metagRoot

F495359

General Info

Members	Datasets	Scaffolds	Average Seq Length
1692	584	3384	404

Family's Representative Sequence

Representative Sequence	3300037471\|Ga0395905_0172995\|Ga0395905_0172995_583_1974
Length	463
Sequence	MVMPNWLDLSVHRVYEVRCLCFGEAACRIFSDAPCLSKKCTDKVWRFWAWGSPWSRALSTPLIITGARVVVTCPGRNFVTLKIETNQGLCGLGDATLNGRELSVVSYLEDHVVPCLIGRDAHRIEDTWQFLYRGAYWRRGPVTMSAIAAVDMALWDIKAKAAGLPLYQLLGGACRSGVRVYGHANGETIDDTIAEALRYKEMGYTAIRLQSGVPGLASTYGVSKDKMFYEPADADLPTENVWSTPKYMNSVPKLFEKAREVLGWDVDLLHDVHHRLTPIEAGRVGKDLEPYRLFWLEDAVPAENQENFRLIRSHTTTPLAVGEIFSSIWDCKDLIQNQLIDYIRSTVVHAGGITHLRKIAAFADIYNVRTGCHGATDLSPVCMAAALHFDMSIPNFGLQEYMRHTAETDAVFPHAYSFDRGSLHPGEAPGLGVDLDESLAAKYPYQRAYLPVNRLEDGTMYNW

Samples

	Sample ID	Description	Type	Environment
1	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
2	2162886007	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1	Metagenome	Rhizosphere
3	3300000041	Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere	Metagenome	Rhizosphere
4	3300001990	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3	Metagenome	Rhizosphere
5	3300002704	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB	Metagenome	Unclassified
6	3300002705	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS	Metagenome	Unclassified
7	3300002737	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA	Metagenome	Endosphere
8	3300002738	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA	Metagenome	Unclassified
9	3300002741	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL	Metagenome	Unclassified
10	3300002773	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS	Metagenome	Endosphere
11	3300002987	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB	Metagenome	Endosphere
12	3300003187	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB	Metagenome	Endosphere
13	3300003203	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
14	3300003214	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL	Metagenome	Endosphere
15	3300003215	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF	Metagenome	Endosphere
16	3300003322	Sugarcane root Sample L2	Metagenome	Unclassified
17	3300003323	Sugarcane root Sample H1	Metagenome	Unclassified
18	3300003752	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2	Metagenome	Endosphere
19	3300003758	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2	Metagenome	Endosphere
20	3300003761	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2	Metagenome	Endosphere
21	3300003762	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2	Metagenome	Endosphere
22	3300003771	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2	Metagenome	Endosphere
23	3300003773	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2	Metagenome	Endosphere
24	3300003775	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2	Metagenome	Endosphere
25	3300003781	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2	Metagenome	Endosphere
26	3300003784	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2	Metagenome	Endosphere
27	3300003790	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2	Metagenome	Endosphere
28	3300003791	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2	Metagenome	Endosphere
29	3300003792	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2	Metagenome	Endosphere
30	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
31	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
32	3300005288	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
33	3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3)	Metagenome	Rhizosphere
34	3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
35	3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2)	Metagenome	Rhizosphere
36	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
37	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
38	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
39	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
40	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
41	3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Metagenome	Rhizosphere
42	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
43	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
44	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
45	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
46	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
47	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
48	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
49	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
50	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
51	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
52	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
53	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
54	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
55	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
56	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
57	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
58	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
59	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
60	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
61	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
62	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
63	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
64	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
65	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
66	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
67	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
68	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
69	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
70	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
71	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
72	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
73	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
74	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
75	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
76	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
77	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
78	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
79	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
80	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
81	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
82	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
83	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
84	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
85	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
86	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
87	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
88	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
89	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
90	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
91	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
92	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
93	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
94	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
95	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
96	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
97	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
98	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
99	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
100	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
101	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
102	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
103	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
104	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
105	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
106	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
107	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
108	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
109	3300006058	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Metagenome	Rhizosphere
110	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
111	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
112	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
113	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
114	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
115	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
116	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
117	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
118	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
119	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
120	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
121	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
122	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
123	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
124	3300006946	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG	Metagenome	Nodule
125	3300006948	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15	Metagenome	Nodule
126	3300007265	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1	Metagenome	Rhizosphere
127	3300007788	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2	Metagenome	Rhizosphere
128	3300009036	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG	Metagenome	Rhizosphere
129	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
130	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
131	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
132	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
133	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
134	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
135	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
136	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
137	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
138	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
139	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
140	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
141	3300010159	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3	Metagenome	Rhizosphere
142	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
143	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
144	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
145	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
146	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
147	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
148	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
149	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
150	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
151	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
152	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
153	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
154	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
155	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
156	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
157	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
158	3300015261	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG	Metagenome	Rhizosphere
159	3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Metagenome	Rhizosphere
160	3300015684	Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02	Metagenome	Unclassified
161	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
162	3300021361	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2	Metagenome	Rhizosphere
163	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
164	3300025206	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2)	Metagenome	Unclassified
165	3300025229	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
166	3300025231	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
167	3300025233	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
168	3300025242	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
169	3300025245	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3)	Metagenome	Endosphere
170	3300025246	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2)	Metagenome	Unclassified
171	3300025250	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2)	Metagenome	Unclassified
172	3300025254	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
173	3300025256	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2)	Metagenome	Unclassified
174	3300025258	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3)	Metagenome	Endosphere
175	3300025261	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2)	Metagenome	Endosphere
176	3300025263	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3)	Metagenome	Endosphere
177	3300025272	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
178	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
179	3300025284	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
180	3300025290	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2)	Metagenome	Rhizosphere
181	3300025291	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3)	Metagenome	Endosphere
182	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
183	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
184	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
185	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
186	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
187	3300025299	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3)	Metagenome	Endosphere
188	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
189	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
190	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
191	3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
192	3300025728	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
193	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
194	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
195	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
196	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
197	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
198	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
199	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
200	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
201	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
202	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
203	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
204	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
205	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
206	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
207	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
208	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
209	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
210	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
211	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
212	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
213	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
214	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
215	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
216	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
217	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
218	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
219	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
220	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
221	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
222	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
223	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
224	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
225	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
226	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
227	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
228	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
229	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
230	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
231	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
232	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
233	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
234	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
235	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
236	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
237	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
238	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
239	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
240	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
241	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
242	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
243	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
244	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
245	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
246	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
247	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
248	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
249	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
250	3300027111	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2)	Metagenome	Nodule
251	3300027312	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2)	Metagenome	Rhizosphere
252	3300027665	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
253	3300027666	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2)	Metagenome	Nodule
254	3300027876	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
255	3300028016	Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1	Metagenome	Rhizosphere
256	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
257	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
258	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
259	3300028786	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM	Metagenome	Unclassified
260	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
261	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
262	3300029957	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG	Metagenome	Rhizosphere
263	3300030500	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3)	Metagenome	Rhizosphere
264	3300030521	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM	Metagenome	Unclassified
265	3300030522	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM	Metagenome	Unclassified
266	3300030733	Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2	Metagenome	Rhizosphere
267	3300031235	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG	Metagenome	Rhizosphere
268	3300031238	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG	Metagenome	Rhizosphere
269	3300031240	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG	Metagenome	Rhizosphere
270	3300031241	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG	Metagenome	Rhizosphere
271	3300031247	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG	Metagenome	Rhizosphere
272	3300031249	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG	Metagenome	Rhizosphere
273	3300031250	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG	Metagenome	Rhizosphere
274	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
275	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
276	3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Metagenome	Unclassified
277	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
278	3300031595	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG	Metagenome	Rhizosphere
279	3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Metagenome	Unclassified
280	3300031649	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM	Metagenome	Unclassified
281	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
282	3300031727	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5	Metagenome	Rhizosphere
283	3300031728	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC	Metagenome	Rhizosphere
284	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
285	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
286	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
287	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
288	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
289	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
290	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
291	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
292	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
293	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
294	3300033179	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM	Metagenome	Unclassified
295	3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Metagenome	Unclassified
296	3300035089	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2	Metagenome	Rhizosphere
297	3300035113	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12	Metagenome	Rhizosphere
298	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
299	3300035398	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1	Metagenome	Rhizosphere
300	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
301	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
302	3300036712	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA	Metagenome	Rhizosphere
303	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
304	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
305	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
306	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
307	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
308	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
309	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
310	3300039450	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2	Metagenome	Unclassified
311	3300041404	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272	Metagenome	Rhizosphere
312	3300041410	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596	Metagenome	Rhizosphere
313	3300041413	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839	Metagenome	Rhizosphere
314	3300041460	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG	Metagenome	Rhizoplane
315	3300041498	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG	Metagenome	Unclassified
316	3300042002	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616	Metagenome	Rhizosphere
317	3300042004	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619	Metagenome	Rhizosphere
318	3300042005	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216	Metagenome	Rhizosphere
319	3300042007	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290	Metagenome	Rhizosphere
320	3300042012	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213	Metagenome	Rhizosphere
321	3300042015	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287	Metagenome	Rhizosphere
322	3300042122	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496	Metagenome	Rhizosphere
323	3300042156	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593	Metagenome	Rhizosphere
324	3300042157	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210	Metagenome	Rhizosphere
325	3300042185	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592	Metagenome	Rhizosphere
326	3300042436	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520	Metagenome	Rhizosphere
327	3300042438	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533	Metagenome	Rhizosphere
328	3300044656	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R	Metagenome	Rhizosphere
329	3300044659	Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E	Metagenome	Unclassified
330	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
331	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
332	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
333	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
334	3300044719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R	Metagenome	Rhizosphere
335	3300044735	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R	Metagenome	Rhizosphere
336	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
337	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
338	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
339	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
340	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
341	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
342	3300046453	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere	Metagenome	Rhizosphere
343	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
344	3300046457	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere	Metagenome	Rhizosphere
345	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
346	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
347	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
348	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
349	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
350	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
351	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
352	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
353	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
354	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
355	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
356	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
357	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
358	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
359	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
360	3300046520	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere	Metagenome	Rhizosphere
361	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
362	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
363	3300046525	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere	Metagenome	Rhizosphere
364	3300046528	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere	Metagenome	Rhizosphere
365	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
366	3300046537	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere	Metagenome	Rhizosphere
367	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
368	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
369	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
370	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
371	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
372	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
373	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
374	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
375	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
376	3300046794	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere	Metagenome	Rhizosphere
377	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
378	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
379	3300047443	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere	Metagenome	Rhizosphere
380	3300047446	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere	Metagenome	Rhizosphere
381	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
382	3300047470	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere	Metagenome	Rhizosphere
383	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
384	3300048090	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere	Metagenome	Rhizosphere
385	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
386	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
387	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
388	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
389	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
390	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
391	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
392	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
393	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
394	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
395	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
396	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
397	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
398	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
399	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
400	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
401	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
402	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
403	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
404	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
405	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
406	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
407	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
408	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
409	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
410	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
411	3300049460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere	Metagenome	Rhizosphere
412	3300049523	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control	Metagenome	Rhizosphere
413	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
414	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
415	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
416	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
417	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
418	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
419	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
420	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
421	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
422	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
423	3300049664	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought	Metagenome	Rhizosphere
424	3300049671	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought	Metagenome	Rhizosphere
425	3300049679	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought	Metagenome	Rhizosphere
426	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
427	3300049763	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control	Metagenome	Rhizosphere
428	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
429	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
430	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
431	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
432	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
433	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
434	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
435	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
436	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
437	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
438	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
439	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
440	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
441	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
442	3300053080	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere	Metagenome	Endosphere
443	3300053086	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere	Metagenome	Endosphere
444	3300053087	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere	Metagenome	Endosphere
445	3300053088	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere	Metagenome	Endosphere
446	3300053092	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere	Metagenome	Endosphere
447	3300053093	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere	Metagenome	Endosphere
448	3300053096	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere	Metagenome	Endosphere
449	3300053098	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere	Metagenome	Endosphere
450	3300053104	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere	Metagenome	Endosphere
451	3300053108	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere	Metagenome	Endosphere
452	3300053111	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere	Metagenome	Endosphere
453	3300053117	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere	Metagenome	Endosphere
454	3300053118	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere	Metagenome	Endosphere
455	3300053119	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere	Metagenome	Endosphere
456	3300053121	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere	Metagenome	Endosphere
457	3300053122	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere	Metagenome	Endosphere
458	3300053123	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere	Metagenome	Endosphere
459	3300053125	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere	Metagenome	Endosphere
460	3300053130	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere	Metagenome	Endosphere
461	3300053136	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere	Metagenome	Endosphere
462	3300053138	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere	Metagenome	Endosphere
463	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
464	3300053140	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere	Metagenome	Endosphere
465	3300053142	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere	Metagenome	Endosphere
466	3300053146	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere	Metagenome	Endosphere
467	3300053151	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere	Metagenome	Endosphere
468	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
469	3300053156	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere	Metagenome	Endosphere
470	3300053158	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere	Metagenome	Endosphere
471	3300053177	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere	Metagenome	Endosphere
472	3300053178	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere	Metagenome	Endosphere
473	3300053730	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere	Metagenome	Endosphere
474	3300053731	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere	Metagenome	Endosphere
475	3300055283	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere	Metagenome	Endosphere
476	3300059423	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
477	3300059424	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
478	3300059426	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
479	3300059493	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
480	3300059510	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
481	3300059623	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
482	3300059645	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
483	3300059652	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
484	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
485	3300061719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1	Metagenome	Rhizosphere
486	2510917020	Caulobacter sp. AP07	Isolate	Rhizosphere
487	2511231002	Polaromonas sp. CF318	Isolate	Rhizosphere
488	2511231003	Herbaspirillum sp. CF444	Isolate	Rhizosphere
489	2513020051	Variovorax sp. CF313	Isolate	Rhizosphere
490	2515154123	Trinickia symbiotica JPY347	Isolate	Nodule
491	2524023250	Niveispirillum irakense DSM 11586	Isolate	Unclassified
492	2547132374	Acidovorax radicis N35	Isolate	Unclassified
493	2548876994	Herbaspirillum lusitanum P6-12	Isolate	Nodule
494	2582581279	Caulobacter henricii OK261	Isolate	Rhizosphere
495	2582581280	Caulobacter henricii CF287	Isolate	Rhizosphere
496	2582581293	Caulobacter henricii YR570	Isolate	Rhizosphere
497	2582581315	Agrobacterium rhizogenes YR147	Isolate	Rhizosphere
498	2582581316	Agrobacterium rhizogenes OK036	Isolate	Rhizosphere
499	2599185214	Variovorax sp. NFACC26	Isolate	Rhizoplane
500	2599185226	Variovorax sp. NFACC27	Isolate	Rhizoplane
501	2599185227	Variovorax sp. NFACC28	Isolate	Rhizoplane
502	2599185229	Variovorax sp. NFACC29	Isolate	Endosphere
503	2599185292	Achromobacter sp. NFACC18-2	Isolate	Rhizoplane
504	2615840698	Rhizobium multihospitium HAMBI 2975	Isolate	Nodule
505	2643221541	Sphingomonas sp. Root50	Isolate	Unclassified
506	2643221545	Caulobacter sp. Root1455	Isolate	Unclassified
507	2643221552	Caulobacter sp. Root1472	Isolate	Unclassified
508	2643221563	Sphingopyxis sp. Root154	Isolate	Unclassified
509	2643221568	Rhizobium sp. Root564	Isolate	Unclassified
510	2643221569	Achromobacter sp. Root565	Isolate	Unclassified
511	2643221583	Caulobacter sp. Root655	Isolate	Unclassified
512	2643221584	Caulobacter sp. Root656	Isolate	Unclassified
513	2643221588	Altererythrobacter sp. Root672	Isolate	Unclassified
514	2643221594	Achromobacter sp. Root170	Isolate	Unclassified
515	2643221606	Sphingomonas sp. Root720	Isolate	Unclassified
516	2643221608	Sphingopyxis sp. Root214	Isolate	Unclassified
517	2643221621	Achromobacter sp. Root83	Isolate	Unclassified
518	2643221622	Sphingomonas sp. Root241	Isolate	Unclassified
519	2643221628	Variovorax sp. Root318D1	Isolate	Unclassified
520	2643221658	Variovorax sp. Root411	Isolate	Unclassified
521	2643221671	Sphingomonas sp. Root1294	Isolate	Unclassified
522	2643221672	Variovorax sp. Root434	Isolate	Unclassified
523	2643221691	Caulobacter sp. Root487D2Y	Isolate	Unclassified
524	2643221717	Acidovorax sp. Root267	Isolate	Unclassified
525	2738541275	Novosphingobium sp. GV027	Isolate	Unclassified
526	2738541276	Cellvibrio sp. YR554	Isolate	Unclassified
527	2738541301	Novosphingobium sp. GV079	Isolate	Unclassified
528	2738541304	Novosphingobium sp. GV061	Isolate	Unclassified
529	2738541307	Variovorax sp. GV008	Isolate	Unclassified
530	2738543022	Novosphingobium sp. GV055	Isolate	Unclassified
531	2738543033	Novosphingobium sp. GV064	Isolate	Unclassified
532	2739367664	Novosphingobium sp. GV002	Isolate	Unclassified
533	2739367700	Dyella sp. YR388	Isolate	Unclassified
534	2739367756	Asticcacaulis sp. CF398	Isolate	Unclassified
535	2739367865	Novosphingobium sp. GV013	Isolate	Unclassified
536	2791355048	Caulobacter flavus CGMCC1 15093	Isolate	Rhizosphere
537	2808606395	Achromobacter sp. SLBN-14	Isolate	Unclassified
538	2808606401	Sphingobium sp. AEW010	Isolate	Rhizosphere
539	2808606404	Sphingobium sp. AEW013	Isolate	Rhizosphere
540	2808606405	Sphingobium sp. AEW001	Isolate	Rhizosphere
541	2816332139	Pseudonocardia kunmingensis DSM 45301	Isolate	Unclassified
542	2818991435	Caulobacter henricii 536	Isolate	Unclassified
543	2818991445	Herbaspirillum hiltneri 3195	Isolate	Unclassified
544	2818991454	Caulobacter rhizosphaerae 3260	Isolate	Rhizosphere
545	2818991461	Neorhizobium alkalisoli 1225	Isolate	Unclassified
546	2818991466	Sphingomonas trueperi 1152a	Isolate	Unclassified
547	2842482326	Rhizobium lusitanum SEMIA 4060	Isolate	Nodule
548	2843744320	Caulobacter flavus RHGG3	Isolate	Unclassified
549	2848297114	Croceibacterium ferulae EGI 63111	Isolate	Unclassified
550	2849560528	Caulobacter zeae 410	Isolate	Unclassified
551	2849573788	Caulobacter endophyticus 774	Isolate	Unclassified
552	2851153111	Caulobacter radicis 736	Isolate	Unclassified
553	2857504554	Caulobacter sp. R-72291	Isolate	Unclassified
554	2857537821	Achromobacter sp. R-71975	Isolate	Unclassified
555	2857576091	Pigmentiphaga sp. R-72090	Isolate	Unclassified
556	2858950400	Achromobacter sp. K91	Isolate	Unclassified
557	2879163058	Sphingomonas pokkalii L3B27	Isolate	Rhizosphere
558	2880518877	Sphingobium sp. JAI105	Isolate	Rhizosphere
559	2884811622	Herbaspirillum sp. 3C11	Isolate	Unclassified
560	2884836552	Herbaspirillum sp. 3R-11	Isolate	Unclassified
561	2884852848	Herbaspirillum sp. 3R11	Isolate	Unclassified
562	2884960567	Caulobacter sp. 602-1	Isolate	Rhizosphere
563	2885198086	Variovorax sp. 679	Isolate	Unclassified
564	2885211737	Variovorax sp. 553	Isolate	Unclassified
565	2896154374	Herbaspirillum sp. 3R-3a1	Isolate	Nodule
566	2896184354	Aurantiacibacter suaedae GH3-15	Isolate	Rhizosphere
567	2896253425	Aurantiacibacter rhizosphaerae GH3-10	Isolate	Rhizosphere
568	2898329390	Caulobacter sp. 602-2	Isolate	Rhizosphere
569	2919138771	Novosphingobium sp. 1748	Isolate	Rhizosphere
570	2919166419	Agrobacterium cavarae 2074	Isolate	Unclassified
571	2919704043	Hydrogenophaga palleronii 4249	Isolate	Unclassified
572	2919709256	Sphingobium xenophagum 4256	Isolate	Unclassified
573	2928070936	Variovorax gossypii 1167	Isolate	Unclassified
574	2928100450	Novosphingobium sp. 1529	Isolate	Rhizosphere
575	2928959182	Novosphingobium capsulatum 1057	Isolate	Unclassified
576	2928963466	Dyella japonica 1073	Isolate	Unclassified
577	2928968154	Sphingomonas trueperi 1075	Isolate	Unclassified
578	2939582691	Mycolicibacterium sp. 624	Isolate	Rhizosphere
579	2941479691
580	2945972063	Variovorax paradoxus W2I8	Isolate	Rhizosphere
581	2946787523	Sphingomonas faeni W4I17	Isolate	Rhizosphere
582	2990044586	Streptomyces sedi JCM 16909	Isolate	Unclassified
583	8005682033	Rhizobium dioscoreae S-93	Isolate	Unclassified
584	8054302542	Novosphingobium kaempferiae Sx8-5	Isolate	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	92.85
Metatranscriptomes	0.3
Isolates	6.86

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	15.37
Nodule	0.59
Rhizoplane	2.42
Rhizosphere	71.1
Stem	0
Stem Tuber	0
Unclassified	0

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	Ga0395905_0172995	3300037471	Bacteria	2028
2	SwRhRL2b_contig_1366519	2162886007	Bacteria	7991
3	ARcpr5oldR_c000853	3300000041	Bacteria	3417
4	JGI24737J22298_10002493	3300001990	Bacteria	6545
5	JGI24737J22298_10002934	3300001990	Bacteria	6043
6	JGI24737J22298_10024862	3300001990	Bacteria	1895
7	JGI25155J39150_1000492	3300002704	Bacteria	9606
8	JGI25155J39150_1000666	3300002704	Bacteria	6580
9	JGI25156J39149_1000469	3300002705	Bacteria	24290
10	JGI25156J39149_1009526	3300002705	Bacteria	2351
11	JGI25162J39368_1001063	3300002737	Bacteria	16796
12	JGI25154J39366_1000074	3300002738	Bacteria	92481
13	JGI25154J39366_1001030	3300002738	Bacteria	11164
14	JGI25157J39369_1000746	3300002741	Bacteria	17162
15	JGI25152J39213_1000149	3300002773	Bacteria	47831
16	JGI25159J45721_1009405	3300002987	Bacteria	2581
17	JGI25151J46595_10000460	3300003187	Bacteria	39097
18	JGI25151J46595_10003628	3300003187	Bacteria	8431
19	JGI25151J46595_10017507	3300003187	Bacteria	3103
20	JGI25406J46586_10005583	3300003203	Bacteria	5826
21	JGI25165J46597_1000017	3300003214	Bacteria	377013
22	JGI25153J46596_10000028	3300003215	Bacteria	209842
23	JGI25153J46596_10000228	3300003215	Bacteria	47831
24	JGI25153J46596_10000443	3300003215	Bacteria	26641
25	JGI25153J46596_10003274	3300003215	Bacteria	9099
26	rootL2_10034900	3300003322	Bacteria	14171
27	rootH1_10037188	3300003323	Bacteria	7193
28	rootH1_10063010	3300003323	Bacteria	2876
29	Ga0055539_1001708	3300003752	Bacteria	3874
30	Ga0055532_1000271	3300003758	Bacteria	33888
31	Ga0055535_1007540	3300003761	Bacteria	2066
32	Ga0055542_1000220	3300003762	Bacteria	69389
33	Ga0055526_1001349	3300003771	Bacteria	17575
34	Ga0055526_1002751	3300003771	Bacteria	11669
35	Ga0055526_1024675	3300003771	Bacteria	1957
36	Ga0055537_1000181	3300003773	Bacteria	46855
37	Ga0055537_1000190	3300003773	Bacteria	45820
38	Ga0055537_1000258	3300003773	Bacteria	38689
39	Ga0055537_1001843	3300003773	Bacteria	7650
40	Ga0055537_1003196	3300003773	Bacteria	5118
41	Ga0055537_1006839	3300003773	Bacteria	2834
42	Ga0055524_1001862	3300003775	Bacteria	11551
43	Ga0055524_1001893	3300003775	Bacteria	11352
44	Ga0055524_1003472	3300003775	Bacteria	7645
45	Ga0055524_1006380	3300003775	Bacteria	5117
46	Ga0055536_1000380	3300003781	Bacteria	32625
47	Ga0055536_1005980	3300003781	Bacteria	5794
48	Ga0055536_1012626	3300003781	Bacteria	3117
49	Ga0055534_1000244	3300003784	Bacteria	38722
50	Ga0055534_1001636	3300003784	Bacteria	8653
51	Ga0055534_1002600	3300003784	Bacteria	6156
52	Ga0055528_1000244	3300003790	Bacteria	45820
53	Ga0055528_1002980	3300003790	Bacteria	8771
54	Ga0055528_1010588	3300003790	Bacteria	3739
55	Ga0055528_1017916	3300003790	Bacteria	2428
56	Ga0055530_10000623	3300003791	Bacteria	30661
57	Ga0055530_10001386	3300003791	Bacteria	17943
58	Ga0055530_10005653	3300003791	Bacteria	5856
59	Ga0055530_10019037	3300003791	Bacteria	2093
60	Ga0055540_1000365	3300003792	Bacteria	38078
61	Ga0055540_1001751	3300003792	Bacteria	12424
62	Ga0055540_1003214	3300003792	Bacteria	8018
63	Ga0055531_10000454	3300003794	Bacteria	38078
64	Ga0055531_10000619	3300003794	Bacteria	30659
65	Ga0055531_10000761	3300003794	Bacteria	27006
66	Ga0055531_10001499	3300003794	Bacteria	17146
67	Ga0055531_10001677	3300003794	Bacteria	15945
68	Ga0055531_10001884	3300003794	Bacteria	14690
69	Ga0055531_10003581	3300003794	Bacteria	9840
70	Ga0055531_10006449	3300003794	Bacteria	6662
71	Ga0055531_10019272	3300003794	Bacteria	2770
72	Ga0065165_1000388	3300005262	Bacteria	71380
73	Ga0065165_1000459	3300005262	Bacteria	63870
74	Ga0065165_1000624	3300005262	Bacteria	51434
75	Ga0065165_1001720	3300005262	Bacteria	21926
76	Ga0065165_1003670	3300005262	Bacteria	10463
77	Ga0065165_1007078	3300005262	Bacteria	5635
78	Ga0065165_1020691	3300005262	Bacteria	2308
79	Ga0065165_1022037	3300005262	Bacteria	2196
80	Ga0065165_1033664	3300005262	Bacteria	1592
81	Ga0065714_10068469	3300005288	Bacteria	4699
82	Ga0065712_10003097	3300005290	Bacteria	5385
83	Ga0065715_10092098	3300005293	Bacteria	5337
84	Ga0065707_10015231	3300005295	Bacteria	2775
85	Ga0065707_10082041	3300005295	Bacteria	23822
86	Ga0070658_10000003	3300005327	Bacteria	465963
87	Ga0070658_10010131	3300005327	Bacteria	7566
88	Ga0070658_10035712	3300005327	Bacteria	4004
89	Ga0070676_10017807	3300005328	Bacteria	3933
90	Ga0070676_10050647	3300005328	Bacteria	2435
91	Ga0070683_100005671	3300005329	Bacteria	10422
92	Ga0070683_100050394	3300005329	Bacteria	3854
93	Ga0070683_100069831	3300005329	Bacteria	3276
94	Ga0070683_100116410	3300005329	Bacteria	2523
95	Ga0070683_100377978	3300005329	Bacteria	1350
96	Ga0070690_100000760	3300005330	Bacteria	16501
97	Ga0070690_100009324	3300005330	Bacteria	5683
98	Ga0070690_100010350	3300005330	Bacteria	5425
99	Ga0070670_100007720	3300005331	Bacteria	9146
100	Ga0070670_100014900	3300005331	Bacteria	6670
101	Ga0070670_100040070	3300005331	Bacteria	4029
102	Ga0070670_100075308	3300005331	Bacteria	2900
103	Ga0070677_10000608	3300005333	Bacteria	12052
104	Ga0068869_100003816	3300005334	Bacteria	9292
105	Ga0068869_100007189	3300005334	Bacteria	7098
106	Ga0068869_100008887	3300005334	Bacteria	6500
107	Ga0068869_100017347	3300005334	Bacteria	4878
108	Ga0070666_10001213	3300005335	Bacteria	15563
109	Ga0070666_10010982	3300005335	Bacteria	5675
110	Ga0070666_10034385	3300005335	Bacteria	3358
111	Ga0070666_10077249	3300005335	Bacteria	2273
112	Ga0070666_10111188	3300005335	Bacteria	1895
113	Ga0070666_10134087	3300005335	Bacteria	1722
114	Ga0070680_100000486	3300005336	Bacteria	27276
115	Ga0070680_100033008	3300005336	Bacteria	4169
116	Ga0070680_100138341	3300005336	Bacteria	2041
117	Ga0070682_100025672	3300005337	Bacteria	3518
118	Ga0070682_100046565	3300005337	Bacteria	2692
119	Ga0070682_100051582	3300005337	Bacteria	2571
120	Ga0070682_100071185	3300005337	Bacteria	2225
121	Ga0068868_100002139	3300005338	Bacteria	13635
122	Ga0068868_100010171	3300005338	Bacteria	6798
123	Ga0068868_100011868	3300005338	Bacteria	6353
124	Ga0068868_100033294	3300005338	Bacteria	3971
125	Ga0068868_100075658	3300005338	Bacteria	2691
126	Ga0070660_100001129	3300005339	Bacteria	18017
127	Ga0070660_100057966	3300005339	Bacteria	3002
128	Ga0070660_100124329	3300005339	Bacteria	2061
129	Ga0070689_100006295	3300005340	Bacteria	8198
130	Ga0070689_100007201	3300005340	Bacteria	7756
131	Ga0070689_100023621	3300005340	Bacteria	4604
132	Ga0070687_100006008	3300005343	Bacteria	4947
133	Ga0070687_100012161	3300005343	Bacteria	3790
134	Ga0070661_100001230	3300005344	Bacteria	18024
135	Ga0070661_100002081	3300005344	Bacteria	13777
136	Ga0070661_100021580	3300005344	Bacteria	4601
137	Ga0070661_100038939	3300005344	Bacteria	3462
138	Ga0070661_100048461	3300005344	Bacteria	3110
139	Ga0070661_100104682	3300005344	Bacteria	2108
140	Ga0070661_100124374	3300005344	Bacteria	1934
141	Ga0070661_100138018	3300005344	Bacteria	1836
142	Ga0070692_10021271	3300005345	Bacteria	3154
143	Ga0070692_10026927	3300005345	Bacteria	2846
144	Ga0070668_100007259	3300005347	Bacteria	8217
145	Ga0070668_100089225	3300005347	Bacteria	2428
146	Ga0070675_100001429	3300005354	Bacteria	17548
147	Ga0070675_100012957	3300005354	Bacteria	6545
148	Ga0070675_100020253	3300005354	Bacteria	5307
149	Ga0070675_100060015	3300005354	Bacteria	3139
150	Ga0070675_100194315	3300005354	Bacteria	1759
151	Ga0070671_100003510	3300005355	Bacteria	12254
152	Ga0070671_100011597	3300005355	Bacteria	7089
153	Ga0070671_100012123	3300005355	Bacteria	6937
154	Ga0070671_100012305	3300005355	Bacteria	6889
155	Ga0070671_100012722	3300005355	Bacteria	6781
156	Ga0070671_100026318	3300005355	Bacteria	4780
157	Ga0070671_100053259	3300005355	Bacteria	3364
158	Ga0070671_100112559	3300005355	Bacteria	2286
159	Ga0070671_100229145	3300005355	Bacteria	1576
160	Ga0070671_100238374	3300005355	Bacteria	1544
161	Ga0070674_100008653	3300005356	Bacteria	6067
162	Ga0070674_100010475	3300005356	Bacteria	5608
163	Ga0070673_100001040	3300005364	Bacteria	15742
164	Ga0070673_100001616	3300005364	Bacteria	13326
165	Ga0070673_100005127	3300005364	Bacteria	8352
166	Ga0070673_100006976	3300005364	Bacteria	7398
167	Ga0070673_100010696	3300005364	Bacteria	6222
168	Ga0070673_100016683	3300005364	Bacteria	5202
169	Ga0070673_100174841	3300005364	Bacteria	1835
170	Ga0070688_100002180	3300005365	Bacteria	9879
171	Ga0070688_100005709	3300005365	Bacteria	6579
172	Ga0070688_100049728	3300005365	Bacteria	2610
173	Ga0070659_100000573	3300005366	Bacteria	26939
174	Ga0070659_100000810	3300005366	Bacteria	22806
175	Ga0070659_100002619	3300005366	Bacteria	12796
176	Ga0070659_100007434	3300005366	Bacteria	7960
177	Ga0070659_100007624	3300005366	Bacteria	7867
178	Ga0070659_100009273	3300005366	Bacteria	7225
179	Ga0070659_100009361	3300005366	Bacteria	7195
180	Ga0070659_100018627	3300005366	Bacteria	5241
181	Ga0070659_100028609	3300005366	Bacteria	4306
182	Ga0070659_100087149	3300005366	Bacteria	2499
183	Ga0070667_100012250	3300005367	Bacteria	7094
184	Ga0070667_100029317	3300005367	Bacteria	4584
185	Ga0070667_100031248	3300005367	Bacteria	4440
186	Ga0070667_100043400	3300005367	Bacteria	3774
187	Ga0070667_100062925	3300005367	Bacteria	3143
188	Ga0070667_100181212	3300005367	Bacteria	1863
189	Ga0070709_10001313	3300005434	Bacteria	13549
190	Ga0070709_10128339	3300005434	Bacteria	1728
191	Ga0070714_100000752	3300005435	Bacteria	22957
192	Ga0070714_100006600	3300005435	Bacteria	8977
193	Ga0070714_100209464	3300005435	Bacteria	1786
194	Ga0070713_100001999	3300005436	Bacteria	13163
195	Ga0070713_100173183	3300005436	Bacteria	1935
196	Ga0070710_10005118	3300005437	Bacteria	6203
197	Ga0070711_100055919	3300005439	Bacteria	2727
198	Ga0070705_100001028	3300005440	Bacteria	15539
199	Ga0070694_100040420	3300005444	Bacteria	3109
200	Ga0070708_100000166	3300005445	Bacteria	46972
201	Ga0070708_100007988	3300005445	Bacteria	8476
202	Ga0070708_100099797	3300005445	Bacteria	2657
203	Ga0070663_100000203	3300005455	Bacteria	29587
204	Ga0070663_100005089	3300005455	Bacteria	7776
205	Ga0070663_100006141	3300005455	Bacteria	7193
206	Ga0070663_100043303	3300005455	Bacteria	3168
207	Ga0070663_100055093	3300005455	Bacteria	2845
208	Ga0070678_100000394	3300005456	Bacteria	20544
209	Ga0070678_100015496	3300005456	Bacteria	4849
210	Ga0070678_100022840	3300005456	Bacteria	4156
211	Ga0070678_100030549	3300005456	Bacteria	3705
212	Ga0070678_100059157	3300005456	Bacteria	2815
213	Ga0070678_100133124	3300005456	Bacteria	1979
214	Ga0070662_100000263	3300005457	Bacteria	30810
215	Ga0070662_100012466	3300005457	Bacteria	5638
216	Ga0070662_100028820	3300005457	Bacteria	3868
217	Ga0070662_100074093	3300005457	Bacteria	2517
218	Ga0070681_10000836	3300005458	Bacteria	25786
219	Ga0070681_10002347	3300005458	Bacteria	17293
220	Ga0070681_10004413	3300005458	Bacteria	13402
221	Ga0070681_10005270	3300005458	Bacteria	12485
222	Ga0070681_10007663	3300005458	Bacteria	10560
223	Ga0070681_10015372	3300005458	Bacteria	7615
224	Ga0070681_10015548	3300005458	Bacteria	7580
225	Ga0070681_10168532	3300005458	Bacteria	2112
226	Ga0070681_10204591	3300005458	Bacteria	1892
227	Ga0070681_10235689	3300005458	Bacteria	1744
228	Ga0068867_100004473	3300005459	Bacteria	9823
229	Ga0068867_100006063	3300005459	Bacteria	8568
230	Ga0068867_100036002	3300005459	Bacteria	3591
231	Ga0068867_100061145	3300005459	Bacteria	2796
232	Ga0068867_100153920	3300005459	Bacteria	1808
233	Ga0070685_10003615	3300005466	Bacteria	7847
234	Ga0070685_10079823	3300005466	Bacteria	1959
235	Ga0070706_100000406	3300005467	Bacteria	51991
236	Ga0070698_100100578	3300005471	Bacteria	2863
237	Ga0070699_100015056	3300005518	Bacteria	6647
238	Ga0070679_100001821	3300005530	Bacteria	19232
239	Ga0070679_100002376	3300005530	Bacteria	17059
240	Ga0070679_100081260	3300005530	Bacteria	3230
241	Ga0070679_100090522	3300005530	Bacteria	3048
242	Ga0070679_100136992	3300005530	Bacteria	2429
243	Ga0070679_100188501	3300005530	Bacteria	2032
244	Ga0070679_100228496	3300005530	Bacteria	1820
245	Ga0070684_100006754	3300005535	Bacteria	8894
246	Ga0070684_100020078	3300005535	Bacteria	5541
247	Ga0070684_100148594	3300005535	Bacteria	2122
248	Ga0070697_100000305	3300005536	Bacteria	39083
249	Ga0068853_100002315	3300005539	Bacteria	14260
250	Ga0068853_100005714	3300005539	Bacteria	9787
251	Ga0068853_100006078	3300005539	Bacteria	9556
252	Ga0068853_100008789	3300005539	Bacteria	8123
253	Ga0068853_100038104	3300005539	Bacteria	4093
254	Ga0068853_100042636	3300005539	Bacteria	3881
255	Ga0068853_100263601	3300005539	Bacteria	1585
256	Ga0070672_100000434	3300005543	Bacteria	24355
257	Ga0070672_100007079	3300005543	Bacteria	7587
258	Ga0070672_100019282	3300005543	Bacteria	4947
259	Ga0070672_100191284	3300005543	Bacteria	1709
260	Ga0070672_100277770	3300005543	Bacteria	1415
261	Ga0070686_100000056	3300005544	Bacteria	87537
262	Ga0070686_100000900	3300005544	Bacteria	17298
263	Ga0070686_100010192	3300005544	Bacteria	5289
264	Ga0070695_100005220	3300005545	Bacteria	7660
265	Ga0070696_100009040	3300005546	Bacteria	6672
266	Ga0070696_100214811	3300005546	Bacteria	1441
267	Ga0070665_100000410	3300005548	Bacteria	62835
268	Ga0070665_100000797	3300005548	Bacteria	41345
269	Ga0070665_100001158	3300005548	Bacteria	32401
270	Ga0070665_100002535	3300005548	Bacteria	20073
271	Ga0070665_100007703	3300005548	Bacteria	10936
272	Ga0070665_100010279	3300005548	Bacteria	9470
273	Ga0070665_100017708	3300005548	Bacteria	7154
274	Ga0070665_100020520	3300005548	Bacteria	6638
275	Ga0070665_100028711	3300005548	Bacteria	5601
276	Ga0070665_100029366	3300005548	Bacteria	5534
277	Ga0070665_100125522	3300005548	Bacteria	2569
278	Ga0070665_100273960	3300005548	Bacteria	1689
279	Ga0070704_100014641	3300005549	Bacteria	4904
280	Ga0068855_100002884	3300005563	Bacteria	21047
281	Ga0068855_100004405	3300005563	Bacteria	17209
282	Ga0068855_100005830	3300005563	Bacteria	15033
283	Ga0068855_100006693	3300005563	Bacteria	13990
284	Ga0068855_100008902	3300005563	Bacteria	12133
285	Ga0068855_100009627	3300005563	Bacteria	11656
286	Ga0068855_100026176	3300005563	Bacteria	6978
287	Ga0068855_100034879	3300005563	Bacteria	5996
288	Ga0068855_100062923	3300005563	Bacteria	4331
289	Ga0068855_100067548	3300005563	Bacteria	4164
290	Ga0070664_100001553	3300005564	Bacteria	18353
291	Ga0070664_100005604	3300005564	Bacteria	10096
292	Ga0070664_100011401	3300005564	Bacteria	7212
293	Ga0070664_100020486	3300005564	Bacteria	5445
294	Ga0070664_100020875	3300005564	Bacteria	5396
295	Ga0070664_100024044	3300005564	Bacteria	5036
296	Ga0070664_100042243	3300005564	Bacteria	3849
297	Ga0070664_100051409	3300005564	Bacteria	3490
298	Ga0070664_100064995	3300005564	Bacteria	3112
299	Ga0068857_100000426	3300005577	Bacteria	29761
300	Ga0068857_100006305	3300005577	Bacteria	10153
301	Ga0068857_100082141	3300005577	Bacteria	2878
302	Ga0068857_100194120	3300005577	Bacteria	1850
303	Ga0068854_100001244	3300005578	Bacteria	15293
304	Ga0068854_100016983	3300005578	Bacteria	4864
305	Ga0068854_100017846	3300005578	Bacteria	4756
306	Ga0068854_100025953	3300005578	Bacteria	4022
307	Ga0068854_100102599	3300005578	Bacteria	2146
308	Ga0068854_100112311	3300005578	Bacteria	2057
309	Ga0068856_100002865	3300005614	Bacteria	17654
310	Ga0068856_100007739	3300005614	Bacteria	10494
311	Ga0068856_100017786	3300005614	Bacteria	6894
312	Ga0068856_100020839	3300005614	Bacteria	6371
313	Ga0068856_100026010	3300005614	Bacteria	5707
314	Ga0068856_100053661	3300005614	Bacteria	3975
315	Ga0068856_100080574	3300005614	Bacteria	3229
316	Ga0068856_100191561	3300005614	Bacteria	2058
317	Ga0068856_100226385	3300005614	Bacteria	1885
318	Ga0068856_100264443	3300005614	Bacteria	1736
319	Ga0070702_100003738	3300005615	Bacteria	6864
320	Ga0068852_100000645	3300005616	Bacteria	22820
321	Ga0068852_100003973	3300005616	Bacteria	10387
322	Ga0068852_100004821	3300005616	Bacteria	9582
323	Ga0068852_100022368	3300005616	Bacteria	5069
324	Ga0068852_100026804	3300005616	Bacteria	4690
325	Ga0068852_100032761	3300005616	Bacteria	4306
326	Ga0068852_100130788	3300005616	Bacteria	2311
327	Ga0068852_100145761	3300005616	Bacteria	2196
328	Ga0068852_100249360	3300005616	Bacteria	1700
329	Ga0068859_100006936	3300005617	Bacteria	11503
330	Ga0068859_100007186	3300005617	Bacteria	11302
331	Ga0068859_100015131	3300005617	Bacteria	7743
332	Ga0068859_100025615	3300005617	Bacteria	5916
333	Ga0068859_100032051	3300005617	Bacteria	5279
334	Ga0068859_100085389	3300005617	Bacteria	3202
335	Ga0068859_100148456	3300005617	Bacteria	2420
336	Ga0068859_100282206	3300005617	Bacteria	1754
337	Ga0068864_100001368	3300005618	Bacteria	20233
338	Ga0068864_100006206	3300005618	Bacteria	9798
339	Ga0068864_100007639	3300005618	Bacteria	8906
340	Ga0068864_100013011	3300005618	Bacteria	6887
341	Ga0068864_100015364	3300005618	Bacteria	6364
342	Ga0068864_100018684	3300005618	Bacteria	5793
343	Ga0068864_100166055	3300005618	Bacteria	2010
344	Ga0068864_100203661	3300005618	Bacteria	1819
345	Ga0068864_100208605	3300005618	Bacteria	1798
346	Ga0068864_100219217	3300005618	Bacteria	1755
347	Ga0068864_100262236	3300005618	Bacteria	1608
348	Ga0068866_10004233	3300005718	Bacteria	5891
349	Ga0068866_10059245	3300005718	Bacteria	1980
350	Ga0068861_100000422	3300005719	Bacteria	24590
351	Ga0068861_100003244	3300005719	Bacteria	10768
352	Ga0068861_100014705	3300005719	Bacteria	5496
353	Ga0068861_100019811	3300005719	Bacteria	4808
354	Ga0068861_100186934	3300005719	Bacteria	1728
355	Ga0068851_10005624	3300005834	Bacteria	5692
356	Ga0068851_10052685	3300005834	Bacteria	2070
357	Ga0068870_10002487	3300005840	Bacteria	7686
358	Ga0068863_100001700	3300005841	Bacteria	21804
359	Ga0068863_100004769	3300005841	Bacteria	13360
360	Ga0068863_100005061	3300005841	Bacteria	13003
361	Ga0068863_100005547	3300005841	Bacteria	12408
362	Ga0068863_100006237	3300005841	Bacteria	11709
363	Ga0068863_100009189	3300005841	Bacteria	9644
364	Ga0068863_100031848	3300005841	Bacteria	5030
365	Ga0068863_100040066	3300005841	Bacteria	4455
366	Ga0068863_100057653	3300005841	Bacteria	3675
367	Ga0068863_100111021	3300005841	Bacteria	2612
368	Ga0068863_100382194	3300005841	Bacteria	1375
369	Ga0068858_100000285	3300005842	Bacteria	54696
370	Ga0068858_100008510	3300005842	Bacteria	9859
371	Ga0068858_100064666	3300005842	Bacteria	3386
372	Ga0068858_100136820	3300005842	Bacteria	2299
373	Ga0068858_100157832	3300005842	Bacteria	2135
374	Ga0068860_100002304	3300005843	Bacteria	20069
375	Ga0068860_100005318	3300005843	Bacteria	13066
376	Ga0068860_100025478	3300005843	Bacteria	5706
377	Ga0068862_100007725	3300005844	Bacteria	8894
378	Ga0068862_100039426	3300005844	Bacteria	4012
379	Ga0081455_10084542	3300005937	Bacteria	2589
380	Ga0081539_10000016	3300005985	Bacteria	381648
381	Ga0081539_10001341	3300005985	Bacteria	42889
382	Ga0070717_10042611	3300006028	Bacteria	3703
383	Ga0075365_10051670	3300006038	Bacteria	2716
384	Ga0075364_10080552	3300006051	Bacteria	2152
385	Ga0075432_10000255	3300006058	Bacteria	14565
386	Ga0070712_100120428	3300006175	Bacteria	1974
387	Ga0075362_10006800	3300006177	Bacteria	4278
388	Ga0075362_10008343	3300006177	Bacteria	3956
389	Ga0075362_10034516	3300006177	Bacteria	2205
390	Ga0075369_10008933	3300006186	Bacteria	3876
391	Ga0075366_10000006	3300006195	Bacteria	106522
392	Ga0075366_10004916	3300006195	Bacteria	7207
393	Ga0075366_10016082	3300006195	Bacteria	4295
394	Ga0075366_10016541	3300006195	Bacteria	4241
395	Ga0075366_10039576	3300006195	Bacteria	2787
396	Ga0075366_10055772	3300006195	Bacteria	2347
397	Ga0097621_100001110	3300006237	Bacteria	18802
398	Ga0097621_100003658	3300006237	Bacteria	10622
399	Ga0097621_100018013	3300006237	Bacteria	5382
400	Ga0097621_100053615	3300006237	Bacteria	3287
401	Ga0075370_10002088	3300006353	Bacteria	9100
402	Ga0075370_10003210	3300006353	Bacteria	7740
403	Ga0075370_10013693	3300006353	Bacteria	4317
404	Ga0075370_10030332	3300006353	Bacteria	3016
405	Ga0075370_10092694	3300006353	Bacteria	1743
406	Ga0068871_100000906	3300006358	Bacteria	19736
407	Ga0068871_100006129	3300006358	Bacteria	8472
408	Ga0068871_100010058	3300006358	Bacteria	6879
409	Ga0068871_100047062	3300006358	Bacteria	3477
410	Ga0068871_100121645	3300006358	Bacteria	2205
411	Ga0068871_100133270	3300006358	Bacteria	2108
412	Ga0075428_100000324	3300006844	Bacteria	47396
413	Ga0075430_100000353	3300006846	Bacteria	33394
414	Ga0075431_100022080	3300006847	Bacteria	6509
415	Ga0075429_100000223	3300006880	Bacteria	38359
416	Ga0068865_100077452	3300006881	Bacteria	2376
417	Ga0068865_100116222	3300006881	Bacteria	1981
418	Ga0068865_100190237	3300006881	Bacteria	1586
419	Ga0075436_100187727	3300006914	Bacteria	1462
420	Ga0097620_100006936	3300006931	Bacteria	11503
421	Ga0097620_100007186	3300006931	Bacteria	11302
422	Ga0097620_100015131	3300006931	Bacteria	7743
423	Ga0097620_100025616	3300006931	Bacteria	5916
424	Ga0097620_100032050	3300006931	Bacteria	5279
425	Ga0097620_100085385	3300006931	Bacteria	3202
426	Ga0097620_100148463	3300006931	Bacteria	2420
427	Ga0097620_100282189	3300006931	Bacteria	1754
428	Ga0079104_1004917	3300006946	Bacteria	5517
429	Ga0079104_1013938	3300006946	Bacteria	2451
430	Ga0099826_10000044	3300006948	Bacteria	88060
431	Ga0099794_10004246	3300007265	Bacteria	5598
432	Ga0099795_10000911	3300007788	Bacteria	5961
433	Ga0105244_10000642	3300009036	Bacteria	30808
434	Ga0105240_10001659	3300009093	Bacteria	37775
435	Ga0105240_10002265	3300009093	Bacteria	31201
436	Ga0105240_10006438	3300009093	Bacteria	17262
437	Ga0105240_10009082	3300009093	Bacteria	14111
438	Ga0105240_10011595	3300009093	Bacteria	12266
439	Ga0105240_10013066	3300009093	Bacteria	11427
440	Ga0105240_10019713	3300009093	Bacteria	9008
441	Ga0105240_10021602	3300009093	Bacteria	8560
442	Ga0105240_10023300	3300009093	Bacteria	8192
443	Ga0105240_10042497	3300009093	Bacteria	5791
444	Ga0105240_10051541	3300009093	Bacteria	5176
445	Ga0105240_10052291	3300009093	Bacteria	5136
446	Ga0105240_10079130	3300009093	Bacteria	4046
447	Ga0105240_10085585	3300009093	Bacteria	3862
448	Ga0105240_10125054	3300009093	Bacteria	3092
449	Ga0105240_10136895	3300009093	Bacteria	2932
450	Ga0105240_10275683	3300009093	Bacteria	1935
451	Ga0105240_10320332	3300009093	Bacteria	1767
452	Ga0105240_10353798	3300009093	Bacteria	1666
453	Ga0111539_10087206	3300009094	Bacteria	3667
454	Ga0105245_10216231	3300009098	Bacteria	1847
455	Ga0105247_10000072	3300009101	Bacteria	113959
456	Ga0105247_10008481	3300009101	Bacteria	6259
457	Ga0105247_10094687	3300009101	Bacteria	1900
458	Ga0114129_10000496	3300009147	Bacteria	47748
459	Ga0114129_10024439	3300009147	Bacteria	8561
460	Ga0114129_10070914	3300009147	Bacteria	4858
461	Ga0114129_10075488	3300009147	Bacteria	4693
462	Ga0114129_10272122	3300009147	Bacteria	2266
463	Ga0114129_10290008	3300009147	Bacteria	2184
464	Ga0105243_10000101	3300009148	Bacteria	98298
465	Ga0105243_10058423	3300009148	Bacteria	3074
466	Ga0105243_10150060	3300009148	Bacteria	1999
467	Ga0105241_10011179	3300009174	Bacteria	6584
468	Ga0105241_10029224	3300009174	Bacteria	4110
469	Ga0105242_10033779	3300009176	Bacteria	4098
470	Ga0105242_10216309	3300009176	Bacteria	1710
471	Ga0105242_10302463	3300009176	Bacteria	1460
472	Ga0105248_10001807	3300009177	Bacteria	23770
473	Ga0105248_10004607	3300009177	Bacteria	15258
474	Ga0105248_10013964	3300009177	Bacteria	8836
475	Ga0105248_10080806	3300009177	Bacteria	3654
476	Ga0105248_10084937	3300009177	Bacteria	3562
477	Ga0105248_10222916	3300009177	Bacteria	2123
478	Ga0105248_10291279	3300009177	Bacteria	1838
479	Ga0105237_10000964	3300009545	Bacteria	38709
480	Ga0105237_10011550	3300009545	Bacteria	9340
481	Ga0105237_10044087	3300009545	Bacteria	4491
482	Ga0105237_10070984	3300009545	Bacteria	3478
483	Ga0105237_10077478	3300009545	Bacteria	3314
484	Ga0105238_10000890	3300009551	Bacteria	30714
485	Ga0105238_10116916	3300009551	Bacteria	2647
486	Ga0105238_10178599	3300009551	Bacteria	2099
487	Ga0105238_10303780	3300009551	Bacteria	1580
488	Ga0105238_10355294	3300009551	Bacteria	1454
489	Ga0105249_10002234	3300009553	Bacteria	16788
490	Ga0105249_10021116	3300009553	Bacteria	5828
491	Ga0105249_10022459	3300009553	Bacteria	5652
492	Ga0105249_10026213	3300009553	Bacteria	5251
493	Ga0105249_10027362	3300009553	Bacteria	5144
494	Ga0099796_10000215	3300010159	Bacteria	9007
495	Ga0105239_10000104	3300010375	Bacteria	117927
496	Ga0105239_10087056	3300010375	Bacteria	3443
497	Ga0105239_10107448	3300010375	Bacteria	3091
498	Ga0105239_10172033	3300010375	Bacteria	2422
499	Ga0105246_10000280	3300011119	Bacteria	26654
500	Ga0105246_10002072	3300011119	Bacteria	12076
501	Ga0105246_10069554	3300011119	Bacteria	2473
502	Ga0157373_10001267	3300013100	Bacteria	19306
503	Ga0157373_10002009	3300013100	Bacteria	15416
504	Ga0157373_10002608	3300013100	Bacteria	13694
505	Ga0157373_10010362	3300013100	Bacteria	6861
506	Ga0157373_10014745	3300013100	Bacteria	5725
507	Ga0157373_10021376	3300013100	Bacteria	4700
508	Ga0157373_10104005	3300013100	Bacteria	1997
509	Ga0157371_10000394	3300013102	Bacteria	55028
510	Ga0157371_10000920	3300013102	Bacteria	33078
511	Ga0157371_10002707	3300013102	Bacteria	16727
512	Ga0157371_10004781	3300013102	Bacteria	11675
513	Ga0157371_10113262	3300013102	Bacteria	1926
514	Ga0157371_10121044	3300013102	Bacteria	1861
515	Ga0157370_10000298	3300013104	Bacteria	62940
516	Ga0157370_10000903	3300013104	Bacteria	37674
517	Ga0157370_10004665	3300013104	Bacteria	15650
518	Ga0157370_10004913	3300013104	Bacteria	15147
519	Ga0157370_10027941	3300013104	Bacteria	5557
520	Ga0157370_10119441	3300013104	Bacteria	2461
521	Ga0157369_10000106	3300013105	Bacteria	117964
522	Ga0157369_10005094	3300013105	Bacteria	15383
523	Ga0157369_10006620	3300013105	Bacteria	13403
524	Ga0157369_10035865	3300013105	Bacteria	5436
525	Ga0157369_10169875	3300013105	Bacteria	2298
526	Ga0157369_10177566	3300013105	Bacteria	2242
527	Ga0157369_10180927	3300013105	Bacteria	2218
528	Ga0157369_10216827	3300013105	Bacteria	2004
529	Ga0157369_10271551	3300013105	Bacteria	1767
530	Ga0157369_10280316	3300013105	Bacteria	1736
531	Ga0157374_10002013	3300013296	Bacteria	17054
532	Ga0157374_10009865	3300013296	Bacteria	8196
533	Ga0157374_10054324	3300013296	Bacteria	3736
534	Ga0157374_10123415	3300013296	Bacteria	2502
535	Ga0157374_10220411	3300013296	Bacteria	1861
536	Ga0157378_10035985	3300013297	Bacteria	4381
537	Ga0157378_10105507	3300013297	Bacteria	2577
538	Ga0163162_10000014	3300013306	Bacteria	268371
539	Ga0163162_10020638	3300013306	Bacteria	6475
540	Ga0163162_10045392	3300013306	Bacteria	4402
541	Ga0163162_10106104	3300013306	Bacteria	2904
542	Ga0163162_10127005	3300013306	Bacteria	2657
543	Ga0163162_10129046	3300013306	Bacteria	2636
544	Ga0157372_10001357	3300013307	Bacteria	26480
545	Ga0157372_10008276	3300013307	Bacteria	11057
546	Ga0157372_10027735	3300013307	Bacteria	6172
547	Ga0157372_10041153	3300013307	Bacteria	5108
548	Ga0157372_10061834	3300013307	Bacteria	4194
549	Ga0157372_10148881	3300013307	Bacteria	2700
550	Ga0157372_10184423	3300013307	Bacteria	2416
551	Ga0157372_10302973	3300013307	Bacteria	1859
552	Ga0157372_10351405	3300013307	Bacteria	1717
553	Ga0157372_10357002	3300013307	Bacteria	1703
554	Ga0157372_10360573	3300013307	Bacteria	1694
555	Ga0157375_10007281	3300013308	Bacteria	9686
556	Ga0157375_10089952	3300013308	Bacteria	3127
557	Ga0157375_10273130	3300013308	Bacteria	1853
558	Ga0163163_10012522	3300014325	Bacteria	7734
559	Ga0163163_10013729	3300014325	Bacteria	7422
560	Ga0163163_10015122	3300014325	Bacteria	7122
561	Ga0163163_10021154	3300014325	Bacteria	6137
562	Ga0163163_10036792	3300014325	Bacteria	4757
563	Ga0163163_10060932	3300014325	Bacteria	3738
564	Ga0163163_10071134	3300014325	Bacteria	3466
565	Ga0163163_10133086	3300014325	Bacteria	2527
566	Ga0182008_10000794	3300014497	Bacteria	22137
567	Ga0182008_10058901	3300014497	Bacteria	1895
568	Ga0157377_10000648	3300014745	Bacteria	14524
569	Ga0157377_10000885	3300014745	Bacteria	12487
570	Ga0157379_10004399	3300014968	Bacteria	12070
571	Ga0157379_10028290	3300014968	Bacteria	4988
572	Ga0157379_10036576	3300014968	Bacteria	4377
573	Ga0157379_10047908	3300014968	Bacteria	3814
574	Ga0157379_10061085	3300014968	Bacteria	3370
575	Ga0157379_10101971	3300014968	Bacteria	2576
576	Ga0157379_10110392	3300014968	Bacteria	2470
577	Ga0157379_10266779	3300014968	Bacteria	1556
578	Ga0157376_10010255	3300014969	Bacteria	6843
579	Ga0157376_10019973	3300014969	Bacteria	5174
580	Ga0157376_10158794	3300014969	Bacteria	2047
581	Ga0157376_10199087	3300014969	Bacteria	1841
582	Ga0182006_1000690	3300015261	Bacteria	23537
583	Ga0182007_10000223	3300015262	Bacteria	38011
584	Ga0182007_10021920	3300015262	Bacteria	2261
585	Ga0183365_10001	3300015684	Bacteria	2090444
586	Ga0163161_10003289	3300017792	Bacteria	11356
587	Ga0163161_10013749	3300017792	Bacteria	5638
588	Ga0163161_10015506	3300017792	Bacteria	5313
589	Ga0213872_10001447	3300021361	Bacteria	15447
590	Ga0213872_10034457	3300021361	Bacteria	2317
591	Ga0213876_10000145	3300021384	Bacteria	76883
592	Ga0213876_10006681	3300021384	Bacteria	6297
593	Ga0209435_100018	3300025206	Bacteria	274625
594	Ga0209147_100051	3300025229	Bacteria	274605
595	Ga0207427_100614	3300025231	Bacteria	17626
596	Ga0209437_100145	3300025233	Bacteria	163138
597	Ga0209437_100338	3300025233	Bacteria	56554
598	Ga0209258_100882	3300025242	Bacteria	15742
599	Ga0209258_101305	3300025242	Bacteria	9243
600	Ga0207425_1000005	3300025245	Bacteria	900502
601	Ga0207425_1000559	3300025245	Bacteria	22102
602	Ga0207425_1003414	3300025245	Bacteria	5091
603	Ga0209646_1000081	3300025246	Bacteria	201708
604	Ga0209646_1000090	3300025246	Bacteria	189912
605	Ga0209026_1000042	3300025250	Bacteria	273111
606	Ga0209026_1001479	3300025250	Bacteria	10353
607	Ga0209026_1007896	3300025250	Bacteria	2304
608	Ga0209148_1000002	3300025254	Bacteria	2399500
609	Ga0209759_1000109	3300025256	Bacteria	145042
610	Ga0209759_1000613	3300025256	Bacteria	34432
611	Ga0209129_1000281	3300025258	Bacteria	48395
612	Ga0209129_1000649	3300025258	Bacteria	23347
613	Ga0209233_1000006	3300025261	Bacteria	1473685
614	Ga0209233_1001086	3300025261	Bacteria	11209
615	Ga0209565_1000010	3300025263	Bacteria	687724
616	Ga0209565_1000021	3300025263	Bacteria	406281
617	Ga0209565_1000047	3300025263	Bacteria	225745
618	Ga0209565_1000049	3300025263	Bacteria	224447
619	Ga0209565_1000056	3300025263	Bacteria	200189
620	Ga0209565_1000132	3300025263	Bacteria	104716
621	Ga0209565_1000278	3300025263	Bacteria	51430
622	Ga0209565_1000652	3300025263	Bacteria	22290
623	Ga0209455_1006376	3300025272	Bacteria	3490
624	Ga0209455_1008189	3300025272	Bacteria	2867
625	Ga0209673_1000079	3300025273	Bacteria	225746
626	Ga0209673_1000693	3300025273	Bacteria	48171
627	Ga0209673_1000712	3300025273	Bacteria	46760
628	Ga0209673_1000871	3300025273	Bacteria	39156
629	Ga0209673_1001168	3300025273	Bacteria	28518
630	Ga0209673_1005918	3300025273	Bacteria	6038
631	Ga0209130_1000890	3300025284	Bacteria	24330
632	Ga0207673_1002117	3300025290	Bacteria	2230
633	Ga0209675_1000046	3300025291	Bacteria	225746
634	Ga0209675_1000149	3300025291	Bacteria	93109
635	Ga0209675_1000423	3300025291	Bacteria	34092
636	Ga0209675_1004103	3300025291	Bacteria	6625
637	Ga0209675_1013229	3300025291	Bacteria	2599
638	Ga0209675_1013952	3300025291	Bacteria	2474
639	Ga0209676_1000014	3300025292	Bacteria	793514
640	Ga0209676_1000215	3300025292	Bacteria	127311
641	Ga0209676_1000383	3300025292	Bacteria	81259
642	Ga0209676_1000729	3300025292	Bacteria	45044
643	Ga0209676_1004890	3300025292	Bacteria	7232
644	Ga0209025_1000464	3300025294	Bacteria	79341
645	Ga0209025_1000522	3300025294	Bacteria	73140
646	Ga0209025_1001835	3300025294	Bacteria	24946
647	Ga0209025_1020008	3300025294	Bacteria	3685
648	Ga0209025_1027207	3300025294	Bacteria	2844
649	Ga0209564_1000455	3300025295	Bacteria	69085
650	Ga0209564_1000502	3300025295	Bacteria	64443
651	Ga0209564_1001019	3300025295	Bacteria	34584
652	Ga0209564_1001045	3300025295	Bacteria	33865
653	Ga0209564_1001385	3300025295	Bacteria	25288
654	Ga0209564_1001672	3300025295	Bacteria	21217
655	Ga0209564_1002205	3300025295	Bacteria	16256
656	Ga0209564_1002819	3300025295	Bacteria	12898
657	Ga0209564_1006465	3300025295	Bacteria	6312
658	Ga0209758_1000002	3300025297	Bacteria	1400310
659	Ga0209758_1000036	3300025297	Bacteria	441671
660	Ga0209758_1000215	3300025297	Bacteria	125461
661	Ga0209758_1000571	3300025297	Bacteria	57774
662	Ga0209758_1000665	3300025297	Bacteria	51391
663	Ga0209758_1001434	3300025297	Bacteria	28162
664	Ga0209758_1001627	3300025297	Bacteria	25573
665	Ga0209758_1002481	3300025297	Bacteria	18757
666	Ga0209758_1004197	3300025297	Bacteria	12222
667	Ga0209758_1007612	3300025297	Bacteria	7306
668	Ga0209758_1029521	3300025297	Bacteria	2290
669	Ga0209050_1000005	3300025298	Bacteria	1557793
670	Ga0209050_1000010	3300025298	Bacteria	980454
671	Ga0209050_1000049	3300025298	Bacteria	364096
672	Ga0209050_1000952	3300025298	Bacteria	37637
673	Ga0209050_1001027	3300025298	Bacteria	34791
674	Ga0209050_1001756	3300025298	Bacteria	21492
675	Ga0209050_1003532	3300025298	Bacteria	11409
676	Ga0209050_1004312	3300025298	Bacteria	9716
677	Ga0209050_1008063	3300025298	Bacteria	5724
678	Ga0209050_1016438	3300025298	Bacteria	3027
679	Ga0209256_1000034	3300025299	Bacteria	388475
680	Ga0209256_1000625	3300025299	Bacteria	48667
681	Ga0209256_1003283	3300025299	Bacteria	11545
682	Ga0209256_1004009	3300025299	Bacteria	9634
683	Ga0209256_1004857	3300025299	Bacteria	8121
684	Ga0209256_1006395	3300025299	Bacteria	6263
685	Ga0209256_1022222	3300025299	Bacteria	1927
686	Ga0207426_1000591	3300025302	Bacteria	47966
687	Ga0209051_1000213	3300025303	Bacteria	98755
688	Ga0209051_1000259	3300025303	Bacteria	88311
689	Ga0209051_1000967	3300025303	Bacteria	28107
690	Ga0209257_1000009	3300025304	Bacteria	1205047
691	Ga0209257_1000116	3300025304	Bacteria	228733
692	Ga0209257_1000187	3300025304	Bacteria	154077
693	Ga0209257_1000313	3300025304	Bacteria	102682
694	Ga0209257_1000330	3300025304	Bacteria	99167
695	Ga0209257_1000373	3300025304	Bacteria	90001
696	Ga0209257_1001706	3300025304	Bacteria	24648
697	Ga0209257_1001867	3300025304	Bacteria	22861
698	Ga0209257_1003323	3300025304	Bacteria	13922
699	Ga0209257_1003466	3300025304	Bacteria	13483
700	Ga0209257_1010418	3300025304	Bacteria	4710
701	Ga0209257_1010684	3300025304	Bacteria	4587
702	Ga0209257_1017565	3300025304	Bacteria	2808
703	Ga0207697_10001102	3300025315	Bacteria	14886
704	Ga0207697_10003235	3300025315	Bacteria	8100
705	Ga0207655_1001085	3300025728	Bacteria	26850
706	Ga0207682_10000298	3300025893	Bacteria	22419
707	Ga0207682_10001189	3300025893	Bacteria	12069
708	Ga0207692_10037501	3300025898	Bacteria	2371
709	Ga0207710_10000303	3300025900	Bacteria	39280
710	Ga0207710_10051563	3300025900	Bacteria	1848
711	Ga0207688_10015554	3300025901	Bacteria	4126
712	Ga0207688_10067486	3300025901	Bacteria	2024
713	Ga0207688_10068867	3300025901	Bacteria	2005
714	Ga0207680_10009591	3300025903	Bacteria	4808
715	Ga0207680_10024492	3300025903	Bacteria	3314
716	Ga0207680_10097432	3300025903	Bacteria	1883
717	Ga0207647_10003210	3300025904	Bacteria	12268
718	Ga0207647_10036661	3300025904	Bacteria	3114
719	Ga0207647_10074746	3300025904	Bacteria	2040
720	Ga0207647_10132433	3300025904	Bacteria	1465
721	Ga0207647_10141578	3300025904	Bacteria	1409
722	Ga0207699_10017688	3300025906	Bacteria	3760
723	Ga0207699_10112413	3300025906	Bacteria	1748
724	Ga0207699_10149813	3300025906	Bacteria	1542
725	Ga0207645_10002299	3300025907	Bacteria	15104
726	Ga0207645_10002475	3300025907	Bacteria	14495
727	Ga0207645_10007419	3300025907	Bacteria	7749
728	Ga0207645_10045034	3300025907	Bacteria	2821
729	Ga0207643_10000777	3300025908	Bacteria	19461
730	Ga0207643_10014040	3300025908	Bacteria	4347
731	Ga0207705_10000005	3300025909	Bacteria	673478
732	Ga0207705_10000151	3300025909	Bacteria	74614
733	Ga0207705_10000784	3300025909	Bacteria	26096
734	Ga0207705_10001518	3300025909	Bacteria	18422
735	Ga0207705_10008057	3300025909	Bacteria	7724
736	Ga0207705_10047193	3300025909	Bacteria	3097
737	Ga0207705_10079362	3300025909	Bacteria	2390
738	Ga0207705_10116517	3300025909	Bacteria	1978
739	Ga0207684_10004628	3300025910	Bacteria	12915
740	Ga0207654_10003207	3300025911	Bacteria	8267
741	Ga0207707_10000130	3300025912	Bacteria	77776
742	Ga0207707_10003768	3300025912	Bacteria	13437
743	Ga0207707_10012372	3300025912	Bacteria	7416
744	Ga0207707_10013033	3300025912	Bacteria	7239
745	Ga0207707_10048983	3300025912	Bacteria	3681
746	Ga0207707_10234804	3300025912	Bacteria	1595
747	Ga0207707_10245181	3300025912	Bacteria	1557
748	Ga0207695_10001490	3300025913	Bacteria	39048
749	Ga0207695_10001758	3300025913	Bacteria	34365
750	Ga0207695_10012887	3300025913	Bacteria	10007
751	Ga0207695_10022902	3300025913	Bacteria	7075
752	Ga0207695_10046664	3300025913	Bacteria	4591
753	Ga0207695_10051834	3300025913	Bacteria	4305
754	Ga0207695_10053233	3300025913	Bacteria	4234
755	Ga0207695_10064125	3300025913	Bacteria	3784
756	Ga0207695_10064827	3300025913	Bacteria	3759
757	Ga0207695_10067952	3300025913	Bacteria	3653
758	Ga0207695_10073524	3300025913	Bacteria	3483
759	Ga0207695_10175981	3300025913	Bacteria	2062
760	Ga0207695_10201850	3300025913	Bacteria	1902
761	Ga0207671_10001460	3300025914	Bacteria	27305
762	Ga0207671_10071977	3300025914	Bacteria	2579
763	Ga0207671_10151483	3300025914	Bacteria	1792
764	Ga0207663_10051633	3300025916	Bacteria	2561
765	Ga0207660_10026013	3300025917	Bacteria	3980
766	Ga0207660_10110250	3300025917	Bacteria	2070
767	Ga0207660_10205668	3300025917	Bacteria	1539
768	Ga0207662_10000433	3300025918	Bacteria	18529
769	Ga0207662_10011828	3300025918	Bacteria	4850
770	Ga0207662_10019435	3300025918	Bacteria	3866
771	Ga0207657_10000709	3300025919	Bacteria	35416
772	Ga0207657_10001164	3300025919	Bacteria	27924
773	Ga0207657_10001175	3300025919	Bacteria	27784
774	Ga0207657_10003788	3300025919	Bacteria	16077
775	Ga0207657_10003995	3300025919	Bacteria	15682
776	Ga0207657_10004237	3300025919	Bacteria	15201
777	Ga0207657_10008100	3300025919	Bacteria	10715
778	Ga0207657_10053495	3300025919	Bacteria	3497
779	Ga0207657_10082443	3300025919	Bacteria	2699
780	Ga0207657_10092211	3300025919	Bacteria	2525
781	Ga0207649_10000607	3300025920	Bacteria	24206
782	Ga0207649_10001103	3300025920	Bacteria	16367
783	Ga0207649_10003552	3300025920	Bacteria	8522
784	Ga0207649_10005799	3300025920	Bacteria	6686
785	Ga0207649_10007340	3300025920	Bacteria	5998
786	Ga0207649_10014273	3300025920	Bacteria	4445
787	Ga0207649_10015081	3300025920	Bacteria	4340
788	Ga0207649_10072765	3300025920	Bacteria	2200
789	Ga0207649_10176362	3300025920	Bacteria	1493
790	Ga0207652_10002942	3300025921	Bacteria	14245
791	Ga0207652_10043601	3300025921	Bacteria	3820
792	Ga0207652_10048516	3300025921	Bacteria	3630
793	Ga0207652_10060027	3300025921	Bacteria	3280
794	Ga0207652_10118939	3300025921	Bacteria	2349
795	Ga0207652_10135438	3300025921	Bacteria	2199
796	Ga0207652_10140668	3300025921	Bacteria	2158
797	Ga0207652_10174988	3300025921	Bacteria	1927
798	Ga0207681_10010289	3300025923	Bacteria	5721
799	Ga0207681_10037420	3300025923	Bacteria	3207
800	Ga0207681_10071635	3300025923	Bacteria	2418
801	Ga0207694_10002264	3300025924	Bacteria	15751
802	Ga0207694_10048209	3300025924	Bacteria	3296
803	Ga0207694_10056115	3300025924	Bacteria	3059
804	Ga0207694_10162752	3300025924	Bacteria	1803
805	Ga0207694_10192974	3300025924	Bacteria	1655
806	Ga0207650_10002369	3300025925	Bacteria	13105
807	Ga0207650_10004490	3300025925	Bacteria	9539
808	Ga0207650_10005284	3300025925	Bacteria	8808
809	Ga0207650_10014502	3300025925	Bacteria	5475
810	Ga0207650_10109498	3300025925	Bacteria	2136
811	Ga0207650_10260303	3300025925	Bacteria	1407
812	Ga0207659_10002875	3300025926	Bacteria	10249
813	Ga0207659_10003272	3300025926	Bacteria	9704
814	Ga0207659_10004738	3300025926	Bacteria	8247
815	Ga0207659_10009581	3300025926	Bacteria	6058
816	Ga0207659_10022335	3300025926	Bacteria	4212
817	Ga0207687_10141241	3300025927	Bacteria	1827
818	Ga0207700_10000031	3300025928	Bacteria	130086
819	Ga0207700_10249356	3300025928	Bacteria	1516
820	Ga0207664_10001913	3300025929	Bacteria	13671
821	Ga0207664_10058108	3300025929	Bacteria	3076
822	Ga0207664_10177893	3300025929	Bacteria	1825
823	Ga0207644_10001473	3300025931	Bacteria	15172
824	Ga0207644_10002148	3300025931	Bacteria	12793
825	Ga0207644_10004524	3300025931	Bacteria	9032
826	Ga0207644_10009006	3300025931	Bacteria	6540
827	Ga0207644_10009250	3300025931	Bacteria	6464
828	Ga0207644_10010564	3300025931	Bacteria	6087
829	Ga0207644_10023840	3300025931	Bacteria	4196
830	Ga0207644_10080034	3300025931	Bacteria	2412
831	Ga0207690_10000889	3300025932	Bacteria	19080
832	Ga0207690_10000946	3300025932	Bacteria	18590
833	Ga0207690_10004206	3300025932	Bacteria	8507
834	Ga0207690_10005864	3300025932	Bacteria	7271
835	Ga0207690_10015434	3300025932	Bacteria	4629
836	Ga0207690_10035700	3300025932	Bacteria	3214
837	Ga0207690_10063673	3300025932	Bacteria	2515
838	Ga0207690_10080820	3300025932	Bacteria	2269
839	Ga0207706_10000002	3300025933	Bacteria	360309
840	Ga0207706_10001587	3300025933	Bacteria	22571
841	Ga0207706_10001696	3300025933	Bacteria	21719
842	Ga0207706_10004253	3300025933	Bacteria	13474
843	Ga0207706_10004458	3300025933	Bacteria	13153
844	Ga0207709_10000103	3300025935	Bacteria	131589
845	Ga0207709_10001788	3300025935	Bacteria	14412
846	Ga0207709_10198943	3300025935	Bacteria	1429
847	Ga0207670_10014766	3300025936	Bacteria	4647
848	Ga0207670_10019324	3300025936	Bacteria	4161
849	Ga0207670_10113689	3300025936	Bacteria	1955
850	Ga0207669_10014186	3300025937	Bacteria	3987
851	Ga0207669_10204671	3300025937	Bacteria	1436
852	Ga0207691_10000006	3300025940	Bacteria	161922
853	Ga0207691_10002316	3300025940	Bacteria	18669
854	Ga0207691_10006366	3300025940	Bacteria	11408
855	Ga0207691_10006549	3300025940	Bacteria	11245
856	Ga0207691_10015590	3300025940	Bacteria	7226
857	Ga0207691_10022325	3300025940	Bacteria	5969
858	Ga0207691_10040919	3300025940	Bacteria	4281
859	Ga0207691_10099589	3300025940	Bacteria	2595
860	Ga0207711_10005564	3300025941	Bacteria	10653
861	Ga0207711_10007443	3300025941	Bacteria	9164
862	Ga0207711_10019796	3300025941	Bacteria	5609
863	Ga0207711_10020986	3300025941	Bacteria	5454
864	Ga0207711_10022643	3300025941	Bacteria	5255
865	Ga0207711_10279046	3300025941	Bacteria	1538
866	Ga0207689_10000898	3300025942	Bacteria	28576
867	Ga0207689_10003096	3300025942	Bacteria	15302
868	Ga0207689_10014984	3300025942	Bacteria	6576
869	Ga0207689_10068838	3300025942	Bacteria	2909
870	Ga0207689_10188121	3300025942	Bacteria	1703
871	Ga0207661_10051637	3300025944	Bacteria	3281
872	Ga0207661_10053374	3300025944	Bacteria	3234
873	Ga0207661_10070643	3300025944	Bacteria	2851
874	Ga0207661_10100895	3300025944	Bacteria	2423
875	Ga0207679_10001025	3300025945	Bacteria	17843
876	Ga0207679_10006569	3300025945	Bacteria	7352
877	Ga0207679_10023257	3300025945	Bacteria	4234
878	Ga0207679_10025307	3300025945	Bacteria	4079
879	Ga0207679_10025541	3300025945	Bacteria	4064
880	Ga0207679_10061157	3300025945	Bacteria	2802
881	Ga0207679_10070766	3300025945	Bacteria	2629
882	Ga0207679_10089132	3300025945	Bacteria	2380
883	Ga0207679_10105265	3300025945	Bacteria	2215
884	Ga0207679_10154195	3300025945	Bacteria	1874
885	Ga0207667_10002497	3300025949	Bacteria	22922
886	Ga0207667_10005026	3300025949	Bacteria	16169
887	Ga0207667_10008687	3300025949	Bacteria	12038
888	Ga0207667_10009443	3300025949	Bacteria	11485
889	Ga0207667_10010048	3300025949	Bacteria	11095
890	Ga0207667_10013275	3300025949	Bacteria	9436
891	Ga0207667_10024837	3300025949	Bacteria	6571
892	Ga0207667_10044730	3300025949	Bacteria	4690
893	Ga0207667_10058132	3300025949	Bacteria	4057
894	Ga0207667_10071494	3300025949	Bacteria	3607
895	Ga0207667_10074579	3300025949	Bacteria	3524
896	Ga0207667_10093796	3300025949	Bacteria	3100
897	Ga0207667_10104786	3300025949	Bacteria	2917
898	Ga0207667_10323233	3300025949	Bacteria	1576
899	Ga0207667_10407600	3300025949	Bacteria	1384
900	Ga0207651_10008743	3300025960	Bacteria	5492
901	Ga0207651_10013074	3300025960	Bacteria	4731
902	Ga0207651_10019678	3300025960	Bacteria	4053
903	Ga0207651_10034743	3300025960	Bacteria	3269
904	Ga0207651_10055664	3300025960	Bacteria	2718
905	Ga0207651_10140000	3300025960	Bacteria	1867
906	Ga0207712_10026321	3300025961	Bacteria	3873
907	Ga0207712_10034445	3300025961	Bacteria	3432
908	Ga0207712_10067008	3300025961	Bacteria	2568
909	Ga0207712_10197083	3300025961	Bacteria	1594
910	Ga0207668_10003112	3300025972	Bacteria	9717
911	Ga0207640_10000455	3300025981	Bacteria	24929
912	Ga0207640_10013811	3300025981	Bacteria	4637
913	Ga0207640_10026813	3300025981	Bacteria	3504
914	Ga0207640_10042514	3300025981	Bacteria	2898
915	Ga0207640_10099183	3300025981	Bacteria	2038
916	Ga0207640_10247179	3300025981	Bacteria	1382
917	Ga0207658_10002011	3300025986	Bacteria	15164
918	Ga0207658_10008113	3300025986	Bacteria	7153
919	Ga0207658_10011056	3300025986	Bacteria	6146
920	Ga0207658_10111697	3300025986	Bacteria	2162
921	Ga0207658_10170601	3300025986	Bacteria	1792
922	Ga0207658_10174633	3300025986	Bacteria	1773
923	Ga0207677_10001239	3300026023	Bacteria	13760
924	Ga0207677_10022458	3300026023	Bacteria	3878
925	Ga0207677_10029121	3300026023	Bacteria	3505
926	Ga0207677_10169867	3300026023	Bacteria	1704
927	Ga0207703_10001223	3300026035	Bacteria	24000
928	Ga0207703_10005459	3300026035	Bacteria	10224
929	Ga0207703_10013908	3300026035	Bacteria	6273
930	Ga0207703_10066695	3300026035	Bacteria	2961
931	Ga0207703_10073636	3300026035	Bacteria	2826
932	Ga0207703_10134253	3300026035	Bacteria	2141
933	Ga0207703_10207782	3300026035	Bacteria	1744
934	Ga0207639_10010877	3300026041	Bacteria	6311
935	Ga0207639_10027941	3300026041	Bacteria	4114
936	Ga0207639_10033738	3300026041	Bacteria	3779
937	Ga0207639_10065731	3300026041	Bacteria	2816
938	Ga0207639_10104901	3300026041	Bacteria	2292
939	Ga0207639_10150970	3300026041	Bacteria	1946
940	Ga0207639_10236001	3300026041	Bacteria	1588
941	Ga0207639_10251124	3300026041	Bacteria	1542
942	Ga0207678_10000491	3300026067	Bacteria	35916
943	Ga0207678_10001355	3300026067	Bacteria	22581
944	Ga0207678_10002806	3300026067	Bacteria	15804
945	Ga0207678_10021820	3300026067	Bacteria	5616
946	Ga0207678_10068504	3300026067	Bacteria	3044
947	Ga0207678_10073973	3300026067	Bacteria	2920
948	Ga0207678_10209538	3300026067	Bacteria	1667
949	Ga0207678_10232911	3300026067	Bacteria	1577
950	Ga0207702_10002976	3300026078	Bacteria	15769
951	Ga0207702_10003235	3300026078	Bacteria	15049
952	Ga0207702_10003514	3300026078	Bacteria	14285
953	Ga0207702_10003558	3300026078	Bacteria	14181
954	Ga0207702_10004370	3300026078	Bacteria	12604
955	Ga0207702_10007704	3300026078	Bacteria	9146
956	Ga0207702_10055303	3300026078	Bacteria	3365
957	Ga0207702_10160675	3300026078	Bacteria	2051
958	Ga0207702_10220844	3300026078	Bacteria	1766
959	Ga0207702_10405557	3300026078	Bacteria	1315
960	Ga0207641_10000083	3300026088	Bacteria	134703
961	Ga0207641_10002451	3300026088	Bacteria	17145
962	Ga0207641_10003909	3300026088	Bacteria	13031
963	Ga0207641_10017101	3300026088	Bacteria	5932
964	Ga0207641_10017494	3300026088	Bacteria	5869
965	Ga0207641_10019452	3300026088	Bacteria	5575
966	Ga0207641_10027587	3300026088	Bacteria	4690
967	Ga0207641_10039452	3300026088	Bacteria	3949
968	Ga0207641_10074784	3300026088	Bacteria	2923
969	Ga0207641_10169154	3300026088	Bacteria	1993
970	Ga0207641_10217938	3300026088	Bacteria	1768
971	Ga0207648_10000539	3300026089	Bacteria	42198
972	Ga0207648_10001920	3300026089	Bacteria	22716
973	Ga0207648_10003180	3300026089	Bacteria	17299
974	Ga0207648_10018136	3300026089	Bacteria	6376
975	Ga0207676_10000682	3300026095	Bacteria	26975
976	Ga0207676_10007453	3300026095	Bacteria	7761
977	Ga0207676_10013258	3300026095	Bacteria	5920
978	Ga0207676_10021783	3300026095	Bacteria	4705
979	Ga0207676_10097200	3300026095	Bacteria	2432
980	Ga0207676_10106522	3300026095	Bacteria	2336
981	Ga0207676_10235499	3300026095	Bacteria	1639
982	Ga0207674_10000057	3300026116	Bacteria	113117
983	Ga0207674_10001685	3300026116	Bacteria	28374
984	Ga0207674_10004095	3300026116	Bacteria	17656
985	Ga0207674_10004812	3300026116	Bacteria	16172
986	Ga0207674_10010677	3300026116	Bacteria	10382
987	Ga0207674_10185978	3300026116	Bacteria	2028
988	Ga0207674_10246606	3300026116	Bacteria	1733
989	Ga0207674_10423570	3300026116	Bacteria	1286
990	Ga0207675_100000035	3300026118	Bacteria	95190
991	Ga0207675_100000788	3300026118	Bacteria	31511
992	Ga0207675_100006813	3300026118	Bacteria	10819
993	Ga0207675_100032307	3300026118	Bacteria	4875
994	Ga0207675_100160094	3300026118	Bacteria	2147
995	Ga0207675_100232290	3300026118	Bacteria	1780
996	Ga0207683_10000011	3300026121	Bacteria	140261
997	Ga0207683_10000056	3300026121	Bacteria	84718
998	Ga0207683_10001653	3300026121	Bacteria	19951
999	Ga0207683_10004594	3300026121	Bacteria	11896
1000	Ga0207683_10021895	3300026121	Bacteria	5482
1001	Ga0207683_10059655	3300026121	Bacteria	3351
1002	Ga0207683_10078364	3300026121	Bacteria	2928
1003	Ga0207683_10093422	3300026121	Bacteria	2681
1004	Ga0207683_10097024	3300026121	Bacteria	2628
1005	Ga0207683_10164952	3300026121	Bacteria	2004
1006	Ga0207683_10277466	3300026121	Bacteria	1531
1007	Ga0207698_10003157	3300026142	Bacteria	9881
1008	Ga0207698_10003571	3300026142	Bacteria	9385
1009	Ga0207698_10004990	3300026142	Bacteria	8137
1010	Ga0207698_10020075	3300026142	Bacteria	4591
1011	Ga0207698_10022204	3300026142	Bacteria	4405
1012	Ga0207698_10031525	3300026142	Bacteria	3827
1013	Ga0207698_10039839	3300026142	Bacteria	3484
1014	Ga0207698_10107283	3300026142	Bacteria	2331
1015	Ga0209281_1016477	3300027111	Bacteria	1518
1016	Ga0209371_1001735	3300027312	Bacteria	13734
1017	Ga0209983_1005370	3300027665	Bacteria	2657
1018	Ga0209282_1000117	3300027666	Bacteria	51134
1019	Ga0209974_10010143	3300027876	Bacteria	3182
1020	Ga0209974_10017296	3300027876	Bacteria	2392
1021	Ga0265354_1002072	3300028016	Bacteria	2603
1022	Ga0268266_10000294	3300028379	Bacteria	81573
1023	Ga0268266_10001305	3300028379	Bacteria	30304
1024	Ga0268266_10003602	3300028379	Bacteria	15321
1025	Ga0268266_10005753	3300028379	Bacteria	11477
1026	Ga0268266_10007280	3300028379	Bacteria	10007
1027	Ga0268266_10010165	3300028379	Bacteria	8246
1028	Ga0268266_10024339	3300028379	Bacteria	5151
1029	Ga0268266_10024458	3300028379	Bacteria	5135
1030	Ga0268266_10042546	3300028379	Bacteria	3880
1031	Ga0268266_10064779	3300028379	Bacteria	3158
1032	Ga0268266_10166439	3300028379	Bacteria	1998
1033	Ga0268266_10197821	3300028379	Bacteria	1838
1034	Ga0268266_10372331	3300028379	Bacteria	1345
1035	Ga0268265_10024680	3300028380	Bacteria	4257
1036	Ga0268265_10144119	3300028380	Bacteria	1998
1037	Ga0268264_10000122	3300028381	Bacteria	189690
1038	Ga0268264_10062896	3300028381	Bacteria	3118
1039	Ga0268264_10130439	3300028381	Bacteria	2227
1040	Ga0268264_10288953	3300028381	Bacteria	1539
1041	Ga0307517_10005566	3300028786	Bacteria	18930
1042	Ga0307517_10010807	3300028786	Bacteria	12729
1043	Ga0307517_10095841	3300028786	Bacteria	2383
1044	Ga0307517_10100285	3300028786	Bacteria	2288
1045	Ga0307515_10020065	3300028794	Bacteria	11965
1046	Ga0265338_10007927	3300028800	Bacteria	13010
1047	Ga0265338_10014337	3300028800	Bacteria	8828
1048	Ga0265338_10044342	3300028800	Bacteria	4108
1049	Ga0265324_10040719	3300029957	Bacteria	1609
1050	Ga0268256_1001423	3300030500	Bacteria	14442
1051	Ga0307511_10000807	3300030521	Bacteria	33428
1052	Ga0307512_10019834	3300030522	Bacteria	6112
1053	Ga0314311_1221697	3300030733	Bacteria	3668
1054	Ga0265330_10048383	3300031235	Bacteria	1870
1055	Ga0265332_10047551	3300031238	Bacteria	1846
1056	Ga0265320_10000355	3300031240	Bacteria	37294
1057	Ga0265325_10005621	3300031241	Bacteria	7720
1058	Ga0265325_10072959	3300031241	Bacteria	1719
1059	Ga0265340_10020837	3300031247	Bacteria	3364
1060	Ga0265340_10046361	3300031247	Bacteria	2121
1061	Ga0265339_10039365	3300031249	Bacteria	2632
1062	Ga0265339_10080609	3300031249	Bacteria	1721
1063	Ga0265331_10003639	3300031250	Bacteria	9842
1064	Ga0265331_10023910	3300031250	Bacteria	3098
1065	Ga0265327_10001207	3300031251	Bacteria	34828
1066	Ga0265327_10005282	3300031251	Bacteria	10861
1067	Ga0265327_10005528	3300031251	Bacteria	10507
1068	Ga0265327_10008299	3300031251	Bacteria	7772
1069	Ga0265327_10026274	3300031251	Bacteria	3376
1070	Ga0265327_10036808	3300031251	Bacteria	2686
1071	Ga0307513_10000008	3300031456	Bacteria	442128
1072	Ga0307513_10000025	3300031456	Bacteria	202918
1073	Ga0307513_10000090	3300031456	Bacteria	129750
1074	Ga0307513_10015280	3300031456	Bacteria	9314
1075	Ga0307513_10019901	3300031456	Bacteria	7975
1076	Ga0307513_10086321	3300031456	Bacteria	3217
1077	Ga0307513_10206790	3300031456	Bacteria	1798
1078	Ga0307509_10000013	3300031507	Bacteria	283027
1079	Ga0307509_10000115	3300031507	Bacteria	116444
1080	Ga0307509_10000157	3300031507	Bacteria	106022
1081	Ga0307509_10134735	3300031507	Bacteria	2418
1082	Ga0307408_100008740	3300031548	Bacteria	6686
1083	Ga0265313_10007597	3300031595	Bacteria	7362
1084	Ga0307508_10000048	3300031616	Bacteria	137587
1085	Ga0307508_10040955	3300031616	Bacteria	4159
1086	Ga0307514_10004434	3300031649	Bacteria	12921
1087	Ga0265314_10004074	3300031711	Bacteria	13788
1088	Ga0265314_10020128	3300031711	Bacteria	5154
1089	Ga0265314_10054654	3300031711	Bacteria	2762
1090	Ga0316576_10065662	3300031727	Bacteria	2667
1091	Ga0316578_10130252	3300031728	Bacteria	1513
1092	Ga0307516_10002914	3300031730	Bacteria	22412
1093	Ga0307516_10011226	3300031730	Bacteria	9768
1094	Ga0307516_10015664	3300031730	Bacteria	7970
1095	Ga0307516_10198933	3300031730	Bacteria	1725
1096	Ga0307405_10027621	3300031731	Bacteria	3293
1097	Ga0307410_10139017	3300031852	Bacteria	1794
1098	Ga0307406_10063264	3300031901	Bacteria	2396
1099	Ga0307412_10000103	3300031911	Bacteria	69660
1100	Ga0307412_10001832	3300031911	Bacteria	11782
1101	Ga0307412_10028266	3300031911	Bacteria	3506
1102	Ga0307412_10029439	3300031911	Bacteria	3446
1103	Ga0307412_10070130	3300031911	Bacteria	2388
1104	Ga0307412_10098195	3300031911	Bacteria	2065
1105	Ga0307412_10248132	3300031911	Bacteria	1381
1106	Ga0307409_100053482	3300031995	Bacteria	3102
1107	Ga0307416_100071715	3300032002	Bacteria	2879
1108	Ga0307416_100160966	3300032002	Bacteria	2075
1109	Ga0307416_100223291	3300032002	Bacteria	1809
1110	Ga0307414_10008178	3300032004	Bacteria	5916
1111	Ga0307414_10014744	3300032004	Bacteria	4697
1112	Ga0307414_10066730	3300032004	Bacteria	2573
1113	Ga0307414_10110982	3300032004	Bacteria	2087
1114	Ga0307411_10017807	3300032005	Bacteria	4060
1115	Ga0307411_10084636	3300032005	Bacteria	2194
1116	Ga0307411_10192696	3300032005	Bacteria	1558
1117	Ga0307415_100017628	3300032126	Bacteria	4286
1118	Ga0307507_10051626	3300033179	Bacteria	3954
1119	Ga0307510_10000013	3300033180	Bacteria	274569
1120	Ga0307510_10000883	3300033180	Bacteria	31532
1121	Ga0307510_10002279	3300033180	Bacteria	21639
1122	Ga0307510_10003490	3300033180	Bacteria	18320
1123	Ga0307510_10004406	3300033180	Bacteria	16565
1124	Ga0373944_0004575	3300035089	Bacteria	3611
1125	Ga0373936_0001148	3300035113	Bacteria	9499
1126	Ga0373955_0020950	3300035172	Bacteria	3293
1127	Ga0316574_0025334	3300035398	Bacteria	3559
1128	Ga0373931_0019909	3300035691	Bacteria	3354
1129	Ga0373931_0046877	3300035691	Bacteria	2286
1130	Ga0373937_0024239	3300036401	Bacteria	5470
1131	Ga0373937_0169349	3300036401	Bacteria	2049
1132	Ga0316584_0008521	3300036712	Bacteria	7067
1133	Ga0316584_0113273	3300036712	Bacteria	2029
1134	Ga0373925_0015482	3300037068	Bacteria	5514
1135	Ga0395899_0000003	3300037312	Bacteria	1232684
1136	Ga0395899_0003573	3300037312	Bacteria	12310
1137	Ga0395899_0012488	3300037312	Bacteria	6507
1138	Ga0395899_0023022	3300037312	Bacteria	4720
1139	Ga0395899_0024731	3300037312	Bacteria	4539
1140	Ga0395899_0042175	3300037312	Bacteria	3407
1141	Ga0395899_0054251	3300037312	Bacteria	2966
1142	Ga0395899_0074946	3300037312	Bacteria	2472
1143	Ga0395900_0000666	3300037418	Bacteria	45776
1144	Ga0395900_0022058	3300037418	Bacteria	6513
1145	Ga0395900_0041744	3300037418	Bacteria	4728
1146	Ga0395900_0060740	3300037418	Bacteria	3888
1147	Ga0395900_0064878	3300037418	Bacteria	3751
1148	Ga0395900_0072277	3300037418	Bacteria	3547
1149	Ga0395900_0079069	3300037418	Bacteria	3379
1150	Ga0395900_0104858	3300037418	Bacteria	2904
1151	Ga0395900_0121241	3300037418	Bacteria	2683
1152	Ga0395900_0157902	3300037418	Bacteria	2315
1153	Ga0395900_0170360	3300037418	Bacteria	2217
1154	Ga0395900_0206632	3300037418	Bacteria	1984
1155	Ga0395900_0213647	3300037418	Bacteria	1947
1156	Ga0395900_0220335	3300037418	Bacteria	1912
1157	Ga0395900_0242015	3300037418	Bacteria	1809
1158	Ga0395900_0269457	3300037418	Bacteria	1698
1159	Ga0395898_0007101	3300037466	Bacteria	11895
1160	Ga0395898_0066657	3300037466	Bacteria	3487
1161	Ga0395898_0116953	3300037466	Bacteria	2555
1162	Ga0395898_0119298	3300037466	Bacteria	2526
1163	Ga0395898_0120161	3300037466	Bacteria	2517
1164	Ga0395898_0134474	3300037466	Bacteria	2367
1165	Ga0395898_0175997	3300037466	Bacteria	2045
1166	Ga0395898_0301130	3300037466	Bacteria	1529
1167	Ga0395898_0315060	3300037466	Bacteria	1493
1168	Ga0395905_0000160	3300037471	Bacteria	111265
1169	Ga0395905_0000292	3300037471	Bacteria	73325
1170	Ga0395905_0001115	3300037471	Bacteria	33668
1171	Ga0395905_0007930	3300037471	Bacteria	10504
1172	Ga0395905_0083255	3300037471	Bacteria	2997
1173	Ga0395905_0093050	3300037471	Bacteria	2827
1174	Ga0395905_0106513	3300037471	Bacteria	2632
1175	Ga0395905_0111863	3300037471	Bacteria	2564
1176	Ga0395905_0234086	3300037471	Bacteria	1717
1177	Ga0395905_0252912	3300037471	Bacteria	1646
1178	Ga0395901_0011007	3300038443	Bacteria	9164
1179	Ga0395901_0013048	3300038443	Bacteria	8433
1180	Ga0395901_0014769	3300038443	Bacteria	7936
1181	Ga0395901_0030397	3300038443	Bacteria	5565
1182	Ga0395901_0056403	3300038443	Bacteria	4086
1183	Ga0395901_0095674	3300038443	Bacteria	3112
1184	Ga0436365_0350000	3300039437	Bacteria	5752
1185	Ga0436365_1326958	3300039437	Bacteria	40452
1186	Ga0436365_1539887	3300039437	Bacteria	15340
1187	Ga0436361_0091005	3300039447	Bacteria	3750
1188	Ga0436361_0114864	3300039447	Bacteria	33465
1189	Ga0436361_0310288	3300039447	Bacteria	6871
1190	Ga0436361_0776771	3300039447	Bacteria	4398
1191	Ga0436363_1583895	3300039450	Bacteria	2839
1192	Ga0439436_0006401	3300041404	Bacteria	3616
1193	Ga0439461_0000019	3300041410	Bacteria	21229
1194	Ga0439465_0005348	3300041413	Bacteria	4100
1195	Ga0451802_1749538	3300041460	Bacteria	2445
1196	Ga0451841_1155968	3300041498	Bacteria	1899
1197	Ga0439442_017972	3300042002	Bacteria	1461
1198	Ga0439445_0000383	3300042004	Bacteria	8904
1199	Ga0439448_0009829	3300042005	Bacteria	2825
1200	Ga0439449_0000151	3300042007	Bacteria	23575
1201	Ga0439449_0000721	3300042007	Bacteria	12660
1202	Ga0439455_0006755	3300042012	Bacteria	2398
1203	Ga0439462_0011796	3300042015	Bacteria	2228
1204	Ga0450920_015282	3300042122	Bacteria	1460
1205	Ga0439446_0009067	3300042156	Bacteria	2656
1206	Ga0439446_0017679	3300042156	Bacteria	1994
1207	Ga0439458_0000141	3300042157	Bacteria	15503
1208	Ga0439458_0000286	3300042157	Bacteria	12553
1209	Ga0450909_003630	3300042185	Bacteria	2194
1210	Ga0439435_0016718	3300042436	Bacteria	1844
1211	Ga0439459_0006838	3300042438	Bacteria	1911
1212	Ga0466969_0008123	3300044656	Bacteria	5571
1213	Ga0466969_0018356	3300044656	Bacteria	3645
1214	Ga0466969_0025292	3300044656	Bacteria	3053
1215	Ga0466969_0032656	3300044656	Bacteria	2646
1216	Ga0466969_0064896	3300044656	Bacteria	1766
1217	Ga0466973_0137933	3300044659	Bacteria	1963
1218	Ga0466966_0000003	3300044684	Bacteria	233677
1219	Ga0466966_0000150	3300044684	Bacteria	44602
1220	Ga0466966_0000460	3300044684	Bacteria	26111
1221	Ga0466966_0000631	3300044684	Bacteria	22399
1222	Ga0466966_0012484	3300044684	Bacteria	5627
1223	Ga0466966_0042697	3300044684	Bacteria	2909
1224	Ga0466966_0168795	3300044684	Bacteria	1330
1225	Ga0466961_0000818	3300044693	Bacteria	19426
1226	Ga0466961_0179577	3300044693	Bacteria	1314
1227	Ga0466963_0024139	3300044694	Bacteria	3869
1228	Ga0466963_0029567	3300044694	Bacteria	3528
1229	Ga0466963_0057983	3300044694	Bacteria	2580
1230	Ga0453684_0095605	3300044712	Bacteria	3651
1231	Ga0466971_0011531	3300044719	Bacteria	3869
1232	Ga0466971_0018741	3300044719	Bacteria	3068
1233	Ga0466968_0020272	3300044735	Bacteria	2682
1234	Ga0466970_0000842	3300044765	Bacteria	14765
1235	Ga0466957_0003081	3300044842	Bacteria	9076
1236	Ga0466957_0127143	3300044842	Bacteria	1629
1237	Ga0466957_0148325	3300044842	Bacteria	1515
1238	Ga0466959_0000278	3300045049	Bacteria	31260
1239	Ga0466959_0005862	3300045049	Bacteria	8458
1240	Ga0466959_0009841	3300045049	Bacteria	6812
1241	Ga0466959_0031155	3300045049	Bacteria	3947
1242	Ga0466959_0036375	3300045049	Bacteria	3638
1243	Ga0451576_0033817	3300045051	Bacteria	5432
1244	Ga0451576_0053562	3300045051	Bacteria	4226
1245	Ga0466958_0000393	3300045836	Bacteria	17891
1246	Ga0466958_0001402	3300045836	Bacteria	11396
1247	Ga0466958_0002715	3300045836	Bacteria	8971
1248	Ga0466958_0010891	3300045836	Bacteria	5107
1249	Ga0466958_0013331	3300045836	Bacteria	4678
1250	Ga0466967_0146084	3300045976	Bacteria	2206
1251	Ga0466967_0153645	3300045976	Bacteria	2154
1252	Ga0466967_0299848	3300045976	Bacteria	1546
1253	Ga0495627_000697	3300046453	Bacteria	25632
1254	Ga0495627_006378	3300046453	Bacteria	4628
1255	Ga0495592_0000058	3300046454	Bacteria	101492
1256	Ga0495592_0161873	3300046454	Bacteria	1539
1257	Ga0495590_0008988	3300046457	Bacteria	3796
1258	Ga0495638_0000062	3300046460	Bacteria	188223
1259	Ga0495638_0000131	3300046460	Bacteria	120792
1260	Ga0495638_0000594	3300046460	Bacteria	40799
1261	Ga0495638_0001016	3300046460	Bacteria	27896
1262	Ga0495638_0001137	3300046460	Bacteria	25724
1263	Ga0495638_0002556	3300046460	Bacteria	14747
1264	Ga0495638_0004025	3300046460	Bacteria	11274
1265	Ga0495638_0004982	3300046460	Bacteria	9959
1266	Ga0495638_0026030	3300046460	Bacteria	3797
1267	Ga0495638_0051815	3300046460	Bacteria	2559
1268	Ga0495638_0102303	3300046460	Bacteria	1712
1269	Ga0495651_0027986	3300046462	Bacteria	4394
1270	Ga0495650_0000017	3300046471	Bacteria	542552
1271	Ga0495650_0003194	3300046471	Bacteria	12206
1272	Ga0495580_0003833	3300046472	Bacteria	12715
1273	Ga0495580_0146634	3300046472	Bacteria	1636
1274	Ga0495582_0088578	3300046473	Bacteria	1724
1275	Ga0495639_0000527	3300046475	Bacteria	17920
1276	Ga0495585_0030810	3300046492	Bacteria	3050
1277	Ga0495607_0000134	3300046501	Bacteria	78370
1278	Ga0495607_0066696	3300046501	Bacteria	2024
1279	Ga0495583_0000002	3300046506	Bacteria	782521
1280	Ga0495583_0000088	3300046506	Bacteria	164073
1281	Ga0495583_0060997	3300046506	Bacteria	1684
1282	Ga0495606_0000791	3300046507	Bacteria	48283
1283	Ga0495606_0006752	3300046507	Bacteria	10501
1284	Ga0495606_0045810	3300046507	Bacteria	2895
1285	Ga0495610_0000058	3300046512	Bacteria	137991
1286	Ga0495610_0000189	3300046512	Bacteria	69205
1287	Ga0495610_0000391	3300046512	Bacteria	45340
1288	Ga0495610_0001390	3300046512	Bacteria	21508
1289	Ga0495610_0010332	3300046512	Bacteria	5813
1290	Ga0495610_0011353	3300046512	Bacteria	5454
1291	Ga0495616_0000366	3300046513	Bacteria	35310
1292	Ga0495616_0000464	3300046513	Bacteria	30834
1293	Ga0495620_0003015	3300046515	Bacteria	9690
1294	Ga0495620_0012162	3300046515	Bacteria	4461
1295	Ga0495620_0045067	3300046515	Bacteria	1913
1296	Ga0495631_0091771	3300046518	Bacteria	1307
1297	Ga0495632_0001528	3300046519	Bacteria	19096
1298	Ga0495632_0002101	3300046519	Bacteria	15577
1299	Ga0495632_0007012	3300046519	Bacteria	7148
1300	Ga0495632_0042827	3300046519	Bacteria	2267
1301	Ga0495637_0006003	3300046520	Bacteria	6138
1302	Ga0495643_0000004	3300046522	Bacteria	519944
1303	Ga0495648_0000068	3300046524	Bacteria	138518
1304	Ga0495663_0012007	3300046525	Bacteria	2414
1305	Ga0495642_0004602	3300046528	Bacteria	5344
1306	Ga0495654_0000012	3300046530	Bacteria	328997
1307	Ga0495654_0066923	3300046530	Bacteria	1711
1308	Ga0495598_0000856	3300046537	Bacteria	5850
1309	Ga0495645_0097158	3300046543	Bacteria	2098
1310	Ga0495622_0010827	3300046557	Bacteria	4209
1311	Ga0495633_0002329	3300046558	Bacteria	13502
1312	Ga0495668_0000047	3300046616	Bacteria	224140
1313	Ga0495668_0000229	3300046616	Bacteria	80748
1314	Ga0495668_0007252	3300046616	Bacteria	7114
1315	Ga0495668_0009513	3300046616	Bacteria	5963
1316	Ga0495668_0017152	3300046616	Bacteria	4205
1317	Ga0495668_0042796	3300046616	Bacteria	2521
1318	Ga0495625_0000011	3300046660	Bacteria	377120
1319	Ga0495625_0000044	3300046660	Bacteria	203855
1320	Ga0495625_0001529	3300046660	Bacteria	27646
1321	Ga0495625_0002225	3300046660	Bacteria	21445
1322	Ga0495625_0002257	3300046660	Bacteria	21188
1323	Ga0495625_0002406	3300046660	Bacteria	20283
1324	Ga0495625_0033197	3300046660	Bacteria	3819
1325	Ga0495625_0083426	3300046660	Bacteria	2221
1326	Ga0495588_0001981	3300046674	Bacteria	8759
1327	Ga0495658_0094153	3300046683	Bacteria	1778
1328	Ga0495670_0000002	3300046691	Bacteria	601814
1329	Ga0495670_0000003	3300046691	Bacteria	326779
1330	Ga0495670_0000008	3300046691	Bacteria	219555
1331	Ga0495670_0000048	3300046691	Bacteria	64848
1332	Ga0495649_0000785	3300046694	Bacteria	25518
1333	Ga0495649_0002553	3300046694	Bacteria	12758
1334	Ga0495649_0051666	3300046694	Bacteria	2229
1335	Ga0495589_0011465	3300046794	Bacteria	4602
1336	Ga0495589_0021159	3300046794	Bacteria	3324
1337	Ga0495589_0043894	3300046794	Bacteria	2225
1338	Ga0495660_0054497	3300046810	Bacteria	2166
1339	Ga0495672_0014921	3300047320	Bacteria	5296
1340	Ga0495687_000722	3300047443	Bacteria	36591
1341	Ga0495687_001915	3300047443	Bacteria	17872
1342	Ga0495687_002495	3300047443	Bacteria	14668
1343	Ga0495679_001475	3300047446	Bacteria	13310
1344	Ga0495673_0000039	3300047469	Bacteria	301943
1345	Ga0495673_0000083	3300047469	Bacteria	198298
1346	Ga0495673_0000259	3300047469	Bacteria	73662
1347	Ga0495673_0000887	3300047469	Bacteria	27526
1348	Ga0495673_0001084	3300047469	Bacteria	23777
1349	Ga0495673_0001368	3300047469	Bacteria	19686
1350	Ga0495681_0002581	3300047470	Bacteria	12867
1351	Ga0495681_0013862	3300047470	Bacteria	4659
1352	Ga0495686_0004411	3300047472	Bacteria	11591
1353	Ga0495686_0004759	3300047472	Bacteria	10982
1354	Ga0495686_0005604	3300047472	Bacteria	9862
1355	Ga0495686_0033712	3300047472	Bacteria	3304
1356	Ga0495686_0144727	3300047472	Bacteria	1400
1357	Ga0495615_0000010	3300048090	Bacteria	70447
1358	Ga0496100_0013140	3300048903	Bacteria	4767
1359	Ga0496101_0006346	3300048904	Bacteria	7612
1360	Ga0496101_0010070	3300048904	Bacteria	6232
1361	Ga0496101_0018958	3300048904	Bacteria	4688
1362	Ga0496102_0009395	3300048905	Bacteria	8402
1363	Ga0496102_0029228	3300048905	Bacteria	4930
1364	Ga0496102_0237473	3300048905	Bacteria	1719
1365	Ga0496102_0250413	3300048905	Bacteria	1670
1366	Ga0496103_0015995	3300048906	Bacteria	4475
1367	Ga0496103_0072577	3300048906	Bacteria	2156
1368	Ga0496103_0136569	3300048906	Bacteria	1567
1369	Ga0496104_0001915	3300048907	Bacteria	18040
1370	Ga0496105_0006470	3300048908	Bacteria	9006
1371	Ga0496106_0006396	3300048909	Bacteria	8719
1372	Ga0496106_0008837	3300048909	Bacteria	7445
1373	Ga0496106_0022938	3300048909	Bacteria	4635
1374	Ga0496106_0023641	3300048909	Bacteria	4566
1375	Ga0496106_0070163	3300048909	Bacteria	2676
1376	Ga0496107_0000084	3300048910	Bacteria	45057
1377	Ga0496107_0012198	3300048910	Bacteria	5997
1378	Ga0496107_0052332	3300048910	Bacteria	2945
1379	Ga0496108_0003380	3300048911	Bacteria	12809
1380	Ga0496108_0035916	3300048911	Bacteria	4122
1381	Ga0496109_0000846	3300048912	Bacteria	25595
1382	Ga0496109_0034822	3300048912	Bacteria	4538
1383	Ga0496109_0072460	3300048912	Bacteria	3165
1384	Ga0496110_0001550	3300048913	Bacteria	16736
1385	Ga0496110_0016630	3300048913	Bacteria	6144
1386	Ga0496111_0142265	3300048914	Bacteria	1778
1387	Ga0496112_0042767	3300048915	Bacteria	4434
1388	Ga0496112_0280174	3300048915	Bacteria	1615
1389	Ga0496114_0000284	3300048917	Bacteria	36897
1390	Ga0496114_0001148	3300048917	Bacteria	20009
1391	Ga0496114_0096892	3300048917	Bacteria	2512
1392	Ga0496115_0000096	3300048918	Bacteria	82735
1393	Ga0496115_0003764	3300048918	Bacteria	10900
1394	Ga0496116_0003017	3300048919	Bacteria	17055
1395	Ga0496116_0007761	3300048919	Bacteria	9437
1396	Ga0496117_0000220	3300048920	Bacteria	109644
1397	Ga0496117_0009415	3300048920	Bacteria	9090
1398	Ga0496118_0000028	3300048921	Bacteria	366490
1399	Ga0496118_0020167	3300048921	Bacteria	5922
1400	Ga0496118_0150380	3300048921	Bacteria	1458
1401	Ga0496119_0011498	3300048922	Bacteria	7319
1402	Ga0496119_0013406	3300048922	Bacteria	6534
1403	Ga0496120_0000115	3300048923	Bacteria	136364
1404	Ga0496120_0005063	3300048923	Bacteria	10674
1405	Ga0496120_0007023	3300048923	Bacteria	8461
1406	Ga0496121_0000628	3300048924	Bacteria	65856
1407	Ga0496121_0000797	3300048924	Bacteria	57614
1408	Ga0496121_0000808	3300048924	Bacteria	57011
1409	Ga0496121_0001528	3300048924	Bacteria	38735
1410	Ga0496121_0001717	3300048924	Bacteria	35824
1411	Ga0496121_0003126	3300048924	Bacteria	23911
1412	Ga0496121_0012279	3300048924	Bacteria	9374
1413	Ga0496121_0019809	3300048924	Bacteria	6703
1414	Ga0496121_0042195	3300048924	Bacteria	3973
1415	Ga0496121_0152750	3300048924	Bacteria	1697
1416	Ga0496122_0001889	3300048925	Bacteria	31699
1417	Ga0496122_0002417	3300048925	Bacteria	26574
1418	Ga0496122_0017870	3300048925	Bacteria	6591
1419	Ga0496122_0037885	3300048925	Bacteria	3872
1420	Ga0496122_0087749	3300048925	Bacteria	2136
1421	Ga0496123_0000345	3300048926	Bacteria	87307
1422	Ga0496123_0001035	3300048926	Bacteria	42221
1423	Ga0496123_0003544	3300048926	Bacteria	17339
1424	Ga0496124_0000038	3300048927	Bacteria	312485
1425	Ga0496124_0000131	3300048927	Bacteria	156256
1426	Ga0496124_0001648	3300048927	Bacteria	31950
1427	Ga0496124_0011508	3300048927	Bacteria	8836
1428	Ga0496124_0033163	3300048927	Bacteria	4546
1429	Ga0496124_0046161	3300048927	Bacteria	3732
1430	Ga0496125_0001627	3300048928	Bacteria	31652
1431	Ga0496125_0002468	3300048928	Bacteria	24011
1432	Ga0496125_0002893	3300048928	Bacteria	21630
1433	Ga0496125_0010340	3300048928	Bacteria	9439
1434	Ga0496125_0023087	3300048928	Bacteria	5754
1435	Ga0496125_0023647	3300048928	Bacteria	5667
1436	Ga0496126_0000432	3300048929	Bacteria	84190
1437	Ga0496126_0015550	3300048929	Bacteria	7647
1438	Ga0496126_0020908	3300048929	Bacteria	6406
1439	Ga0496126_0038897	3300048929	Bacteria	4421
1440	Ga0495682_0003157	3300049460	Bacteria	7429
1441	Ga0501300_001187	3300049523	Bacteria	3947
1442	Ga0501033_0001221	3300049570	Bacteria	23081
1443	Ga0501034_0015804	3300049571	Bacteria	7753
1444	Ga0501034_0051674	3300049571	Bacteria	4144
1445	Ga0501034_0061222	3300049571	Bacteria	3781
1446	Ga0501034_0072078	3300049571	Bacteria	3464
1447	Ga0501034_0227188	3300049571	Bacteria	1817
1448	Ga0501043_0021875	3300049579	Bacteria	5015
1449	Ga0501046_0033430	3300049580	Bacteria	4155
1450	Ga0501046_0142260	3300049580	Bacteria	1814
1451	Ga0501047_0000243	3300049581	Bacteria	64639
1452	Ga0501047_0000779	3300049581	Bacteria	33349
1453	Ga0501047_0012653	3300049581	Bacteria	7993
1454	Ga0501067_0013969	3300049583	Bacteria	4448
1455	Ga0501067_0045748	3300049583	Bacteria	2429
1456	Ga0501069_0020556	3300049585	Bacteria	3577
1457	Ga0501070_0010636	3300049586	Bacteria	7777
1458	Ga0501072_0026435	3300049588	Bacteria	4525
1459	Ga0501073_0004008	3300049589	Bacteria	11061
1460	Ga0501073_0009324	3300049589	Bacteria	7242
1461	Ga0501224_000897	3300049664	Bacteria	3830
1462	Ga0501238_002068	3300049671	Bacteria	2363
1463	Ga0501249_000220	3300049679	Bacteria	17314
1464	Ga0501249_002048	3300049679	Bacteria	4102
1465	Ga0501080_0004792	3300049742	Bacteria	12065
1466	Ga0501266_000064	3300049763	Bacteria	16070
1467	Ga0501035_0007791	3300049822	Bacteria	10008
1468	Ga0501035_0037168	3300049822	Bacteria	4411
1469	Ga0501035_0040409	3300049822	Bacteria	4215
1470	Ga0501035_0099771	3300049822	Bacteria	2549
1471	Ga0501044_0000646	3300049823	Bacteria	42149
1472	Ga0501044_0002337	3300049823	Bacteria	21622
1473	Ga0501044_0082916	3300049823	Bacteria	3243
1474	Ga0501044_0094418	3300049823	Bacteria	3016
1475	nmdc:mga03683_12483_c1	3300050489	Bacteria	3105
1476	nmdc:mga03683_14246_c1	3300050489	Bacteria	2939
1477	nmdc:mga03n38_15265_c1	3300050490	Bacteria	2962
1478	nmdc:mga00v17_120288_c1	3300050491	Bacteria	1478
1479	nmdc:mga00v17_129955_c1	3300050491	Bacteria	1609
1480	nmdc:mga0k408_16275_c1	3300050493	Bacteria	4124
1481	nmdc:mga0k408_22854_c1	3300050493	Bacteria	3524
1482	nmdc:mga0k408_5470_c1	3300050493	Bacteria	6762
1483	nmdc:mga0k408_8_c1	3300050493	Bacteria	161211
1484	nmdc:mga07m45_2222_c1	3300050496	Bacteria	9069
1485	nmdc:mga07m45_3969_c1	3300050496	Bacteria	7192
1486	nmdc:mga07m45_45156_c1	3300050496	Bacteria	2474
1487	nmdc:mga07m45_4560_c1	3300050496	Bacteria	6785
1488	nmdc:mga07m45_6709_c1	3300050496	Bacteria	5841
1489	nmdc:mga07m45_9406_c1	3300050496	Bacteria	5069
1490	nmdc:mga07m45_9421_c1	3300050496	Bacteria	5067
1491	nmdc:mga05p37_106532_c1	3300050507	Bacteria	3449
1492	nmdc:mga05p37_1439_c1	3300050507	Bacteria	27650
1493	nmdc:mga05p37_297165_c1	3300050507	Bacteria	1920
1494	nmdc:mga09592_2173_c1	3300050508	Bacteria	15815
1495	nmdc:mga09592_225412_c1	3300050508	Bacteria	1624
1496	nmdc:mga0qj67_576_c1	3300050509	Bacteria	25025
1497	nmdc:mga06r32_246_c1	3300050510	Bacteria	44586
1498	nmdc:mga08y16_72741_c1	3300050511	Bacteria	3582
1499	nmdc:mga0sz30_20174_c1	3300050516	Bacteria	2686
1500	nmdc:mga0sz30_6322_c1	3300050516	Bacteria	3297
1501	Ga0495601_0041426	3300053077	Bacteria	2887
1502	Ga0500635_0020271	3300053080	Bacteria	2035
1503	Ga0500578_0000030	3300053086	Bacteria	140063
1504	Ga0500643_000008	3300053087	Bacteria	457931
1505	Ga0500643_003643	3300053087	Bacteria	7297
1506	Ga0500644_0000015	3300053088	Bacteria	108763
1507	Ga0500644_0000122	3300053088	Bacteria	48036
1508	Ga0500644_0011996	3300053088	Bacteria	2384
1509	Ga0500583_0035284	3300053092	Bacteria	2230
1510	Ga0500651_0077391	3300053093	Bacteria	2064
1511	Ga0500641_0011423	3300053096	Bacteria	3223
1512	Ga0500641_0021004	3300053096	Bacteria	2483
1513	Ga0500641_0033277	3300053096	Bacteria	2045
1514	Ga0500641_0034697	3300053096	Bacteria	2010
1515	Ga0500650_0057936	3300053098	Bacteria	1807
1516	Ga0500556_0001406	3300053104	Bacteria	10467
1517	Ga0500562_000331	3300053108	Bacteria	11349
1518	Ga0500562_003243	3300053108	Bacteria	4064
1519	Ga0500572_001673	3300053111	Bacteria	5801
1520	Ga0500593_000946	3300053117	Bacteria	10692
1521	Ga0500594_0000077	3300053118	Bacteria	30827
1522	Ga0500594_0032797	3300053118	Bacteria	1378
1523	Ga0500595_000805	3300053119	Bacteria	18136
1524	Ga0500595_012781	3300053119	Bacteria	3235
1525	Ga0500607_000025	3300053121	Bacteria	95473
1526	Ga0500607_000065	3300053121	Bacteria	74437
1527	Ga0500608_000102	3300053122	Bacteria	34987
1528	Ga0500608_000179	3300053122	Bacteria	25858
1529	Ga0500608_000731	3300053122	Bacteria	11996
1530	Ga0500614_010045	3300053123	Bacteria	2027
1531	Ga0500618_000022	3300053125	Bacteria	157907
1532	Ga0500618_000692	3300053125	Bacteria	19846
1533	Ga0500642_0065419	3300053130	Bacteria	1643
1534	Ga0500559_0000326	3300053136	Bacteria	35945
1535	Ga0500559_0000458	3300053136	Bacteria	28993
1536	Ga0500559_0002218	3300053136	Bacteria	10267
1537	Ga0500559_0009611	3300053136	Bacteria	4177
1538	Ga0500559_0026878	3300053136	Bacteria	2454
1539	Ga0500564_000052	3300053138	Bacteria	30288
1540	Ga0500568_0008486	3300053139	Bacteria	4945
1541	Ga0500573_0000009	3300053140	Bacteria	230823
1542	Ga0500577_0004774	3300053142	Bacteria	3607
1543	Ga0500588_0035656	3300053146	Bacteria	1465
1544	Ga0500604_0000021	3300053151	Bacteria	72909
1545	Ga0500616_0000018	3300053153	Bacteria	610976
1546	Ga0500616_0000101	3300053153	Bacteria	172722
1547	Ga0500622_0000867	3300053156	Bacteria	25738
1548	Ga0500622_0001267	3300053156	Bacteria	20613
1549	Ga0500622_0002373	3300053156	Bacteria	13666
1550	Ga0500622_0004224	3300053156	Bacteria	9145
1551	Ga0500622_0015839	3300053156	Bacteria	4036
1552	Ga0500627_0026946	3300053158	Bacteria	2376
1553	Ga0500636_0001428	3300053177	Bacteria	13017
1554	Ga0500636_0073632	3300053177	Bacteria	1978
1555	Ga0500637_0008779	3300053178	Bacteria	5116
1556	Ga0500645_000659	3300053730	Bacteria	21659
1557	Ga0500645_001373	3300053730	Bacteria	12495
1558	Ga0500645_005314	3300053730	Bacteria	4767
1559	Ga0500645_006086	3300053730	Bacteria	4350
1560	Ga0500609_000850	3300053731	Bacteria	4583
1561	Ga0500661_000356	3300055283	Bacteria	8385
1562	Ga0590074_002219	3300059423	Bacteria	3187
1563	Ga0590075_000584	3300059424	Bacteria	9835
1564	Ga0590075_009822	3300059424	Bacteria	2297
1565	Ga0590077_000284	3300059426	Bacteria	14374
1566	Ga0587077_000079	3300059493	Bacteria	5171
1567	Ga0587090_007721	3300059510	Bacteria	1421
1568	Ga0587101_003826	3300059623	Bacteria	1561
1569	Ga0587076_003427	3300059645	Bacteria	1889
1570	Ga0587107_001717	3300059652	Bacteria	1836
1571	Ga0501082_0290744	3300060353	Bacteria	1423
1572	Ga0466962_0001618	3300061719	Bacteria	10553
1573	Ga0466962_0004596	3300061719	Bacteria	6621
1574	Ga0466962_0012568	3300061719	Bacteria	4071
1575	Ga0466962_0019374	3300061719	Bacteria	3270
1576	Ga0466962_0036308	3300061719	Bacteria	2358
1577	2511123453	2510917020	Bacteria	5657507
1578	2511124814	2510917020	Bacteria	5657507
1579	2511242519	2511231002	Bacteria	5042903
1580	2511248756	2511231003	Bacteria	5606035
1581	2513228664	2513020051	Bacteria	6053213
1582	2515689830	2515154123	Bacteria	6387382
1583	2524614018	2524023250	Bacteria	5457705
1584	2548497880	2547132374	Bacteria	5530232
1585	2550697430	2548876994	Bacteria	4904866
1586	2585148324	2582581279	Bacteria	4980720
1587	2585151343	2582581280	Bacteria	5994497
1588	2585153569	2582581280	Bacteria	5994497
1589	2585196056	2582581293	Bacteria	5907401
1590	2585197373	2582581293	Bacteria	5907401
1591	2585324386	2582581315	Bacteria	7318924
1592	2585332622	2582581316	Bacteria	7774528
1593	2599623839	2599185214	Bacteria	8209958
1594	2599671542	2599185226	Bacteria	8233575
1595	2599681445	2599185227	Bacteria	8246414
1596	2599693152	2599185229	Bacteria	8216126
1597	2599904727	2599185292	Bacteria	6290804
1598	2616552979	2615840698	Bacteria	7319877
1599	2643730174	2643221541	Bacteria	5498788
1600	2643751574	2643221545	Bacteria	5083237
1601	2643780208	2643221552	Bacteria	5708754
1602	2643782627	2643221552	Bacteria	5708754
1603	2643836466	2643221563	Bacteria	4726935
1604	2643857209	2643221568	Bacteria	5187270
1605	2643861270	2643221569	Bacteria	6064337
1606	2643924710	2643221583	Bacteria	5218014
1607	2643925045	2643221583	Bacteria	5218014
1608	2643928597	2643221584	Bacteria	5511711
1609	2643928838	2643221584	Bacteria	5511711
1610	2643951519	2643221588	Bacteria	3692460
1611	2643983053	2643221594	Bacteria	5811388
1612	2644045661	2643221606	Bacteria	5588032
1613	2644052943	2643221608	Bacteria	4724829
1614	2644120617	2643221621	Bacteria	6212786
1615	2644126563	2643221622	Bacteria	4212502
1616	2644163302	2643221628	Bacteria	5745828
1617	2644327709	2643221658	Bacteria	6064537
1618	2644392714	2643221671	Bacteria	5496681
1619	2644400397	2643221672	Bacteria	6322190
1620	2644511333	2643221691	Bacteria	5093099
1621	2644649505	2643221717	Bacteria	5676132
1622	2738712817	2738541275	Bacteria	4830863
1623	2738713433	2738541276	Bacteria	4690596
1624	2738851241	2738541301	Bacteria	4834102
1625	2738866971	2738541304	Bacteria	4833665
1626	2738879457	2738541307	Bacteria	8606193
1627	2739299488	2738543022	Bacteria	4835059
1628	2739361167	2738543033	Bacteria	4833336
1629	2739651082	2739367664	Bacteria	4114334
1630	2739733019	2739367700	Bacteria	4747630
1631	2739794031	2739367756	Bacteria	4553612
1632	2740029555	2739367865	Bacteria	4114482
1633	2792459872	2791355048	Bacteria	5832535
1634	2792463823	2791355048	Bacteria	5832535
1635	2809032822	2808606395	Bacteria	6020352
1636	2809065051	2808606401	Bacteria	4586670
1637	2809080985	2808606404	Bacteria	4652788
1638	2809085350	2808606405	Bacteria	4586632
1639	2816508257	2816332139	Bacteria	9138787
1640	2816509202	2816332139	Bacteria	9138787
1641	2819536698	2818991435	Bacteria	5433759
1642	2819537071	2818991435	Bacteria	5433759
1643	2819594793	2818991445	Bacteria	4955017
1644	2819645483	2818991454	Bacteria	5563326
1645	2819645859	2818991454	Bacteria	5563326
1646	2819683225	2818991461	Bacteria	7026071
1647	2819712955	2818991466	Bacteria	4748179
1648	2842485651	2842482326	Bacteria	7212537
1649	2843744536	2843744320	Bacteria	5659202
1650	2843747568	2843744320	Bacteria	5659202
1651	2848297891	2848297114	Bacteria	3608511
1652	2849563367	2849560528	Bacteria	5393480
1653	2849563903	2849560528	Bacteria	5393480
1654	2849565123	2849560528	Bacteria	5393480
1655	2849575617	2849573788	Bacteria	5421256
1656	2849578200	2849573788	Bacteria	5421256
1657	2849578732	2849573788	Bacteria	5421256
1658	2851154446	2851153111	Bacteria	5542585
1659	2851156016	2851153111	Bacteria	5542585
1660	2857506904	2857504554	Bacteria	5369913
1661	2857540632	2857537821	Bacteria	5248181
1662	2857578387	2857576091	Bacteria	5465855
1663	2858954132	2858950400	Bacteria	6783797
1664	2879166906	2879163058	Bacteria	4223965
1665	2880522524	2880518877	Bacteria	5012590
1666	2884813654	2884811622	Bacteria	5552861
1667	2884841301	2884836552	Bacteria	5219991
1668	2884856175	2884852848	Bacteria	5221161
1669	2884962541	2884960567	Bacteria	5437054
1670	2885204580	2885198086	Bacteria	7212419
1671	2885218233	2885211737	Bacteria	7212420
1672	2896156899	2896154374	Bacteria	5221518
1673	2896187014	2896184354	Bacteria	3258548
1674	2896256481	2896253425	Bacteria	3418029
1675	2898331680	2898329390	Bacteria	5168154
1676	2898333839	2898329390	Bacteria	5168154
1677	2919143601	2919138771	Bacteria	5281312
1678	2919170353	2919166419	Bacteria	4952238
1679	2919707388	2919704043	Bacteria	5560311
1680	2919710824	2919709256	Bacteria	4318106
1681	2928071604	2928070936	Bacteria	8062541
1682	2928103440	2928100450	Bacteria	4837635
1683	2928962478	2928959182	Bacteria	4725774
1684	2928967888	2928963466	Bacteria	5165703
1685	2928969018	2928968154	Bacteria	4633371
1686	2939589257	2939582691	Bacteria	7088898
1687	2941482959
1688	2945977360	2945972063	Bacteria	6086495
1689	2946789498	2946787523	Bacteria	4366789
1690	2990047176	2990044586	Bacteria	6603797
1691	8005683595	8005682033	Bacteria	6726518
1692	8054306957	8054302542	Bacteria	5698134
1693	Ga0395905_0172995
1694	SwRhRL2b_contig_1366519
1695	ARcpr5oldR_c000853
1696	JGI24737J22298_10002493
1697	JGI24737J22298_10002934
1698	JGI24737J22298_10024862
1699	JGI25155J39150_1000492
1700	JGI25155J39150_1000666
1701	JGI25156J39149_1000469
1702	JGI25156J39149_1009526
1703	JGI25162J39368_1001063
1704	JGI25154J39366_1000074
1705	JGI25154J39366_1001030
1706	JGI25157J39369_1000746
1707	JGI25152J39213_1000149
1708	JGI25159J45721_1009405
1709	JGI25151J46595_10000460
1710	JGI25151J46595_10003628
1711	JGI25151J46595_10017507
1712	JGI25406J46586_10005583
1713	JGI25165J46597_1000017
1714	JGI25153J46596_10000028
1715	JGI25153J46596_10000228
1716	JGI25153J46596_10000443
1717	JGI25153J46596_10003274
1718	rootL2_10034900
1719	rootH1_10037188
1720	rootH1_10063010
1721	Ga0055539_1001708
1722	Ga0055532_1000271
1723	Ga0055535_1007540
1724	Ga0055542_1000220
1725	Ga0055526_1001349
1726	Ga0055526_1002751
1727	Ga0055526_1024675
1728	Ga0055537_1000181
1729	Ga0055537_1000190
1730	Ga0055537_1000258
1731	Ga0055537_1001843
1732	Ga0055537_1003196
1733	Ga0055537_1006839
1734	Ga0055524_1001862
1735	Ga0055524_1001893
1736	Ga0055524_1003472
1737	Ga0055524_1006380
1738	Ga0055536_1000380
1739	Ga0055536_1005980
1740	Ga0055536_1012626
1741	Ga0055534_1000244
1742	Ga0055534_1001636
1743	Ga0055534_1002600
1744	Ga0055528_1000244
1745	Ga0055528_1002980
1746	Ga0055528_1010588
1747	Ga0055528_1017916
1748	Ga0055530_10000623
1749	Ga0055530_10001386
1750	Ga0055530_10005653
1751	Ga0055530_10019037
1752	Ga0055540_1000365
1753	Ga0055540_1001751
1754	Ga0055540_1003214
1755	Ga0055531_10000454
1756	Ga0055531_10000619
1757	Ga0055531_10000761
1758	Ga0055531_10001499
1759	Ga0055531_10001677
1760	Ga0055531_10001884
1761	Ga0055531_10003581
1762	Ga0055531_10006449
1763	Ga0055531_10019272
1764	Ga0065165_1000388
1765	Ga0065165_1000459
1766	Ga0065165_1000624
1767	Ga0065165_1001720
1768	Ga0065165_1003670
1769	Ga0065165_1007078
1770	Ga0065165_1020691
1771	Ga0065165_1022037
1772	Ga0065165_1033664
1773	Ga0065714_10068469
1774	Ga0065712_10003097
1775	Ga0065715_10092098
1776	Ga0065707_10015231
1777	Ga0065707_10082041
1778	Ga0070658_10000003
1779	Ga0070658_10010131
1780	Ga0070658_10035712
1781	Ga0070676_10017807
1782	Ga0070676_10050647
1783	Ga0070683_100005671
1784	Ga0070683_100050394
1785	Ga0070683_100069831
1786	Ga0070683_100116410
1787	Ga0070683_100377978
1788	Ga0070690_100000760
1789	Ga0070690_100009324
1790	Ga0070690_100010350
1791	Ga0070670_100007720
1792	Ga0070670_100014900
1793	Ga0070670_100040070
1794	Ga0070670_100075308
1795	Ga0070677_10000608
1796	Ga0068869_100003816
1797	Ga0068869_100007189
1798	Ga0068869_100008887
1799	Ga0068869_100017347
1800	Ga0070666_10001213
1801	Ga0070666_10010982
1802	Ga0070666_10034385
1803	Ga0070666_10077249
1804	Ga0070666_10111188
1805	Ga0070666_10134087
1806	Ga0070680_100000486
1807	Ga0070680_100033008
1808	Ga0070680_100138341
1809	Ga0070682_100025672
1810	Ga0070682_100046565
1811	Ga0070682_100051582
1812	Ga0070682_100071185
1813	Ga0068868_100002139
1814	Ga0068868_100010171
1815	Ga0068868_100011868
1816	Ga0068868_100033294
1817	Ga0068868_100075658
1818	Ga0070660_100001129
1819	Ga0070660_100057966
1820	Ga0070660_100124329
1821	Ga0070689_100006295
1822	Ga0070689_100007201
1823	Ga0070689_100023621
1824	Ga0070687_100006008
1825	Ga0070687_100012161
1826	Ga0070661_100001230
1827	Ga0070661_100002081
1828	Ga0070661_100021580
1829	Ga0070661_100038939
1830	Ga0070661_100048461
1831	Ga0070661_100104682
1832	Ga0070661_100124374
1833	Ga0070661_100138018
1834	Ga0070692_10021271
1835	Ga0070692_10026927
1836	Ga0070668_100007259
1837	Ga0070668_100089225
1838	Ga0070675_100001429
1839	Ga0070675_100012957
1840	Ga0070675_100020253
1841	Ga0070675_100060015
1842	Ga0070675_100194315
1843	Ga0070671_100003510
1844	Ga0070671_100011597
1845	Ga0070671_100012123
1846	Ga0070671_100012305
1847	Ga0070671_100012722
1848	Ga0070671_100026318
1849	Ga0070671_100053259
1850	Ga0070671_100112559
1851	Ga0070671_100229145
1852	Ga0070671_100238374
1853	Ga0070674_100008653
1854	Ga0070674_100010475
1855	Ga0070673_100001040
1856	Ga0070673_100001616
1857	Ga0070673_100005127
1858	Ga0070673_100006976
1859	Ga0070673_100010696
1860	Ga0070673_100016683
1861	Ga0070673_100174841
1862	Ga0070688_100002180
1863	Ga0070688_100005709
1864	Ga0070688_100049728
1865	Ga0070659_100000573
1866	Ga0070659_100000810
1867	Ga0070659_100002619
1868	Ga0070659_100007434
1869	Ga0070659_100007624
1870	Ga0070659_100009273
1871	Ga0070659_100009361
1872	Ga0070659_100018627
1873	Ga0070659_100028609
1874	Ga0070659_100087149
1875	Ga0070667_100012250
1876	Ga0070667_100029317
1877	Ga0070667_100031248
1878	Ga0070667_100043400
1879	Ga0070667_100062925
1880	Ga0070667_100181212
1881	Ga0070709_10001313
1882	Ga0070709_10128339
1883	Ga0070714_100000752
1884	Ga0070714_100006600
1885	Ga0070714_100209464
1886	Ga0070713_100001999
1887	Ga0070713_100173183
1888	Ga0070710_10005118
1889	Ga0070711_100055919
1890	Ga0070705_100001028
1891	Ga0070694_100040420
1892	Ga0070708_100000166
1893	Ga0070708_100007988
1894	Ga0070708_100099797
1895	Ga0070663_100000203
1896	Ga0070663_100005089
1897	Ga0070663_100006141
1898	Ga0070663_100043303
1899	Ga0070663_100055093
1900	Ga0070678_100000394
1901	Ga0070678_100015496
1902	Ga0070678_100022840
1903	Ga0070678_100030549
1904	Ga0070678_100059157
1905	Ga0070678_100133124
1906	Ga0070662_100000263
1907	Ga0070662_100012466
1908	Ga0070662_100028820
1909	Ga0070662_100074093
1910	Ga0070681_10000836
1911	Ga0070681_10002347
1912	Ga0070681_10004413
1913	Ga0070681_10005270
1914	Ga0070681_10007663
1915	Ga0070681_10015372
1916	Ga0070681_10015548
1917	Ga0070681_10168532
1918	Ga0070681_10204591
1919	Ga0070681_10235689
1920	Ga0068867_100004473
1921	Ga0068867_100006063
1922	Ga0068867_100036002
1923	Ga0068867_100061145
1924	Ga0068867_100153920
1925	Ga0070685_10003615
1926	Ga0070685_10079823
1927	Ga0070706_100000406
1928	Ga0070698_100100578
1929	Ga0070699_100015056
1930	Ga0070679_100001821
1931	Ga0070679_100002376
1932	Ga0070679_100081260
1933	Ga0070679_100090522
1934	Ga0070679_100136992
1935	Ga0070679_100188501
1936	Ga0070679_100228496
1937	Ga0070684_100006754
1938	Ga0070684_100020078
1939	Ga0070684_100148594
1940	Ga0070697_100000305
1941	Ga0068853_100002315
1942	Ga0068853_100005714
1943	Ga0068853_100006078
1944	Ga0068853_100008789
1945	Ga0068853_100038104
1946	Ga0068853_100042636
1947	Ga0068853_100263601
1948	Ga0070672_100000434
1949	Ga0070672_100007079
1950	Ga0070672_100019282
1951	Ga0070672_100191284
1952	Ga0070672_100277770
1953	Ga0070686_100000056
1954	Ga0070686_100000900
1955	Ga0070686_100010192
1956	Ga0070695_100005220
1957	Ga0070696_100009040
1958	Ga0070696_100214811
1959	Ga0070665_100000410
1960	Ga0070665_100000797
1961	Ga0070665_100001158
1962	Ga0070665_100002535
1963	Ga0070665_100007703
1964	Ga0070665_100010279
1965	Ga0070665_100017708
1966	Ga0070665_100020520
1967	Ga0070665_100028711
1968	Ga0070665_100029366
1969	Ga0070665_100125522
1970	Ga0070665_100273960
1971	Ga0070704_100014641
1972	Ga0068855_100002884
1973	Ga0068855_100004405
1974	Ga0068855_100005830
1975	Ga0068855_100006693
1976	Ga0068855_100008902
1977	Ga0068855_100009627
1978	Ga0068855_100026176
1979	Ga0068855_100034879
1980	Ga0068855_100062923
1981	Ga0068855_100067548
1982	Ga0070664_100001553
1983	Ga0070664_100005604
1984	Ga0070664_100011401
1985	Ga0070664_100020486
1986	Ga0070664_100020875
1987	Ga0070664_100024044
1988	Ga0070664_100042243
1989	Ga0070664_100051409
1990	Ga0070664_100064995
1991	Ga0068857_100000426
1992	Ga0068857_100006305
1993	Ga0068857_100082141
1994	Ga0068857_100194120
1995	Ga0068854_100001244
1996	Ga0068854_100016983
1997	Ga0068854_100017846
1998	Ga0068854_100025953
1999	Ga0068854_100102599
2000	Ga0068854_100112311
2001	Ga0068856_100002865
2002	Ga0068856_100007739
2003	Ga0068856_100017786
2004	Ga0068856_100020839
2005	Ga0068856_100026010
2006	Ga0068856_100053661
2007	Ga0068856_100080574
2008	Ga0068856_100191561
2009	Ga0068856_100226385
2010	Ga0068856_100264443
2011	Ga0070702_100003738
2012	Ga0068852_100000645
2013	Ga0068852_100003973
2014	Ga0068852_100004821
2015	Ga0068852_100022368
2016	Ga0068852_100026804
2017	Ga0068852_100032761
2018	Ga0068852_100130788
2019	Ga0068852_100145761
2020	Ga0068852_100249360
2021	Ga0068859_100006936
2022	Ga0068859_100007186
2023	Ga0068859_100015131
2024	Ga0068859_100025615
2025	Ga0068859_100032051
2026	Ga0068859_100085389
2027	Ga0068859_100148456
2028	Ga0068859_100282206
2029	Ga0068864_100001368
2030	Ga0068864_100006206
2031	Ga0068864_100007639
2032	Ga0068864_100013011
2033	Ga0068864_100015364
2034	Ga0068864_100018684
2035	Ga0068864_100166055
2036	Ga0068864_100203661
2037	Ga0068864_100208605
2038	Ga0068864_100219217
2039	Ga0068864_100262236
2040	Ga0068866_10004233
2041	Ga0068866_10059245
2042	Ga0068861_100000422
2043	Ga0068861_100003244
2044	Ga0068861_100014705
2045	Ga0068861_100019811
2046	Ga0068861_100186934
2047	Ga0068851_10005624
2048	Ga0068851_10052685
2049	Ga0068870_10002487
2050	Ga0068863_100001700
2051	Ga0068863_100004769
2052	Ga0068863_100005061
2053	Ga0068863_100005547
2054	Ga0068863_100006237
2055	Ga0068863_100009189
2056	Ga0068863_100031848
2057	Ga0068863_100040066
2058	Ga0068863_100057653
2059	Ga0068863_100111021
2060	Ga0068863_100382194
2061	Ga0068858_100000285
2062	Ga0068858_100008510
2063	Ga0068858_100064666
2064	Ga0068858_100136820
2065	Ga0068858_100157832
2066	Ga0068860_100002304
2067	Ga0068860_100005318
2068	Ga0068860_100025478
2069	Ga0068862_100007725
2070	Ga0068862_100039426
2071	Ga0081455_10084542
2072	Ga0081539_10000016
2073	Ga0081539_10001341
2074	Ga0070717_10042611
2075	Ga0075365_10051670
2076	Ga0075364_10080552
2077	Ga0075432_10000255
2078	Ga0070712_100120428
2079	Ga0075362_10006800
2080	Ga0075362_10008343
2081	Ga0075362_10034516
2082	Ga0075369_10008933
2083	Ga0075366_10000006
2084	Ga0075366_10004916
2085	Ga0075366_10016082
2086	Ga0075366_10016541
2087	Ga0075366_10039576
2088	Ga0075366_10055772
2089	Ga0097621_100001110
2090	Ga0097621_100003658
2091	Ga0097621_100018013
2092	Ga0097621_100053615
2093	Ga0075370_10002088
2094	Ga0075370_10003210
2095	Ga0075370_10013693
2096	Ga0075370_10030332
2097	Ga0075370_10092694
2098	Ga0068871_100000906
2099	Ga0068871_100006129
2100	Ga0068871_100010058
2101	Ga0068871_100047062
2102	Ga0068871_100121645
2103	Ga0068871_100133270
2104	Ga0075428_100000324
2105	Ga0075430_100000353
2106	Ga0075431_100022080
2107	Ga0075429_100000223
2108	Ga0068865_100077452
2109	Ga0068865_100116222
2110	Ga0068865_100190237
2111	Ga0075436_100187727
2112	Ga0097620_100006936
2113	Ga0097620_100007186
2114	Ga0097620_100015131
2115	Ga0097620_100025616
2116	Ga0097620_100032050
2117	Ga0097620_100085385
2118	Ga0097620_100148463
2119	Ga0097620_100282189
2120	Ga0079104_1004917
2121	Ga0079104_1013938
2122	Ga0099826_10000044
2123	Ga0099794_10004246
2124	Ga0099795_10000911
2125	Ga0105244_10000642
2126	Ga0105240_10001659
2127	Ga0105240_10002265
2128	Ga0105240_10006438
2129	Ga0105240_10009082
2130	Ga0105240_10011595
2131	Ga0105240_10013066
2132	Ga0105240_10019713
2133	Ga0105240_10021602
2134	Ga0105240_10023300
2135	Ga0105240_10042497
2136	Ga0105240_10051541
2137	Ga0105240_10052291
2138	Ga0105240_10079130
2139	Ga0105240_10085585
2140	Ga0105240_10125054
2141	Ga0105240_10136895
2142	Ga0105240_10275683
2143	Ga0105240_10320332
2144	Ga0105240_10353798
2145	Ga0111539_10087206
2146	Ga0105245_10216231
2147	Ga0105247_10000072
2148	Ga0105247_10008481
2149	Ga0105247_10094687
2150	Ga0114129_10000496
2151	Ga0114129_10024439
2152	Ga0114129_10070914
2153	Ga0114129_10075488
2154	Ga0114129_10272122
2155	Ga0114129_10290008
2156	Ga0105243_10000101
2157	Ga0105243_10058423
2158	Ga0105243_10150060
2159	Ga0105241_10011179
2160	Ga0105241_10029224
2161	Ga0105242_10033779
2162	Ga0105242_10216309
2163	Ga0105242_10302463
2164	Ga0105248_10001807
2165	Ga0105248_10004607
2166	Ga0105248_10013964
2167	Ga0105248_10080806
2168	Ga0105248_10084937
2169	Ga0105248_10222916
2170	Ga0105248_10291279
2171	Ga0105237_10000964
2172	Ga0105237_10011550
2173	Ga0105237_10044087
2174	Ga0105237_10070984
2175	Ga0105237_10077478
2176	Ga0105238_10000890
2177	Ga0105238_10116916
2178	Ga0105238_10178599
2179	Ga0105238_10303780
2180	Ga0105238_10355294
2181	Ga0105249_10002234
2182	Ga0105249_10021116
2183	Ga0105249_10022459
2184	Ga0105249_10026213
2185	Ga0105249_10027362
2186	Ga0099796_10000215
2187	Ga0105239_10000104
2188	Ga0105239_10087056
2189	Ga0105239_10107448
2190	Ga0105239_10172033
2191	Ga0105246_10000280
2192	Ga0105246_10002072
2193	Ga0105246_10069554
2194	Ga0157373_10001267
2195	Ga0157373_10002009
2196	Ga0157373_10002608
2197	Ga0157373_10010362
2198	Ga0157373_10014745
2199	Ga0157373_10021376
2200	Ga0157373_10104005
2201	Ga0157371_10000394
2202	Ga0157371_10000920
2203	Ga0157371_10002707
2204	Ga0157371_10004781
2205	Ga0157371_10113262
2206	Ga0157371_10121044
2207	Ga0157370_10000298
2208	Ga0157370_10000903
2209	Ga0157370_10004665
2210	Ga0157370_10004913
2211	Ga0157370_10027941
2212	Ga0157370_10119441
2213	Ga0157369_10000106
2214	Ga0157369_10005094
2215	Ga0157369_10006620
2216	Ga0157369_10035865
2217	Ga0157369_10169875
2218	Ga0157369_10177566
2219	Ga0157369_10180927
2220	Ga0157369_10216827
2221	Ga0157369_10271551
2222	Ga0157369_10280316
2223	Ga0157374_10002013
2224	Ga0157374_10009865
2225	Ga0157374_10054324
2226	Ga0157374_10123415
2227	Ga0157374_10220411
2228	Ga0157378_10035985
2229	Ga0157378_10105507
2230	Ga0163162_10000014
2231	Ga0163162_10020638
2232	Ga0163162_10045392
2233	Ga0163162_10106104
2234	Ga0163162_10127005
2235	Ga0163162_10129046
2236	Ga0157372_10001357
2237	Ga0157372_10008276
2238	Ga0157372_10027735
2239	Ga0157372_10041153
2240	Ga0157372_10061834
2241	Ga0157372_10148881
2242	Ga0157372_10184423
2243	Ga0157372_10302973
2244	Ga0157372_10351405
2245	Ga0157372_10357002
2246	Ga0157372_10360573
2247	Ga0157375_10007281
2248	Ga0157375_10089952
2249	Ga0157375_10273130
2250	Ga0163163_10012522
2251	Ga0163163_10013729
2252	Ga0163163_10015122
2253	Ga0163163_10021154
2254	Ga0163163_10036792
2255	Ga0163163_10060932
2256	Ga0163163_10071134
2257	Ga0163163_10133086
2258	Ga0182008_10000794
2259	Ga0182008_10058901
2260	Ga0157377_10000648
2261	Ga0157377_10000885
2262	Ga0157379_10004399
2263	Ga0157379_10028290
2264	Ga0157379_10036576
2265	Ga0157379_10047908
2266	Ga0157379_10061085
2267	Ga0157379_10101971
2268	Ga0157379_10110392
2269	Ga0157379_10266779
2270	Ga0157376_10010255
2271	Ga0157376_10019973
2272	Ga0157376_10158794
2273	Ga0157376_10199087
2274	Ga0182006_1000690
2275	Ga0182007_10000223
2276	Ga0182007_10021920
2277	Ga0183365_10001
2278	Ga0163161_10003289
2279	Ga0163161_10013749
2280	Ga0163161_10015506
2281	Ga0213872_10001447
2282	Ga0213872_10034457
2283	Ga0213876_10000145
2284	Ga0213876_10006681
2285	Ga0209435_100018
2286	Ga0209147_100051
2287	Ga0207427_100614
2288	Ga0209437_100145
2289	Ga0209437_100338
2290	Ga0209258_100882
2291	Ga0209258_101305
2292	Ga0207425_1000005
2293	Ga0207425_1000559
2294	Ga0207425_1003414
2295	Ga0209646_1000081
2296	Ga0209646_1000090
2297	Ga0209026_1000042
2298	Ga0209026_1001479
2299	Ga0209026_1007896
2300	Ga0209148_1000002
2301	Ga0209759_1000109
2302	Ga0209759_1000613
2303	Ga0209129_1000281
2304	Ga0209129_1000649
2305	Ga0209233_1000006
2306	Ga0209233_1001086
2307	Ga0209565_1000010
2308	Ga0209565_1000021
2309	Ga0209565_1000047
2310	Ga0209565_1000049
2311	Ga0209565_1000056
2312	Ga0209565_1000132
2313	Ga0209565_1000278
2314	Ga0209565_1000652
2315	Ga0209455_1006376
2316	Ga0209455_1008189
2317	Ga0209673_1000079
2318	Ga0209673_1000693
2319	Ga0209673_1000712
2320	Ga0209673_1000871
2321	Ga0209673_1001168
2322	Ga0209673_1005918
2323	Ga0209130_1000890
2324	Ga0207673_1002117
2325	Ga0209675_1000046
2326	Ga0209675_1000149
2327	Ga0209675_1000423
2328	Ga0209675_1004103
2329	Ga0209675_1013229
2330	Ga0209675_1013952
2331	Ga0209676_1000014
2332	Ga0209676_1000215
2333	Ga0209676_1000383
2334	Ga0209676_1000729
2335	Ga0209676_1004890
2336	Ga0209025_1000464
2337	Ga0209025_1000522
2338	Ga0209025_1001835
2339	Ga0209025_1020008
2340	Ga0209025_1027207
2341	Ga0209564_1000455
2342	Ga0209564_1000502
2343	Ga0209564_1001019
2344	Ga0209564_1001045
2345	Ga0209564_1001385
2346	Ga0209564_1001672
2347	Ga0209564_1002205
2348	Ga0209564_1002819
2349	Ga0209564_1006465
2350	Ga0209758_1000002
2351	Ga0209758_1000036
2352	Ga0209758_1000215
2353	Ga0209758_1000571
2354	Ga0209758_1000665
2355	Ga0209758_1001434
2356	Ga0209758_1001627
2357	Ga0209758_1002481
2358	Ga0209758_1004197
2359	Ga0209758_1007612
2360	Ga0209758_1029521
2361	Ga0209050_1000005
2362	Ga0209050_1000010
2363	Ga0209050_1000049
2364	Ga0209050_1000952
2365	Ga0209050_1001027
2366	Ga0209050_1001756
2367	Ga0209050_1003532
2368	Ga0209050_1004312
2369	Ga0209050_1008063
2370	Ga0209050_1016438
2371	Ga0209256_1000034
2372	Ga0209256_1000625
2373	Ga0209256_1003283
2374	Ga0209256_1004009
2375	Ga0209256_1004857
2376	Ga0209256_1006395
2377	Ga0209256_1022222
2378	Ga0207426_1000591
2379	Ga0209051_1000213
2380	Ga0209051_1000259
2381	Ga0209051_1000967
2382	Ga0209257_1000009
2383	Ga0209257_1000116
2384	Ga0209257_1000187
2385	Ga0209257_1000313
2386	Ga0209257_1000330
2387	Ga0209257_1000373
2388	Ga0209257_1001706
2389	Ga0209257_1001867
2390	Ga0209257_1003323
2391	Ga0209257_1003466
2392	Ga0209257_1010418
2393	Ga0209257_1010684
2394	Ga0209257_1017565
2395	Ga0207697_10001102
2396	Ga0207697_10003235
2397	Ga0207655_1001085
2398	Ga0207682_10000298
2399	Ga0207682_10001189
2400	Ga0207692_10037501
2401	Ga0207710_10000303
2402	Ga0207710_10051563
2403	Ga0207688_10015554
2404	Ga0207688_10067486
2405	Ga0207688_10068867
2406	Ga0207680_10009591
2407	Ga0207680_10024492
2408	Ga0207680_10097432
2409	Ga0207647_10003210
2410	Ga0207647_10036661
2411	Ga0207647_10074746
2412	Ga0207647_10132433
2413	Ga0207647_10141578
2414	Ga0207699_10017688
2415	Ga0207699_10112413
2416	Ga0207699_10149813
2417	Ga0207645_10002299
2418	Ga0207645_10002475
2419	Ga0207645_10007419
2420	Ga0207645_10045034
2421	Ga0207643_10000777
2422	Ga0207643_10014040
2423	Ga0207705_10000005
2424	Ga0207705_10000151
2425	Ga0207705_10000784
2426	Ga0207705_10001518
2427	Ga0207705_10008057
2428	Ga0207705_10047193
2429	Ga0207705_10079362
2430	Ga0207705_10116517
2431	Ga0207684_10004628
2432	Ga0207654_10003207
2433	Ga0207707_10000130
2434	Ga0207707_10003768
2435	Ga0207707_10012372
2436	Ga0207707_10013033
2437	Ga0207707_10048983
2438	Ga0207707_10234804
2439	Ga0207707_10245181
2440	Ga0207695_10001490
2441	Ga0207695_10001758
2442	Ga0207695_10012887
2443	Ga0207695_10022902
2444	Ga0207695_10046664
2445	Ga0207695_10051834
2446	Ga0207695_10053233
2447	Ga0207695_10064125
2448	Ga0207695_10064827
2449	Ga0207695_10067952
2450	Ga0207695_10073524
2451	Ga0207695_10175981
2452	Ga0207695_10201850
2453	Ga0207671_10001460
2454	Ga0207671_10071977
2455	Ga0207671_10151483
2456	Ga0207663_10051633
2457	Ga0207660_10026013
2458	Ga0207660_10110250
2459	Ga0207660_10205668
2460	Ga0207662_10000433
2461	Ga0207662_10011828
2462	Ga0207662_10019435
2463	Ga0207657_10000709
2464	Ga0207657_10001164
2465	Ga0207657_10001175
2466	Ga0207657_10003788
2467	Ga0207657_10003995
2468	Ga0207657_10004237
2469	Ga0207657_10008100
2470	Ga0207657_10053495
2471	Ga0207657_10082443
2472	Ga0207657_10092211
2473	Ga0207649_10000607
2474	Ga0207649_10001103
2475	Ga0207649_10003552
2476	Ga0207649_10005799
2477	Ga0207649_10007340
2478	Ga0207649_10014273
2479	Ga0207649_10015081
2480	Ga0207649_10072765
2481	Ga0207649_10176362
2482	Ga0207652_10002942
2483	Ga0207652_10043601
2484	Ga0207652_10048516
2485	Ga0207652_10060027
2486	Ga0207652_10118939
2487	Ga0207652_10135438
2488	Ga0207652_10140668
2489	Ga0207652_10174988
2490	Ga0207681_10010289
2491	Ga0207681_10037420
2492	Ga0207681_10071635
2493	Ga0207694_10002264
2494	Ga0207694_10048209
2495	Ga0207694_10056115
2496	Ga0207694_10162752
2497	Ga0207694_10192974
2498	Ga0207650_10002369
2499	Ga0207650_10004490
2500	Ga0207650_10005284
2501	Ga0207650_10014502
2502	Ga0207650_10109498
2503	Ga0207650_10260303
2504	Ga0207659_10002875
2505	Ga0207659_10003272
2506	Ga0207659_10004738
2507	Ga0207659_10009581
2508	Ga0207659_10022335
2509	Ga0207687_10141241
2510	Ga0207700_10000031
2511	Ga0207700_10249356
2512	Ga0207664_10001913
2513	Ga0207664_10058108
2514	Ga0207664_10177893
2515	Ga0207644_10001473
2516	Ga0207644_10002148
2517	Ga0207644_10004524
2518	Ga0207644_10009006
2519	Ga0207644_10009250
2520	Ga0207644_10010564
2521	Ga0207644_10023840
2522	Ga0207644_10080034
2523	Ga0207690_10000889
2524	Ga0207690_10000946
2525	Ga0207690_10004206
2526	Ga0207690_10005864
2527	Ga0207690_10015434
2528	Ga0207690_10035700
2529	Ga0207690_10063673
2530	Ga0207690_10080820
2531	Ga0207706_10000002
2532	Ga0207706_10001587
2533	Ga0207706_10001696
2534	Ga0207706_10004253
2535	Ga0207706_10004458
2536	Ga0207709_10000103
2537	Ga0207709_10001788
2538	Ga0207709_10198943
2539	Ga0207670_10014766
2540	Ga0207670_10019324
2541	Ga0207670_10113689
2542	Ga0207669_10014186
2543	Ga0207669_10204671
2544	Ga0207691_10000006
2545	Ga0207691_10002316
2546	Ga0207691_10006366
2547	Ga0207691_10006549
2548	Ga0207691_10015590
2549	Ga0207691_10022325
2550	Ga0207691_10040919
2551	Ga0207691_10099589
2552	Ga0207711_10005564
2553	Ga0207711_10007443
2554	Ga0207711_10019796
2555	Ga0207711_10020986
2556	Ga0207711_10022643
2557	Ga0207711_10279046
2558	Ga0207689_10000898
2559	Ga0207689_10003096
2560	Ga0207689_10014984
2561	Ga0207689_10068838
2562	Ga0207689_10188121
2563	Ga0207661_10051637
2564	Ga0207661_10053374
2565	Ga0207661_10070643
2566	Ga0207661_10100895
2567	Ga0207679_10001025
2568	Ga0207679_10006569
2569	Ga0207679_10023257
2570	Ga0207679_10025307
2571	Ga0207679_10025541
2572	Ga0207679_10061157
2573	Ga0207679_10070766
2574	Ga0207679_10089132
2575	Ga0207679_10105265
2576	Ga0207679_10154195
2577	Ga0207667_10002497
2578	Ga0207667_10005026
2579	Ga0207667_10008687
2580	Ga0207667_10009443
2581	Ga0207667_10010048
2582	Ga0207667_10013275
2583	Ga0207667_10024837
2584	Ga0207667_10044730
2585	Ga0207667_10058132
2586	Ga0207667_10071494
2587	Ga0207667_10074579
2588	Ga0207667_10093796
2589	Ga0207667_10104786
2590	Ga0207667_10323233
2591	Ga0207667_10407600
2592	Ga0207651_10008743
2593	Ga0207651_10013074
2594	Ga0207651_10019678
2595	Ga0207651_10034743
2596	Ga0207651_10055664
2597	Ga0207651_10140000
2598	Ga0207712_10026321
2599	Ga0207712_10034445
2600	Ga0207712_10067008
2601	Ga0207712_10197083
2602	Ga0207668_10003112
2603	Ga0207640_10000455
2604	Ga0207640_10013811
2605	Ga0207640_10026813
2606	Ga0207640_10042514
2607	Ga0207640_10099183
2608	Ga0207640_10247179
2609	Ga0207658_10002011
2610	Ga0207658_10008113
2611	Ga0207658_10011056
2612	Ga0207658_10111697
2613	Ga0207658_10170601
2614	Ga0207658_10174633
2615	Ga0207677_10001239
2616	Ga0207677_10022458
2617	Ga0207677_10029121
2618	Ga0207677_10169867
2619	Ga0207703_10001223
2620	Ga0207703_10005459
2621	Ga0207703_10013908
2622	Ga0207703_10066695
2623	Ga0207703_10073636
2624	Ga0207703_10134253
2625	Ga0207703_10207782
2626	Ga0207639_10010877
2627	Ga0207639_10027941
2628	Ga0207639_10033738
2629	Ga0207639_10065731
2630	Ga0207639_10104901
2631	Ga0207639_10150970
2632	Ga0207639_10236001
2633	Ga0207639_10251124
2634	Ga0207678_10000491
2635	Ga0207678_10001355
2636	Ga0207678_10002806
2637	Ga0207678_10021820
2638	Ga0207678_10068504
2639	Ga0207678_10073973
2640	Ga0207678_10209538
2641	Ga0207678_10232911
2642	Ga0207702_10002976
2643	Ga0207702_10003235
2644	Ga0207702_10003514
2645	Ga0207702_10003558
2646	Ga0207702_10004370
2647	Ga0207702_10007704
2648	Ga0207702_10055303
2649	Ga0207702_10160675
2650	Ga0207702_10220844
2651	Ga0207702_10405557
2652	Ga0207641_10000083
2653	Ga0207641_10002451
2654	Ga0207641_10003909
2655	Ga0207641_10017101
2656	Ga0207641_10017494
2657	Ga0207641_10019452
2658	Ga0207641_10027587
2659	Ga0207641_10039452
2660	Ga0207641_10074784
2661	Ga0207641_10169154
2662	Ga0207641_10217938
2663	Ga0207648_10000539
2664	Ga0207648_10001920
2665	Ga0207648_10003180
2666	Ga0207648_10018136
2667	Ga0207676_10000682
2668	Ga0207676_10007453
2669	Ga0207676_10013258
2670	Ga0207676_10021783
2671	Ga0207676_10097200
2672	Ga0207676_10106522
2673	Ga0207676_10235499
2674	Ga0207674_10000057
2675	Ga0207674_10001685
2676	Ga0207674_10004095
2677	Ga0207674_10004812
2678	Ga0207674_10010677
2679	Ga0207674_10185978
2680	Ga0207674_10246606
2681	Ga0207674_10423570
2682	Ga0207675_100000035
2683	Ga0207675_100000788
2684	Ga0207675_100006813
2685	Ga0207675_100032307
2686	Ga0207675_100160094
2687	Ga0207675_100232290
2688	Ga0207683_10000011
2689	Ga0207683_10000056
2690	Ga0207683_10001653
2691	Ga0207683_10004594
2692	Ga0207683_10021895
2693	Ga0207683_10059655
2694	Ga0207683_10078364
2695	Ga0207683_10093422
2696	Ga0207683_10097024
2697	Ga0207683_10164952
2698	Ga0207683_10277466
2699	Ga0207698_10003157
2700	Ga0207698_10003571
2701	Ga0207698_10004990
2702	Ga0207698_10020075
2703	Ga0207698_10022204
2704	Ga0207698_10031525
2705	Ga0207698_10039839
2706	Ga0207698_10107283
2707	Ga0209281_1016477
2708	Ga0209371_1001735
2709	Ga0209983_1005370
2710	Ga0209282_1000117
2711	Ga0209974_10010143
2712	Ga0209974_10017296
2713	Ga0265354_1002072
2714	Ga0268266_10000294
2715	Ga0268266_10001305
2716	Ga0268266_10003602
2717	Ga0268266_10005753
2718	Ga0268266_10007280
2719	Ga0268266_10010165
2720	Ga0268266_10024339
2721	Ga0268266_10024458
2722	Ga0268266_10042546
2723	Ga0268266_10064779
2724	Ga0268266_10166439
2725	Ga0268266_10197821
2726	Ga0268266_10372331
2727	Ga0268265_10024680
2728	Ga0268265_10144119
2729	Ga0268264_10000122
2730	Ga0268264_10062896
2731	Ga0268264_10130439
2732	Ga0268264_10288953
2733	Ga0307517_10005566
2734	Ga0307517_10010807
2735	Ga0307517_10095841
2736	Ga0307517_10100285
2737	Ga0307515_10020065
2738	Ga0265338_10007927
2739	Ga0265338_10014337
2740	Ga0265338_10044342
2741	Ga0265324_10040719
2742	Ga0268256_1001423
2743	Ga0307511_10000807
2744	Ga0307512_10019834
2745	Ga0314311_1221697
2746	Ga0265330_10048383
2747	Ga0265332_10047551
2748	Ga0265320_10000355
2749	Ga0265325_10005621
2750	Ga0265325_10072959
2751	Ga0265340_10020837
2752	Ga0265340_10046361
2753	Ga0265339_10039365
2754	Ga0265339_10080609
2755	Ga0265331_10003639
2756	Ga0265331_10023910
2757	Ga0265327_10001207
2758	Ga0265327_10005282
2759	Ga0265327_10005528
2760	Ga0265327_10008299
2761	Ga0265327_10026274
2762	Ga0265327_10036808
2763	Ga0307513_10000008
2764	Ga0307513_10000025
2765	Ga0307513_10000090
2766	Ga0307513_10015280
2767	Ga0307513_10019901
2768	Ga0307513_10086321
2769	Ga0307513_10206790
2770	Ga0307509_10000013
2771	Ga0307509_10000115
2772	Ga0307509_10000157
2773	Ga0307509_10134735
2774	Ga0307408_100008740
2775	Ga0265313_10007597
2776	Ga0307508_10000048
2777	Ga0307508_10040955
2778	Ga0307514_10004434
2779	Ga0265314_10004074
2780	Ga0265314_10020128
2781	Ga0265314_10054654
2782	Ga0316576_10065662
2783	Ga0316578_10130252
2784	Ga0307516_10002914
2785	Ga0307516_10011226
2786	Ga0307516_10015664
2787	Ga0307516_10198933
2788	Ga0307405_10027621
2789	Ga0307410_10139017
2790	Ga0307406_10063264
2791	Ga0307412_10000103
2792	Ga0307412_10001832
2793	Ga0307412_10028266
2794	Ga0307412_10029439
2795	Ga0307412_10070130
2796	Ga0307412_10098195
2797	Ga0307412_10248132
2798	Ga0307409_100053482
2799	Ga0307416_100071715
2800	Ga0307416_100160966
2801	Ga0307416_100223291
2802	Ga0307414_10008178
2803	Ga0307414_10014744
2804	Ga0307414_10066730
2805	Ga0307414_10110982
2806	Ga0307411_10017807
2807	Ga0307411_10084636
2808	Ga0307411_10192696
2809	Ga0307415_100017628
2810	Ga0307507_10051626
2811	Ga0307510_10000013
2812	Ga0307510_10000883
2813	Ga0307510_10002279
2814	Ga0307510_10003490
2815	Ga0307510_10004406
2816	Ga0373944_0004575
2817	Ga0373936_0001148
2818	Ga0373955_0020950
2819	Ga0316574_0025334
2820	Ga0373931_0019909
2821	Ga0373931_0046877
2822	Ga0373937_0024239
2823	Ga0373937_0169349
2824	Ga0316584_0008521
2825	Ga0316584_0113273
2826	Ga0373925_0015482
2827	Ga0395899_0000003
2828	Ga0395899_0003573
2829	Ga0395899_0012488
2830	Ga0395899_0023022
2831	Ga0395899_0024731
2832	Ga0395899_0042175
2833	Ga0395899_0054251
2834	Ga0395899_0074946
2835	Ga0395900_0000666
2836	Ga0395900_0022058
2837	Ga0395900_0041744
2838	Ga0395900_0060740
2839	Ga0395900_0064878
2840	Ga0395900_0072277
2841	Ga0395900_0079069
2842	Ga0395900_0104858
2843	Ga0395900_0121241
2844	Ga0395900_0157902
2845	Ga0395900_0170360
2846	Ga0395900_0206632
2847	Ga0395900_0213647
2848	Ga0395900_0220335
2849	Ga0395900_0242015
2850	Ga0395900_0269457
2851	Ga0395898_0007101
2852	Ga0395898_0066657
2853	Ga0395898_0116953
2854	Ga0395898_0119298
2855	Ga0395898_0120161
2856	Ga0395898_0134474
2857	Ga0395898_0175997
2858	Ga0395898_0301130
2859	Ga0395898_0315060
2860	Ga0395905_0000160
2861	Ga0395905_0000292
2862	Ga0395905_0001115
2863	Ga0395905_0007930
2864	Ga0395905_0083255
2865	Ga0395905_0093050
2866	Ga0395905_0106513
2867	Ga0395905_0111863
2868	Ga0395905_0234086
2869	Ga0395905_0252912
2870	Ga0395901_0011007
2871	Ga0395901_0013048
2872	Ga0395901_0014769
2873	Ga0395901_0030397
2874	Ga0395901_0056403
2875	Ga0395901_0095674
2876	Ga0436365_0350000
2877	Ga0436365_1326958
2878	Ga0436365_1539887
2879	Ga0436361_0091005
2880	Ga0436361_0114864
2881	Ga0436361_0310288
2882	Ga0436361_0776771
2883	Ga0436363_1583895
2884	Ga0439436_0006401
2885	Ga0439461_0000019
2886	Ga0439465_0005348
2887	Ga0451802_1749538
2888	Ga0451841_1155968
2889	Ga0439442_017972
2890	Ga0439445_0000383
2891	Ga0439448_0009829
2892	Ga0439449_0000151
2893	Ga0439449_0000721
2894	Ga0439455_0006755
2895	Ga0439462_0011796
2896	Ga0450920_015282
2897	Ga0439446_0009067
2898	Ga0439446_0017679
2899	Ga0439458_0000141
2900	Ga0439458_0000286
2901	Ga0450909_003630
2902	Ga0439435_0016718
2903	Ga0439459_0006838
2904	Ga0466969_0008123
2905	Ga0466969_0018356
2906	Ga0466969_0025292
2907	Ga0466969_0032656
2908	Ga0466969_0064896
2909	Ga0466973_0137933
2910	Ga0466966_0000003
2911	Ga0466966_0000150
2912	Ga0466966_0000460
2913	Ga0466966_0000631
2914	Ga0466966_0012484
2915	Ga0466966_0042697
2916	Ga0466966_0168795
2917	Ga0466961_0000818
2918	Ga0466961_0179577
2919	Ga0466963_0024139
2920	Ga0466963_0029567
2921	Ga0466963_0057983
2922	Ga0453684_0095605
2923	Ga0466971_0011531
2924	Ga0466971_0018741
2925	Ga0466968_0020272
2926	Ga0466970_0000842
2927	Ga0466957_0003081
2928	Ga0466957_0127143
2929	Ga0466957_0148325
2930	Ga0466959_0000278
2931	Ga0466959_0005862
2932	Ga0466959_0009841
2933	Ga0466959_0031155
2934	Ga0466959_0036375
2935	Ga0451576_0033817
2936	Ga0451576_0053562
2937	Ga0466958_0000393
2938	Ga0466958_0001402
2939	Ga0466958_0002715
2940	Ga0466958_0010891
2941	Ga0466958_0013331
2942	Ga0466967_0146084
2943	Ga0466967_0153645
2944	Ga0466967_0299848
2945	Ga0495627_000697
2946	Ga0495627_006378
2947	Ga0495592_0000058
2948	Ga0495592_0161873
2949	Ga0495590_0008988
2950	Ga0495638_0000062
2951	Ga0495638_0000131
2952	Ga0495638_0000594
2953	Ga0495638_0001016
2954	Ga0495638_0001137
2955	Ga0495638_0002556
2956	Ga0495638_0004025
2957	Ga0495638_0004982
2958	Ga0495638_0026030
2959	Ga0495638_0051815
2960	Ga0495638_0102303
2961	Ga0495651_0027986
2962	Ga0495650_0000017
2963	Ga0495650_0003194
2964	Ga0495580_0003833
2965	Ga0495580_0146634
2966	Ga0495582_0088578
2967	Ga0495639_0000527
2968	Ga0495585_0030810
2969	Ga0495607_0000134
2970	Ga0495607_0066696
2971	Ga0495583_0000002
2972	Ga0495583_0000088
2973	Ga0495583_0060997
2974	Ga0495606_0000791
2975	Ga0495606_0006752
2976	Ga0495606_0045810
2977	Ga0495610_0000058
2978	Ga0495610_0000189
2979	Ga0495610_0000391
2980	Ga0495610_0001390
2981	Ga0495610_0010332
2982	Ga0495610_0011353
2983	Ga0495616_0000366
2984	Ga0495616_0000464
2985	Ga0495620_0003015
2986	Ga0495620_0012162
2987	Ga0495620_0045067
2988	Ga0495631_0091771
2989	Ga0495632_0001528
2990	Ga0495632_0002101
2991	Ga0495632_0007012
2992	Ga0495632_0042827
2993	Ga0495637_0006003
2994	Ga0495643_0000004
2995	Ga0495648_0000068
2996	Ga0495663_0012007
2997	Ga0495642_0004602
2998	Ga0495654_0000012
2999	Ga0495654_0066923
3000	Ga0495598_0000856
3001	Ga0495645_0097158
3002	Ga0495622_0010827
3003	Ga0495633_0002329
3004	Ga0495668_0000047
3005	Ga0495668_0000229
3006	Ga0495668_0007252
3007	Ga0495668_0009513
3008	Ga0495668_0017152
3009	Ga0495668_0042796
3010	Ga0495625_0000011
3011	Ga0495625_0000044
3012	Ga0495625_0001529
3013	Ga0495625_0002225
3014	Ga0495625_0002257
3015	Ga0495625_0002406
3016	Ga0495625_0033197
3017	Ga0495625_0083426
3018	Ga0495588_0001981
3019	Ga0495658_0094153
3020	Ga0495670_0000002
3021	Ga0495670_0000003
3022	Ga0495670_0000008
3023	Ga0495670_0000048
3024	Ga0495649_0000785
3025	Ga0495649_0002553
3026	Ga0495649_0051666
3027	Ga0495589_0011465
3028	Ga0495589_0021159
3029	Ga0495589_0043894
3030	Ga0495660_0054497
3031	Ga0495672_0014921
3032	Ga0495687_000722
3033	Ga0495687_001915
3034	Ga0495687_002495
3035	Ga0495679_001475
3036	Ga0495673_0000039
3037	Ga0495673_0000083
3038	Ga0495673_0000259
3039	Ga0495673_0000887
3040	Ga0495673_0001084
3041	Ga0495673_0001368
3042	Ga0495681_0002581
3043	Ga0495681_0013862
3044	Ga0495686_0004411
3045	Ga0495686_0004759
3046	Ga0495686_0005604
3047	Ga0495686_0033712
3048	Ga0495686_0144727
3049	Ga0495615_0000010
3050	Ga0496100_0013140
3051	Ga0496101_0006346
3052	Ga0496101_0010070
3053	Ga0496101_0018958
3054	Ga0496102_0009395
3055	Ga0496102_0029228
3056	Ga0496102_0237473
3057	Ga0496102_0250413
3058	Ga0496103_0015995
3059	Ga0496103_0072577
3060	Ga0496103_0136569
3061	Ga0496104_0001915
3062	Ga0496105_0006470
3063	Ga0496106_0006396
3064	Ga0496106_0008837
3065	Ga0496106_0022938
3066	Ga0496106_0023641
3067	Ga0496106_0070163
3068	Ga0496107_0000084
3069	Ga0496107_0012198
3070	Ga0496107_0052332
3071	Ga0496108_0003380
3072	Ga0496108_0035916
3073	Ga0496109_0000846
3074	Ga0496109_0034822
3075	Ga0496109_0072460
3076	Ga0496110_0001550
3077	Ga0496110_0016630
3078	Ga0496111_0142265
3079	Ga0496112_0042767
3080	Ga0496112_0280174
3081	Ga0496114_0000284
3082	Ga0496114_0001148
3083	Ga0496114_0096892
3084	Ga0496115_0000096
3085	Ga0496115_0003764
3086	Ga0496116_0003017
3087	Ga0496116_0007761
3088	Ga0496117_0000220
3089	Ga0496117_0009415
3090	Ga0496118_0000028
3091	Ga0496118_0020167
3092	Ga0496118_0150380
3093	Ga0496119_0011498
3094	Ga0496119_0013406
3095	Ga0496120_0000115
3096	Ga0496120_0005063
3097	Ga0496120_0007023
3098	Ga0496121_0000628
3099	Ga0496121_0000797
3100	Ga0496121_0000808
3101	Ga0496121_0001528
3102	Ga0496121_0001717
3103	Ga0496121_0003126
3104	Ga0496121_0012279
3105	Ga0496121_0019809
3106	Ga0496121_0042195
3107	Ga0496121_0152750
3108	Ga0496122_0001889
3109	Ga0496122_0002417
3110	Ga0496122_0017870
3111	Ga0496122_0037885
3112	Ga0496122_0087749
3113	Ga0496123_0000345
3114	Ga0496123_0001035
3115	Ga0496123_0003544
3116	Ga0496124_0000038
3117	Ga0496124_0000131
3118	Ga0496124_0001648
3119	Ga0496124_0011508
3120	Ga0496124_0033163
3121	Ga0496124_0046161
3122	Ga0496125_0001627
3123	Ga0496125_0002468
3124	Ga0496125_0002893
3125	Ga0496125_0010340
3126	Ga0496125_0023087
3127	Ga0496125_0023647
3128	Ga0496126_0000432
3129	Ga0496126_0015550
3130	Ga0496126_0020908
3131	Ga0496126_0038897
3132	Ga0495682_0003157
3133	Ga0501300_001187
3134	Ga0501033_0001221
3135	Ga0501034_0015804
3136	Ga0501034_0051674
3137	Ga0501034_0061222
3138	Ga0501034_0072078
3139	Ga0501034_0227188
3140	Ga0501043_0021875
3141	Ga0501046_0033430
3142	Ga0501046_0142260
3143	Ga0501047_0000243
3144	Ga0501047_0000779
3145	Ga0501047_0012653
3146	Ga0501067_0013969
3147	Ga0501067_0045748
3148	Ga0501069_0020556
3149	Ga0501070_0010636
3150	Ga0501072_0026435
3151	Ga0501073_0004008
3152	Ga0501073_0009324
3153	Ga0501224_000897
3154	Ga0501238_002068
3155	Ga0501249_000220
3156	Ga0501249_002048
3157	Ga0501080_0004792
3158	Ga0501266_000064
3159	Ga0501035_0007791
3160	Ga0501035_0037168
3161	Ga0501035_0040409
3162	Ga0501035_0099771
3163	Ga0501044_0000646
3164	Ga0501044_0002337
3165	Ga0501044_0082916
3166	Ga0501044_0094418
3167	nmdc:mga03683_12483_c1
3168	nmdc:mga03683_14246_c1
3169	nmdc:mga03n38_15265_c1
3170	nmdc:mga00v17_120288_c1
3171	nmdc:mga00v17_129955_c1
3172	nmdc:mga0k408_16275_c1
3173	nmdc:mga0k408_22854_c1
3174	nmdc:mga0k408_5470_c1
3175	nmdc:mga0k408_8_c1
3176	nmdc:mga07m45_2222_c1
3177	nmdc:mga07m45_3969_c1
3178	nmdc:mga07m45_45156_c1
3179	nmdc:mga07m45_4560_c1
3180	nmdc:mga07m45_6709_c1
3181	nmdc:mga07m45_9406_c1
3182	nmdc:mga07m45_9421_c1
3183	nmdc:mga05p37_106532_c1
3184	nmdc:mga05p37_1439_c1
3185	nmdc:mga05p37_297165_c1
3186	nmdc:mga09592_2173_c1
3187	nmdc:mga09592_225412_c1
3188	nmdc:mga0qj67_576_c1
3189	nmdc:mga06r32_246_c1
3190	nmdc:mga08y16_72741_c1
3191	nmdc:mga0sz30_20174_c1
3192	nmdc:mga0sz30_6322_c1
3193	Ga0495601_0041426
3194	Ga0500635_0020271
3195	Ga0500578_0000030
3196	Ga0500643_000008
3197	Ga0500643_003643
3198	Ga0500644_0000015
3199	Ga0500644_0000122
3200	Ga0500644_0011996
3201	Ga0500583_0035284
3202	Ga0500651_0077391
3203	Ga0500641_0011423
3204	Ga0500641_0021004
3205	Ga0500641_0033277
3206	Ga0500641_0034697
3207	Ga0500650_0057936
3208	Ga0500556_0001406
3209	Ga0500562_000331
3210	Ga0500562_003243
3211	Ga0500572_001673
3212	Ga0500593_000946
3213	Ga0500594_0000077
3214	Ga0500594_0032797
3215	Ga0500595_000805
3216	Ga0500595_012781
3217	Ga0500607_000025
3218	Ga0500607_000065
3219	Ga0500608_000102
3220	Ga0500608_000179
3221	Ga0500608_000731
3222	Ga0500614_010045
3223	Ga0500618_000022
3224	Ga0500618_000692
3225	Ga0500642_0065419
3226	Ga0500559_0000326
3227	Ga0500559_0000458
3228	Ga0500559_0002218
3229	Ga0500559_0009611
3230	Ga0500559_0026878
3231	Ga0500564_000052
3232	Ga0500568_0008486
3233	Ga0500573_0000009
3234	Ga0500577_0004774
3235	Ga0500588_0035656
3236	Ga0500604_0000021
3237	Ga0500616_0000018
3238	Ga0500616_0000101
3239	Ga0500622_0000867
3240	Ga0500622_0001267
3241	Ga0500622_0002373
3242	Ga0500622_0004224
3243	Ga0500622_0015839
3244	Ga0500627_0026946
3245	Ga0500636_0001428
3246	Ga0500636_0073632
3247	Ga0500637_0008779
3248	Ga0500645_000659
3249	Ga0500645_001373
3250	Ga0500645_005314
3251	Ga0500645_006086
3252	Ga0500609_000850
3253	Ga0500661_000356
3254	Ga0590074_002219
3255	Ga0590075_000584
3256	Ga0590075_009822
3257	Ga0590077_000284
3258	Ga0587077_000079
3259	Ga0587090_007721
3260	Ga0587101_003826
3261	Ga0587076_003427
3262	Ga0587107_001717
3263	Ga0501082_0290744
3264	Ga0466962_0001618
3265	Ga0466962_0004596
3266	Ga0466962_0012568
3267	Ga0466962_0019374
3268	Ga0466962_0036308
3269	2511123453
3270	2511124814
3271	2511242519
3272	2511248756
3273	2513228664
3274	2515689830
3275	2524614018
3276	2548497880
3277	2550697430
3278	2585148324
3279	2585151343
3280	2585153569
3281	2585196056
3282	2585197373
3283	2585324386
3284	2585332622
3285	2599623839
3286	2599671542
3287	2599681445
3288	2599693152
3289	2599904727
3290	2616552979
3291	2643730174
3292	2643751574
3293	2643780208
3294	2643782627
3295	2643836466
3296	2643857209
3297	2643861270
3298	2643924710
3299	2643925045
3300	2643928597
3301	2643928838
3302	2643951519
3303	2643983053
3304	2644045661
3305	2644052943
3306	2644120617
3307	2644126563
3308	2644163302
3309	2644327709
3310	2644392714
3311	2644400397
3312	2644511333
3313	2644649505
3314	2738712817
3315	2738713433
3316	2738851241
3317	2738866971
3318	2738879457
3319	2739299488
3320	2739361167
3321	2739651082
3322	2739733019
3323	2739794031
3324	2740029555
3325	2792459872
3326	2792463823
3327	2809032822
3328	2809065051
3329	2809080985
3330	2809085350
3331	2816508257
3332	2816509202
3333	2819536698
3334	2819537071
3335	2819594793
3336	2819645483
3337	2819645859
3338	2819683225
3339	2819712955
3340	2842485651
3341	2843744536
3342	2843747568
3343	2848297891
3344	2849563367
3345	2849563903
3346	2849565123
3347	2849575617
3348	2849578200
3349	2849578732
3350	2851154446
3351	2851156016
3352	2857506904
3353	2857540632
3354	2857578387
3355	2858954132
3356	2879166906
3357	2880522524
3358	2884813654
3359	2884841301
3360	2884856175
3361	2884962541
3362	2885204580
3363	2885218233
3364	2896156899
3365	2896187014
3366	2896256481
3367	2898331680
3368	2898333839
3369	2919143601
3370	2919170353
3371	2919707388
3372	2919710824
3373	2928071604
3374	2928103440
3375	2928962478
3376	2928967888
3377	2928969018
3378	2939589257
3379	2941482959
3380	2945977360
3381	2946789498
3382	2990047176
3383	8005683595
3384	8054306957

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02746

MR_MLE_N

Mandelate racemase / muconate lactonizing enzyme, N-terminal domain

62

171

0.96 PF13378

MR_MLE_C

Enolase C-terminal domain-like

191

439

0.95 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
2qjj-assembly2.cif.gz_C	crystal structure of d-mannonate dehydratase from novosphingobium aromaticivorans	0.9951	10	410
2qjn-assembly1.cif.gz_A	crystal structure of d-mannonate dehydratase from novosphingobium aromaticivorans complexed with mg and 2-keto-3-deoxy-d-gluconate	0.995	10	410
4k1w-assembly2.cif.gz_D	crystal structure of the a314p mutant of mannonate dehydratase from novosphingobium aromaticivorans complexed with mg and d-mannonate	0.9949	9	410
4k1w-assembly1.cif.gz_B	crystal structure of the a314p mutant of mannonate dehydratase from novosphingobium aromaticivorans complexed with mg and d-mannonate	0.9947	9	410
4k8g-assembly1.cif.gz_A	crystal structure of d-mannonate dehydratase from novosphingobium aromaticivorans mutant (v161a, r163a, k165g, l166a, y167g, y168a, e169g)	0.9946	9	410

ID	Description	Score	Start	End	Superfamily
3bsmB02	Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Enolase-like C-terminal domain	0.9942	114	374	3.20.20.120
3bsmB02	Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Enolase-like C-terminal domain	0.9858	114	374	3.20.20.120
af_P38104_1_104_3.30.390.10	Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;Enolase-like, N-terminal domain	0.9848	10	112	3.30.390.10
4k1wA01	Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;Enolase-like, N-terminal domain	0.9818	6	109	3.30.390.10
4f4rA02	Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Enolase-like C-terminal domain	0.9817	114	374	3.20.20.120

ID	Description	Score	Start	End	GO Terms
AF-A0A838S228-F1-model_v4	Bifunctional D-altronate/D-mannonate dehydratase	0.9921	229	410
AF-H1SGP0-F1-model_v4	Bifunctional D-altronate/D-mannonate dehydratase	0.9917	244	410
AF-A0A520JD45-F1-model_v4	D-galactonate dehydratase family protein	0.9915	9	330	GO:0000287 GO:0008927 GO:0009063 GO:0016052
AF-A0A536V2H8-F1-model_v4	Bifunctional D-altronate/D-mannonate dehydratase	0.9913	10	157	GO:0009063
AF-A0A7Y9GTP0-F1-model_v4	Mannonate dehydratase (EC 4.2.1.8)	0.9901	10	410	GO:0000287 GO:0008927 GO:0009063 GO:0016052

F495359

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF02746

MR_MLE_N

Mandelate racemase / muconate lactonizing enzyme, N-terminal domain

62

171

0.96

PF13378

MR_MLE_C

Enolase C-terminal domain-like

191

439

0.95

Structural Annotation

Top 5 Hits

Map