2888419890 | Bacteria | 7857137 |
| 1567 | 2891051061 | 2891048133 | Bacteria | 4447501 |
| 1568 | 2894655418 | 2894652903 | Bacteria | 4587256 |
| 1569 | 2903728355 | 2903727486 | Bacteria | 8281579 |
| 1570 | 2903774766 | 2903768456 | Bacteria | 9749579 |
| 1571 | 2904579121 | 2904578770 | Bacteria | 5302906 |
| 1572 | 2904671469 | 2904666416 | Bacteria | 8226587 |
| 1573 | 2904695100 | 2904690495 | Bacteria | 9412302 |
| 1574 | 2904719765 | 2904711408 | Bacteria | 9771557 |
| 1575 | 2906606495 | 2906602504 | Bacteria | 8295279 |
| 1576 | 2906631387 | 2906626472 | Bacteria | 8826946 |
| 1577 | 2906646734 | 2906643746 | Bacteria | 8722424 |
| 1578 | 2908756886 | 2908756301 | Bacteria | 8864324 |
| 1579 | 2908777257 | 2908775508 | Bacteria | 8092255 |
| 1580 | 2913308852 | 2913308742 | Bacteria | 5350706 |
| 1581 | 2919122054 | 2919119836 | Bacteria | 5208557 |
| 1582 | 2920825669 | 2920822456 | Bacteria | 6897201 |
| 1583 | 2922377369 | |||
| 1584 | 2922389419 | 2922386360 | Bacteria | 7017218 |
| 1585 | 2922398461 | 2922393267 | Bacteria | 8285685 |
| 1586 | 2929141181 | 2929138655 | Bacteria | 5810547 |
| 1587 | 2929204358 | 2929199973 | Bacteria | 7260745 |
| 1588 | 2929622162 | 2929615660 | Bacteria | 9193770 |
| 1589 | 2929630191 | 2929624759 | Bacteria | 9339455 |
| 1590 | 2932787881 | 2932784394 | Bacteria | 9704911 |
| 1591 | 2932795999 | 2932794094 | Bacteria | 7915132 |
| 1592 | 2932807576 | 2932801729 | Bacteria | 7987968 |
| 1593 | 2932835091 | 2932828146 | Bacteria | 9745859 |
| 1594 | 2933584223 | 2933577622 | Bacteria | 9116884 |
| 1595 | 2935614396 | 2935608549 | Bacteria | 8203142 |
| 1596 | 2935620468 | 2935616580 | Bacteria | 9032984 |
| 1597 | 2935640791 | 2935638405 | Bacteria | 10015038 |
| 1598 | 2935649425 | 2935648319 | Bacteria | 8801166 |
| 1599 | 2935657803 | 2935656913 | Bacteria | 8965014 |
| 1600 | 2935670294 | 2935665750 | Bacteria | 9571747 |
| 1601 | 2935679724 | 2935675223 | Bacteria | 9928132 |
| 1602 | 2935687293 | 2935684952 | Bacteria | 9590419 |
| 1603 | 2935696736 | 2935694250 | Bacteria | 9291695 |
| 1604 | 2935709172 | 2935703347 | Bacteria | 10242284 |
| 1605 | 2935718752 | 2935713505 | Bacteria | 9608509 |
| 1606 | 2935728404 | 2935722832 | Bacteria | 9608746 |
| 1607 | 2935736999 | 2935732158 | Bacteria | 9706831 |
| 1608 | 2935745998 | 2935741537 | Bacteria | 9707219 |
| 1609 | 2935753259 | 2935750917 | Bacteria | 9590372 |
| 1610 | 2935770261 | 2935769743 | Bacteria | 7878163 |
| 1611 | 2935777711 | 2935777560 | Bacteria | 8077691 |
| 1612 | 2935786686 | 2935785616 | Bacteria | 7962367 |
| 1613 | 2935794740 | 2935793552 | Bacteria | 8012592 |
| 1614 | 2935809030 | 2935801545 | Bacteria | 9301974 |
| 1615 | 2935813790 | 2935810662 | Bacteria | 9401221 |
| 1616 | 2935826614 | 2935819856 | Bacteria | 8261050 |
| 1617 | 2935832298 | 2935827899 | Bacteria | 10038562 |
| 1618 | 2935844003 | 2935837841 | Bacteria | 9454360 |
| 1619 | 2935851092 | 2935847175 | Bacteria | 8228321 |
| 1620 | 2935862794 | 2935855204 | Bacteria | 9035059 |
| 1621 | 2935864537 | 2935864058 | Bacteria | 9784707 |
| 1622 | 2935875111 | 2935873716 | Bacteria | 9632195 |
| 1623 | 2935887268 | 2935883170 | Bacteria | 7964738 |
| 1624 | 2935913142 | 2935908558 | Bacteria | 8568796 |
| 1625 | 2935922564 | 2935916978 | Bacteria | 9113783 |
| 1626 | 2935930933 | 2935926038 | Bacteria | 8601059 |
| 1627 | 2935939733 | 2935934488 | Bacteria | 8602579 |
| 1628 | 2935946682 | 2935942939 | Bacteria | 8599779 |
| 1629 | 2935956117 | 2935951376 | Bacteria | 8602333 |
| 1630 | 2935965022 | 2935959822 | Bacteria | 7869783 |
| 1631 | 2935972910 | 2935967501 | Bacteria | 8603075 |
| 1632 | 2935978175 | 2935975950 | Bacteria | 8347125 |
| 1633 | 2935985701 | 2935984226 | Bacteria | 8302647 |
| 1634 | 2935999271 | 2935992306 | Bacteria | 9802711 |
| 1635 | 2936005826 | 2936002035 | Bacteria | 9362176 |
| 1636 | 2936012022 | 2936011229 | Bacteria | 8801034 |
| 1637 | 2936020897 | 2936019824 | Bacteria | 8804134 |
| 1638 | 2936029315 | 2936028420 | Bacteria | 8965941 |
| 1639 | 2936039346 | 2936037263 | Bacteria | 9446081 |
| 1640 | 2936048361 | 2936046547 | Bacteria | 8903709 |
| 1641 | 2936056528 | 2936055302 | Bacteria | 8785755 |
| 1642 | 2940559172 | 2940556831 | Bacteria | 9590747 |
| 1643 | 2941534540 | 2941531003 | Bacteria | 7653939 |
| 1644 | 2941541866 | 2941538514 | Bacteria | 9402094 |
| 1645 | 2970492430 | 2970489779 | Bacteria | 6517260 |
| 1646 | 3000018829 | 3000017691 | Bacteria | 3772574 |
| 1647 | 3002142610 | 3002141150 | Bacteria | 5254435 |
| 1648 | 3005491119 | 3005483717 | Bacteria | 7877331 |
| 1649 | 3005510960 | 3005506211 | Bacteria | 6943378 |
| 1650 | 3005592126 | 3005587118 | Bacteria | 7794411 |
| 1651 | 3005595923 | 3005594810 | Bacteria | 8716512 |
| 1652 | 3005711859 | 3005710791 | Bacteria | 7622528 |
| 1653 | 3005719116 | 3005718088 | Bacteria | 8283608 |
| 1654 | 8006929759 | 8006926726 | Bacteria | 6749210 |
| 1655 | 8016517212 | 8016511872 | Bacteria | 9921665 |
| 1656 | 8016527031 | 8016522445 | Bacteria | 8156687 |
| 1657 | 8016532110 | 8016530956 | Bacteria | 8155261 |
| 1658 | 8016545322 | 8016539877 | Bacteria | 8155419 |
| 1659 | 8016556767 | 8016548790 | Bacteria | 8155074 |
| 1660 | 8016565122 | 8016557553 | Bacteria | 8154380 |
| 1661 | 8016570405 | 8016566248 | Bacteria | 8158151 |
| 1662 | 8016582942 | 8016575299 | Bacteria | 8154085 |
| 1663 | 8016585360 | 8016583857 | Bacteria | 10421953 |
| 1664 | 8016602769 | 8016595262 | Bacteria | 8149947 |
| 1665 | 8016605629 | 8016603502 | Bacteria | 8731218 |
| 1666 | 8016617544 | 8016613128 | Bacteria | 8794220 |
| 1667 | 8016624027 | 8016622563 | Bacteria | 7999408 |
| 1668 | 8016634837 | 8016630954 | Bacteria | 9217207 |
| 1669 | 8017059378 | 8017057580 | Bacteria | 10023680 |
| 1670 | 8019531931 | 8019530166 | Bacteria | 8155624 |
| 1671 | 8019539606 | 8019538911 | Bacteria | 7872763 |
| 1672 | 8019551051 | 8019547302 | Bacteria | 7996444 |
| 1673 | 8019560236 | 8019555841 | Bacteria | 9642137 |
| 1674 | 8019570336 | 8019565922 | Bacteria | 9639779 |
| 1675 | 8019576241 | 8019576017 | Bacteria | 10049540 |
| 1676 | 8019594118 | 8019586578 | Bacteria | 10212056 |
| 1677 | 8019607445 | 8019597564 | Bacteria | 10041141 |
| 1678 | 8019611065 | 8019608314 | Bacteria | 10042931 |
| 1679 | 8019621914 | 8019619141 | Bacteria | 9218857 |
| 1680 | 8019639204 | 8019638758 | Bacteria | 9062356 |
| 1681 | 8019651355 | 8019648815 | Bacteria | 10014479 |
| 1682 | 8019668217 | 8019659431 | Bacteria | 8577854 |
| 1683 | 8019677676 | 8019668869 | Bacteria | 8791617 |
| 1684 | 8019687269 | 8019678201 | Bacteria | 8863603 |
| 1685 | 8019693248 | 8019687851 | Bacteria | 8712826 |
| 1686 | 8055432250 | 8055431914 | Bacteria | 4551896 |
| 1687 | 8055743588 | 8055742211 | Bacteria | 9226248 |
| 1688 | 8055910676 | 8055909800 | Bacteria | 7278581 |
| 1689 | 8056678125 | 8056673599 | Bacteria | 7871253 |
| 1690 | 8056681662 | 8056681323 | Bacteria | 8472857 |
| 1691 | 8056974104 | 8056967851 | Bacteria | 9038162 |
| 1692 | Ga0495600_0000832 | |||
| 1693 | RicEn_FSXC74732_b1 | |||
| 1694 | JGI25155J39150_1000066 | |||
| 1695 | JGI25156J39149_1000075 | |||
| 1696 | JGI25154J39366_1000075 | |||
| 1697 | JGI25157J39369_1000051 | |||
| 1698 | JGI25157J39369_1000077 | |||
| 1699 | JGI25159J45721_1000008 | |||
| 1700 | JGI25151J46595_10012676 | |||
| 1701 | JGI25406J46586_10000225 | |||
| 1702 | JGI25406J46586_10063975 | |||
| 1703 | JGI25165J46597_1028180 | |||
| 1704 | JGI25153J46596_10000082 | |||
| 1705 | JGI25153J46596_10000595 | |||
| 1706 | JGI25153J46596_10000982 | |||
| 1707 | JGI25153J46596_10022500 | |||
| 1708 | JGI25153J46596_10039071 | |||
| 1709 | JGI25153J46596_10046251 | |||
| 1710 | JGI25160J50197_1000033 | |||
| 1711 | JGI25160J50197_1002442 | |||
| 1712 | JGI25160J50197_1009191 | |||
| 1713 | JGI25161J50226_1001354 | |||
| 1714 | Ga0006562J51391_1011312 | |||
| 1715 | Ga0006562J51391_1011313 | |||
| 1716 | JGI25404J52841_10026631 | |||
| 1717 | JGI25404J52841_10107003 | |||
| 1718 | Ga0055542_1042663 | |||
| 1719 | Ga0055526_1005670 | |||
| 1720 | Ga0055524_1002859 | |||
| 1721 | Ga0055536_1039786 | |||
| 1722 | Ga0055531_10011991 | |||
| 1723 | Ga0055531_10017995 | |||
| 1724 | Ga0055531_10028449 | |||
| 1725 | Ga0055543_1000026 | |||
| 1726 | Ga0055543_1001915 | |||
| 1727 | Ga0065165_1000178 | |||
| 1728 | Ga0065165_1001462 | |||
| 1729 | Ga0065165_1006394 | |||
| 1730 | Ga0065165_1008164 | |||
| 1731 | Ga0070658_10125525 | |||
| 1732 | Ga0070658_10269850 | |||
| 1733 | Ga0070683_100400476 | |||
| 1734 | Ga0070670_100027526 | |||
| 1735 | Ga0070670_100648980 | |||
| 1736 | Ga0068869_100462861 | |||
| 1737 | Ga0070666_10000938 | |||
| 1738 | Ga0070666_10002179 | |||
| 1739 | Ga0070666_10461914 | |||
| 1740 | Ga0070666_10792504 | |||
| 1741 | Ga0070682_100793374 | |||
| 1742 | Ga0068868_100120833 | |||
| 1743 | Ga0068868_100207269 | |||
| 1744 | Ga0068868_100435331 | |||
| 1745 | Ga0068868_100624510 | |||
| 1746 | Ga0068868_100754263 | |||
| 1747 | Ga0070660_100498844 | |||
| 1748 | Ga0070660_101002077 | |||
| 1749 | Ga0070660_101071775 | |||
| 1750 | Ga0070660_101625457 | |||
| 1751 | Ga0070687_100898497 | |||
| 1752 | Ga0070661_100091190 | |||
| 1753 | Ga0070661_100103251 | |||
| 1754 | Ga0070661_100475049 | |||
| 1755 | Ga0070668_100076460 | |||
| 1756 | Ga0070668_100668251 | |||
| 1757 | Ga0070669_100546943 | |||
| 1758 | Ga0070675_100691069 | |||
| 1759 | Ga0070671_100066518 | |||
| 1760 | Ga0070671_100118451 | |||
| 1761 | Ga0070671_100419795 | |||
| 1762 | Ga0070671_100629849 | |||
| 1763 | Ga0070674_100279621 | |||
| 1764 | Ga0070673_100061322 | |||
| 1765 | Ga0070659_101505210 | |||
| 1766 | Ga0070667_100103589 | |||
| 1767 | Ga0070667_101453161 | |||
| 1768 | Ga0070709_10001415 | |||
| 1769 | Ga0070709_10384768 | |||
| 1770 | Ga0070714_100013698 | |||
| 1771 | Ga0070714_100043813 | |||
| 1772 | Ga0070714_100516305 | |||
| 1773 | Ga0070714_100812592 | |||
| 1774 | Ga0070713_100029447 | |||
| 1775 | Ga0070713_100035173 | |||
| 1776 | Ga0070713_101332407 | |||
| 1777 | Ga0070710_10001980 | |||
| 1778 | Ga0070710_10793071 | |||
| 1779 | Ga0070711_100048152 | |||
| 1780 | Ga0070705_100281784 | |||
| 1781 | Ga0070705_101244621 | |||
| 1782 | Ga0070694_100026298 | |||
| 1783 | Ga0070663_100076650 | |||
| 1784 | Ga0070663_100134033 | |||
| 1785 | Ga0070663_100231387 | |||
| 1786 | Ga0070663_100280610 | |||
| 1787 | Ga0070663_100564845 | |||
| 1788 | Ga0070663_101246216 | |||
| 1789 | Ga0070663_101523805 | |||
| 1790 | Ga0070678_101125746 | |||
| 1791 | Ga0070678_101141721 | |||
| 1792 | Ga0070662_100204055 | |||
| 1793 | Ga0070662_100375822 | |||
| 1794 | Ga0070662_100608571 | |||
| 1795 | Ga0068867_101064157 | |||
| 1796 | Ga0068867_101705279 | |||
| 1797 | Ga0068867_102045715 | |||
| 1798 | Ga0070685_10001247 | |||
| 1799 | Ga0070685_10629391 | |||
| 1800 | Ga0070706_100087842 | |||
| 1801 | Ga0070706_101442302 | |||
| 1802 | Ga0070698_100830490 | |||
| 1803 | Ga0070679_100416155 | |||
| 1804 | Ga0070679_100839175 | |||
| 1805 | Ga0070684_100523659 | |||
| 1806 | Ga0070684_100585244 | |||
| 1807 | Ga0070697_101073120 | |||
| 1808 | Ga0068853_100000598 | |||
| 1809 | Ga0068853_100093391 | |||
| 1810 | Ga0068853_100838175 | |||
| 1811 | Ga0068853_101173642 | |||
| 1812 | Ga0068853_101518320 | |||
| 1813 | Ga0068853_101738571 | |||
| 1814 | Ga0070672_100777139 | |||
| 1815 | Ga0070686_100138269 | |||
| 1816 | Ga0070686_100255065 | |||
| 1817 | Ga0070695_100061578 | |||
| 1818 | Ga0070695_100968165 | |||
| 1819 | Ga0070696_100475766 | |||
| 1820 | Ga0070665_100000144 | |||
| 1821 | Ga0070665_100002074 | |||
| 1822 | Ga0070665_100011926 | |||
| 1823 | Ga0070665_100013246 | |||
| 1824 | Ga0070665_100032040 | |||
| 1825 | Ga0070665_100112798 | |||
| 1826 | Ga0070665_100336078 | |||
| 1827 | Ga0070665_100775174 | |||
| 1828 | Ga0070704_100128764 | |||
| 1829 | Ga0068855_100115416 | |||
| 1830 | Ga0068855_100282797 | |||
| 1831 | Ga0068855_100302799 | |||
| 1832 | Ga0068855_100693099 | |||
| 1833 | Ga0070664_100457086 | |||
| 1834 | Ga0068857_100136620 | |||
| 1835 | Ga0068857_100159120 | |||
| 1836 | Ga0068857_100607937 | |||
| 1837 | Ga0068854_100009801 | |||
| 1838 | Ga0068854_100012342 | |||
| 1839 | Ga0068854_100056101 | |||
| 1840 | Ga0068856_100096137 | |||
| 1841 | Ga0068856_100211790 | |||
| 1842 | Ga0068856_100414149 | |||
| 1843 | Ga0068856_102107612 | |||
| 1844 | Ga0068852_100001361 | |||
| 1845 | Ga0068852_100116660 | |||
| 1846 | Ga0068852_100254911 | |||
| 1847 | Ga0068852_100737597 | |||
| 1848 | Ga0068852_101485771 | |||
| 1849 | Ga0068852_101731291 | |||
| 1850 | Ga0068859_100068675 | |||
| 1851 | Ga0068859_100564979 | |||
| 1852 | Ga0068864_100007889 | |||
| 1853 | Ga0068864_100364109 | |||
| 1854 | Ga0068864_100448473 | |||
| 1855 | Ga0068851_10088483 | |||
| 1856 | Ga0068851_10112180 | |||
| 1857 | Ga0068863_100000037 | |||
| 1858 | Ga0068863_100037516 | |||
| 1859 | Ga0068863_100046659 | |||
| 1860 | Ga0068863_100223536 | |||
| 1861 | Ga0068863_101056514 | |||
| 1862 | Ga0068863_101619949 | |||
| 1863 | Ga0068858_100000029 | |||
| 1864 | Ga0068858_100000416 | |||
| 1865 | Ga0068858_100471729 | |||
| 1866 | Ga0068858_100895420 | |||
| 1867 | Ga0068858_102580495 | |||
| 1868 | Ga0068860_100000610 | |||
| 1869 | Ga0068860_100114286 | |||
| 1870 | Ga0068860_101776018 | |||
| 1871 | Ga0068860_102665158 | |||
| 1872 | Ga0068862_100005038 | |||
| 1873 | Ga0068862_100514950 | |||
| 1874 | Ga0068862_100650609 | |||
| 1875 | Ga0081455_10016776 | |||
| 1876 | Ga0081455_10026682 | |||
| 1877 | Ga0081455_10031500 | |||
| 1878 | Ga0081455_10323019 | |||
| 1879 | Ga0081538_10074861 | |||
| 1880 | Ga0081540_1000162 | |||
| 1881 | Ga0081540_1000379 | |||
| 1882 | Ga0081540_1004532 | |||
| 1883 | Ga0081540_1014174 | |||
| 1884 | Ga0081540_1033731 | |||
| 1885 | Ga0081540_1066967 | |||
| 1886 | Ga0081540_1091642 | |||
| 1887 | Ga0081540_1106176 | |||
| 1888 | Ga0081539_10000801 | |||
| 1889 | Ga0081539_10010210 | |||
| 1890 | Ga0070717_10044908 | |||
| 1891 | Ga0070717_10215363 | |||
| 1892 | Ga0070717_10538852 | |||
| 1893 | Ga0075365_10094039 | |||
| 1894 | Ga0075365_10122863 | |||
| 1895 | Ga0075365_10159918 | |||
| 1896 | Ga0075365_10191892 | |||
| 1897 | Ga0075365_10248735 | |||
| 1898 | Ga0075365_10361365 | |||
| 1899 | Ga0075368_10029782 | |||
| 1900 | Ga0075368_10340335 | |||
| 1901 | Ga0075363_100252495 | |||
| 1902 | Ga0075363_100359214 | |||
| 1903 | Ga0075363_100408291 | |||
| 1904 | Ga0075363_101013450 | |||
| 1905 | Ga0075364_10114922 | |||
| 1906 | Ga0075364_10307839 | |||
| 1907 | Ga0075364_10994487 | |||
| 1908 | Ga0075432_10011455 | |||
| 1909 | Ga0070715_10100755 | |||
| 1910 | Ga0070716_100739097 | |||
| 1911 | Ga0070712_100011824 | |||
| 1912 | Ga0070712_100213292 | |||
| 1913 | Ga0075362_10054161 | |||
| 1914 | Ga0075362_10224348 | |||
| 1915 | Ga0075362_10308810 | |||
| 1916 | Ga0075367_10715338 | |||
| 1917 | Ga0075369_10011029 | |||
| 1918 | Ga0075369_10028654 | |||
| 1919 | Ga0075369_10030461 | |||
| 1920 | Ga0075369_10348003 | |||
| 1921 | Ga0075369_10433177 | |||
| 1922 | Ga0075369_10453428 | |||
| 1923 | Ga0075366_10419043 | |||
| 1924 | Ga0075366_10441905 | |||
| 1925 | Ga0097621_100211422 | |||
| 1926 | Ga0097621_100542758 | |||
| 1927 | Ga0097621_100648202 | |||
| 1928 | Ga0075370_10097196 | |||
| 1929 | Ga0075370_10223380 | |||
| 1930 | Ga0075370_10223785 | |||
| 1931 | Ga0075370_10424475 | |||
| 1932 | Ga0075370_10468635 | |||
| 1933 | Ga0075370_10991942 | |||
| 1934 | Ga0075370_10995286 | |||
| 1935 | Ga0068871_100617986 | |||
| 1936 | Ga0075428_100557058 | |||
| 1937 | Ga0075428_100778824 | |||
| 1938 | Ga0075428_102305845 | |||
| 1939 | Ga0075430_100601900 | |||
| 1940 | Ga0075430_100777212 | |||
| 1941 | Ga0075430_100810030 | |||
| 1942 | Ga0075431_100169253 | |||
| 1943 | Ga0075431_100815083 | |||
| 1944 | Ga0075429_100228293 | |||
| 1945 | Ga0075429_101208563 | |||
| 1946 | Ga0075436_100176200 | |||
| 1947 | Ga0075436_100314759 | |||
| 1948 | Ga0097620_100068675 | |||
| 1949 | Ga0097620_100564988 | |||
| 1950 | Ga0099824_1020962 | |||
| 1951 | Ga0099823_1023273 | |||
| 1952 | Ga0079104_1065654 | |||
| 1953 | Ga0075435_100078555 | |||
| 1954 | Ga0075435_100558593 | |||
| 1955 | Ga0075435_101285133 | |||
| 1956 | Ga0075435_101302718 | |||
| 1957 | Ga0099795_10091163 | |||
| 1958 | Ga0099795_10323616 | |||
| 1959 | Ga0105251_10069762 | |||
| 1960 | Ga0105250_10462498 | |||
| 1961 | Ga0105250_10490571 | |||
| 1962 | Ga0105240_10000906 | |||
| 1963 | Ga0105240_10020715 | |||
| 1964 | Ga0105240_10190889 | |||
| 1965 | Ga0105240_10391068 | |||
| 1966 | Ga0105240_10507292 | |||
| 1967 | Ga0105240_10721265 | |||
| 1968 | Ga0105240_11045775 | |||
| 1969 | Ga0105240_11344387 | |||
| 1970 | Ga0111539_10016502 | |||
| 1971 | Ga0111539_11095602 | |||
| 1972 | Ga0111539_11642657 | |||
| 1973 | Ga0105245_10099561 | |||
| 1974 | Ga0105245_10120596 | |||
| 1975 | Ga0105245_10326876 | |||
| 1976 | Ga0105247_10262534 | |||
| 1977 | Ga0105247_10922932 | |||
| 1978 | Ga0105247_11239282 | |||
| 1979 | Ga0114129_10065857 | |||
| 1980 | Ga0114129_10554633 | |||
| 1981 | Ga0114129_10707709 | |||
| 1982 | Ga0114129_10708763 | |||
| 1983 | Ga0114129_11676250 | |||
| 1984 | Ga0114129_12766504 | |||
| 1985 | Ga0105243_10085767 | |||
| 1986 | Ga0105243_10142913 | |||
| 1987 | Ga0105243_11700857 | |||
| 1988 | Ga0105241_10058129 | |||
| 1989 | Ga0105241_10081720 | |||
| 1990 | Ga0105241_10214916 | |||
| 1991 | Ga0105241_10358587 | |||
| 1992 | Ga0105241_10606121 | |||
| 1993 | Ga0105241_10974794 | |||
| 1994 | Ga0105241_11952100 | |||
| 1995 | Ga0105241_12120477 | |||
| 1996 | Ga0105242_10248285 | |||
| 1997 | Ga0105242_10316963 | |||
| 1998 | Ga0105242_11482615 | |||
| 1999 | Ga0105242_12029122 | |||
| 2000 | Ga0105248_10121106 | |||
| 2001 | Ga0105248_10311374 | |||
| 2002 | Ga0105248_10425081 | |||
| 2003 | Ga0105248_11133207 | |||
| 2004 | Ga0105237_10000768 | |||
| 2005 | Ga0105237_10034618 | |||
| 2006 | Ga0105237_10105484 | |||
| 2007 | Ga0105237_10185435 | |||
| 2008 | Ga0105237_10353218 | |||
| 2009 | Ga0105237_10390180 | |||
| 2010 | Ga0105237_10394759 | |||
| 2011 | Ga0105237_10780348 | |||
| 2012 | Ga0105237_11197889 | |||
| 2013 | Ga0105237_12099693 | |||
| 2014 | Ga0105237_12511515 | |||
| 2015 | Ga0105238_10037476 | |||
| 2016 | Ga0105238_10054946 | |||
| 2017 | Ga0105238_10059189 | |||
| 2018 | Ga0105238_10060050 | |||
| 2019 | Ga0105238_10063273 | |||
| 2020 | Ga0105238_10086639 | |||
| 2021 | Ga0105238_10135292 | |||
| 2022 | Ga0105238_10227960 | |||
| 2023 | Ga0105238_10497883 | |||
| 2024 | Ga0105238_10511163 | |||
| 2025 | Ga0105238_10946299 | |||
| 2026 | Ga0105238_11526223 | |||
| 2027 | Ga0105238_12174350 | |||
| 2028 | Ga0105249_10013373 | |||
| 2029 | Ga0105249_10454865 | |||
| 2030 | Ga0099796_10090755 | |||
| 2031 | Ga0099796_10138296 | |||
| 2032 | Ga0105239_10000846 | |||
| 2033 | Ga0105239_10009303 | |||
| 2034 | Ga0105239_10014928 | |||
| 2035 | Ga0105239_10097555 | |||
| 2036 | Ga0105239_10288032 | |||
| 2037 | Ga0105239_10327199 | |||
| 2038 | Ga0105239_10390393 | |||
| 2039 | Ga0105239_10398331 | |||
| 2040 | Ga0105239_10458925 | |||
| 2041 | Ga0105239_10799132 | |||
| 2042 | Ga0105239_11023502 | |||
| 2043 | Ga0105239_11185436 | |||
| 2044 | Ga0105239_11675732 | |||
| 2045 | Ga0105239_11840572 | |||
| 2046 | Ga0105239_12685967 | |||
| 2047 | Ga0105246_10088471 | |||
| 2048 | Ga0105246_11564809 | |||
| 2049 | Ga0105246_11686401 | |||
| 2050 | Ga0105246_12258735 | |||
| 2051 | Ga0157342_1057251 | |||
| 2052 | Ga0157373_10838269 | |||
| 2053 | Ga0157371_10022848 | |||
| 2054 | Ga0157371_10341159 | |||
| 2055 | Ga0157370_10007830 | |||
| 2056 | Ga0157370_10409387 | |||
| 2057 | Ga0157370_10678802 | |||
| 2058 | Ga0157369_10422318 | |||
| 2059 | Ga0171463_1007 | |||
| 2060 | Ga0157374_10072574 | |||
| 2061 | Ga0157374_10313533 | |||
| 2062 | Ga0157374_10410884 | |||
| 2063 | Ga0157378_10015322 | |||
| 2064 | Ga0157378_10357821 | |||
| 2065 | Ga0157378_10411110 | |||
| 2066 | Ga0157378_11292257 | |||
| 2067 | Ga0163162_10101266 | |||
| 2068 | Ga0163162_10224326 | |||
| 2069 | Ga0163162_11608189 | |||
| 2070 | Ga0163162_12279075 | |||
| 2071 | Ga0157372_10254990 | |||
| 2072 | Ga0157372_10440349 | |||
| 2073 | Ga0157375_11117528 | |||
| 2074 | Ga0157375_11825182 | |||
| 2075 | Ga0157375_13323844 | |||
| 2076 | Ga0163163_10047824 | |||
| 2077 | Ga0163163_10060022 | |||
| 2078 | Ga0163163_10169415 | |||
| 2079 | Ga0163163_10217856 | |||
| 2080 | Ga0163163_10314559 | |||
| 2081 | Ga0157380_10881439 | |||
| 2082 | Ga0182008_10166788 | |||
| 2083 | Ga0182008_10466190 | |||
| 2084 | Ga0157379_10034956 | |||
| 2085 | Ga0157379_10314220 | |||
| 2086 | Ga0157379_11197775 | |||
| 2087 | Ga0157376_11156297 | |||
| 2088 | Ga0157376_12647181 | |||
| 2089 | Ga0157376_13053723 | |||
| 2090 | Ga0183363_1259 | |||
| 2091 | Ga0163161_10522430 | |||
| 2092 | Ga0197907_10317020 | |||
| 2093 | Ga0206353_10434026 | |||
| 2094 | Ga0214544_1000011 | |||
| 2095 | Ga0214542_1000009 | |||
| 2096 | Ga0214545_1000007 | |||
| 2097 | Ga0214543_1000020 | |||
| 2098 | Ga0213873_10012381 | |||
| 2099 | Ga0213873_10015537 | |||
| 2100 | Ga0213873_10179808 | |||
| 2101 | Ga0213872_10004352 | |||
| 2102 | Ga0213872_10035915 | |||
| 2103 | Ga0213872_10126948 | |||
| 2104 | Ga0213872_10240571 | |||
| 2105 | Ga0213872_10470543 | |||
| 2106 | Ga0213874_10200151 | |||
| 2107 | Ga0213876_10015403 | |||
| 2108 | Ga0213871_10031702 | |||
| 2109 | Ga0209435_100005 | |||
| 2110 | Ga0209436_101180 | |||
| 2111 | Ga0209563_100718 | |||
| 2112 | Ga0209258_128199 | |||
| 2113 | Ga0209646_1000011 | |||
| 2114 | Ga0209026_1000008 | |||
| 2115 | Ga0209026_1012371 | |||
| 2116 | Ga0209026_1028587 | |||
| 2117 | Ga0209026_1032988 | |||
| 2118 | Ga0209677_100400 | |||
| 2119 | Ga0209677_103245 | |||
| 2120 | Ga0209148_1000321 | |||
| 2121 | Ga0209148_1001029 | |||
| 2122 | Ga0209759_1000004 | |||
| 2123 | Ga0209233_1003560 | |||
| 2124 | Ga0209233_1009331 | |||
| 2125 | Ga0209233_1024852 | |||
| 2126 | Ga0209233_1027633 | |||
| 2127 | Ga0209233_1038593 | |||
| 2128 | Ga0209233_1049905 | |||
| 2129 | Ga0209455_1002441 | |||
| 2130 | Ga0209455_1013650 | |||
| 2131 | Ga0209673_1060114 | |||
| 2132 | Ga0209130_1000017 | |||
| 2133 | Ga0209676_1006987 | |||
| 2134 | Ga0209025_1000153 | |||
| 2135 | Ga0209025_1040142 | |||
| 2136 | Ga0209564_1000013 | |||
| 2137 | Ga0209564_1018331 | |||
| 2138 | Ga0209564_1078132 | |||
| 2139 | Ga0209758_1000119 | |||
| 2140 | Ga0209758_1000206 | |||
| 2141 | Ga0209758_1000536 | |||
| 2142 | Ga0209758_1001853 | |||
| 2143 | Ga0209758_1002042 | |||
| 2144 | Ga0209758_1006010 | |||
| 2145 | Ga0209758_1016012 | |||
| 2146 | Ga0209758_1036437 | |||
| 2147 | Ga0209758_1044493 | |||
| 2148 | Ga0209050_1000029 | |||
| 2149 | Ga0209050_1005510 | |||
| 2150 | Ga0209050_1013688 | |||
| 2151 | Ga0209256_1000211 | |||
| 2152 | Ga0209256_1004227 | |||
| 2153 | Ga0209256_1005602 | |||
| 2154 | Ga0209256_1096731 | |||
| 2155 | Ga0207426_1000006 | |||
| 2156 | Ga0207426_1000870 | |||
| 2157 | Ga0207426_1003803 | |||
| 2158 | Ga0207426_1004991 | |||
| 2159 | Ga0207426_1068848 | |||
| 2160 | Ga0209051_1048380 | |||
| 2161 | Ga0209257_1000271 | |||
| 2162 | Ga0209257_1000301 | |||
| 2163 | Ga0209257_1000394 | |||
| 2164 | Ga0209257_1011550 | |||
| 2165 | Ga0209257_1020690 | |||
| 2166 | Ga0209257_1030953 | |||
| 2167 | Ga0209257_1082005 | |||
| 2168 | Ga0209257_1130115 | |||
| 2169 | Ga0207697_10184810 | |||
| 2170 | Ga0207656_10051320 | |||
| 2171 | Ga0207656_10055558 | |||
| 2172 | Ga0207692_10012356 | |||
| 2173 | Ga0207692_10072441 | |||
| 2174 | Ga0207692_10118555 | |||
| 2175 | Ga0207710_10183941 | |||
| 2176 | Ga0207710_10342768 | |||
| 2177 | Ga0207710_10544739 | |||
| 2178 | Ga0207688_10265382 | |||
| 2179 | Ga0207680_10001600 | |||
| 2180 | Ga0207680_10003166 | |||
| 2181 | Ga0207680_10120654 | |||
| 2182 | Ga0207680_11363288 | |||
| 2183 | Ga0207647_10001114 | |||
| 2184 | Ga0207647_10016170 | |||
| 2185 | Ga0207685_10028515 | |||
| 2186 | Ga0207685_10273612 | |||
| 2187 | Ga0207699_10000352 | |||
| 2188 | Ga0207699_10107452 | |||
| 2189 | Ga0207699_10411699 | |||
| 2190 | Ga0207645_10206179 | |||
| 2191 | Ga0207705_10070467 | |||
| 2192 | Ga0207654_10033099 | |||
| 2193 | Ga0207654_10143253 | |||
| 2194 | Ga0207654_10254110 | |||
| 2195 | Ga0207654_10300211 | |||
| 2196 | Ga0207654_10401781 | |||
| 2197 | Ga0207654_10497670 | |||
| 2198 | Ga0207707_10353100 | |||
| 2199 | Ga0207695_10000040 | |||
| 2200 | Ga0207695_10025575 | |||
| 2201 | Ga0207695_10027614 | |||
| 2202 | Ga0207695_10161780 | |||
| 2203 | Ga0207695_10425339 | |||
| 2204 | Ga0207695_10652637 | |||
| 2205 | Ga0207695_10826123 | |||
| 2206 | Ga0207695_10922875 | |||
| 2207 | Ga0207695_11148006 | |||
| 2208 | Ga0207671_10000361 | |||
| 2209 | Ga0207671_10015883 | |||
| 2210 | Ga0207671_10083610 | |||
| 2211 | Ga0207671_10227144 | |||
| 2212 | Ga0207671_10245203 | |||
| 2213 | Ga0207671_10262805 | |||
| 2214 | Ga0207671_10522646 | |||
| 2215 | Ga0207693_10024896 | |||
| 2216 | Ga0207663_10002073 | |||
| 2217 | Ga0207663_10010518 | |||
| 2218 | Ga0207663_10742139 | |||
| 2219 | Ga0207663_11020323 | |||
| 2220 | Ga0207663_11321817 | |||
| 2221 | Ga0207660_10488825 | |||
| 2222 | Ga0207657_10251288 | |||
| 2223 | Ga0207657_10530903 | |||
| 2224 | Ga0207657_10818198 | |||
| 2225 | Ga0207649_10018924 | |||
| 2226 | Ga0207649_10071728 | |||
| 2227 | Ga0207649_10177173 | |||
| 2228 | Ga0207649_10309295 | |||
| 2229 | Ga0207649_10688860 | |||
| 2230 | Ga0207681_11155970 | |||
| 2231 | Ga0207694_10001195 | |||
| 2232 | Ga0207694_10002483 | |||
| 2233 | Ga0207694_10030886 | |||
| 2234 | Ga0207694_10034603 | |||
| 2235 | Ga0207694_10120291 | |||
| 2236 | Ga0207694_10127691 | |||
| 2237 | Ga0207694_10219474 | |||
| 2238 | Ga0207694_10449401 | |||
| 2239 | Ga0207694_10471166 | |||
| 2240 | Ga0207694_10566684 | |||
| 2241 | Ga0207694_10968306 | |||
| 2242 | Ga0207694_11743758 | |||
| 2243 | Ga0207650_10021597 | |||
| 2244 | Ga0207650_10517836 | |||
| 2245 | Ga0207650_10758429 | |||
| 2246 | Ga0207650_10946865 | |||
| 2247 | Ga0207659_10737055 | |||
| 2248 | Ga0207687_10155441 | |||
| 2249 | Ga0207700_10031588 | |||
| 2250 | Ga0207700_10167948 | |||
| 2251 | Ga0207700_11085087 | |||
| 2252 | Ga0207700_11400064 | |||
| 2253 | Ga0207664_10044956 | |||
| 2254 | Ga0207664_10073306 | |||
| 2255 | Ga0207664_10894476 | |||
| 2256 | Ga0207644_10212348 | |||
| 2257 | Ga0207644_10477105 | |||
| 2258 | Ga0207644_11006629 | |||
| 2259 | Ga0207644_11058168 | |||
| 2260 | Ga0207644_11566838 | |||
| 2261 | Ga0207690_10676498 | |||
| 2262 | Ga0207706_10188835 | |||
| 2263 | Ga0207706_10198515 | |||
| 2264 | Ga0207706_10380681 | |||
| 2265 | Ga0207686_10156225 | |||
| 2266 | Ga0207709_11062388 | |||
| 2267 | Ga0207670_10801955 | |||
| 2268 | Ga0207670_10881774 | |||
| 2269 | Ga0207670_11516482 | |||
| 2270 | Ga0207669_10898035 | |||
| 2271 | Ga0207669_11705851 | |||
| 2272 | Ga0207665_10156483 | |||
| 2273 | Ga0207665_10174443 | |||
| 2274 | Ga0207665_10177685 | |||
| 2275 | Ga0207665_11201030 | |||
| 2276 | Ga0207665_11586644 | |||
| 2277 | Ga0207691_10276597 | |||
| 2278 | Ga0207691_11063922 | |||
| 2279 | Ga0207711_10066476 | |||
| 2280 | Ga0207711_10604005 | |||
| 2281 | Ga0207711_11185576 | |||
| 2282 | Ga0207711_11186868 | |||
| 2283 | Ga0207661_10523945 | |||
| 2284 | Ga0207679_11334797 | |||
| 2285 | Ga0207679_11359299 | |||
| 2286 | Ga0207667_10169996 | |||
| 2287 | Ga0207667_10182625 | |||
| 2288 | Ga0207667_10283454 | |||
| 2289 | Ga0207667_10718834 | |||
| 2290 | Ga0207667_11200819 | |||
| 2291 | Ga0207667_11291788 | |||
| 2292 | Ga0207651_10032659 | |||
| 2293 | Ga0207651_11517973 | |||
| 2294 | Ga0207712_10324405 | |||
| 2295 | Ga0207668_10077230 | |||
| 2296 | Ga0207640_10018949 | |||
| 2297 | Ga0207640_10101491 | |||
| 2298 | Ga0207640_10115178 | |||
| 2299 | Ga0207640_11608913 | |||
| 2300 | Ga0207640_12140402 | |||
| 2301 | Ga0207640_12187397 | |||
| 2302 | Ga0207658_10003350 | |||
| 2303 | Ga0207658_10083678 | |||
| 2304 | Ga0207658_11677434 | |||
| 2305 | Ga0207658_11907967 | |||
| 2306 | Ga0207658_12017879 | |||
| 2307 | Ga0207677_10187579 | |||
| 2308 | Ga0207677_10331893 | |||
| 2309 | Ga0207677_11814911 | |||
| 2310 | Ga0207703_10000429 | |||
| 2311 | Ga0207703_10001132 | |||
| 2312 | Ga0207703_10081368 | |||
| 2313 | Ga0207703_10853229 | |||
| 2314 | Ga0207703_11646875 | |||
| 2315 | Ga0207639_10000308 | |||
| 2316 | Ga0207639_10000858 | |||
| 2317 | Ga0207639_11170875 | |||
| 2318 | Ga0207678_10074670 | |||
| 2319 | Ga0207678_10091454 | |||
| 2320 | Ga0207678_10093155 | |||
| 2321 | Ga0207678_10285644 | |||
| 2322 | Ga0207678_10325731 | |||
| 2323 | Ga0207678_10683875 | |||
| 2324 | Ga0207678_10694369 | |||
| 2325 | Ga0207678_10908163 | |||
| 2326 | Ga0207678_10963984 | |||
| 2327 | Ga0207678_11922870 | |||
| 2328 | Ga0207702_10001580 | |||
| 2329 | Ga0207702_10099364 | |||
| 2330 | Ga0207702_10126406 | |||
| 2331 | Ga0207702_10152645 | |||
| 2332 | Ga0207702_10393248 | |||
| 2333 | Ga0207702_10625891 | |||
| 2334 | Ga0207641_10000034 | |||
| 2335 | Ga0207641_10008638 | |||
| 2336 | Ga0207641_10708877 | |||
| 2337 | Ga0207641_11525582 | |||
| 2338 | Ga0207641_12459991 | |||
| 2339 | Ga0207648_10105574 | |||
| 2340 | Ga0207648_10159531 | |||
| 2341 | Ga0207676_10000202 | |||
| 2342 | Ga0207676_10003773 | |||
| 2343 | Ga0207676_10143239 | |||
| 2344 | Ga0207676_10404232 | |||
| 2345 | Ga0207676_11983090 | |||
| 2346 | Ga0207674_10037382 | |||
| 2347 | Ga0207674_10393199 | |||
| 2348 | Ga0207674_10454657 | |||
| 2349 | Ga0207674_10486232 | |||
| 2350 | Ga0207674_10890276 | |||
| 2351 | Ga0207675_100316872 | |||
| 2352 | Ga0207675_102712301 | |||
| 2353 | Ga0207683_10304083 | |||
| 2354 | Ga0207683_10520202 | |||
| 2355 | Ga0207683_10823559 | |||
| 2356 | Ga0207698_10005879 | |||
| 2357 | Ga0207698_10009260 | |||
| 2358 | Ga0207698_10194806 | |||
| 2359 | Ga0207698_10347305 | |||
| 2360 | Ga0207698_10664838 | |||
| 2361 | Ga0207698_10780659 | |||
| 2362 | Ga0207698_11654014 | |||
| 2363 | Ga0207698_11949232 | |||
| 2364 | Ga0209281_1070928 | |||
| 2365 | Ga0209389_1000034 | |||
| 2366 | Ga0209389_1000039 | |||
| 2367 | Ga0209589_1000038 | |||
| 2368 | Ga0209489_100023 | |||
| 2369 | Ga0209489_100087 | |||
| 2370 | Ga0209700_100090 | |||
| 2371 | Ga0209179_1047920 | |||
| 2372 | Ga0209813_10158514 | |||
| 2373 | Ga0209813_10262334 | |||
| 2374 | Ga0207428_10051956 | |||
| 2375 | Ga0207428_10068908 | |||
| 2376 | Ga0268266_10000003 | |||
| 2377 | Ga0268266_10000008 | |||
| 2378 | Ga0268266_10000086 | |||
| 2379 | Ga0268266_10033319 | |||
| 2380 | Ga0268266_10047500 | |||
| 2381 | Ga0268266_10199386 | |||
| 2382 | Ga0268266_10320253 | |||
| 2383 | Ga0268265_10011219 | |||
| 2384 | Ga0268265_10312136 | |||
| 2385 | Ga0268265_11056938 | |||
| 2386 | Ga0268264_10000194 | |||
| 2387 | Ga0268264_10848359 | |||
| 2388 | Ga0268264_10991337 | |||
| 2389 | Ga0268264_11732992 | |||
| 2390 | Ga0268264_11954783 | |||
| 2391 | Ga0265337_1004679 | |||
| 2392 | Ga0265326_10001084 | |||
| 2393 | Ga0265319_1004856 | |||
| 2394 | Ga0265319_1065409 | |||
| 2395 | Ga0265334_10003918 | |||
| 2396 | Ga0265318_10029465 | |||
| 2397 | Ga0265318_10069342 | |||
| 2398 | Ga0265318_10167416 | |||
| 2399 | Ga0265323_10001297 | |||
| 2400 | Ga0265322_10074888 | |||
| 2401 | Ga0265336_10000620 | |||
| 2402 | Ga0307517_10000200 | |||
| 2403 | Ga0307517_10377461 | |||
| 2404 | Ga0307517_10466557 | |||
| 2405 | Ga0307515_10000017 | |||
| 2406 | Ga0307515_10001155 | |||
| 2407 | Ga0307515_10009128 | |||
| 2408 | Ga0265338_10001434 | |||
| 2409 | Ga0265338_10109509 | |||
| 2410 | Ga0265338_10972480 | |||
| 2411 | Ga0265324_10002184 | |||
| 2412 | Ga0265324_10108124 | |||
| 2413 | Ga0307512_10112280 | |||
| 2414 | Ga0265332_10200301 | |||
| 2415 | Ga0265332_10289098 | |||
| 2416 | Ga0265328_10155256 | |||
| 2417 | Ga0265328_10271102 | |||
| 2418 | Ga0265320_10075795 | |||
| 2419 | Ga0265325_10006538 | |||
| 2420 | Ga0265325_10009438 | |||
| 2421 | Ga0265325_10227246 | |||
| 2422 | Ga0265329_10058269 | |||
| 2423 | Ga0265329_10166878 | |||
| 2424 | Ga0265340_10001678 | |||
| 2425 | Ga0265340_10032481 | |||
| 2426 | Ga0265340_10075438 | |||
| 2427 | Ga0265340_10114786 | |||
| 2428 | Ga0265331_10021780 | |||
| 2429 | Ga0265331_10064808 | |||
| 2430 | Ga0265331_10135888 | |||
| 2431 | Ga0265331_10141382 | |||
| 2432 | Ga0265327_10003183 | |||
| 2433 | Ga0265327_10027477 | |||
| 2434 | Ga0265327_10156539 | |||
| 2435 | Ga0265316_10265257 | |||
| 2436 | Ga0265316_10343827 | |||
| 2437 | Ga0265316_10418871 | |||
| 2438 | Ga0265316_11268221 | |||
| 2439 | Ga0307513_10000852 | |||
| 2440 | Ga0307513_10002169 | |||
| 2441 | Ga0307513_10084803 | |||
| 2442 | Ga0307513_10132190 | |||
| 2443 | Ga0307513_11085111 | |||
| 2444 | Ga0307509_10000115 | |||
| 2445 | Ga0307509_10605560 | |||
| 2446 | Ga0307408_100076769 | |||
| 2447 | Ga0307408_100888614 | |||
| 2448 | Ga0307408_101269491 | |||
| 2449 | Ga0265313_10031074 | |||
| 2450 | Ga0265313_10194519 | |||
| 2451 | Ga0307508_10011570 | |||
| 2452 | Ga0307508_10049419 | |||
| 2453 | Ga0307508_10075275 | |||
| 2454 | Ga0307508_10271173 | |||
| 2455 | Ga0316575_10074038 | |||
| 2456 | Ga0265314_10065760 | |||
| 2457 | Ga0265314_10101750 | |||
| 2458 | Ga0265314_10135802 | |||
| 2459 | Ga0265314_10198905 | |||
| 2460 | Ga0265342_10105466 | |||
| 2461 | Ga0265342_10205207 | |||
| 2462 | Ga0265342_10547188 | |||
| 2463 | Ga0316576_10537020 | |||
| 2464 | Ga0307516_10000029 | |||
| 2465 | Ga0307516_10366324 | |||
| 2466 | Ga0307516_10445344 | |||
| 2467 | Ga0307410_11155952 | |||
| 2468 | Ga0307407_10167016 | |||
| 2469 | Ga0307407_11387629 | |||
| 2470 | Ga0307409_100249540 | |||
| 2471 | Ga0307409_102956189 | |||
| 2472 | Ga0307416_100473599 | |||
| 2473 | Ga0307416_101874870 | |||
| 2474 | Ga0307411_11053823 | |||
| 2475 | Ga0316583_10058542 | |||
| 2476 | Ga0307510_10051340 | |||
| 2477 | Ga0307510_10105648 | |||
| 2478 | Ga0307510_10356649 | |||
| 2479 | Ga0307510_10492470 | |||
| 2480 | Ga0373938_0245460 | |||
| 2481 | Ga0373926_0085038 | |||
| 2482 | Ga0373926_0271087 | |||
| 2483 | Ga0373928_0245085 | |||
| 2484 | Ga0373940_0026875 | |||
| 2485 | Ga0373940_0305113 | |||
| 2486 | Ga0373944_0003979 | |||
| 2487 | Ga0373951_0177728 | |||
| 2488 | Ga0373932_0138135 | |||
| 2489 | Ga0373936_0332489 | |||
| 2490 | Ga0373939_0045189 | |||
| 2491 | Ga0373941_0315002 | |||
| 2492 | Ga0373953_0127756 | |||
| 2493 | Ga0373954_0104993 | |||
| 2494 | Ga0373957_0008983 | |||
| 2495 | Ga0373943_0085914 | |||
| 2496 | Ga0373943_0186214 | |||
| 2497 | Ga0373943_0195356 | |||
| 2498 | Ga0373946_0067975 | |||
| 2499 | Ga0373961_0190804 | |||
| 2500 | Ga0373962_0306855 | |||
| 2501 | Ga0316574_0000161 | |||
| 2502 | Ga0373931_0005928 | |||
| 2503 | Ga0373931_0519344 | |||
| 2504 | Ga0373931_0726162 | |||
| 2505 | Ga0373935_0218330 | |||
| 2506 | Ga0373927_0000155 | |||
| 2507 | Ga0373927_0090786 | |||
| 2508 | Ga0373927_0218513 | |||
| 2509 | Ga0373947_0120662 | |||
| 2510 | Ga0373947_0233356 | |||
| 2511 | Ga0373947_0518297 | |||
| 2512 | Ga0373947_0796061 | |||
| 2513 | Ga0373937_0002250 | |||
| 2514 | Ga0373937_0094799 | |||
| 2515 | Ga0373937_1607474 | |||
| 2516 | Ga0316582_0163544 | |||
| 2517 | Ga0316584_0008065 | |||
| 2518 | Ga0373925_0000050 | |||
| 2519 | Ga0373925_0633260 | |||
| 2520 | Ga0395899_0049253 | |||
| 2521 | Ga0395899_0106177 | |||
| 2522 | Ga0395899_0480008 | |||
| 2523 | Ga0395899_0733907 | |||
| 2524 | Ga0395900_0003044 | |||
| 2525 | Ga0395900_0049001 | |||
| 2526 | Ga0395900_0229886 | |||
| 2527 | Ga0395900_0374247 | |||
| 2528 | Ga0395900_0608026 | |||
| 2529 | Ga0395900_0877385 | |||
| 2530 | Ga0395900_1369596 | |||
| 2531 | Ga0395898_0003078 | |||
| 2532 | Ga0395898_0116788 | |||
| 2533 | Ga0395898_0117951 | |||
| 2534 | Ga0395898_0357161 | |||
| 2535 | Ga0395898_1021522 | |||
| 2536 | Ga0395898_1390515 | |||
| 2537 | Ga0395905_0001273 | |||
| 2538 | Ga0395905_0178258 | |||
| 2539 | Ga0395905_0182365 | |||
| 2540 | Ga0395905_0221863 | |||
| 2541 | Ga0395905_1452281 | |||
| 2542 | Ga0395905_1818690 | |||
| 2543 | Ga0395905_1877897 | |||
| 2544 | Ga0436364_0407990 | |||
| 2545 | Ga0436364_0561975 | |||
| 2546 | Ga0436364_1280483 | |||
| 2547 | Ga0436364_1290587 | |||
| 2548 | Ga0436364_1382664 | |||
| 2549 | Ga0395901_0022715 | |||
| 2550 | Ga0395901_0261930 | |||
| 2551 | Ga0395901_0787307 | |||
| 2552 | Ga0400483_113437 | |||
| 2553 | Ga0436365_0071066 | |||
| 2554 | Ga0436365_0089719 | |||
| 2555 | Ga0436365_0097049 | |||
| 2556 | Ga0436365_0176700 | |||
| 2557 | Ga0436365_0478528 | |||
| 2558 | Ga0436365_0652448 | |||
| 2559 | Ga0436365_0987719 | |||
| 2560 | Ga0436365_1901637 | |||
| 2561 | Ga0436365_1912355 | |||
| 2562 | Ga0436360_0107966 | |||
| 2563 | Ga0436360_0560001 | |||
| 2564 | Ga0436360_0659897 | |||
| 2565 | Ga0436360_1276140 | |||
| 2566 | Ga0436360_1336701 | |||
| 2567 | Ga0436361_0123394 | |||
| 2568 | Ga0436361_0126524 | |||
| 2569 | Ga0436361_0259266 | |||
| 2570 | Ga0436361_0275557 | |||
| 2571 | Ga0436361_0344369 | |||
| 2572 | Ga0436361_0433996 | |||
| 2573 | Ga0436361_0564472 | |||
| 2574 | Ga0436361_0585344 | |||
| 2575 | Ga0436361_0590022 | |||
| 2576 | Ga0436361_1147896 | |||
| 2577 | Ga0436363_0659025 | |||
| 2578 | Ga0436363_0766421 | |||
| 2579 | Ga0436363_0786529 | |||
| 2580 | Ga0436363_0903263 | |||
| 2581 | Ga0436363_1146700 | |||
| 2582 | Ga0436363_1592292 | |||
| 2583 | Ga0436362_0242406 | |||
| 2584 | Ga0436362_0466387 | |||
| 2585 | Ga0436362_1077664 | |||
| 2586 | Ga0439436_0003632 | |||
| 2587 | Ga0439438_031950 | |||
| 2588 | Ga0439439_0227969 | |||
| 2589 | Ga0439447_017777 | |||
| 2590 | Ga0439465_0003746 | |||
| 2591 | Ga0439465_0099729 | |||
| 2592 | Ga0439465_0378543 | |||
| 2593 | Ga0451789_1302564 | |||
| 2594 | Ga0451793_0870755 | |||
| 2595 | Ga0451802_0383790 | |||
| 2596 | Ga0451833_0407321 | |||
| 2597 | Ga0451833_0737184 | |||
| 2598 | Ga0451833_1325230 | |||
| 2599 | Ga0451833_1417654 | |||
| 2600 | Ga0451847_0260825 | |||
| 2601 | Ga0451849_0406743 | |||
| 2602 | Ga0451849_0912448 | |||
| 2603 | Ga0451853_0820542 | |||
| 2604 | Ga0451853_2029874 | |||
| 2605 | Ga0451853_4114360 | |||
| 2606 | Ga0439445_0034436 | |||
| 2607 | Ga0439445_0201410 | |||
| 2608 | Ga0439432_061721 | |||
| 2609 | Ga0439449_0020329 | |||
| 2610 | Ga0439462_0029571 | |||
| 2611 | Ga0450912_026150 | |||
| 2612 | Ga0450920_006886 | |||
| 2613 | Ga0450906_005298 | |||
| 2614 | Ga0450907_014165 | |||
| 2615 | Ga0450910_051659 | |||
| 2616 | Ga0439458_0147696 | |||
| 2617 | Ga0450918_002227 | |||
| 2618 | Ga0451577_1361144 | |||
| 2619 | Ga0466969_0134804 | |||
| 2620 | Ga0466972_0000053 | |||
| 2621 | Ga0466972_0004635 | |||
| 2622 | Ga0466972_0304231 | |||
| 2623 | Ga0466965_0106903 | |||
| 2624 | Ga0466965_0395966 | |||
| 2625 | Ga0466965_0583269 | |||
| 2626 | Ga0466966_0003689 | |||
| 2627 | Ga0466966_0494001 | |||
| 2628 | Ga0466961_0004648 | |||
| 2629 | Ga0466961_0426019 | |||
| 2630 | Ga0466963_0870803 | |||
| 2631 | Ga0466963_1045763 | |||
| 2632 | Ga0466964_0054370 | |||
| 2633 | Ga0466964_0854536 | |||
| 2634 | Ga0453684_0508793 | |||
| 2635 | Ga0466971_0432648 | |||
| 2636 | Ga0466968_0001220 | |||
| 2637 | Ga0466970_0101279 | |||
| 2638 | Ga0466970_0230458 | |||
| 2639 | Ga0466957_0395124 | |||
| 2640 | Ga0466957_0503763 | |||
| 2641 | Ga0466960_0009742 | |||
| 2642 | Ga0466960_0013395 | |||
| 2643 | Ga0466960_0793258 | |||
| 2644 | Ga0466959_0002926 | |||
| 2645 | Ga0466959_0195198 | |||
| 2646 | Ga0451576_0000194 | |||
| 2647 | Ga0451576_1630076 | |||
| 2648 | Ga0466958_0192720 | |||
| 2649 | Ga0466967_0139418 | |||
| 2650 | Ga0466967_0638282 | |||
| 2651 | Ga0466967_0773688 | |||
| 2652 | Ga0466967_1465549 | |||
| 2653 | Ga0495627_123321 | |||
| 2654 | Ga0495592_0043578 | |||
| 2655 | Ga0495592_0087729 | |||
| 2656 | Ga0495603_0070143 | |||
| 2657 | Ga0495590_0217065 | |||
| 2658 | Ga0495629_0003885 | |||
| 2659 | Ga0495638_0002872 | |||
| 2660 | Ga0495638_0058306 | |||
| 2661 | Ga0495638_0409065 | |||
| 2662 | Ga0495651_0005311 | |||
| 2663 | Ga0495651_0026825 | |||
| 2664 | Ga0495653_0284276 | |||
| 2665 | Ga0495650_0336504 | |||
| 2666 | Ga0495580_0204314 | |||
| 2667 | Ga0495605_0285771 | |||
| 2668 | Ga0495664_0166292 | |||
| 2669 | Ga0495664_0728822 | |||
| 2670 | Ga0495596_0130914 | |||
| 2671 | Ga0495607_0091356 | |||
| 2672 | Ga0495606_0076424 | |||
| 2673 | Ga0495606_0137801 | |||
| 2674 | Ga0495606_0192182 | |||
| 2675 | Ga0495606_0209552 | |||
| 2676 | Ga0495606_0219766 | |||
| 2677 | Ga0495610_0291090 | |||
| 2678 | Ga0495616_0201254 | |||
| 2679 | Ga0495618_0035880 | |||
| 2680 | Ga0495620_0054254 | |||
| 2681 | Ga0495628_0103744 | |||
| 2682 | Ga0495628_0684683 | |||
| 2683 | Ga0495643_0127233 | |||
| 2684 | Ga0495643_0143795 | |||
| 2685 | Ga0495648_0055521 | |||
| 2686 | Ga0495648_0237903 | |||
| 2687 | Ga0495666_0179598 | |||
| 2688 | Ga0495666_0527791 | |||
| 2689 | Ga0495652_0082534 | |||
| 2690 | Ga0495652_0095736 | |||
| 2691 | Ga0495652_0218829 | |||
| 2692 | Ga0495654_0321195 | |||
| 2693 | Ga0495640_0019349 | |||
| 2694 | Ga0495640_0032240 | |||
| 2695 | Ga0495586_0856004 | |||
| 2696 | Ga0495587_0185731 | |||
| 2697 | Ga0495587_0297556 | |||
| 2698 | Ga0495609_0092136 | |||
| 2699 | Ga0495609_0184469 | |||
| 2700 | Ga0495609_0267792 | |||
| 2701 | Ga0495609_0290807 | |||
| 2702 | Ga0495597_0027670 | |||
| 2703 | Ga0495597_0171342 | |||
| 2704 | Ga0495645_0384559 | |||
| 2705 | Ga0495622_0016703 | |||
| 2706 | Ga0495622_0049422 | |||
| 2707 | Ga0495622_0053966 | |||
| 2708 | Ga0495633_0208489 | |||
| 2709 | Ga0495667_0202232 | |||
| 2710 | Ga0495668_0068816 | |||
| 2711 | Ga0495668_0207226 | |||
| 2712 | Ga0495668_0259317 | |||
| 2713 | Ga0495668_0765814 | |||
| 2714 | Ga0495634_0107967 | |||
| 2715 | Ga0495611_0096248 | |||
| 2716 | Ga0495611_0330549 | |||
| 2717 | Ga0495625_0052558 | |||
| 2718 | Ga0495625_0210390 | |||
| 2719 | Ga0495625_0221718 | |||
| 2720 | Ga0495625_0226986 | |||
| 2721 | Ga0495635_0009411 | |||
| 2722 | Ga0495661_0038077 | |||
| 2723 | Ga0495661_0442437 | |||
| 2724 | Ga0495588_0032954 | |||
| 2725 | Ga0495588_0681564 | |||
| 2726 | Ga0495657_0011877 | |||
| 2727 | Ga0495599_0046793 | |||
| 2728 | Ga0495599_0579137 | |||
| 2729 | Ga0495623_0202565 | |||
| 2730 | Ga0495623_0271605 | |||
| 2731 | Ga0495646_0261083 | |||
| 2732 | Ga0495646_0373711 | |||
| 2733 | Ga0495658_0972039 | |||
| 2734 | Ga0495613_0033862 | |||
| 2735 | Ga0495613_0041620 | |||
| 2736 | Ga0495624_0150720 | |||
| 2737 | Ga0495649_0028321 | |||
| 2738 | Ga0495649_0065029 | |||
| 2739 | Ga0495589_0178156 | |||
| 2740 | Ga0495600_0711700 | |||
| 2741 | Ga0495581_0074513 | |||
| 2742 | Ga0495604_0010490 | |||
| 2743 | Ga0495604_0100979 | |||
| 2744 | Ga0495604_0296360 | |||
| 2745 | Ga0495674_0042102 | |||
| 2746 | Ga0495674_0122217 | |||
| 2747 | Ga0495672_0046408 | |||
| 2748 | Ga0495672_0150739 | |||
| 2749 | Ga0495672_0155635 | |||
| 2750 | Ga0495672_0338301 | |||
| 2751 | Ga0495672_0366175 | |||
| 2752 | Ga0495676_0022307 | |||
| 2753 | Ga0495680_0035033 | |||
| 2754 | Ga0495680_0169272 | |||
| 2755 | Ga0495683_0178119 | |||
| 2756 | Ga0495687_005686 | |||
| 2757 | Ga0495687_091885 | |||
| 2758 | Ga0495675_0026947 | |||
| 2759 | Ga0495673_0276378 | |||
| 2760 | Ga0495681_0164783 | |||
| 2761 | Ga0495684_0213402 | |||
| 2762 | Ga0495684_1036722 | |||
| 2763 | Ga0495686_0103802 | |||
| 2764 | Ga0495686_0578539 | |||
| 2765 | Ga0495593_0222005 | |||
| 2766 | Ga0495602_0092771 | |||
| 2767 | Ga0495602_0125194 | |||
| 2768 | Ga0495626_0162916 | |||
| 2769 | Ga0496100_0203336 | |||
| 2770 | Ga0496100_0464065 | |||
| 2771 | Ga0496100_1182217 | |||
| 2772 | Ga0496101_0076663 | |||
| 2773 | Ga0496101_0443713 | |||
| 2774 | Ga0496101_0980585 | |||
| 2775 | Ga0496102_0052325 | |||
| 2776 | Ga0496102_1182874 | |||
| 2777 | Ga0496102_1844263 | |||
| 2778 | Ga0496103_0009918 | |||
| 2779 | Ga0496103_0435099 | |||
| 2780 | Ga0496103_0524638 | |||
| 2781 | Ga0496103_0725685 | |||
| 2782 | Ga0496104_0055763 | |||
| 2783 | Ga0496104_0058115 | |||
| 2784 | Ga0496104_0167280 | |||
| 2785 | Ga0496104_0831400 | |||
| 2786 | Ga0496104_1336728 | |||
| 2787 | Ga0496104_1559141 | |||
| 2788 | Ga0496105_0107446 | |||
| 2789 | Ga0496105_0413947 | |||
| 2790 | Ga0496106_0105098 | |||
| 2791 | Ga0496106_0441862 | |||
| 2792 | Ga0496106_1570368 | |||
| 2793 | Ga0496107_0751530 | |||
| 2794 | Ga0496108_0005061 | |||
| 2795 | Ga0496108_0141180 | |||
| 2796 | Ga0496108_0215381 | |||
| 2797 | Ga0496108_0731870 | |||
| 2798 | Ga0496108_0936967 | |||
| 2799 | Ga0496108_0959533 | |||
| 2800 | Ga0496108_1084318 | |||
| 2801 | Ga0496108_1393577 | |||
| 2802 | Ga0496109_0003617 | |||
| 2803 | Ga0496109_0021676 | |||
| 2804 | Ga0496109_0061636 | |||
| 2805 | Ga0496109_0090763 | |||
| 2806 | Ga0496109_0140646 | |||
| 2807 | Ga0496109_0513538 | |||
| 2808 | Ga0496109_0742063 | |||
| 2809 | Ga0496110_0001002 | |||
| 2810 | Ga0496110_0058619 | |||
| 2811 | Ga0496110_0138102 | |||
| 2812 | Ga0496110_0900981 | |||
| 2813 | Ga0496110_1017474 | |||
| 2814 | Ga0496111_0004762 | |||
| 2815 | Ga0496111_0009201 | |||
| 2816 | Ga0496111_0061999 | |||
| 2817 | Ga0496111_0114914 | |||
| 2818 | Ga0496111_1140738 | |||
| 2819 | Ga0496112_0035998 | |||
| 2820 | Ga0496112_0089073 | |||
| 2821 | Ga0496112_0275470 | |||
| 2822 | Ga0496112_0291893 | |||
| 2823 | Ga0496112_0912800 | |||
| 2824 | Ga0496112_1029678 | |||
| 2825 | Ga0496112_1338460 | |||
| 2826 | Ga0496113_0008012 | |||
| 2827 | Ga0496113_0125164 | |||
| 2828 | Ga0496113_0211221 | |||
| 2829 | Ga0496113_0286936 | |||
| 2830 | Ga0496113_0300593 | |||
| 2831 | Ga0496114_1302464 | |||
| 2832 | Ga0496115_0003355 | |||
| 2833 | Ga0496115_0029999 | |||
| 2834 | Ga0496115_0130548 | |||
| 2835 | Ga0496115_0708547 | |||
| 2836 | Ga0496116_0015598 | |||
| 2837 | Ga0496116_0161594 | |||
| 2838 | Ga0496116_0394696 | |||
| 2839 | Ga0496117_0128935 | |||
| 2840 | Ga0496117_0512698 | |||
| 2841 | Ga0496118_0033503 | |||
| 2842 | Ga0496118_0090210 | |||
| 2843 | Ga0496118_0135239 | |||
| 2844 | Ga0496118_0415208 | |||
| 2845 | Ga0496118_0581071 | |||
| 2846 | Ga0496119_0008748 | |||
| 2847 | Ga0496119_0016625 | |||
| 2848 | Ga0496119_0035070 | |||
| 2849 | Ga0496119_0049830 | |||
| 2850 | Ga0496119_0090351 | |||
| 2851 | Ga0496119_0379680 | |||
| 2852 | Ga0496120_0012617 | |||
| 2853 | Ga0496120_0238343 | |||
| 2854 | Ga0496120_0246130 | |||
| 2855 | Ga0496120_0317461 | |||
| 2856 | Ga0496121_0024927 | |||
| 2857 | Ga0496121_0033653 | |||
| 2858 | Ga0496121_0048784 | |||
| 2859 | Ga0496121_0102047 | |||
| 2860 | Ga0496121_0172983 | |||
| 2861 | Ga0496121_0257936 | |||
| 2862 | Ga0496121_0461130 | |||
| 2863 | Ga0496121_0480331 | |||
| 2864 | Ga0496121_0632691 | |||
| 2865 | Ga0496121_0687822 | |||
| 2866 | Ga0496122_0040874 | |||
| 2867 | Ga0496122_0075619 | |||
| 2868 | Ga0496122_0079731 | |||
| 2869 | Ga0496123_0014393 | |||
| 2870 | Ga0496123_0017468 | |||
| 2871 | Ga0496123_0053073 | |||
| 2872 | Ga0496124_0080375 | |||
| 2873 | Ga0496124_0259342 | |||
| 2874 | Ga0496124_0437364 | |||
| 2875 | Ga0496124_0451706 | |||
| 2876 | Ga0496124_0617234 | |||
| 2877 | Ga0496124_0697112 | |||
| 2878 | Ga0496124_0726809 | |||
| 2879 | Ga0496125_0000262 | |||
| 2880 | Ga0496125_0017545 | |||
| 2881 | Ga0496125_0038460 | |||
| 2882 | Ga0496125_0067626 | |||
| 2883 | Ga0496125_0088917 | |||
| 2884 | Ga0496125_0198145 | |||
| 2885 | Ga0496125_0276647 | |||
| 2886 | Ga0496125_0391537 | |||
| 2887 | Ga0496125_0489596 | |||
| 2888 | Ga0496126_0018560 | |||
| 2889 | Ga0496126_0089962 | |||
| 2890 | Ga0496126_0125076 | |||
| 2891 | Ga0496126_0357788 | |||
| 2892 | Ga0496126_0389176 | |||
| 2893 | Ga0496126_0657462 | |||
| 2894 | Ga0496126_0916301 | |||
| 2895 | Ga0495682_0093547 | |||
| 2896 | Ga0501031_0608411 | |||
| 2897 | Ga0501031_0706409 | |||
| 2898 | Ga0501032_0037931 | |||
| 2899 | Ga0501032_0351675 | |||
| 2900 | Ga0501033_0006182 | |||
| 2901 | Ga0501033_0047501 | |||
| 2902 | Ga0501033_0226086 | |||
| 2903 | Ga0501034_0017794 | |||
| 2904 | Ga0501034_0126282 | |||
| 2905 | Ga0501034_0158857 | |||
| 2906 | Ga0501034_0172394 | |||
| 2907 | Ga0501034_0191807 | |||
| 2908 | Ga0501034_0326680 | |||
| 2909 | Ga0501034_0575975 | |||
| 2910 | Ga0501036_0418738 | |||
| 2911 | Ga0501036_1036953 | |||
| 2912 | Ga0501037_0046610 | |||
| 2913 | Ga0501037_0347326 | |||
| 2914 | Ga0501038_0064990 | |||
| 2915 | Ga0501038_1086840 | |||
| 2916 | Ga0501039_0203717 | |||
| 2917 | Ga0501039_0210449 | |||
| 2918 | Ga0501039_1163142 | |||
| 2919 | Ga0501040_0766934 | |||
| 2920 | Ga0501041_0147011 | |||
| 2921 | Ga0501043_0033643 | |||
| 2922 | Ga0501043_0806277 | |||
| 2923 | Ga0501043_1178112 | |||
| 2924 | Ga0501046_0207259 | |||
| 2925 | Ga0501046_0522620 | |||
| 2926 | Ga0501047_0015697 | |||
| 2927 | Ga0501047_0062863 | |||
| 2928 | Ga0501047_0080773 | |||
| 2929 | Ga0501047_0711345 | |||
| 2930 | Ga0501048_1246599 | |||
| 2931 | Ga0501048_1273986 | |||
| 2932 | Ga0501067_0084863 | |||
| 2933 | Ga0501067_0198979 | |||
| 2934 | Ga0501067_0694980 | |||
| 2935 | Ga0501068_0432187 | |||
| 2936 | Ga0501069_0093494 | |||
| 2937 | Ga0501070_0147792 | |||
| 2938 | Ga0501070_0334908 | |||
| 2939 | Ga0501071_0753297 | |||
| 2940 | Ga0501071_1051523 | |||
| 2941 | Ga0501072_0150759 | |||
| 2942 | Ga0501072_0379381 | |||
| 2943 | Ga0501073_0038796 | |||
| 2944 | Ga0501073_0072139 | |||
| 2945 | Ga0501073_0399628 | |||
| 2946 | Ga0501073_0752377 | |||
| 2947 | Ga0501073_0842418 | |||
| 2948 | Ga0501074_0129706 | |||
| 2949 | Ga0501074_0326520 | |||
| 2950 | Ga0501074_0414922 | |||
| 2951 | Ga0501075_0354297 | |||
| 2952 | Ga0501076_0324897 | |||
| 2953 | Ga0501076_0507557 | |||
| 2954 | Ga0501077_0522038 | |||
| 2955 | Ga0501079_0064820 | |||
| 2956 | Ga0501079_0128929 | |||
| 2957 | Ga0501079_0256692 | |||
| 2958 | Ga0501079_1316417 | |||
| 2959 | Ga0501080_0253256 | |||
| 2960 | Ga0501080_0513373 | |||
| 2961 | Ga0501080_1092382 | |||
| 2962 | Ga0501081_0445796 | |||
| 2963 | Ga0501081_1251393 | |||
| 2964 | Ga0501083_0350641 | |||
| 2965 | Ga0501083_0423385 | |||
| 2966 | Ga0501035_0019546 | |||
| 2967 | Ga0501035_0287033 | |||
| 2968 | Ga0501035_0898876 | |||
| 2969 | Ga0501035_1067954 | |||
| 2970 | Ga0501044_0054329 | |||
| 2971 | Ga0501044_0068818 | |||
| 2972 | Ga0501044_0123225 | |||
| 2973 | Ga0501044_0406082 | |||
| 2974 | Ga0501044_1221377 | |||
| 2975 | Ga0501045_0063745 | |||
| 2976 | Ga0501045_0730590 | |||
| 2977 | nmdc:mga03683_506215_c1 | |||
| 2978 | nmdc:mga03683_50712_c1 | |||
| 2979 | nmdc:mga00v17_71250_c1 | |||
| 2980 | nmdc:mga00v17_799101_c1 | |||
| 2981 | nmdc:mga00v17_874229_c1 | |||
| 2982 | nmdc:mga00v17_919217_c1 | |||
| 2983 | nmdc:mga0yw44_183525_c1 | |||
| 2984 | nmdc:mga0yw44_273936_c1 | |||
| 2985 | nmdc:mga0yw44_28850_c1 | |||
| 2986 | nmdc:mga0yw44_432640_c1 | |||
| 2987 | nmdc:mga0yw44_550759_c1 | |||
| 2988 | nmdc:mga0yw44_561619_c1 | |||
| 2989 | nmdc:mga0yw44_710704_c1 | |||
| 2990 | nmdc:mga0yw44_771345_c1 | |||
| 2991 | nmdc:mga0yw44_98343_c1 | |||
| 2992 | nmdc:mga0k408_190297_c2 | |||
| 2993 | nmdc:mga0k408_376202_c1 | |||
| 2994 | nmdc:mga06z11_129696_c1 | |||
| 2995 | nmdc:mga06z11_896547_c1 | |||
| 2996 | nmdc:mga04h51_294259_c1 | |||
| 2997 | nmdc:mga07m45_206420_c1 | |||
| 2998 | nmdc:mga07m45_490729_c1 | |||
| 2999 | nmdc:mga07m45_545750_c1 | |||
| 3000 | nmdc:mga07m45_88502_c1 | |||
| 3001 | nmdc:mga05p37_1483277_c1 | |||
| 3002 | nmdc:mga05p37_1695717_c1 | |||
| 3003 | nmdc:mga05p37_209022_c1 | |||
| 3004 | nmdc:mga05p37_580366_c1 | |||
| 3005 | nmdc:mga09592_329002_c1 | |||
| 3006 | nmdc:mga0qj67_1030041_c1 | |||
| 3007 | nmdc:mga0qj67_430678_c1 | |||
| 3008 | nmdc:mga0qj67_598672_c1 | |||
| 3009 | nmdc:mga06r32_242332_c1 | |||
| 3010 | nmdc:mga06r32_724741_c1 | |||
| 3011 | nmdc:mga08y16_111942_c1 | |||
| 3012 | nmdc:mga08y16_252440_c1 | |||
| 3013 | nmdc:mga08y16_729579_c1 | |||
| 3014 | nmdc:mga0n895_246685_c1 | |||
| 3015 | nmdc:mga0rr50_1168712_c1 | |||
| 3016 | nmdc:mga0rr50_1407421_c1 | |||
| 3017 | nmdc:mga0rr50_315375_c1 | |||
| 3018 | nmdc:mga0rr50_606100_c1 | |||
| 3019 | nmdc:mga08x19_281972_c1 | |||
| 3020 | nmdc:mga08x19_47478_c1 | |||
| 3021 | nmdc:mga0a205_1026640_c1 | |||
| 3022 | nmdc:mga0a205_91000_c1 | |||
| 3023 | nmdc:mga0sz30_35679_c2 | |||
| 3024 | nmdc:mga0sz30_54283_c1 | |||
| 3025 | Ga0500635_0287500 | |||
| 3026 | Ga0495595_0127311 | |||
| 3027 | Ga0495619_0569811 | |||
| 3028 | Ga0495619_0638249 | |||
| 3029 | Ga0495619_0877492 | |||
| 3030 | Ga0500578_0293019 | |||
| 3031 | Ga0500578_0492330 | |||
| 3032 | Ga0500578_0779076 | |||
| 3033 | Ga0500643_000168 | |||
| 3034 | Ga0500643_086271 | |||
| 3035 | Ga0500643_088126 | |||
| 3036 | Ga0500644_0211214 | |||
| 3037 | Ga0500646_0081418 | |||
| 3038 | Ga0500646_0155112 | |||
| 3039 | Ga0500647_0035653 | |||
| 3040 | Ga0500583_0116523 | |||
| 3041 | Ga0500583_0292692 | |||
| 3042 | Ga0500651_0013928 | |||
| 3043 | Ga0500651_0179768 | |||
| 3044 | Ga0500566_0003871 | |||
| 3045 | Ga0500566_0174286 | |||
| 3046 | Ga0500640_029966 | |||
| 3047 | Ga0500641_0003143 | |||
| 3048 | Ga0500641_0092726 | |||
| 3049 | Ga0500641_0137266 | |||
| 3050 | Ga0500641_0326009 | |||
| 3051 | Ga0500650_0113406 | |||
| 3052 | Ga0500654_101895 | |||
| 3053 | Ga0500554_120981 | |||
| 3054 | Ga0500555_003109 | |||
| 3055 | Ga0500555_004439 | |||
| 3056 | Ga0500555_044617 | |||
| 3057 | Ga0500555_049646 | |||
| 3058 | Ga0500555_139884 | |||
| 3059 | Ga0500556_0014866 | |||
| 3060 | Ga0500557_000032 | |||
| 3061 | Ga0500569_001709 | |||
| 3062 | Ga0500572_000255 | |||
| 3063 | Ga0500582_298091 | |||
| 3064 | Ga0500594_0124609 | |||
| 3065 | Ga0500595_007298 | |||
| 3066 | Ga0500595_050725 | |||
| 3067 | Ga0500597_243867 | |||
| 3068 | Ga0500607_066935 | |||
| 3069 | Ga0500614_204203 | |||
| 3070 | Ga0500628_049601 | |||
| 3071 | Ga0500642_0000191 | |||
| 3072 | Ga0500642_0000197 | |||
| 3073 | Ga0500642_0050847 | |||
| 3074 | Ga0500652_106472 | |||
| 3075 | Ga0500658_0060264 | |||
| 3076 | Ga0500658_0065575 | |||
| 3077 | Ga0500658_0077302 | |||
| 3078 | Ga0500658_0083924 | |||
| 3079 | Ga0500559_0000299 | |||
| 3080 | Ga0500559_0321324 | |||
| 3081 | Ga0500564_197766 | |||
| 3082 | Ga0500568_0006561 | |||
| 3083 | Ga0500568_0016564 | |||
| 3084 | Ga0500568_0046228 | |||
| 3085 | Ga0500568_0048140 | |||
| 3086 | Ga0500568_0054363 | |||
| 3087 | Ga0500573_0388452 | |||
| 3088 | Ga0500577_0014421 | |||
| 3089 | Ga0500577_0021338 | |||
| 3090 | Ga0500577_0445820 | |||
| 3091 | Ga0500588_0011981 | |||
| 3092 | Ga0500588_0035735 | |||
| 3093 | Ga0500588_0170826 | |||
| 3094 | Ga0500590_156609 | |||
| 3095 | Ga0500603_107636 | |||
| 3096 | Ga0500604_0002113 | |||
| 3097 | Ga0500604_0035106 | |||
| 3098 | Ga0500604_0035372 | |||
| 3099 | Ga0500604_0155353 | |||
| 3100 | Ga0500616_0000038 | |||
| 3101 | Ga0500616_0000702 | |||
| 3102 | Ga0500616_0002930 | |||
| 3103 | Ga0500616_0005830 | |||
| 3104 | Ga0500619_021892 | |||
| 3105 | Ga0500622_0012455 | |||
| 3106 | Ga0500624_020053 | |||
| 3107 | Ga0500624_057038 | |||
| 3108 | Ga0500627_0132726 | |||
| 3109 | Ga0500627_0136444 | |||
| 3110 | Ga0500634_0000041 | |||
| 3111 | Ga0500634_0260871 | |||
| 3112 | Ga0500638_029142 | |||
| 3113 | Ga0500639_033573 | |||
| 3114 | Ga0500636_0000659 | |||
| 3115 | Ga0500636_0058573 | |||
| 3116 | Ga0500636_0188920 | |||
| 3117 | Ga0500636_0392719 | |||
| 3118 | Ga0500636_0402115 | |||
| 3119 | Ga0500637_0555206 | |||
| 3120 | Ga0500649_062485 | |||
| 3121 | Ga0500567_218915 | |||
| 3122 | Ga0500576_033923 | |||
| 3123 | Ga0500625_144533 | |||
| 3124 | Ga0500645_059279 | |||
| 3125 | Ga0500609_000077 | |||
| 3126 | Ga0500609_000771 | |||
| 3127 | Ga0500609_001181 | |||
| 3128 | Ga0500656_039060 | |||
| 3129 | Ga0500552_010701 | |||
| 3130 | Ga0500596_036323 | |||
| 3131 | Ga0500601_000475 | |||
| 3132 | Ga0500601_037002 | |||
| 3133 | Ga0501084_0566671 | |||
| 3134 | Ga0501084_0581516 | |||
| 3135 | Ga0501082_0103543 | |||
| 3136 | Ga0501082_0585173 | |||
| 3137 | Ga0530510_0034341 | |||
| 3138 | 2507505971 | |||
| 3139 | 2508540160 | |||
| 3140 | 2508696234 | |||
| 3141 | 2509148161 | |||
| 3142 | 2511394577 | |||
| 3143 | 2512034028 | |||
| 3144 | 2513624879 | |||
| 3145 | 2513649125 | |||
| 3146 | 2513674984 | |||
| 3147 | 2513700191 | |||
| 3148 | 2513716140 | |||
| 3149 | 2513877199 | |||
| 3150 | 2513891561 | |||
| 3151 | 2513997531 | |||
| 3152 | 2514014568 | |||
| 3153 | 2515628486 | |||
| 3154 | 2516206031 | |||
| 3155 | 2517103157 | |||
| 3156 | 2524440790 | |||
| 3157 | 2528850737 | |||
| 3158 | 2535484045 | |||
| 3159 | 2561469046 | |||
| 3160 | 2585167596 | |||
| 3161 | 2585265826 | |||
| 3162 | 2585390016 | |||
| 3163 | 2585395219 | |||
| 3164 | 2599722270 | |||
| 3165 | 2600196029 | |||
| 3166 | 2617347854 | |||
| 3167 | 2617374776 | |||
| 3168 | 2643804429 | |||
| 3169 | 2644052088 | |||
| 3170 | 2644065199 | |||
| 3171 | 2644204881 | |||
| 3172 | 2644334068 | |||
| 3173 | 2644377609 | |||
| 3174 | 2644416871 | |||
| 3175 | 2644449911 | |||
| 3176 | 2644484831 | |||
| 3177 | 2644500611 | |||
| 3178 | 2644541665 | |||
| 3179 | 2644672734 | |||
| 3180 | 2644690046 | |||
| 3181 | 2715499331 | |||
| 3182 | 2738944232 | |||
| 3183 | 2745076031 | |||
| 3184 | 2753357282 | |||
| 3185 | 2765464287 | |||
| 3186 | 2776272581 | |||
| 3187 | 2776284522 | |||
| 3188 | 2776914339 | |||
| 3189 | 2792747035 | |||
| 3190 | 2793061495 | |||
| 3191 | 2805916201 | |||
| 3192 | 2818240516 | |||
| 3193 | 2824603674 | |||
| 3194 | 2824610740 | |||
| 3195 | 2824625154 | |||
| 3196 | 2824630964 | |||
| 3197 | 2824642283 | |||
| 3198 | 2824648301 | |||
| 3199 | 2824657942 | |||
| 3200 | 2824666878 | |||
| 3201 | 2824674055 | |||
| 3202 | 2824685801 | |||
| 3203 | 2824690721 | |||
| 3204 | 2824699942 | |||
| 3205 | 2824709137 | |||
| 3206 | 2824719481 | |||
| 3207 | 2824729095 | |||
| 3208 | 2824738525 | |||
| 3209 | 2824753123 | |||
| 3210 | 2824760313 | |||
| 3211 | 2824772343 | |||
| 3212 | 2824776372 | |||
| 3213 | 2837680680 | |||
| 3214 | 2838125038 | |||
| 3215 | 2839994211 | |||
| 3216 | 2840769398 | |||
| 3217 | 2841945777 | |||
| 3218 | 2841956876 | |||
| 3219 | 2841963998 | |||
| 3220 | 2841973564 | |||
| 3221 | 2841981958 | |||
| 3222 | 2841989452 | |||
| 3223 | 2842044437 | |||
| 3224 | 2842051574 | |||
| 3225 | 2842338241 | |||
| 3226 | 2842522227 | |||
| 3227 | 2842779699 | |||
| 3228 | 2842924495 | |||
| 3229 | 2844316310 | |||
| 3230 | 2847939389 | |||
| 3231 | 2847941146 | |||
| 3232 | 2849082134 | |||
| 3233 | 2854685508 | |||
| 3234 | 2854914136 | |||
| 3235 | 2855022280 | |||
| 3236 | 2857513388 | |||
| 3237 | 2857530216 | |||
| 3238 | 2874596293 | |||
| 3239 | 2874616506 | |||
| 3240 | 2874622524 | |||
| 3241 | 2874633432 | |||
| 3242 | 2874650280 | |||
| 3243 | 2876763689 | |||
| 3244 | 2876776758 | |||
| 3245 | 2876824548 | |||
| 3246 | 2879080895 | |||
| 3247 | 2879087062 | |||
| 3248 | 2879133740 | |||
| 3249 | 2879148242 | |||
| 3250 | 2881369551 | |||
| 3251 | 2881669732 | |||
| 3252 | 2885367802 | |||
| 3253 | 2885380850 | |||
| 3254 | 2885412951 | |||
| 3255 | 2888387193 | |||
| 3256 | 2888389885 | |||
| 3257 | 2888421225 | |||
| 3258 | 2891051061 | |||
| 3259 | 2894655418 | |||
| 3260 | 2903728355 | |||
| 3261 | 2903774766 | |||
| 3262 | 2904579121 | |||
| 3263 | 2904671469 | |||
| 3264 | 2904695100 | |||
| 3265 | 2904719765 | |||
| 3266 | 2906606495 | |||
| 3267 | 2906631387 | |||
| 3268 | 2906646734 | |||
| 3269 | 2908756886 | |||
| 3270 | 2908777257 | |||
| 3271 | 2913308852 | |||
| 3272 | 2919122054 | |||
| 3273 | 2920825669 | |||
| 3274 | 2922377369 | |||
| 3275 | 2922389419 | |||
| 3276 | 2922398461 | |||
| 3277 | 2929141181 | |||
| 3278 | 2929204358 | |||
| 3279 | 2929622162 | |||
| 3280 | 2929630191 | |||
| 3281 | 2932787881 | |||
| 3282 | 2932795999 | |||
| 3283 | 2932807576 | |||
| 3284 | 2932835091 | |||
| 3285 | 2933584223 | |||
| 3286 | 2935614396 | |||
| 3287 | 2935620468 | |||
| 3288 | 2935640791 | |||
| 3289 | 2935649425 | |||
| 3290 | 2935657803 | |||
| 3291 | 2935670294 | |||
| 3292 | 2935679724 | |||
| 3293 | 2935687293 | |||
| 3294 | 2935696736 | |||
| 3295 | 2935709172 | |||
| 3296 | 2935718752 | |||
| 3297 | 2935728404 | |||
| 3298 | 2935736999 | |||
| 3299 | 2935745998 | |||
| 3300 | 2935753259 | |||
| 3301 | 2935770261 | |||
| 3302 | 2935777711 | |||
| 3303 | 2935786686 | |||
| 3304 | 2935794740 | |||
| 3305 | 2935809030 | |||
| 3306 | 2935813790 | |||
| 3307 | 2935826614 | |||
| 3308 | 2935832298 | |||
| 3309 | 2935844003 | |||
| 3310 | 2935851092 | |||
| 3311 | 2935862794 | |||
| 3312 | 2935864537 | |||
| 3313 | 2935875111 | |||
| 3314 | 2935887268 | |||
| 3315 | 2935913142 | |||
| 3316 | 2935922564 | |||
| 3317 | 2935930933 | |||
| 3318 | 2935939733 | |||
| 3319 | 2935946682 | |||
| 3320 | 2935956117 | |||
| 3321 | 2935965022 | |||
| 3322 | 2935972910 | |||
| 3323 | 2935978175 | |||
| 3324 | 2935985701 | |||
| 3325 | 2935999271 | |||
| 3326 | 2936005826 | |||
| 3327 | 2936012022 | |||
| 3328 | 2936020897 | |||
| 3329 | 2936029315 | |||
| 3330 | 2936039346 | |||
| 3331 | 2936048361 | |||
| 3332 | 2936056528 | |||
| 3333 | 2940559172 | |||
| 3334 | 2941534540 | |||
| 3335 | 2941541866 | |||
| 3336 | 2970492430 | |||
| 3337 | 3000018829 | |||
| 3338 | 3002142610 | |||
| 3339 | 3005491119 | |||
| 3340 | 3005510960 | |||
| 3341 | 3005592126 | |||
| 3342 | 3005595923 | |||
| 3343 | 3005711859 | |||
| 3344 | 3005719116 | |||
| 3345 | 8006929759 | |||
| 3346 | 8016517212 | |||
| 3347 | 8016527031 | |||
| 3348 | 8016532110 | |||
| 3349 | 8016545322 | |||
| 3350 | 8016556767 | |||
| 3351 | 8016565122 | |||
| 3352 | 8016570405 | |||
| 3353 | 8016582942 | |||
| 3354 | 8016585360 | |||
| 3355 | 8016602769 | |||
| 3356 | 8016605629 | |||
| 3357 | 8016617544 | |||
| 3358 | 8016624027 | |||
| 3359 | 8016634837 | |||
| 3360 | 8017059378 | |||
| 3361 | 8019531931 | |||
| 3362 | 8019539606 | |||
| 3363 | 8019551051 | |||
| 3364 | 8019560236 | |||
| 3365 | 8019570336 | |||
| 3366 | 8019576241 | |||
| 3367 | 8019594118 | |||
| 3368 | 8019607445 | |||
| 3369 | 8019611065 | |||
| 3370 | 8019621914 | |||
| 3371 | 8019639204 | |||
| 3372 | 8019651355 | |||
| 3373 | 8019668217 | |||
| 3374 | 8019677676 | |||
| 3375 | 8019687269 | |||
| 3376 | 8019693248 | |||
| 3377 | 8055432250 | |||
| 3378 | 8055743588 | |||
| 3379 | 8055910676 | |||
| 3380 | 8056678125 | |||
| 3381 | 8056681662 | |||
| 3382 | 8056974104 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6zo0-assembly1.cif.gz_AAA | 2.23 a resolution 3,4-dimethylcatechol (3,4-dimethylbenzene-1,2-diol) inhibited sporosarcina pasteurii urease | 0.9784 | 2 | 100 |
| 4fur-assembly1.cif.gz_A | crystal structure of urease subunit gamma 2 from brucella melitensis biovar abortus 2308 | 0.9782 | 1 | 100 |
| 2fvh-assembly1.cif.gz_C | crystal structure of rv1848, a urease gamma subunit urea (urea amidohydrolase), from mycobacterium tuberculosis | 0.9773 | 2 | 100 |
| 2ubp-assembly1.cif.gz_A | structure of native urease from bacillus pasteurii | 0.9746 | 1 | 100 |
| 1a5k-assembly1.cif.gz_A | k217e variant of klebsiella aerogenes urease | 0.9707 | 1 | 100 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1a5kA00 | Alpha Beta;2-Layer Sandwich;Urease; subunit A;Urease, gamma-like subunit | 0.9707 | 1 | 100 | 3.30.280.10 |
| 4gy7A01 | Alpha Beta;2-Layer Sandwich;Urease; subunit A;Urease, gamma-like subunit | 0.9613 | 4 | 100 | 3.30.280.10 |
| 4gy7A01 | Alpha Beta;2-Layer Sandwich;Urease; subunit A;Urease, gamma-like subunit | 0.9242 | 4 | 100 | 3.30.280.10 |
| 4x28D02 | Mainly Beta;Beta Barrel;Butyryl-CoA Dehydrogenase, subunit A; domain 2;Butyryl-CoA Dehydrogenase, subunit A, domain 2 | 0.7032 | 74 | 96 | 2.40.110.10 |
| af_Q04457_5_543_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.6899 | 78 | 98 | 3.40.50.1820 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-T0ZPP4-F1-model_v4 | Urease, gamma subunit region domain protein (EC 3.5.1.5) | 1.006 | 40 | 100 |
GO:0009039
GO:0016151 GO:0043419 |
| AF-A0A7X6IQS9-F1-model_v4 | deleted | 1.005 | 40 | 100 |
|
| AF-A0A848Y6D5-F1-model_v4 | Urease subunit gamma (EC 3.5.1.5) | 1.003 | 12 | 100 |
GO:0005737
GO:0009039 GO:0016151 GO:0043419 |
| AF-A0A6M0C757-F1-model_v4 | Urease subunit gamma (EC 3.5.1.5) | 1.003 | 29 | 100 |
GO:0005737
GO:0009039 GO:0016151 GO:0043419 |
| AF-A0A2S9GPV6-F1-model_v4 | Urease subunit gamma (EC 3.5.1.5) | 1.003 | 22 | 93 |
GO:0005737
GO:0009039 GO:0016151 GO:0043419 |