F495362
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1692 | 681 | 3382 | 444 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|8047710418|8047719884 |
| Length | 496 |
| Sequence | NQANAADKAYEESLGGGTRTESVSDASTGTDTSAAGSDSRDADARAGDARADEASTIAAGPSVDVADSRQTTEGTVYTVTGGDWDEVLADAAGDERIVMNLGPQHPSTHGVLRLVLELEGESVTQARSVIGYLHTGIEKNLEYRNWTQGVTFVTRMDYLAPLHNEAAYCMSVEKLLGVEVPQRAQVIRVLLMELNRISSHLVALATGGMELGALTGMTAGFREREEVLHLLEHLTGLRMNHAFIRPGGVAQDLPADAVEKIRSFLKIMDKRLPDYDKLLTGQPIWRNRLAGVGYLPVDACLALGITGPILRSAGLPWDLRKVEPYSGYETYDFDVPTSNAADSFARYLMRVEEIHQSLRLVRQAVDRLEPGPVMVEDAKIAWPAQLTIGSDGMGNSLEHVRKIMGQSMESLIHHFKLVTEGFDVPAGQVYVPIESPRGELGYHVVSDGGTRPFRVHVREPSFVNLQSMPAMCEGGMVADVIASVASIDPVMGGCDR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 2 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 5 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 6 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 7 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 8 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 9 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 10 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 11 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 12 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 13 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 14 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 15 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 21 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 25 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 38 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 56 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 61 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 64 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 71 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 73 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 74 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 75 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 77 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 78 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 79 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 80 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 81 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 82 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 83 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 84 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 85 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 86 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 87 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 88 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 89 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 90 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 92 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 93 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 94 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 95 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 96 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 97 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 98 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 99 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 101 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 102 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 103 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 104 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 105 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 106 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 107 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 108 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 109 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 110 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 126 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 143 | 3300015688 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 | Metagenome | Rhizosphere |
| 144 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 146 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 147 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 148 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 149 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 150 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 151 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 152 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 153 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 154 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 155 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 156 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 157 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 158 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 227 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 231 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 232 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 233 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 234 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 235 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 236 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 237 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 238 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 239 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 240 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 241 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 242 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 243 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 244 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 245 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 246 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 247 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 248 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 249 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 250 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 251 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 252 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 253 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 254 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 255 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 256 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 257 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 258 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 259 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 260 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 261 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 262 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 263 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 264 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 265 | 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Metagenome | Unclassified |
| 266 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 267 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 268 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 269 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 270 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 271 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 272 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 273 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 274 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 275 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 276 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 277 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 278 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 279 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 280 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 281 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 282 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 283 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 284 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 285 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 286 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 287 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 288 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 289 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 290 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 291 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 292 | 3300036457 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 293 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 294 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 295 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 296 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 297 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 298 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 299 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 300 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 301 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 302 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 303 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 304 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 305 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 306 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 307 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 308 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 309 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 310 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 311 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 312 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 313 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 314 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 315 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 316 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 317 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 318 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 319 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 320 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 321 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 322 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 323 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 324 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 325 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 326 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 327 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 328 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 329 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 330 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 331 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 332 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 333 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 334 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 335 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 336 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 337 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 338 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 339 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 340 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 411 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 412 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 413 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 414 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 415 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 416 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 417 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 418 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 419 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 420 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 421 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 422 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 423 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 424 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 425 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 426 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 427 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 428 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 429 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 430 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 431 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 432 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 433 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 434 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 435 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 436 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 437 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 439 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 440 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 441 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 442 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 443 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 444 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 445 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 446 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 447 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 448 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 449 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 450 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 451 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 452 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 453 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 454 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 455 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 456 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 457 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 458 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 459 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 460 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 461 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 462 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 463 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 464 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 465 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 466 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 467 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 468 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 469 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 470 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 471 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 472 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 473 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 474 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 475 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 476 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 477 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 478 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 479 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 480 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 481 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 482 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 483 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 484 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 485 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 486 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 487 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 488 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 489 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 490 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 491 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 492 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 493 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 494 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 495 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 496 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 497 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 498 | 8047710418 | Umezawaea endophytica DSM 103496 | Isolate | Unclassified |
| 499 | 2501939600 | Micromonospora sp. L5 | Isolate | Unclassified |
| 500 | 2506783011 | Frankia datiscae Dg1 | Isolate | Nodule |
| 501 | 2508501039 | Frankia saprophytica CN3 | Isolate | Nodule |
| 502 | 2515154088 | Salinispora arenicola CNT800 | Isolate | Rhizosphere |
| 503 | 2515154129 | Salinispora pacifica CNS103 | Isolate | Rhizosphere |
| 504 | 2515154137 | Salinispora arenicola CNX482 | Isolate | Rhizosphere |
| 505 | 2515154155 | Actinopolymorpha alba DSM 45243 | Isolate | Rhizosphere |
| 506 | 2515154202 | Salinispora pacifica CNT084 | Isolate | Rhizosphere |
| 507 | 2515154203 | Salinispora arenicola CNR921 | Isolate | Rhizosphere |
| 508 | 2517572101 | Frankia sp. DC12 | Isolate | Nodule |
| 509 | 2527291627 | Frankia casuarinae Thr | Isolate | Nodule |
| 510 | 2527291629 | Frankia sp. BMG5.23 | Isolate | Nodule |
| 511 | 2546825537 | Frankia sp. CcI6 | Isolate | Rhizoplane |
| 512 | 2547132424 | Nocardia nova SH22a | Isolate | Unclassified |
| 513 | 2551306166 | Nocardia tenerifensis NBRC 101015 | Isolate | Rhizosphere |
| 514 | 2558860112 | Pseudonocardia acaciae DSM 45401 | Isolate | Unclassified |
| 515 | 2558860280 | Kutzneria sp. 744 | Isolate | Unclassified |
| 516 | 2576861822 | Frankia sp. CeD | Isolate | Nodule |
| 517 | 2579778521 | Frankia torreyi CpI1-S | Isolate | Unclassified |
| 518 | 2582580736 | Prauserella sp. Am3 | Isolate | Unclassified |
| 519 | 2582581312 | Streptomyces atratus OK008 | Isolate | Rhizosphere |
| 520 | 2582581314 | Streptomyces mirabilis YR139 | Isolate | Rhizosphere |
| 521 | 2585427649 | Amycolatopsis japonica MG417-CF17, DSM 44213 | Isolate | Unclassified |
| 522 | 2619618881 | Frankia sp. ACN1ag | Isolate | Unclassified |
| 523 | 2619619003 | Frankia sp. CpI1-P | Isolate | Nodule |
| 524 | 2622736605 | Geodermatophilus ruber DSM 45317 | Isolate | Rhizosphere |
| 525 | 2622736626 | Micromonospora rhizosphaerae DSM 45431 | Isolate | Rhizosphere |
| 526 | 2626541554 | Frankia sp. AvcI.1 | Isolate | Nodule |
| 527 | 2643221578 | Streptomyces sp. Root63 | Isolate | Unclassified |
| 528 | 2643221601 | Kitasatospora sp. Root187 | Isolate | Unclassified |
| 529 | 2643221631 | Kitasatospora sp. Root107 | Isolate | Unclassified |
| 530 | 2643221673 | Streptomyces sp. Root1295 | Isolate | Unclassified |
| 531 | 2643221678 | Streptomyces sp. Root1310 | Isolate | Unclassified |
| 532 | 2643221687 | Mycobacterium sp. Root135 | Isolate | Unclassified |
| 533 | 2643221692 | Nocardia sp. Root136 | Isolate | Unclassified |
| 534 | 2643221714 | Streptomyces sp. Root264 | Isolate | Unclassified |
| 535 | 2643221715 | Mycobacterium sp. Root265 | Isolate | Unclassified |
| 536 | 2671180195 | Frankia sp. CcI49 | Isolate | Nodule |
| 537 | 2675902999 | Frankia asymbiotica NRRL B-16386 | Isolate | Nodule |
| 538 | 2675903058 | Actinopolymorpha cephalotaxi CPCC 202808 | Isolate | Rhizosphere |
| 539 | 2675903059 | Asanoa hainanensis CGMCC 4.5593 | Isolate | Rhizosphere |
| 540 | 2684623035 | Frankia sp. NRRL B-16219 | Isolate | Rhizosphere |
| 541 | 2684623036 | Frankia sp. CgIM4 | Isolate | Nodule |
| 542 | 2687453737 | Frankia sp. BMG5.36 | Isolate | Nodule |
| 543 | 2687453743 | Frankia colletiae Cc1.17 | Isolate | Nodule |
| 544 | 2710264753 | Frankia sp. KB5 | Isolate | Nodule |
| 545 | 2738541308 | Rhodococcus sp. OK551 | Isolate | Unclassified |
| 546 | 2738543005 | Rhodococcus sp. OK519 | Isolate | Unclassified |
| 547 | 2738543011 | Rhodococcus sp. OK611 | Isolate | Unclassified |
| 548 | 2738543034 | Rhodococcus sp. OK269 | Isolate | Unclassified |
| 549 | 2751185725 | Microbispora sp. NRRL B-24597 | Isolate | Unclassified |
| 550 | 2751185734 | Saccharothrix sp. NRRL B-16314 | Isolate | Rhizosphere |
| 551 | 2751185782 | Actinoplanes subtropicus NRRL B-24665 | Isolate | Rhizosphere |
| 552 | 2751185792 | Kitasatospora arboriphila NRRL B-24581 | Isolate | Unclassified |
| 553 | 2767802112 | Streptomyces avicenniae NRRL B-24776 | Isolate | Rhizosphere |
| 554 | 2772190715 | Micromonospora chokoriensis NRRL B-24750 | Isolate | Unclassified |
| 555 | 2773857921 | Frankia asymbiotica NRRL B-16386 | Isolate | Nodule |
| 556 | 2773857922 | Frankia sp. CcI49 | Isolate | Nodule |
| 557 | 2773857924 | Frankia sp. CgIS1 | Isolate | Nodule |
| 558 | 2773857933 | Frankia sp. BMG5.30 | Isolate | Nodule |
| 559 | 2775506925 | Saccharopolyspora phatthalungensis NRRL B-24798 | Isolate | Rhizosphere |
| 560 | 2791354901 | Actinophytocola xanthii 11-183 | Isolate | Rhizosphere |
| 561 | 2795385470 | Labedaea rhizosphaerae DSM 45361 | Isolate | Rhizosphere |
| 562 | 2795385472 | Herbihabitans rhizosphaerae DSM 101727 | Isolate | Rhizosphere |
| 563 | 2808606359 | Streptomyces sp. RJA2910 | Isolate | Unclassified |
| 564 | 2808606375 | Streptomyces sp. SLBN-31 | Isolate | Unclassified |
| 565 | 2808606522 | Amycolatopsis sp. BJA-103 | Isolate | Unclassified |
| 566 | 2808606982 | Streptomyces sp. SLBN-118 | Isolate | Unclassified |
| 567 | 2811994879 | Streptomyces sp. 4-17 | Isolate | Unclassified |
| 568 | 2816332139 | Pseudonocardia kunmingensis DSM 45301 | Isolate | Unclassified |
| 569 | 2818991472 | Kitasatospora viridis DSM 44826 | Isolate | Rhizosphere |
| 570 | 2827628540 | Actinopolymorpha cephalotaxi DSM 45117 | Isolate | Rhizosphere |
| 571 | 2831935698 | Jishengella sp. AZ1-13 | Isolate | Unclassified |
| 572 | 2832004796 | Micromonospora endophytica JCM 18317 | Isolate | Unclassified |
| 573 | 2842134933 | Mycolicibacterium obuense SEMIA 442 | Isolate | Nodule |
| 574 | 2855670206 | Micromonospora noduli Lupac 07 | Isolate | Nodule |
| 575 | 2855676851 | Micromonospora saelicesensis GAR05 | Isolate | Unclassified |
| 576 | 2855683550 | Micromonospora sp. RP3T | Isolate | Unclassified |
| 577 | 2856741275 | Microbispora triticiradicis NEAU-HRDPA2-9 | Isolate | Unclassified |
| 578 | 2856858025 | Micromonospora aurantiaca 110B(2018) | Isolate | Unclassified |
| 579 | 2857288857 | Micromonospora noduli ONO23 | Isolate | Unclassified |
| 580 | 2858848962 | Micromonospora saelicesensis GAR06 | Isolate | Unclassified |
| 581 | 2858868258 | Micromonospora sp. MH33 | Isolate | Unclassified |
| 582 | 2858882152 | Micromonospora noduli MED15 | Isolate | Nodule |
| 583 | 2858888857 | Micromonospora saelicesensis Lupac 06 | Isolate | Unclassified |
| 584 | 2858895516 | Micromonospora saelicesensis PSN13 | Isolate | Unclassified |
| 585 | 2858902515 | Micromonospora sp. MW-13 | Isolate | Rhizosphere |
| 586 | 2861520306 | Phytomonospora endophytica DSM 45386 | Isolate | Unclassified |
| 587 | 2862281513 | Streptomyces sp. Act143 | Isolate | Rhizosphere |
| 588 | 2862290372 | Streptomyces triticagri NEAU-YY421 | Isolate | Rhizosphere |
| 589 | 2862382967 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 590 | 2862705112 | Streptomyces triticirhizae NEAU-YY642 | Isolate | Rhizosphere |
| 591 | 2863067949 | Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) | Isolate | Rhizosphere |
| 592 | 2863404153 | Streptomyces scabiei SAI-025 (Annotation) (version 2) | Isolate | Unclassified |
| 593 | 2866065130 | Micromonospora endophytica DSM 45430 | Isolate | Unclassified |
| 594 | 2866552031 | Saccharopolyspora rhizosphaerae H219 | Isolate | Unclassified |
| 595 | 2866612099 | Amycolatopsis suaedae 8-3EHSu | Isolate | Unclassified |
| 596 | 2867302475 | Micromonospora globbae WPS1-2 | Isolate | Unclassified |
| 597 | 2867312974 | Micromonospora musae NGC1-4 | Isolate | Unclassified |
| 598 | 2867319477 | Micromonospora musae MS1-9 | Isolate | Unclassified |
| 599 | 2867346516 | Streptomyces radicis AZ1-7 | Isolate | Unclassified |
| 600 | 2867369537 | Streptomyces sp. Z26 | Isolate | Unclassified |
| 601 | 2867475112 | Streptomyces sp. TM32 | Isolate | Unclassified |
| 602 | 2867507094 | Micromonospora zingiberis PLAI 1-1 | Isolate | Unclassified |
| 603 | 2869048445 | Micromonospora saelicesensis PSN01 | Isolate | Unclassified |
| 604 | 2869061728 | Micromonospora noduli ONO86 | Isolate | Unclassified |
| 605 | 2869068681 | Micromonospora noduli GUI43 | Isolate | Unclassified |
| 606 | 2870721527 | Saccharothrix ecbatanensis DSM 45486 | Isolate | Rhizosphere |
| 607 | 2870782633 | Pseudonocardia eucalypti DSM 45351 | Isolate | Unclassified |
| 608 | 2873151551 | Streptomyces silaceus ACCC40021 | Isolate | Rhizosphere |
| 609 | 2875391855 | Streptomyces cavourensis 1AS2a | Isolate | Rhizosphere |
| 610 | 2880489317 | Micromonospora ureilytica DSM 101692 | Isolate | Unclassified |
| 611 | 2880495981 | Micromonospora vinacea DSM 101695 | Isolate | Unclassified |
| 612 | 2883821847 | Microlunatus elymi KUDC0627 | Isolate | Rhizosphere |
| 613 | 2884693830 | Nonomuraea phyllanthi WYY166 | Isolate | Unclassified |
| 614 | 2887478801 | Catellatospora paridis NEAU-CL2 | Isolate | Rhizosphere |
| 615 | 2889300758 | Rhodococcus sp. PvR099 | Isolate | Rhizosphere |
| 616 | 2891326441 | Actinokineospora pegani TRM65233 | Isolate | Unclassified |
| 617 | 2891395885 | Microbispora catharanthi CR1-09 | Isolate | Unclassified |
| 618 | 2891554331 | Microbispora sp. CL1-1 | Isolate | Unclassified |
| 619 | 2891562705 | Microbispora tritici MT50 | Isolate | Unclassified |
| 620 | 2895427314 | Nonomuraea sp. PA05 | Isolate | Unclassified |
| 621 | 2895442618 | Nonomuraea phyllanthi PA1-10 | Isolate | Unclassified |
| 622 | 2895880812 | Frankia sp. BMG5.11 | Isolate | Unclassified |
| 623 | 2899359706 | Amycolatopsis anabasis EGI 650086 | Isolate | Unclassified |
| 624 | 2899370129 | Amycolatopsis alkalitolerans SYSUP0005 | Isolate | Stem Tuber |
| 625 | 2902582711 | Micromonospora sp. AP08 | Isolate | Unclassified |
| 626 | 2902792274 | Mycolicibacterium sp. P9-64 | Isolate | Unclassified |
| 627 | 2902799365 | Mycolicibacterium sp. P1-5 | Isolate | Unclassified |
| 628 | 2902810491 | Mycolicibacterium sp. P9-22 | Isolate | Unclassified |
| 629 | 2902837492 | Mycolicibacterium sp. P1-18 | Isolate | Unclassified |
| 630 | 2912715099 | Streptomyces sp. Z423-1 | Isolate | Rhizosphere |
| 631 | 2912723979 | Streptomyces sp. NEAU-sy36 | Isolate | Rhizosphere |
| 632 | 2915358134 | Pseudonocardia pini CAP47R | Isolate | Unclassified |
| 633 | 2915768154 | Amycolatopsis pittospori PIP199 | Isolate | Unclassified |
| 634 | 2917736166 | Amycolatopsis dendrobii DR6-1 | Isolate | Unclassified |
| 635 | 2919713450 | Nocardia kruczakiae 4272 | Isolate | Rhizosphere |
| 636 | 2928142448 | Prescottella equi DPS 2018 | Isolate | Unclassified |
| 637 | 2929212328 | Mycolicibacterium sp. R-73050 Hybrid assembly | Isolate | Unclassified |
| 638 | 2929219909 | Micromonospora sp. R-75348 Hybrid assembly | Isolate | Unclassified |
| 639 | 2929226422 | Micromonospora sp. R-74116 Hybrid assembly | Isolate | Unclassified |
| 640 | 2932398195 | Dietzia sp. 2505 | Isolate | Rhizosphere |
| 641 | 2939582691 | Mycolicibacterium sp. 624 | Isolate | Rhizosphere |
| 642 | 2939743619 | Rhodococcus sp. PvR044 | Isolate | Rhizosphere |
| 643 | 2946045630 | Streptomyces sp. W4I9-2 | Isolate | Rhizosphere |
| 644 | 2946064051 | Streptomyces luteogriseus W4I19-1 | Isolate | Rhizosphere |
| 645 | 2956939328 | Lolliginicoccus suaedae LNNU 331112 | Isolate | Rhizosphere |
| 646 | 2974315732 | Rhodococcus sp. SORGH_AS 301 | Isolate | Unclassified |
| 647 | 2990088156 | Streptomyces albidus CAP 215 | Isolate | Unclassified |
| 648 | 2996221748 | Micromonospora veneta CAP181 | Isolate | Unclassified |
| 649 | 3001119090 | Lolliginicoccus lacisalsi G463 | Isolate | Rhizosphere |
| 650 | 3002998708 | Actinomadura barringtoniae GKU 128 | Isolate | Unclassified |
| 651 | 3006425503 | Streptomyces zingiberis PLAI1-29 | Isolate | Unclassified |
| 652 | 3006493962 | Streptomyces grisecoloratus TRM S81-3 | Isolate | Rhizosphere |
| 653 | 637000116 | Frankia casuarinae CcI3 | Isolate | Nodule |
| 654 | 649633069 | Micromonospora sp. L5 | Isolate | Unclassified |
| 655 | 8001781756 | Catellatospora tritici NEAU-YM18 | Isolate | Rhizosphere |
| 656 | 8002775197 | Frankia nepalensis CN7 | Isolate | Nodule |
| 657 | 8002784119 | Frankia sp. AgB1.9 | Isolate | Nodule |
| 658 | 8003314358 | Amycolatopsis sp. MtRt-6 | Isolate | Unclassified |
| 659 | 8003830390 | Micromonospora parastrephiae STR1_7 | Isolate | Rhizosphere |
| 660 | 8003856774 | Micromonospora echinofusca MPMI6 | Isolate | Unclassified |
| 661 | 8003870546 | Micromonospora tarensis STR1s_6 | Isolate | Rhizosphere |
| 662 | 8008485437 | Streptomyces mimosae 3MP-10 | Isolate | Unclassified |
| 663 | 8008558824 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 664 | 8008574985 | Streptomyces sp. Jing01 | Isolate | Rhizosphere |
| 665 | 8025478263 | Streptomyces telluris AA8 | Isolate | Rhizosphere |
| 666 | 8025524527 | Streptomyces sp. 3MP-14 | Isolate | Unclassified |
| 667 | 8033684223 | Streptomyces phytophilus PIP175 | Isolate | Unclassified |
| 668 | 8053945823 | Actinomadura terrae OS3-83 | Isolate | Rhizosphere |
| 669 | 8054472261 | Pseudonocardia terrae RS11V-5 | Isolate | Rhizosphere |
| 670 | 8054704163 | Micromonospora trifolii NIE79 | Isolate | Nodule |
| 671 | 8054727385 | Micromonospora alfalfae MED01 | Isolate | Nodule |
| 672 | 8054734606 | Micromonospora hortensis NIE111 | Isolate | Nodule |
| 673 | 8054913762 | Frankia gtarii Agncl-10 | Isolate | Nodule |
| 674 | 8054920844 | Frankia tisae Agncl-8 | Isolate | Nodule |
| 675 | 8055157932 | Frankia umida Ag45/Mut15 | Isolate | Nodule |
| 676 | 8055412473 | Micromonospora phytophila DSM 105363 | Isolate | Nodule |
| 677 | 8056054917 | Glycomyces luteolus NEAU-A15 | Isolate | Rhizosphere |
| 678 | 8056207758 | Saccharopolyspora indica KCTC 29208 | Isolate | Rhizosphere |
| 679 | 8056667051 | Streptomyces sichuanensis SCA3-4 | Isolate | Rhizosphere |
| 680 | 8056829672 | Streptomyces barringtoniae JA03 | Isolate | Rhizosphere |
| 681 | 8057568493 | Actinorhabdospora filicis NBRC 111898 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 87.53 |
| Metatranscriptomes | 1.48 |
| Isolates | 10.99 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.55 |
| Nodule | 1.95 |
| Rhizoplane | 6.68 |
| Rhizosphere | 75.3 |
| Stem | 0 |
| Stem Tuber | 0.12 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJQas_1007077 | 3300000549 | Bacteria | 1384 |
| 2 | JGI24752J21851_1003471 | 3300001976 | Bacteria | 2073 |
| 3 | JGI24737J22298_10019288 | 3300001990 | Bacteria | 2182 |
| 4 | JGI24743J22301_10007272 | 3300001991 | Bacteria | 1915 |
| 5 | JGI24735J21928_10011371 | 3300002067 | Bacteria | 2825 |
| 6 | JGI24745J21846_1003962 | 3300002073 | Bacteria | 1568 |
| 7 | JGI24738J21930_10014650 | 3300002075 | Bacteria | 1680 |
| 8 | JGI24744J21845_10000088 | 3300002077 | Bacteria | 11973 |
| 9 | JGI24744J21845_10001304 | 3300002077 | Bacteria | 4925 |
| 10 | JGI24742J22300_10000442 | 3300002244 | Bacteria | 6102 |
| 11 | JGI24751J29686_10005336 | 3300002459 | Bacteria | 2616 |
| 12 | JGI24751J29686_10016334 | 3300002459 | Bacteria | 1531 |
| 13 | JGI25406J46586_10001934 | 3300003203 | Bacteria | 9774 |
| 14 | JGI25406J46586_10015066 | 3300003203 | Bacteria | 3270 |
| 15 | JGI25406J46586_10021225 | 3300003203 | Bacteria | 2610 |
| 16 | JGI25160J50197_1021813 | 3300003354 | Bacteria | 1892 |
| 17 | JGI25404J52841_10000389 | 3300003659 | Bacteria | 6058 |
| 18 | Ga0055540_1000003 | 3300003792 | Bacteria | 428375 |
| 19 | Ga0055540_1011637 | 3300003792 | Bacteria | 2819 |
| 20 | Ga0070658_10000319 | 3300005327 | Bacteria | 41203 |
| 21 | Ga0070658_10000776 | 3300005327 | Bacteria | 27421 |
| 22 | Ga0070658_10010607 | 3300005327 | Bacteria | 7382 |
| 23 | Ga0070658_10027200 | 3300005327 | Bacteria | 4592 |
| 24 | Ga0070658_10045247 | 3300005327 | Bacteria | 3559 |
| 25 | Ga0070676_10011568 | 3300005328 | Bacteria | 4800 |
| 26 | Ga0070683_100017452 | 3300005329 | Bacteria | 6344 |
| 27 | Ga0070683_100025549 | 3300005329 | Bacteria | 5306 |
| 28 | Ga0070683_100074305 | 3300005329 | Bacteria | 3175 |
| 29 | Ga0070683_100110779 | 3300005329 | Bacteria | 2589 |
| 30 | Ga0070683_100151142 | 3300005329 | Bacteria | 2201 |
| 31 | Ga0070690_100021350 | 3300005330 | Bacteria | 3952 |
| 32 | Ga0070670_100046760 | 3300005331 | Bacteria | 3722 |
| 33 | Ga0070670_100065296 | 3300005331 | Bacteria | 3123 |
| 34 | Ga0068869_100001172 | 3300005334 | Bacteria | 15378 |
| 35 | Ga0068869_100003836 | 3300005334 | Bacteria | 9270 |
| 36 | Ga0068869_100015543 | 3300005334 | Bacteria | 5109 |
| 37 | Ga0068869_100041488 | 3300005334 | Bacteria | 3296 |
| 38 | Ga0068869_100086618 | 3300005334 | Bacteria | 2348 |
| 39 | Ga0068869_100097501 | 3300005334 | Bacteria | 2220 |
| 40 | Ga0070666_10017287 | 3300005335 | Bacteria | 4622 |
| 41 | Ga0070666_10038699 | 3300005335 | Bacteria | 3174 |
| 42 | Ga0070666_10076122 | 3300005335 | Bacteria | 2289 |
| 43 | Ga0070680_100000061 | 3300005336 | Bacteria | 56357 |
| 44 | Ga0070680_100000142 | 3300005336 | Bacteria | 43698 |
| 45 | Ga0070682_100013085 | 3300005337 | Bacteria | 4767 |
| 46 | Ga0070682_100015617 | 3300005337 | Bacteria | 4403 |
| 47 | Ga0070682_100024558 | 3300005337 | Bacteria | 3588 |
| 48 | Ga0070682_100034343 | 3300005337 | Bacteria | 3088 |
| 49 | Ga0068868_100001480 | 3300005338 | Bacteria | 16204 |
| 50 | Ga0068868_100016132 | 3300005338 | Bacteria | 5541 |
| 51 | Ga0068868_100044260 | 3300005338 | Bacteria | 3480 |
| 52 | Ga0068868_100052582 | 3300005338 | Bacteria | 3207 |
| 53 | Ga0068868_100093418 | 3300005338 | Bacteria | 2426 |
| 54 | Ga0068868_100095458 | 3300005338 | Bacteria | 2400 |
| 55 | Ga0068868_100125388 | 3300005338 | Bacteria | 2097 |
| 56 | Ga0070660_100009555 | 3300005339 | Bacteria | 6828 |
| 57 | Ga0070660_100056785 | 3300005339 | Bacteria | 3030 |
| 58 | Ga0070660_100093165 | 3300005339 | Bacteria | 2378 |
| 59 | Ga0070689_100025866 | 3300005340 | Bacteria | 4412 |
| 60 | Ga0070689_100026796 | 3300005340 | Bacteria | 4342 |
| 61 | Ga0070691_10004160 | 3300005341 | Bacteria | 6570 |
| 62 | Ga0070691_10056891 | 3300005341 | Bacteria | 1876 |
| 63 | Ga0070687_100010502 | 3300005343 | Bacteria | 4007 |
| 64 | Ga0070687_100066214 | 3300005343 | Bacteria | 1924 |
| 65 | Ga0070661_100038413 | 3300005344 | Bacteria | 3485 |
| 66 | Ga0070692_10010462 | 3300005345 | Bacteria | 4222 |
| 67 | Ga0070692_10027337 | 3300005345 | Bacteria | 2827 |
| 68 | Ga0070692_10038183 | 3300005345 | Bacteria | 2446 |
| 69 | Ga0070668_100001192 | 3300005347 | Bacteria | 18433 |
| 70 | Ga0070668_100001297 | 3300005347 | Bacteria | 17872 |
| 71 | Ga0070668_100024803 | 3300005347 | Bacteria | 4545 |
| 72 | Ga0070668_100030442 | 3300005347 | Bacteria | 4103 |
| 73 | Ga0070668_100046862 | 3300005347 | Bacteria | 3322 |
| 74 | Ga0070669_100004569 | 3300005353 | Bacteria | 9993 |
| 75 | Ga0070669_100022235 | 3300005353 | Bacteria | 4535 |
| 76 | Ga0070675_100000392 | 3300005354 | Bacteria | 29617 |
| 77 | Ga0070675_100010873 | 3300005354 | Bacteria | 7118 |
| 78 | Ga0070671_100001259 | 3300005355 | Bacteria | 18984 |
| 79 | Ga0070671_100001780 | 3300005355 | Bacteria | 16356 |
| 80 | Ga0070674_100000187 | 3300005356 | Bacteria | 29321 |
| 81 | Ga0070674_100123412 | 3300005356 | Bacteria | 1920 |
| 82 | Ga0070673_100022227 | 3300005364 | Bacteria | 4614 |
| 83 | Ga0070673_100245360 | 3300005364 | Bacteria | 1559 |
| 84 | Ga0070688_100057304 | 3300005365 | Bacteria | 2449 |
| 85 | Ga0070659_100023288 | 3300005366 | Bacteria | 4738 |
| 86 | Ga0070659_100032701 | 3300005366 | Bacteria | 4036 |
| 87 | Ga0070659_100054109 | 3300005366 | Bacteria | 3161 |
| 88 | Ga0070659_100107419 | 3300005366 | Bacteria | 2250 |
| 89 | Ga0070667_100000056 | 3300005367 | Bacteria | 150952 |
| 90 | Ga0070667_100000854 | 3300005367 | Bacteria | 28370 |
| 91 | Ga0070667_100003985 | 3300005367 | Bacteria | 12518 |
| 92 | Ga0070667_100012230 | 3300005367 | Bacteria | 7100 |
| 93 | Ga0070667_100051103 | 3300005367 | Bacteria | 3484 |
| 94 | Ga0070667_100134697 | 3300005367 | Bacteria | 2159 |
| 95 | Ga0070703_10009742 | 3300005406 | Bacteria | 2710 |
| 96 | Ga0070709_10045596 | 3300005434 | Bacteria | 2721 |
| 97 | Ga0070714_100000011 | 3300005435 | Bacteria | 231268 |
| 98 | Ga0070714_100006750 | 3300005435 | Bacteria | 8894 |
| 99 | Ga0070714_100086997 | 3300005435 | Bacteria | 2732 |
| 100 | Ga0070714_100110626 | 3300005435 | Bacteria | 2432 |
| 101 | Ga0070714_100163353 | 3300005435 | Bacteria | 2016 |
| 102 | Ga0070713_100003953 | 3300005436 | Bacteria | 9851 |
| 103 | Ga0070713_100106097 | 3300005436 | Bacteria | 2442 |
| 104 | Ga0070713_100152745 | 3300005436 | Bacteria | 2055 |
| 105 | Ga0070710_10000264 | 3300005437 | Bacteria | 24986 |
| 106 | Ga0070710_10000277 | 3300005437 | Bacteria | 24255 |
| 107 | Ga0070701_10000584 | 3300005438 | Bacteria | 12705 |
| 108 | Ga0070701_10003695 | 3300005438 | Bacteria | 6104 |
| 109 | Ga0070711_100000493 | 3300005439 | Bacteria | 20558 |
| 110 | Ga0070711_100154332 | 3300005439 | Bacteria | 1734 |
| 111 | Ga0070705_100004099 | 3300005440 | Bacteria | 7115 |
| 112 | Ga0070700_100000046 | 3300005441 | Bacteria | 91380 |
| 113 | Ga0070700_100003730 | 3300005441 | Bacteria | 7875 |
| 114 | Ga0070700_100005557 | 3300005441 | Bacteria | 6683 |
| 115 | Ga0070700_100026657 | 3300005441 | Bacteria | 3417 |
| 116 | Ga0070700_100090058 | 3300005441 | Bacteria | 2000 |
| 117 | Ga0070694_100024042 | 3300005444 | Bacteria | 3929 |
| 118 | Ga0070708_100000671 | 3300005445 | Bacteria | 26000 |
| 119 | Ga0070708_100008205 | 3300005445 | Bacteria | 8381 |
| 120 | Ga0070663_100015215 | 3300005455 | Bacteria | 4959 |
| 121 | Ga0070663_100046120 | 3300005455 | Bacteria | 3082 |
| 122 | Ga0070663_100065685 | 3300005455 | Bacteria | 2627 |
| 123 | Ga0070678_100000280 | 3300005456 | Bacteria | 23679 |
| 124 | Ga0070678_100059459 | 3300005456 | Bacteria | 2809 |
| 125 | Ga0070662_100001491 | 3300005457 | Bacteria | 14399 |
| 126 | Ga0070681_10000077 | 3300005458 | Bacteria | 72675 |
| 127 | Ga0070681_10001025 | 3300005458 | Bacteria | 23693 |
| 128 | Ga0070681_10071491 | 3300005458 | Bacteria | 3434 |
| 129 | Ga0068867_100002048 | 3300005459 | Bacteria | 14123 |
| 130 | Ga0068867_100003687 | 3300005459 | Bacteria | 10780 |
| 131 | Ga0070685_10018850 | 3300005466 | Bacteria | 3717 |
| 132 | Ga0070706_100009403 | 3300005467 | Bacteria | 9102 |
| 133 | Ga0070706_100021841 | 3300005467 | Bacteria | 5894 |
| 134 | Ga0070706_100028028 | 3300005467 | Bacteria | 5182 |
| 135 | Ga0070706_100066875 | 3300005467 | Bacteria | 3324 |
| 136 | Ga0070706_100085150 | 3300005467 | Bacteria | 2929 |
| 137 | Ga0070706_100167265 | 3300005467 | Bacteria | 2053 |
| 138 | Ga0070707_100001912 | 3300005468 | Bacteria | 19958 |
| 139 | Ga0070707_100180704 | 3300005468 | Bacteria | 2056 |
| 140 | Ga0070698_100008833 | 3300005471 | Bacteria | 10839 |
| 141 | Ga0070698_100045276 | 3300005471 | Bacteria | 4504 |
| 142 | Ga0070698_100053032 | 3300005471 | Bacteria | 4122 |
| 143 | Ga0070679_100000135 | 3300005530 | Bacteria | 59584 |
| 144 | Ga0070679_100001551 | 3300005530 | Bacteria | 20538 |
| 145 | Ga0070679_100040221 | 3300005530 | Bacteria | 4651 |
| 146 | Ga0070679_100067837 | 3300005530 | Bacteria | 3558 |
| 147 | Ga0070679_100167285 | 3300005530 | Bacteria | 2172 |
| 148 | Ga0070684_100003821 | 3300005535 | Bacteria | 11391 |
| 149 | Ga0070684_100088166 | 3300005535 | Bacteria | 2756 |
| 150 | Ga0070697_100002048 | 3300005536 | Bacteria | 15439 |
| 151 | Ga0068853_100001367 | 3300005539 | Bacteria | 17604 |
| 152 | Ga0068853_100017068 | 3300005539 | Bacteria | 5987 |
| 153 | Ga0068853_100044645 | 3300005539 | Bacteria | 3794 |
| 154 | Ga0070672_100003670 | 3300005543 | Bacteria | 9972 |
| 155 | Ga0070695_100021815 | 3300005545 | Bacteria | 3924 |
| 156 | Ga0070695_100036124 | 3300005545 | Bacteria | 3108 |
| 157 | Ga0070696_100002977 | 3300005546 | Bacteria | 11251 |
| 158 | Ga0070696_100030003 | 3300005546 | Bacteria | 3720 |
| 159 | Ga0070693_100009341 | 3300005547 | Bacteria | 4874 |
| 160 | Ga0070665_100001617 | 3300005548 | Bacteria | 25940 |
| 161 | Ga0070665_100006813 | 3300005548 | Bacteria | 11618 |
| 162 | Ga0070665_100056517 | 3300005548 | Bacteria | 3934 |
| 163 | Ga0070665_100075774 | 3300005548 | Bacteria | 3371 |
| 164 | Ga0070665_100113871 | 3300005548 | Bacteria | 2708 |
| 165 | Ga0070665_100160653 | 3300005548 | Bacteria | 2249 |
| 166 | Ga0070704_100001052 | 3300005549 | Bacteria | 14260 |
| 167 | Ga0070704_100129626 | 3300005549 | Bacteria | 1952 |
| 168 | Ga0068855_100010555 | 3300005563 | Bacteria | 11138 |
| 169 | Ga0068855_100038437 | 3300005563 | Bacteria | 5687 |
| 170 | Ga0068855_100050888 | 3300005563 | Bacteria | 4880 |
| 171 | Ga0070664_100020153 | 3300005564 | Bacteria | 5491 |
| 172 | Ga0070664_100031931 | 3300005564 | Bacteria | 4404 |
| 173 | Ga0068857_100033853 | 3300005577 | Bacteria | 4519 |
| 174 | Ga0068857_100057168 | 3300005577 | Bacteria | 3462 |
| 175 | Ga0068854_100000458 | 3300005578 | Bacteria | 25182 |
| 176 | Ga0068854_100069551 | 3300005578 | Bacteria | 2570 |
| 177 | Ga0068856_100023376 | 3300005614 | Bacteria | 6009 |
| 178 | Ga0068856_100068491 | 3300005614 | Bacteria | 3508 |
| 179 | Ga0068856_100077717 | 3300005614 | Bacteria | 3289 |
| 180 | Ga0068856_100081444 | 3300005614 | Bacteria | 3211 |
| 181 | Ga0068856_100093039 | 3300005614 | Bacteria | 3000 |
| 182 | Ga0068856_100139694 | 3300005614 | Bacteria | 2429 |
| 183 | Ga0070702_100000308 | 3300005615 | Bacteria | 16864 |
| 184 | Ga0070702_100016071 | 3300005615 | Bacteria | 3833 |
| 185 | Ga0068852_100020000 | 3300005616 | Bacteria | 5315 |
| 186 | Ga0068852_100046729 | 3300005616 | Bacteria | 3690 |
| 187 | Ga0068859_100000596 | 3300005617 | Bacteria | 36034 |
| 188 | Ga0068859_100000751 | 3300005617 | Bacteria | 32654 |
| 189 | Ga0068859_100061973 | 3300005617 | Bacteria | 3769 |
| 190 | Ga0068859_100064675 | 3300005617 | Bacteria | 3690 |
| 191 | Ga0068859_100245302 | 3300005617 | Bacteria | 1881 |
| 192 | Ga0068864_100010645 | 3300005618 | Bacteria | 7603 |
| 193 | Ga0068864_100049976 | 3300005618 | Bacteria | 3598 |
| 194 | Ga0068864_100143695 | 3300005618 | Bacteria | 2154 |
| 195 | Ga0068866_10000187 | 3300005718 | Bacteria | 29090 |
| 196 | Ga0068866_10039686 | 3300005718 | Bacteria | 2326 |
| 197 | Ga0068866_10066629 | 3300005718 | Bacteria | 1888 |
| 198 | Ga0068861_100000195 | 3300005719 | Bacteria | 32550 |
| 199 | Ga0068861_100009645 | 3300005719 | Bacteria | 6669 |
| 200 | Ga0068851_10044148 | 3300005834 | Bacteria | 2249 |
| 201 | Ga0068863_100000345 | 3300005841 | Bacteria | 47228 |
| 202 | Ga0068863_100001182 | 3300005841 | Bacteria | 26109 |
| 203 | Ga0068863_100002092 | 3300005841 | Bacteria | 19783 |
| 204 | Ga0068863_100009630 | 3300005841 | Bacteria | 9424 |
| 205 | Ga0068863_100009994 | 3300005841 | Bacteria | 9236 |
| 206 | Ga0068863_100014417 | 3300005841 | Bacteria | 7614 |
| 207 | Ga0068863_100066840 | 3300005841 | Bacteria | 3400 |
| 208 | Ga0068863_100076174 | 3300005841 | Bacteria | 3174 |
| 209 | Ga0068863_100115358 | 3300005841 | Bacteria | 2559 |
| 210 | Ga0068863_100249428 | 3300005841 | Bacteria | 1714 |
| 211 | Ga0068858_100000010 | 3300005842 | Bacteria | 234748 |
| 212 | Ga0068858_100000013 | 3300005842 | Bacteria | 216466 |
| 213 | Ga0068858_100013843 | 3300005842 | Bacteria | 7610 |
| 214 | Ga0068858_100047379 | 3300005842 | Bacteria | 3985 |
| 215 | Ga0068858_100068586 | 3300005842 | Bacteria | 3286 |
| 216 | Ga0068858_100070309 | 3300005842 | Bacteria | 3244 |
| 217 | Ga0068858_100102867 | 3300005842 | Bacteria | 2664 |
| 218 | Ga0068860_100000054 | 3300005843 | Bacteria | 206114 |
| 219 | Ga0068860_100000092 | 3300005843 | Bacteria | 150190 |
| 220 | Ga0068860_100001932 | 3300005843 | Bacteria | 21940 |
| 221 | Ga0068860_100122269 | 3300005843 | Bacteria | 2493 |
| 222 | Ga0068860_100184455 | 3300005843 | Bacteria | 2017 |
| 223 | Ga0068860_100187925 | 3300005843 | Bacteria | 1998 |
| 224 | Ga0068862_100000035 | 3300005844 | Bacteria | 174953 |
| 225 | Ga0068862_100000358 | 3300005844 | Bacteria | 49480 |
| 226 | Ga0068862_100033018 | 3300005844 | Bacteria | 4372 |
| 227 | Ga0068862_100036238 | 3300005844 | Bacteria | 4181 |
| 228 | Ga0081455_10000071 | 3300005937 | Bacteria | 110373 |
| 229 | Ga0081455_10000262 | 3300005937 | Bacteria | 69313 |
| 230 | Ga0081455_10001346 | 3300005937 | Bacteria | 30424 |
| 231 | Ga0081455_10015182 | 3300005937 | Bacteria | 7494 |
| 232 | Ga0081455_10015517 | 3300005937 | Bacteria | 7396 |
| 233 | Ga0081455_10015911 | 3300005937 | Bacteria | 7282 |
| 234 | Ga0081538_10000050 | 3300005981 | Bacteria | 110501 |
| 235 | Ga0081538_10022725 | 3300005981 | Bacteria | 4534 |
| 236 | Ga0081538_10070670 | 3300005981 | Bacteria | 1926 |
| 237 | Ga0081540_1000522 | 3300005983 | Bacteria | 37453 |
| 238 | Ga0081540_1000903 | 3300005983 | Bacteria | 26812 |
| 239 | Ga0081540_1000912 | 3300005983 | Bacteria | 26643 |
| 240 | Ga0081540_1002205 | 3300005983 | Bacteria | 16090 |
| 241 | Ga0081540_1015235 | 3300005983 | Bacteria | 4874 |
| 242 | Ga0081540_1028790 | 3300005983 | Bacteria | 3109 |
| 243 | Ga0081539_10000086 | 3300005985 | Bacteria | 217801 |
| 244 | Ga0081539_10000763 | 3300005985 | Bacteria | 63498 |
| 245 | Ga0081539_10003492 | 3300005985 | Bacteria | 19204 |
| 246 | Ga0081539_10004406 | 3300005985 | Bacteria | 15592 |
| 247 | Ga0081539_10005222 | 3300005985 | Bacteria | 13439 |
| 248 | Ga0081539_10010250 | 3300005985 | Bacteria | 7655 |
| 249 | Ga0081539_10036577 | 3300005985 | Bacteria | 2937 |
| 250 | Ga0081539_10044321 | 3300005985 | Bacteria | 2569 |
| 251 | Ga0081539_10072764 | 3300005985 | Bacteria | 1836 |
| 252 | Ga0070717_10040433 | 3300006028 | Bacteria | 3798 |
| 253 | Ga0070717_10049357 | 3300006028 | Bacteria | 3455 |
| 254 | Ga0070717_10161596 | 3300006028 | Bacteria | 1943 |
| 255 | Ga0075365_10031640 | 3300006038 | Bacteria | 3395 |
| 256 | Ga0075365_10040457 | 3300006038 | Bacteria | 3040 |
| 257 | Ga0075365_10072687 | 3300006038 | Bacteria | 2317 |
| 258 | Ga0075363_100019672 | 3300006048 | Bacteria | 3378 |
| 259 | Ga0075363_100040686 | 3300006048 | Bacteria | 2450 |
| 260 | Ga0075363_100058072 | 3300006048 | Bacteria | 2078 |
| 261 | Ga0075364_10001965 | 3300006051 | Bacteria | 11452 |
| 262 | Ga0075364_10003691 | 3300006051 | Bacteria | 8739 |
| 263 | Ga0075364_10017939 | 3300006051 | Bacteria | 4426 |
| 264 | Ga0075364_10051014 | 3300006051 | Bacteria | 2701 |
| 265 | Ga0070715_10005907 | 3300006163 | Bacteria | 4123 |
| 266 | Ga0070716_100007171 | 3300006173 | Bacteria | 5480 |
| 267 | Ga0070716_100025356 | 3300006173 | Bacteria | 3163 |
| 268 | Ga0070716_100116427 | 3300006173 | Bacteria | 1665 |
| 269 | Ga0070712_100001061 | 3300006175 | Bacteria | 16610 |
| 270 | Ga0070712_100009444 | 3300006175 | Bacteria | 6146 |
| 271 | Ga0070712_100110988 | 3300006175 | Bacteria | 2046 |
| 272 | Ga0075362_10021385 | 3300006177 | Bacteria | 2714 |
| 273 | Ga0075369_10002244 | 3300006186 | Bacteria | 6854 |
| 274 | Ga0075369_10006357 | 3300006186 | Bacteria | 4463 |
| 275 | Ga0075369_10044254 | 3300006186 | Bacteria | 1912 |
| 276 | Ga0075369_10046171 | 3300006186 | Bacteria | 1875 |
| 277 | Ga0097621_100036611 | 3300006237 | Bacteria | 3927 |
| 278 | Ga0075370_10001448 | 3300006353 | Bacteria | 10304 |
| 279 | Ga0075370_10034607 | 3300006353 | Bacteria | 2832 |
| 280 | Ga0075370_10063851 | 3300006353 | Bacteria | 2099 |
| 281 | Ga0068871_100011221 | 3300006358 | Bacteria | 6566 |
| 282 | Ga0068871_100093095 | 3300006358 | Bacteria | 2514 |
| 283 | Ga0075428_100000610 | 3300006844 | Bacteria | 36472 |
| 284 | Ga0075428_100007051 | 3300006844 | Bacteria | 12454 |
| 285 | Ga0075428_100007414 | 3300006844 | Bacteria | 12158 |
| 286 | Ga0075428_100030689 | 3300006844 | Bacteria | 5943 |
| 287 | Ga0075428_100174888 | 3300006844 | Bacteria | 2326 |
| 288 | Ga0075428_100311879 | 3300006844 | Bacteria | 1691 |
| 289 | Ga0075428_100400186 | 3300006844 | Bacteria | 1472 |
| 290 | Ga0075430_100007092 | 3300006846 | Bacteria | 9450 |
| 291 | Ga0075430_100015607 | 3300006846 | Bacteria | 6467 |
| 292 | Ga0075430_100034036 | 3300006846 | Bacteria | 4324 |
| 293 | Ga0075430_100041690 | 3300006846 | Bacteria | 3883 |
| 294 | Ga0075430_100067840 | 3300006846 | Bacteria | 2994 |
| 295 | Ga0075431_100012865 | 3300006847 | Bacteria | 8445 |
| 296 | Ga0075431_100056189 | 3300006847 | Bacteria | 4060 |
| 297 | Ga0075431_100060345 | 3300006847 | Bacteria | 3913 |
| 298 | Ga0075431_100068233 | 3300006847 | Bacteria | 3669 |
| 299 | Ga0075431_100171475 | 3300006847 | Bacteria | 2229 |
| 300 | Ga0075433_10007460 | 3300006852 | Bacteria | 8684 |
| 301 | Ga0075434_100032312 | 3300006871 | Bacteria | 5161 |
| 302 | Ga0075434_100291348 | 3300006871 | Bacteria | 1652 |
| 303 | Ga0075429_100009820 | 3300006880 | Bacteria | 8298 |
| 304 | Ga0075429_100016282 | 3300006880 | Bacteria | 6444 |
| 305 | Ga0075429_100022283 | 3300006880 | Bacteria | 5495 |
| 306 | Ga0075429_100051551 | 3300006880 | Bacteria | 3581 |
| 307 | Ga0075429_100144942 | 3300006880 | Bacteria | 2079 |
| 308 | Ga0068865_100003084 | 3300006881 | Bacteria | 9971 |
| 309 | Ga0068865_100006359 | 3300006881 | Bacteria | 7199 |
| 310 | Ga0068865_100053951 | 3300006881 | Bacteria | 2791 |
| 311 | Ga0075436_100050482 | 3300006914 | Bacteria | 2871 |
| 312 | Ga0097620_100000596 | 3300006931 | Bacteria | 36034 |
| 313 | Ga0097620_100000751 | 3300006931 | Bacteria | 32654 |
| 314 | Ga0097620_100061974 | 3300006931 | Bacteria | 3769 |
| 315 | Ga0097620_100064675 | 3300006931 | Bacteria | 3690 |
| 316 | Ga0097620_100245303 | 3300006931 | Bacteria | 1881 |
| 317 | Ga0105251_10030178 | 3300009011 | Bacteria | 2725 |
| 318 | Ga0105251_10053826 | 3300009011 | Bacteria | 1912 |
| 319 | Ga0105250_10018756 | 3300009092 | Bacteria | 2800 |
| 320 | Ga0105240_10003639 | 3300009093 | Bacteria | 23876 |
| 321 | Ga0105240_10037111 | 3300009093 | Bacteria | 6264 |
| 322 | Ga0105240_10194704 | 3300009093 | Bacteria | 2381 |
| 323 | Ga0105240_10354671 | 3300009093 | Bacteria | 1663 |
| 324 | Ga0111539_10001504 | 3300009094 | Bacteria | 31141 |
| 325 | Ga0111539_10002724 | 3300009094 | Bacteria | 23442 |
| 326 | Ga0111539_10009764 | 3300009094 | Bacteria | 12113 |
| 327 | Ga0111539_10100066 | 3300009094 | Bacteria | 3404 |
| 328 | Ga0105245_10000870 | 3300009098 | Bacteria | 27352 |
| 329 | Ga0105245_10005605 | 3300009098 | Bacteria | 11030 |
| 330 | Ga0105245_10005886 | 3300009098 | Bacteria | 10772 |
| 331 | Ga0105245_10018820 | 3300009098 | Bacteria | 6043 |
| 332 | Ga0105245_10097087 | 3300009098 | Bacteria | 2720 |
| 333 | Ga0105245_10176509 | 3300009098 | Bacteria | 2038 |
| 334 | Ga0105245_10263285 | 3300009098 | Bacteria | 1679 |
| 335 | Ga0105247_10000038 | 3300009101 | Bacteria | 164083 |
| 336 | Ga0105247_10000062 | 3300009101 | Bacteria | 126437 |
| 337 | Ga0105247_10000637 | 3300009101 | Bacteria | 28051 |
| 338 | Ga0105247_10009210 | 3300009101 | Bacteria | 6005 |
| 339 | Ga0105247_10018328 | 3300009101 | Bacteria | 4200 |
| 340 | Ga0105247_10022164 | 3300009101 | Bacteria | 3824 |
| 341 | Ga0114129_10000852 | 3300009147 | Bacteria | 39505 |
| 342 | Ga0114129_10001274 | 3300009147 | Bacteria | 33664 |
| 343 | Ga0114129_10001724 | 3300009147 | Bacteria | 29818 |
| 344 | Ga0114129_10091266 | 3300009147 | Bacteria | 4221 |
| 345 | Ga0114129_10118258 | 3300009147 | Bacteria | 3651 |
| 346 | Ga0114129_10185214 | 3300009147 | Bacteria | 2830 |
| 347 | Ga0105243_10001020 | 3300009148 | Bacteria | 25871 |
| 348 | Ga0105243_10021920 | 3300009148 | Bacteria | 4852 |
| 349 | Ga0105243_10194003 | 3300009148 | Bacteria | 1776 |
| 350 | Ga0105241_10025845 | 3300009174 | Bacteria | 4365 |
| 351 | Ga0105241_10133231 | 3300009174 | Bacteria | 2014 |
| 352 | Ga0105242_10000650 | 3300009176 | Bacteria | 27213 |
| 353 | Ga0105242_10027971 | 3300009176 | Bacteria | 4483 |
| 354 | Ga0105242_10041014 | 3300009176 | Bacteria | 3731 |
| 355 | Ga0105242_10092703 | 3300009176 | Bacteria | 2545 |
| 356 | Ga0105242_10103959 | 3300009176 | Bacteria | 2410 |
| 357 | Ga0105242_10135768 | 3300009176 | Bacteria | 2129 |
| 358 | Ga0105248_10000035 | 3300009177 | Bacteria | 187578 |
| 359 | Ga0105248_10000036 | 3300009177 | Bacteria | 187421 |
| 360 | Ga0105248_10003863 | 3300009177 | Bacteria | 16573 |
| 361 | Ga0105248_10011321 | 3300009177 | Bacteria | 9832 |
| 362 | Ga0105248_10033866 | 3300009177 | Bacteria | 5707 |
| 363 | Ga0105248_10039835 | 3300009177 | Bacteria | 5266 |
| 364 | Ga0105248_10045424 | 3300009177 | Bacteria | 4926 |
| 365 | Ga0105248_10049682 | 3300009177 | Bacteria | 4704 |
| 366 | Ga0105248_10075304 | 3300009177 | Bacteria | 3793 |
| 367 | Ga0105248_10134247 | 3300009177 | Bacteria | 2792 |
| 368 | Ga0105248_10201205 | 3300009177 | Bacteria | 2244 |
| 369 | Ga0105248_10238833 | 3300009177 | Bacteria | 2045 |
| 370 | Ga0105248_10241017 | 3300009177 | Bacteria | 2036 |
| 371 | Ga0105237_10000467 | 3300009545 | Bacteria | 57237 |
| 372 | Ga0105237_10014748 | 3300009545 | Bacteria | 8156 |
| 373 | Ga0105237_10014930 | 3300009545 | Bacteria | 8099 |
| 374 | Ga0105237_10044770 | 3300009545 | Bacteria | 4456 |
| 375 | Ga0105238_10032638 | 3300009551 | Bacteria | 5298 |
| 376 | Ga0105238_10085210 | 3300009551 | Bacteria | 3148 |
| 377 | Ga0105238_10307532 | 3300009551 | Bacteria | 1570 |
| 378 | Ga0105249_10000046 | 3300009553 | Bacteria | 176363 |
| 379 | Ga0105249_10001186 | 3300009553 | Bacteria | 23057 |
| 380 | Ga0105249_10005191 | 3300009553 | Bacteria | 11241 |
| 381 | Ga0105249_10118937 | 3300009553 | Bacteria | 2508 |
| 382 | Ga0099796_10029146 | 3300010159 | Bacteria | 1778 |
| 383 | Ga0105239_10003093 | 3300010375 | Bacteria | 20661 |
| 384 | Ga0105239_10008819 | 3300010375 | Bacteria | 11412 |
| 385 | Ga0105239_10016946 | 3300010375 | Bacteria | 8054 |
| 386 | Ga0105239_10147161 | 3300010375 | Bacteria | 2628 |
| 387 | Ga0105239_10323128 | 3300010375 | Bacteria | 1740 |
| 388 | Ga0105246_10014319 | 3300011119 | Bacteria | 4987 |
| 389 | Ga0105246_10040638 | 3300011119 | Bacteria | 3140 |
| 390 | Ga0105246_10062558 | 3300011119 | Bacteria | 2593 |
| 391 | Ga0105246_10083890 | 3300011119 | Bacteria | 2278 |
| 392 | Ga0105246_10094152 | 3300011119 | Bacteria | 2166 |
| 393 | Ga0157373_10026116 | 3300013100 | Bacteria | 4221 |
| 394 | Ga0157373_10034275 | 3300013100 | Bacteria | 3646 |
| 395 | Ga0157371_10056311 | 3300013102 | Bacteria | 2789 |
| 396 | Ga0157370_10014109 | 3300013104 | Bacteria | 8196 |
| 397 | Ga0157370_10016416 | 3300013104 | Bacteria | 7496 |
| 398 | Ga0157370_10040559 | 3300013104 | Bacteria | 4495 |
| 399 | Ga0157370_10132940 | 3300013104 | Bacteria | 2320 |
| 400 | Ga0157369_10000890 | 3300013105 | Bacteria | 38122 |
| 401 | Ga0157369_10010203 | 3300013105 | Bacteria | 10717 |
| 402 | Ga0157369_10048565 | 3300013105 | Bacteria | 4605 |
| 403 | Ga0157369_10065749 | 3300013105 | Bacteria | 3902 |
| 404 | Ga0157369_10098846 | 3300013105 | Bacteria | 3111 |
| 405 | Ga0157369_10100808 | 3300013105 | Bacteria | 3078 |
| 406 | Ga0157369_10235375 | 3300013105 | Bacteria | 1914 |
| 407 | Ga0157369_10269053 | 3300013105 | Bacteria | 1776 |
| 408 | Ga0157374_10203151 | 3300013296 | Bacteria | 1941 |
| 409 | Ga0157378_10029056 | 3300013297 | Bacteria | 4879 |
| 410 | Ga0163162_10001609 | 3300013306 | Bacteria | 21131 |
| 411 | Ga0163162_10054540 | 3300013306 | Bacteria | 4021 |
| 412 | Ga0163162_10094916 | 3300013306 | Bacteria | 3069 |
| 413 | Ga0157372_10000069 | 3300013307 | Bacteria | 110621 |
| 414 | Ga0157372_10004145 | 3300013307 | Bacteria | 15520 |
| 415 | Ga0157372_10081467 | 3300013307 | Bacteria | 3663 |
| 416 | Ga0157372_10252452 | 3300013307 | Bacteria | 2047 |
| 417 | Ga0157372_10256371 | 3300013307 | Bacteria | 2031 |
| 418 | Ga0157372_10466967 | 3300013307 | Bacteria | 1471 |
| 419 | Ga0157375_10000419 | 3300013308 | Bacteria | 38685 |
| 420 | Ga0157375_10097169 | 3300013308 | Bacteria | 3019 |
| 421 | Ga0163163_10008079 | 3300014325 | Bacteria | 9322 |
| 422 | Ga0163163_10013354 | 3300014325 | Bacteria | 7517 |
| 423 | Ga0163163_10041882 | 3300014325 | Bacteria | 4481 |
| 424 | Ga0163163_10095860 | 3300014325 | Bacteria | 2987 |
| 425 | Ga0163163_10109215 | 3300014325 | Bacteria | 2793 |
| 426 | Ga0163163_10141080 | 3300014325 | Bacteria | 2452 |
| 427 | Ga0157380_10015814 | 3300014326 | Bacteria | 5551 |
| 428 | Ga0157380_10056783 | 3300014326 | Bacteria | 3115 |
| 429 | Ga0157380_10162506 | 3300014326 | Bacteria | 1943 |
| 430 | Ga0157377_10003983 | 3300014745 | Bacteria | 6737 |
| 431 | Ga0157377_10037198 | 3300014745 | Bacteria | 2681 |
| 432 | Ga0157379_10000012 | 3300014968 | Bacteria | 110577 |
| 433 | Ga0157379_10008843 | 3300014968 | Bacteria | 8783 |
| 434 | Ga0157379_10020489 | 3300014968 | Bacteria | 5847 |
| 435 | Ga0157379_10045149 | 3300014968 | Bacteria | 3934 |
| 436 | Ga0157379_10185118 | 3300014968 | Bacteria | 1882 |
| 437 | Ga0157376_10003944 | 3300014969 | Bacteria | 10264 |
| 438 | Ga0182007_10006330 | 3300015262 | Bacteria | 5091 |
| 439 | Ga0183367_1002 | 3300015688 | Bacteria | 1101531 |
| 440 | Ga0163161_10004818 | 3300017792 | Bacteria | 9403 |
| 441 | Ga0163161_10021838 | 3300017792 | Bacteria | 4501 |
| 442 | Ga0163161_10025906 | 3300017792 | Bacteria | 4152 |
| 443 | Ga0197907_10125209 | 3300020069 | Bacteria | 3972 |
| 444 | Ga0197907_10824310 | 3300020069 | Bacteria | 2432 |
| 445 | Ga0197907_11041682 | 3300020069 | Bacteria | 2109 |
| 446 | Ga0206356_11084540 | 3300020070 | Bacteria | 3024 |
| 447 | Ga0206356_11251781 | 3300020070 | Bacteria | 3419 |
| 448 | Ga0206356_11557117 | 3300020070 | Bacteria | 2360 |
| 449 | Ga0206355_1061250 | 3300020076 | Bacteria | 1620 |
| 450 | Ga0206351_10970124 | 3300020077 | Bacteria | 2115 |
| 451 | Ga0206352_11163761 | 3300020078 | Bacteria | 1641 |
| 452 | Ga0206350_11654720 | 3300020080 | Bacteria | 2983 |
| 453 | Ga0206353_10041609 | 3300020082 | Bacteria | 2329 |
| 454 | Ga0206353_10184723 | 3300020082 | Bacteria | 3671 |
| 455 | Ga0206353_10976662 | 3300020082 | Bacteria | 5738 |
| 456 | Ga0154015_1539966 | 3300020610 | Bacteria | 2439 |
| 457 | Ga0154015_1634210 | 3300020610 | Bacteria | 1709 |
| 458 | Ga0154015_1690007 | 3300020610 | Bacteria | 2383 |
| 459 | Ga0213873_10000037 | 3300021358 | Bacteria | 34798 |
| 460 | Ga0213876_10000793 | 3300021384 | Bacteria | 21431 |
| 461 | Ga0213876_10019769 | 3300021384 | Bacteria | 3557 |
| 462 | Ga0213876_10075381 | 3300021384 | Bacteria | 1781 |
| 463 | Ga0213875_10002364 | 3300021388 | Bacteria | 11366 |
| 464 | Ga0213875_10010278 | 3300021388 | Bacteria | 4690 |
| 465 | Ga0213875_10011142 | 3300021388 | Bacteria | 4482 |
| 466 | Ga0213875_10016187 | 3300021388 | Bacteria | 3618 |
| 467 | Ga0213875_10017198 | 3300021388 | Bacteria | 3498 |
| 468 | Ga0213875_10023525 | 3300021388 | Bacteria | 2942 |
| 469 | Ga0213875_10035752 | 3300021388 | Bacteria | 2343 |
| 470 | Ga0224712_10000640 | 3300022467 | Bacteria | 7152 |
| 471 | Ga0224712_10000868 | 3300022467 | Bacteria | 6453 |
| 472 | Ga0224712_10001321 | 3300022467 | Bacteria | 5648 |
| 473 | Ga0224712_10002852 | 3300022467 | Bacteria | 4361 |
| 474 | Ga0224712_10003615 | 3300022467 | Bacteria | 4050 |
| 475 | Ga0224712_10008703 | 3300022467 | Bacteria | 3023 |
| 476 | Ga0224712_10021348 | 3300022467 | Bacteria | 2215 |
| 477 | Ga0228598_1007224 | 3300024227 | Bacteria | 2270 |
| 478 | Ga0209758_1005072 | 3300025297 | Bacteria | 10434 |
| 479 | Ga0207426_1002674 | 3300025302 | Bacteria | 10931 |
| 480 | Ga0207426_1004723 | 3300025302 | Bacteria | 6516 |
| 481 | Ga0209051_1000011 | 3300025303 | Bacteria | 610828 |
| 482 | Ga0209051_1000620 | 3300025303 | Bacteria | 40785 |
| 483 | Ga0209051_1000933 | 3300025303 | Bacteria | 28862 |
| 484 | Ga0209051_1001428 | 3300025303 | Bacteria | 20451 |
| 485 | Ga0209051_1042780 | 3300025303 | Bacteria | 1597 |
| 486 | Ga0207713_1047252 | 3300025735 | Bacteria | 1743 |
| 487 | Ga0207653_10019979 | 3300025885 | Bacteria | 2117 |
| 488 | Ga0207692_10000049 | 3300025898 | Bacteria | 35853 |
| 489 | Ga0207692_10006547 | 3300025898 | Bacteria | 4728 |
| 490 | Ga0207692_10041273 | 3300025898 | Bacteria | 2283 |
| 491 | Ga0207642_10000726 | 3300025899 | Bacteria | 10182 |
| 492 | Ga0207642_10008157 | 3300025899 | Bacteria | 3579 |
| 493 | Ga0207710_10000017 | 3300025900 | Bacteria | 370962 |
| 494 | Ga0207710_10000048 | 3300025900 | Bacteria | 189597 |
| 495 | Ga0207710_10000060 | 3300025900 | Bacteria | 168230 |
| 496 | Ga0207710_10000890 | 3300025900 | Bacteria | 15991 |
| 497 | Ga0207710_10017562 | 3300025900 | Bacteria | 3034 |
| 498 | Ga0207710_10018265 | 3300025900 | Bacteria | 2981 |
| 499 | Ga0207688_10000177 | 3300025901 | Bacteria | 28125 |
| 500 | Ga0207688_10000985 | 3300025901 | Bacteria | 14533 |
| 501 | Ga0207688_10001785 | 3300025901 | Bacteria | 11428 |
| 502 | Ga0207688_10003133 | 3300025901 | Bacteria | 9023 |
| 503 | Ga0207688_10069288 | 3300025901 | Bacteria | 1999 |
| 504 | Ga0207688_10089663 | 3300025901 | Bacteria | 1765 |
| 505 | Ga0207680_10004709 | 3300025903 | Bacteria | 6485 |
| 506 | Ga0207680_10019714 | 3300025903 | Bacteria | 3612 |
| 507 | Ga0207680_10055310 | 3300025903 | Bacteria | 2391 |
| 508 | Ga0207680_10074674 | 3300025903 | Bacteria | 2112 |
| 509 | Ga0207647_10041404 | 3300025904 | Bacteria | 2896 |
| 510 | Ga0207647_10052506 | 3300025904 | Bacteria | 2516 |
| 511 | Ga0207685_10001985 | 3300025905 | Bacteria | 4542 |
| 512 | Ga0207685_10028071 | 3300025905 | Bacteria | 1977 |
| 513 | Ga0207699_10044380 | 3300025906 | Bacteria | 2587 |
| 514 | Ga0207699_10066505 | 3300025906 | Bacteria | 2188 |
| 515 | Ga0207699_10071370 | 3300025906 | Bacteria | 2123 |
| 516 | Ga0207645_10022095 | 3300025907 | Bacteria | 4144 |
| 517 | Ga0207643_10000335 | 3300025908 | Bacteria | 32120 |
| 518 | Ga0207643_10012832 | 3300025908 | Bacteria | 4529 |
| 519 | Ga0207705_10000676 | 3300025909 | Bacteria | 28263 |
| 520 | Ga0207705_10002002 | 3300025909 | Bacteria | 15842 |
| 521 | Ga0207705_10014666 | 3300025909 | Bacteria | 5638 |
| 522 | Ga0207705_10020763 | 3300025909 | Bacteria | 4687 |
| 523 | Ga0207705_10020946 | 3300025909 | Bacteria | 4665 |
| 524 | Ga0207705_10061174 | 3300025909 | Bacteria | 2720 |
| 525 | Ga0207705_10138892 | 3300025909 | Bacteria | 1813 |
| 526 | Ga0207684_10002893 | 3300025910 | Bacteria | 17012 |
| 527 | Ga0207684_10143592 | 3300025910 | Bacteria | 2053 |
| 528 | Ga0207707_10000089 | 3300025912 | Bacteria | 90919 |
| 529 | Ga0207707_10009801 | 3300025912 | Bacteria | 8308 |
| 530 | Ga0207707_10010633 | 3300025912 | Bacteria | 7993 |
| 531 | Ga0207695_10017340 | 3300025913 | Bacteria | 8383 |
| 532 | Ga0207695_10027984 | 3300025913 | Bacteria | 6264 |
| 533 | Ga0207671_10038644 | 3300025914 | Bacteria | 3537 |
| 534 | Ga0207671_10056241 | 3300025914 | Bacteria | 2915 |
| 535 | Ga0207693_10000339 | 3300025915 | Bacteria | 43073 |
| 536 | Ga0207693_10001185 | 3300025915 | Bacteria | 23283 |
| 537 | Ga0207693_10029887 | 3300025915 | Bacteria | 4300 |
| 538 | Ga0207693_10067864 | 3300025915 | Bacteria | 2792 |
| 539 | Ga0207693_10075462 | 3300025915 | Bacteria | 2640 |
| 540 | Ga0207693_10083640 | 3300025915 | Bacteria | 2500 |
| 541 | Ga0207693_10118340 | 3300025915 | Bacteria | 2080 |
| 542 | Ga0207693_10157566 | 3300025915 | Bacteria | 1786 |
| 543 | Ga0207693_10170474 | 3300025915 | Bacteria | 1714 |
| 544 | Ga0207663_10035253 | 3300025916 | Bacteria | 3000 |
| 545 | Ga0207663_10062232 | 3300025916 | Bacteria | 2371 |
| 546 | Ga0207660_10000115 | 3300025917 | Bacteria | 46447 |
| 547 | Ga0207660_10000815 | 3300025917 | Bacteria | 20585 |
| 548 | Ga0207660_10163950 | 3300025917 | Bacteria | 1717 |
| 549 | Ga0207660_10194254 | 3300025917 | Bacteria | 1582 |
| 550 | Ga0207662_10013813 | 3300025918 | Bacteria | 4520 |
| 551 | Ga0207662_10020422 | 3300025918 | Bacteria | 3780 |
| 552 | Ga0207662_10084502 | 3300025918 | Bacteria | 1942 |
| 553 | Ga0207657_10002680 | 3300025919 | Bacteria | 19204 |
| 554 | Ga0207657_10014660 | 3300025919 | Bacteria | 7638 |
| 555 | Ga0207657_10020276 | 3300025919 | Bacteria | 6287 |
| 556 | Ga0207657_10062164 | 3300025919 | Bacteria | 3198 |
| 557 | Ga0207657_10084696 | 3300025919 | Bacteria | 2656 |
| 558 | Ga0207657_10129847 | 3300025919 | Bacteria | 2066 |
| 559 | Ga0207649_10004339 | 3300025920 | Bacteria | 7701 |
| 560 | Ga0207649_10150627 | 3300025920 | Bacteria | 1602 |
| 561 | Ga0207652_10000015 | 3300025921 | Bacteria | 193042 |
| 562 | Ga0207652_10010364 | 3300025921 | Bacteria | 7504 |
| 563 | Ga0207652_10016837 | 3300025921 | Bacteria | 5974 |
| 564 | Ga0207652_10037921 | 3300025921 | Bacteria | 4081 |
| 565 | Ga0207652_10047432 | 3300025921 | Bacteria | 3669 |
| 566 | Ga0207646_10022954 | 3300025922 | Bacteria | 5736 |
| 567 | Ga0207681_10000788 | 3300025923 | Bacteria | 20865 |
| 568 | Ga0207694_10023506 | 3300025924 | Bacteria | 4679 |
| 569 | Ga0207650_10007490 | 3300025925 | Bacteria | 7443 |
| 570 | Ga0207650_10077853 | 3300025925 | Bacteria | 2507 |
| 571 | Ga0207650_10208497 | 3300025925 | Bacteria | 1569 |
| 572 | Ga0207659_10012720 | 3300025926 | Bacteria | 5369 |
| 573 | Ga0207659_10014966 | 3300025926 | Bacteria | 5015 |
| 574 | Ga0207687_10003312 | 3300025927 | Bacteria | 10883 |
| 575 | Ga0207687_10024289 | 3300025927 | Bacteria | 4048 |
| 576 | Ga0207687_10034677 | 3300025927 | Bacteria | 3427 |
| 577 | Ga0207687_10077886 | 3300025927 | Bacteria | 2385 |
| 578 | Ga0207687_10153233 | 3300025927 | Bacteria | 1761 |
| 579 | Ga0207700_10063014 | 3300025928 | Bacteria | 2818 |
| 580 | Ga0207700_10065136 | 3300025928 | Bacteria | 2779 |
| 581 | Ga0207700_10122586 | 3300025928 | Bacteria | 2110 |
| 582 | Ga0207700_10124281 | 3300025928 | Bacteria | 2096 |
| 583 | Ga0207664_10000001 | 3300025929 | Bacteria | 724213 |
| 584 | Ga0207664_10003864 | 3300025929 | Bacteria | 10068 |
| 585 | Ga0207664_10016390 | 3300025929 | Bacteria | 5406 |
| 586 | Ga0207664_10028564 | 3300025929 | Bacteria | 4240 |
| 587 | Ga0207664_10044386 | 3300025929 | Bacteria | 3480 |
| 588 | Ga0207664_10065900 | 3300025929 | Bacteria | 2901 |
| 589 | Ga0207664_10130771 | 3300025929 | Bacteria | 2113 |
| 590 | Ga0207664_10142941 | 3300025929 | Bacteria | 2026 |
| 591 | Ga0207644_10000976 | 3300025931 | Bacteria | 18277 |
| 592 | Ga0207644_10003155 | 3300025931 | Bacteria | 10607 |
| 593 | Ga0207644_10107041 | 3300025931 | Bacteria | 2109 |
| 594 | Ga0207690_10000171 | 3300025932 | Bacteria | 50511 |
| 595 | Ga0207690_10022295 | 3300025932 | Bacteria | 3937 |
| 596 | Ga0207706_10002589 | 3300025933 | Bacteria | 17618 |
| 597 | Ga0207706_10007779 | 3300025933 | Bacteria | 9895 |
| 598 | Ga0207706_10053435 | 3300025933 | Bacteria | 3566 |
| 599 | Ga0207686_10001637 | 3300025934 | Bacteria | 12508 |
| 600 | Ga0207686_10017197 | 3300025934 | Bacteria | 4072 |
| 601 | Ga0207686_10070814 | 3300025934 | Bacteria | 2242 |
| 602 | Ga0207686_10104898 | 3300025934 | Bacteria | 1894 |
| 603 | Ga0207709_10001393 | 3300025935 | Bacteria | 16930 |
| 604 | Ga0207709_10005302 | 3300025935 | Bacteria | 7335 |
| 605 | Ga0207709_10008671 | 3300025935 | Bacteria | 5610 |
| 606 | Ga0207670_10044191 | 3300025936 | Bacteria | 2947 |
| 607 | Ga0207670_10142032 | 3300025936 | Bacteria | 1771 |
| 608 | Ga0207669_10000205 | 3300025937 | Bacteria | 26813 |
| 609 | Ga0207669_10003947 | 3300025937 | Bacteria | 6471 |
| 610 | Ga0207704_10000618 | 3300025938 | Bacteria | 15725 |
| 611 | Ga0207704_10005569 | 3300025938 | Bacteria | 5806 |
| 612 | Ga0207704_10107026 | 3300025938 | Bacteria | 1880 |
| 613 | Ga0207665_10006357 | 3300025939 | Bacteria | 7837 |
| 614 | Ga0207665_10009000 | 3300025939 | Bacteria | 6552 |
| 615 | Ga0207665_10019025 | 3300025939 | Bacteria | 4511 |
| 616 | Ga0207665_10041528 | 3300025939 | Bacteria | 3072 |
| 617 | Ga0207665_10043041 | 3300025939 | Bacteria | 3019 |
| 618 | Ga0207665_10095785 | 3300025939 | Bacteria | 2063 |
| 619 | Ga0207691_10000365 | 3300025940 | Bacteria | 45542 |
| 620 | Ga0207691_10014980 | 3300025940 | Bacteria | 7383 |
| 621 | Ga0207691_10123103 | 3300025940 | Bacteria | 2296 |
| 622 | Ga0207711_10000073 | 3300025941 | Bacteria | 107878 |
| 623 | Ga0207711_10000747 | 3300025941 | Bacteria | 31851 |
| 624 | Ga0207711_10001409 | 3300025941 | Bacteria | 22525 |
| 625 | Ga0207711_10006606 | 3300025941 | Bacteria | 9769 |
| 626 | Ga0207711_10009126 | 3300025941 | Bacteria | 8280 |
| 627 | Ga0207711_10010854 | 3300025941 | Bacteria | 7570 |
| 628 | Ga0207711_10016330 | 3300025941 | Bacteria | 6168 |
| 629 | Ga0207711_10099817 | 3300025941 | Bacteria | 2567 |
| 630 | Ga0207711_10125273 | 3300025941 | Bacteria | 2297 |
| 631 | Ga0207711_10160682 | 3300025941 | Bacteria | 2033 |
| 632 | Ga0207689_10002913 | 3300025942 | Bacteria | 15796 |
| 633 | Ga0207689_10006800 | 3300025942 | Bacteria | 10062 |
| 634 | Ga0207689_10047196 | 3300025942 | Bacteria | 3558 |
| 635 | Ga0207689_10071434 | 3300025942 | Bacteria | 2851 |
| 636 | Ga0207661_10001912 | 3300025944 | Bacteria | 14292 |
| 637 | Ga0207661_10025154 | 3300025944 | Bacteria | 4523 |
| 638 | Ga0207661_10026607 | 3300025944 | Bacteria | 4410 |
| 639 | Ga0207661_10064146 | 3300025944 | Bacteria | 2977 |
| 640 | Ga0207661_10076749 | 3300025944 | Bacteria | 2745 |
| 641 | Ga0207661_10123955 | 3300025944 | Bacteria | 2204 |
| 642 | Ga0207661_10187600 | 3300025944 | Bacteria | 1811 |
| 643 | Ga0207661_10234549 | 3300025944 | Bacteria | 1626 |
| 644 | Ga0207679_10006663 | 3300025945 | Bacteria | 7313 |
| 645 | Ga0207679_10024111 | 3300025945 | Bacteria | 4168 |
| 646 | Ga0207679_10037555 | 3300025945 | Bacteria | 3444 |
| 647 | Ga0207679_10260636 | 3300025945 | Bacteria | 1478 |
| 648 | Ga0207667_10009549 | 3300025949 | Bacteria | 11416 |
| 649 | Ga0207667_10027730 | 3300025949 | Bacteria | 6160 |
| 650 | Ga0207667_10102345 | 3300025949 | Bacteria | 2955 |
| 651 | Ga0207667_10146731 | 3300025949 | Bacteria | 2429 |
| 652 | Ga0207667_10230340 | 3300025949 | Bacteria | 1897 |
| 653 | Ga0207651_10040572 | 3300025960 | Bacteria | 3081 |
| 654 | Ga0207651_10209457 | 3300025960 | Bacteria | 1568 |
| 655 | Ga0207712_10000042 | 3300025961 | Bacteria | 176338 |
| 656 | Ga0207712_10015171 | 3300025961 | Bacteria | 4966 |
| 657 | Ga0207712_10076219 | 3300025961 | Bacteria | 2427 |
| 658 | Ga0207712_10210514 | 3300025961 | Bacteria | 1548 |
| 659 | Ga0207668_10000918 | 3300025972 | Bacteria | 17752 |
| 660 | Ga0207668_10002531 | 3300025972 | Bacteria | 10674 |
| 661 | Ga0207668_10003383 | 3300025972 | Bacteria | 9352 |
| 662 | Ga0207668_10006483 | 3300025972 | Bacteria | 6920 |
| 663 | Ga0207668_10011491 | 3300025972 | Bacteria | 5383 |
| 664 | Ga0207668_10030292 | 3300025972 | Bacteria | 3555 |
| 665 | Ga0207640_10003652 | 3300025981 | Bacteria | 8297 |
| 666 | Ga0207640_10010659 | 3300025981 | Bacteria | 5184 |
| 667 | Ga0207640_10068543 | 3300025981 | Bacteria | 2378 |
| 668 | Ga0207658_10000449 | 3300025986 | Bacteria | 38511 |
| 669 | Ga0207658_10005595 | 3300025986 | Bacteria | 8596 |
| 670 | Ga0207658_10053121 | 3300025986 | Bacteria | 2992 |
| 671 | Ga0207658_10076757 | 3300025986 | Bacteria | 2547 |
| 672 | Ga0207658_10188247 | 3300025986 | Bacteria | 1713 |
| 673 | Ga0207677_10003695 | 3300026023 | Bacteria | 8117 |
| 674 | Ga0207677_10011197 | 3300026023 | Bacteria | 5104 |
| 675 | Ga0207677_10027876 | 3300026023 | Bacteria | 3565 |
| 676 | Ga0207677_10035072 | 3300026023 | Bacteria | 3254 |
| 677 | Ga0207677_10036316 | 3300026023 | Bacteria | 3210 |
| 678 | Ga0207677_10038832 | 3300026023 | Bacteria | 3124 |
| 679 | Ga0207677_10043595 | 3300026023 | Bacteria | 2984 |
| 680 | Ga0207703_10000002 | 3300026035 | Bacteria | 600711 |
| 681 | Ga0207703_10000009 | 3300026035 | Bacteria | 343983 |
| 682 | Ga0207703_10002964 | 3300026035 | Bacteria | 14391 |
| 683 | Ga0207703_10061458 | 3300026035 | Bacteria | 3075 |
| 684 | Ga0207639_10005809 | 3300026041 | Bacteria | 8358 |
| 685 | Ga0207639_10045082 | 3300026041 | Bacteria | 3320 |
| 686 | Ga0207639_10047931 | 3300026041 | Bacteria | 3232 |
| 687 | Ga0207639_10050377 | 3300026041 | Bacteria | 3162 |
| 688 | Ga0207639_10061070 | 3300026041 | Bacteria | 2909 |
| 689 | Ga0207678_10000657 | 3300026067 | Bacteria | 31782 |
| 690 | Ga0207678_10002619 | 3300026067 | Bacteria | 16406 |
| 691 | Ga0207678_10008350 | 3300026067 | Bacteria | 9130 |
| 692 | Ga0207678_10008815 | 3300026067 | Bacteria | 8876 |
| 693 | Ga0207678_10037057 | 3300026067 | Bacteria | 4244 |
| 694 | Ga0207678_10051777 | 3300026067 | Bacteria | 3544 |
| 695 | Ga0207678_10121879 | 3300026067 | Bacteria | 2225 |
| 696 | Ga0207708_10000002 | 3300026075 | Bacteria | 411071 |
| 697 | Ga0207708_10000208 | 3300026075 | Bacteria | 46487 |
| 698 | Ga0207708_10005701 | 3300026075 | Bacteria | 9204 |
| 699 | Ga0207708_10013101 | 3300026075 | Bacteria | 6188 |
| 700 | Ga0207702_10004196 | 3300026078 | Bacteria | 12876 |
| 701 | Ga0207702_10009828 | 3300026078 | Bacteria | 8022 |
| 702 | Ga0207702_10017665 | 3300026078 | Bacteria | 5902 |
| 703 | Ga0207702_10096501 | 3300026078 | Bacteria | 2600 |
| 704 | Ga0207702_10143824 | 3300026078 | Bacteria | 2161 |
| 705 | Ga0207702_10239809 | 3300026078 | Bacteria | 1698 |
| 706 | Ga0207641_10001094 | 3300026088 | Bacteria | 27248 |
| 707 | Ga0207641_10001703 | 3300026088 | Bacteria | 21401 |
| 708 | Ga0207641_10002959 | 3300026088 | Bacteria | 15363 |
| 709 | Ga0207641_10013167 | 3300026088 | Bacteria | 6781 |
| 710 | Ga0207641_10014228 | 3300026088 | Bacteria | 6519 |
| 711 | Ga0207641_10057479 | 3300026088 | Bacteria | 3308 |
| 712 | Ga0207641_10237589 | 3300026088 | Bacteria | 1696 |
| 713 | Ga0207648_10000623 | 3300026089 | Bacteria | 39688 |
| 714 | Ga0207648_10002531 | 3300026089 | Bacteria | 19612 |
| 715 | Ga0207676_10003163 | 3300026095 | Bacteria | 11746 |
| 716 | Ga0207674_10013076 | 3300026116 | Bacteria | 9241 |
| 717 | Ga0207674_10015850 | 3300026116 | Bacteria | 8264 |
| 718 | Ga0207674_10201721 | 3300026116 | Bacteria | 1938 |
| 719 | Ga0207674_10300114 | 3300026116 | Bacteria | 1555 |
| 720 | Ga0207675_100001672 | 3300026118 | Bacteria | 22194 |
| 721 | Ga0207675_100022173 | 3300026118 | Bacteria | 5913 |
| 722 | Ga0207675_100033946 | 3300026118 | Bacteria | 4755 |
| 723 | Ga0207675_100115421 | 3300026118 | Bacteria | 2537 |
| 724 | Ga0207683_10000539 | 3300026121 | Bacteria | 35044 |
| 725 | Ga0207683_10000857 | 3300026121 | Bacteria | 27885 |
| 726 | Ga0207683_10001164 | 3300026121 | Bacteria | 23801 |
| 727 | Ga0207683_10001504 | 3300026121 | Bacteria | 21012 |
| 728 | Ga0207683_10055797 | 3300026121 | Bacteria | 3465 |
| 729 | Ga0207683_10068459 | 3300026121 | Bacteria | 3134 |
| 730 | Ga0207698_10014728 | 3300026142 | Bacteria | 5209 |
| 731 | Ga0207698_10040729 | 3300026142 | Bacteria | 3455 |
| 732 | Ga0207698_10309789 | 3300026142 | Bacteria | 1474 |
| 733 | Ga0207428_10005680 | 3300027907 | Bacteria | 11590 |
| 734 | Ga0207428_10022479 | 3300027907 | Bacteria | 5321 |
| 735 | Ga0207428_10030910 | 3300027907 | Bacteria | 4424 |
| 736 | Ga0268266_10003190 | 3300028379 | Bacteria | 16606 |
| 737 | Ga0268266_10005174 | 3300028379 | Bacteria | 12290 |
| 738 | Ga0268266_10014863 | 3300028379 | Bacteria | 6684 |
| 739 | Ga0268266_10084004 | 3300028379 | Bacteria | 2780 |
| 740 | Ga0268266_10106405 | 3300028379 | Bacteria | 2479 |
| 741 | Ga0268266_10146164 | 3300028379 | Bacteria | 2126 |
| 742 | Ga0268265_10000051 | 3300028380 | Bacteria | 174968 |
| 743 | Ga0268265_10000156 | 3300028380 | Bacteria | 83798 |
| 744 | Ga0268265_10015530 | 3300028380 | Bacteria | 5213 |
| 745 | Ga0268265_10036439 | 3300028380 | Bacteria | 3603 |
| 746 | Ga0268264_10000097 | 3300028381 | Bacteria | 229722 |
| 747 | Ga0268264_10000108 | 3300028381 | Bacteria | 208791 |
| 748 | Ga0268264_10004939 | 3300028381 | Bacteria | 11297 |
| 749 | Ga0268264_10075422 | 3300028381 | Bacteria | 2868 |
| 750 | Ga0268264_10091589 | 3300028381 | Bacteria | 2623 |
| 751 | Ga0307515_10000038 | 3300028794 | Bacteria | 331376 |
| 752 | Ga0307515_10019047 | 3300028794 | Bacteria | 12384 |
| 753 | Ga0307515_10033888 | 3300028794 | Bacteria | 8389 |
| 754 | Ga0307515_10037382 | 3300028794 | Bacteria | 7810 |
| 755 | Ga0307515_10070295 | 3300028794 | Bacteria | 4767 |
| 756 | Ga0265338_10017927 | 3300028800 | Bacteria | 7604 |
| 757 | Ga0265338_10038060 | 3300028800 | Bacteria | 4565 |
| 758 | Ga0307511_10000590 | 3300030521 | Bacteria | 38846 |
| 759 | Ga0307511_10002042 | 3300030521 | Bacteria | 21169 |
| 760 | Ga0307512_10006290 | 3300030522 | Bacteria | 12063 |
| 761 | Ga0307512_10024887 | 3300030522 | Bacteria | 5316 |
| 762 | Ga0307512_10045352 | 3300030522 | Bacteria | 3602 |
| 763 | Ga0316180_1157808 | 3300030736 | Bacteria | 2010 |
| 764 | Ga0316183_1115972 | 3300030742 | Bacteria | 2236 |
| 765 | Ga0265325_10003221 | 3300031241 | Bacteria | 10740 |
| 766 | Ga0265325_10005156 | 3300031241 | Bacteria | 8125 |
| 767 | Ga0265340_10019334 | 3300031247 | Bacteria | 3507 |
| 768 | Ga0265339_10008767 | 3300031249 | Bacteria | 6409 |
| 769 | Ga0265339_10049576 | 3300031249 | Bacteria | 2299 |
| 770 | Ga0265327_10000021 | 3300031251 | Bacteria | 417788 |
| 771 | Ga0265327_10000071 | 3300031251 | Bacteria | 215502 |
| 772 | Ga0307513_10000002 | 3300031456 | Bacteria | 842612 |
| 773 | Ga0307513_10007971 | 3300031456 | Bacteria | 13620 |
| 774 | Ga0307513_10009861 | 3300031456 | Bacteria | 12056 |
| 775 | Ga0307513_10015380 | 3300031456 | Bacteria | 9277 |
| 776 | Ga0307513_10094607 | 3300031456 | Bacteria | 3032 |
| 777 | Ga0307509_10015278 | 3300031507 | Bacteria | 8971 |
| 778 | Ga0307509_10048348 | 3300031507 | Bacteria | 4569 |
| 779 | Ga0307509_10149351 | 3300031507 | Bacteria | 2256 |
| 780 | Ga0307408_100189282 | 3300031548 | Bacteria | 1657 |
| 781 | Ga0307508_10000506 | 3300031616 | Bacteria | 46624 |
| 782 | Ga0307508_10001775 | 3300031616 | Bacteria | 23968 |
| 783 | Ga0307508_10070716 | 3300031616 | Bacteria | 3063 |
| 784 | Ga0307514_10006847 | 3300031649 | Bacteria | 9870 |
| 785 | Ga0307514_10075008 | 3300031649 | Bacteria | 2523 |
| 786 | Ga0265314_10006663 | 3300031711 | Bacteria | 10148 |
| 787 | Ga0265342_10042943 | 3300031712 | Bacteria | 2729 |
| 788 | Ga0316576_10001518 | 3300031727 | Bacteria | 12548 |
| 789 | Ga0316576_10004023 | 3300031727 | Bacteria | 8750 |
| 790 | Ga0316576_10017633 | 3300031727 | Bacteria | 4856 |
| 791 | Ga0316576_10114347 | 3300031727 | Bacteria | 2024 |
| 792 | Ga0316578_10010142 | 3300031728 | Bacteria | 4876 |
| 793 | Ga0316578_10069683 | 3300031728 | Bacteria | 2081 |
| 794 | Ga0307516_10002871 | 3300031730 | Bacteria | 22675 |
| 795 | Ga0307516_10093745 | 3300031730 | Bacteria | 2827 |
| 796 | Ga0307516_10094321 | 3300031730 | Bacteria | 2817 |
| 797 | Ga0307405_10000804 | 3300031731 | Bacteria | 12338 |
| 798 | Ga0307405_10024124 | 3300031731 | Bacteria | 3469 |
| 799 | Ga0307405_10127210 | 3300031731 | Bacteria | 1754 |
| 800 | Ga0307413_10000862 | 3300031824 | Bacteria | 10698 |
| 801 | Ga0307413_10018416 | 3300031824 | Bacteria | 3664 |
| 802 | Ga0307413_10034067 | 3300031824 | Bacteria | 2907 |
| 803 | Ga0307413_10160841 | 3300031824 | Bacteria | 1577 |
| 804 | Ga0307518_10004772 | 3300031838 | Bacteria | 9704 |
| 805 | Ga0307410_10015291 | 3300031852 | Bacteria | 4547 |
| 806 | Ga0307410_10024255 | 3300031852 | Bacteria | 3787 |
| 807 | Ga0307410_10045221 | 3300031852 | Bacteria | 2930 |
| 808 | Ga0307410_10054371 | 3300031852 | Bacteria | 2714 |
| 809 | Ga0307410_10096536 | 3300031852 | Bacteria | 2110 |
| 810 | Ga0307410_10111554 | 3300031852 | Bacteria | 1979 |
| 811 | Ga0307406_10004254 | 3300031901 | Bacteria | 7791 |
| 812 | Ga0307406_10075140 | 3300031901 | Bacteria | 2228 |
| 813 | Ga0307406_10082326 | 3300031901 | Bacteria | 2143 |
| 814 | Ga0307406_10131537 | 3300031901 | Bacteria | 1757 |
| 815 | Ga0307406_10181694 | 3300031901 | Bacteria | 1532 |
| 816 | Ga0307407_10002514 | 3300031903 | Bacteria | 7194 |
| 817 | Ga0307407_10003337 | 3300031903 | Bacteria | 6563 |
| 818 | Ga0307409_100000406 | 3300031995 | Bacteria | 18400 |
| 819 | Ga0307409_100000409 | 3300031995 | Bacteria | 18204 |
| 820 | Ga0307409_100012688 | 3300031995 | Bacteria | 5382 |
| 821 | Ga0307409_100089208 | 3300031995 | Bacteria | 2520 |
| 822 | Ga0307409_100156524 | 3300031995 | Bacteria | 1986 |
| 823 | Ga0307409_100256598 | 3300031995 | Bacteria | 1602 |
| 824 | Ga0307416_100005536 | 3300032002 | Bacteria | 7769 |
| 825 | Ga0307416_100006145 | 3300032002 | Bacteria | 7484 |
| 826 | Ga0307416_100007073 | 3300032002 | Bacteria | 7088 |
| 827 | Ga0307414_10089640 | 3300032004 | Bacteria | 2280 |
| 828 | Ga0307414_10106356 | 3300032004 | Bacteria | 2124 |
| 829 | Ga0307415_100000021 | 3300032126 | Bacteria | 67460 |
| 830 | Ga0307415_100000422 | 3300032126 | Bacteria | 18141 |
| 831 | Ga0307415_100003770 | 3300032126 | Bacteria | 7768 |
| 832 | Ga0307415_100004822 | 3300032126 | Bacteria | 7070 |
| 833 | Ga0307415_100039753 | 3300032126 | Bacteria | 3112 |
| 834 | Ga0307415_100052948 | 3300032126 | Bacteria | 2763 |
| 835 | Ga0316585_10004353 | 3300032137 | Bacteria | 3938 |
| 836 | Ga0316580_10019075 | 3300032139 | Bacteria | 2111 |
| 837 | Ga0316593_10000889 | 3300032168 | Bacteria | 6090 |
| 838 | Ga0307507_10000732 | 3300033179 | Bacteria | 72083 |
| 839 | Ga0307507_10016917 | 3300033179 | Bacteria | 8430 |
| 840 | Ga0307507_10020822 | 3300033179 | Bacteria | 7326 |
| 841 | Ga0307510_10055624 | 3300033180 | Bacteria | 4131 |
| 842 | Ga0307510_10089223 | 3300033180 | Bacteria | 2937 |
| 843 | Ga0307510_10116839 | 3300033180 | Bacteria | 2387 |
| 844 | Ga0316214_1001544 | 3300033545 | Bacteria | 2712 |
| 845 | Ga0373959_0014790 | 3300034820 | Bacteria | 1425 |
| 846 | Ga0373926_0009791 | 3300035083 | Bacteria | 3202 |
| 847 | Ga0373934_0003190 | 3300035086 | Bacteria | 5994 |
| 848 | Ga0373944_0007599 | 3300035089 | Bacteria | 2909 |
| 849 | Ga0373949_0005321 | 3300035090 | Bacteria | 2875 |
| 850 | Ga0373951_0000115 | 3300035091 | Bacteria | 30473 |
| 851 | Ga0373923_0001801 | 3300035111 | Bacteria | 6330 |
| 852 | Ga0373936_0000466 | 3300035113 | Bacteria | 13640 |
| 853 | Ga0373936_0051674 | 3300035113 | Bacteria | 1663 |
| 854 | Ga0373945_0001125 | 3300035116 | Bacteria | 8082 |
| 855 | Ga0373945_0005546 | 3300035116 | Bacteria | 4043 |
| 856 | Ga0373953_0001306 | 3300035117 | Bacteria | 7137 |
| 857 | Ga0373953_0002560 | 3300035117 | Bacteria | 5499 |
| 858 | Ga0373953_0025343 | 3300035117 | Bacteria | 2265 |
| 859 | Ga0373954_0025370 | 3300035118 | Bacteria | 2708 |
| 860 | Ga0373956_0003065 | 3300035119 | Bacteria | 6767 |
| 861 | Ga0373956_0033163 | 3300035119 | Bacteria | 2269 |
| 862 | Ga0373960_0004283 | 3300035121 | Bacteria | 3259 |
| 863 | Ga0373943_0001264 | 3300035170 | Bacteria | 11318 |
| 864 | Ga0373946_0001321 | 3300035171 | Bacteria | 8568 |
| 865 | Ga0373955_0003782 | 3300035172 | Bacteria | 6663 |
| 866 | Ga0373955_0040542 | 3300035172 | Bacteria | 2491 |
| 867 | Ga0373942_0000196 | 3300035207 | Bacteria | 15484 |
| 868 | Ga0373942_0012372 | 3300035207 | Bacteria | 2037 |
| 869 | Ga0373962_0011117 | 3300035242 | Bacteria | 2252 |
| 870 | Ga0316574_0024953 | 3300035398 | Bacteria | 3584 |
| 871 | Ga0316574_0058180 | 3300035398 | Bacteria | 2421 |
| 872 | Ga0316574_0061945 | 3300035398 | Bacteria | 2350 |
| 873 | Ga0373924_0005485 | 3300035410 | Bacteria | 4495 |
| 874 | Ga0373924_0013950 | 3300035410 | Bacteria | 3027 |
| 875 | Ga0373931_0008885 | 3300035691 | Bacteria | 4785 |
| 876 | Ga0373931_0048658 | 3300035691 | Bacteria | 2248 |
| 877 | Ga0373935_0004907 | 3300035692 | Bacteria | 7858 |
| 878 | Ga0373935_0014322 | 3300035692 | Bacteria | 4786 |
| 879 | Ga0373935_0015818 | 3300035692 | Bacteria | 4565 |
| 880 | Ga0373935_0029064 | 3300035692 | Bacteria | 3420 |
| 881 | Ga0373935_0151391 | 3300035692 | Bacteria | 1574 |
| 882 | Ga0373927_0002894 | 3300035695 | Bacteria | 12485 |
| 883 | Ga0373927_0093639 | 3300035695 | Bacteria | 1952 |
| 884 | Ga0373933_0013288 | 3300035724 | Bacteria | 4561 |
| 885 | Ga0373947_0000039 | 3300035725 | Bacteria | 63474 |
| 886 | Ga0373947_0003402 | 3300035725 | Bacteria | 9414 |
| 887 | Ga0373947_0009537 | 3300035725 | Bacteria | 5571 |
| 888 | Ga0373937_0053491 | 3300036401 | Bacteria | 3703 |
| 889 | Ga0373937_0070973 | 3300036401 | Bacteria | 3212 |
| 890 | Ga0373937_0086281 | 3300036401 | Bacteria | 2905 |
| 891 | Ga0265778_000400 | 3300036457 | Bacteria | 3373 |
| 892 | Ga0316582_0097304 | 3300036647 | Bacteria | 1945 |
| 893 | Ga0316584_0000281 | 3300036712 | Bacteria | 26040 |
| 894 | Ga0316584_0005744 | 3300036712 | Bacteria | 8359 |
| 895 | Ga0316584_0071624 | 3300036712 | Bacteria | 2597 |
| 896 | Ga0316584_0102955 | 3300036712 | Bacteria | 2138 |
| 897 | Ga0373925_0000006 | 3300037068 | Bacteria | 278942 |
| 898 | Ga0373925_0050996 | 3300037068 | Bacteria | 3087 |
| 899 | Ga0395899_0053281 | 3300037312 | Bacteria | 2996 |
| 900 | Ga0395900_0003901 | 3300037418 | Bacteria | 15934 |
| 901 | Ga0395900_0008791 | 3300037418 | Bacteria | 10378 |
| 902 | Ga0395900_0042604 | 3300037418 | Bacteria | 4678 |
| 903 | Ga0395900_0182565 | 3300037418 | Bacteria | 2131 |
| 904 | Ga0395898_0011400 | 3300037466 | Bacteria | 9232 |
| 905 | Ga0395898_0035335 | 3300037466 | Bacteria | 4971 |
| 906 | Ga0395898_0119080 | 3300037466 | Bacteria | 2529 |
| 907 | Ga0395898_0136410 | 3300037466 | Bacteria | 2349 |
| 908 | Ga0395905_0023889 | 3300037471 | Bacteria | 5771 |
| 909 | Ga0395905_0087531 | 3300037471 | Bacteria | 2920 |
| 910 | Ga0395905_0254809 | 3300037471 | Bacteria | 1639 |
| 911 | Ga0436364_0238775 | 3300037853 | Bacteria | 6929 |
| 912 | Ga0436364_0516238 | 3300037853 | Bacteria | 122645 |
| 913 | Ga0436364_0696641 | 3300037853 | Bacteria | 19004 |
| 914 | Ga0436364_0735260 | 3300037853 | Bacteria | 16919 |
| 915 | Ga0436364_0823558 | 3300037853 | Bacteria | 25963 |
| 916 | Ga0436364_1039945 | 3300037853 | Bacteria | 3520 |
| 917 | Ga0436364_1051432 | 3300037853 | Bacteria | 7404 |
| 918 | Ga0436364_1086504 | 3300037853 | Bacteria | 29464 |
| 919 | Ga0436364_1291536 | 3300037853 | Bacteria | 16625 |
| 920 | Ga0395901_0033677 | 3300038443 | Bacteria | 5289 |
| 921 | Ga0436365_0447055 | 3300039437 | Bacteria | 3724 |
| 922 | Ga0436365_0567091 | 3300039437 | Bacteria | 46375 |
| 923 | Ga0436365_0574117 | 3300039437 | Bacteria | 5877 |
| 924 | Ga0436365_0939033 | 3300039437 | Bacteria | 60216 |
| 925 | Ga0436365_1050647 | 3300039437 | Bacteria | 21064 |
| 926 | Ga0436365_1284454 | 3300039437 | Bacteria | 8745 |
| 927 | Ga0436365_1908396 | 3300039437 | Bacteria | 15438 |
| 928 | Ga0436363_0129189 | 3300039450 | Bacteria | 2074 |
| 929 | Ga0436363_0464660 | 3300039450 | Bacteria | 2418 |
| 930 | Ga0436363_1431793 | 3300039450 | Bacteria | 2059 |
| 931 | Ga0436362_0884990 | 3300039453 | Bacteria | 27774 |
| 932 | Ga0439436_0000647 | 3300041404 | Bacteria | 9264 |
| 933 | Ga0439436_0002022 | 3300041404 | Bacteria | 6033 |
| 934 | Ga0439439_0010546 | 3300041406 | Bacteria | 2211 |
| 935 | Ga0439461_0001991 | 3300041410 | Bacteria | 3230 |
| 936 | Ga0439466_0004599 | 3300041411 | Bacteria | 5300 |
| 937 | Ga0439465_0008298 | 3300041413 | Bacteria | 3278 |
| 938 | Ga0439465_0009044 | 3300041413 | Bacteria | 3139 |
| 939 | Ga0451789_0957144 | 3300041443 | Bacteria | 1201 |
| 940 | Ga0451793_0254203 | 3300041452 | Bacteria | 6453 |
| 941 | Ga0451795_0111892 | 3300041456 | Bacteria | 2768 |
| 942 | Ga0451853_2614358 | 3300041512 | Bacteria | 3913 |
| 943 | Ga0439431_0005807 | 3300041997 | Bacteria | 2725 |
| 944 | Ga0439433_0001382 | 3300041999 | Bacteria | 4990 |
| 945 | Ga0439433_0009801 | 3300041999 | Bacteria | 2091 |
| 946 | Ga0439442_002424 | 3300042002 | Bacteria | 3662 |
| 947 | Ga0439445_0003352 | 3300042004 | Bacteria | 3597 |
| 948 | Ga0439432_020825 | 3300042006 | Bacteria | 2177 |
| 949 | Ga0439457_000479 | 3300042014 | Bacteria | 11535 |
| 950 | Ga0439457_004100 | 3300042014 | Bacteria | 3854 |
| 951 | Ga0450894_000878 | 3300042131 | Bacteria | 4808 |
| 952 | Ga0450899_000129 | 3300042135 | Bacteria | 7101 |
| 953 | Ga0439459_0000473 | 3300042438 | Bacteria | 5243 |
| 954 | Ga0451577_0066941 | 3300042876 | Bacteria | 3203 |
| 955 | Ga0466969_0000632 | 3300044656 | Bacteria | 19011 |
| 956 | Ga0466969_0002576 | 3300044656 | Bacteria | 9685 |
| 957 | Ga0466969_0004118 | 3300044656 | Bacteria | 7717 |
| 958 | Ga0466969_0049407 | 3300044656 | Bacteria | 2076 |
| 959 | Ga0466972_0002173 | 3300044658 | Bacteria | 9628 |
| 960 | Ga0466972_0011396 | 3300044658 | Bacteria | 4462 |
| 961 | Ga0466972_0014915 | 3300044658 | Bacteria | 3888 |
| 962 | Ga0466972_0028907 | 3300044658 | Bacteria | 2731 |
| 963 | Ga0466972_0039438 | 3300044658 | Bacteria | 2304 |
| 964 | Ga0466972_0057374 | 3300044658 | Bacteria | 1870 |
| 965 | Ga0466965_0000194 | 3300044683 | Bacteria | 18907 |
| 966 | Ga0466965_0007146 | 3300044683 | Bacteria | 5114 |
| 967 | Ga0466965_0024585 | 3300044683 | Bacteria | 2915 |
| 968 | Ga0466965_0024726 | 3300044683 | Bacteria | 2906 |
| 969 | Ga0466965_0026949 | 3300044683 | Bacteria | 2787 |
| 970 | Ga0466966_0001302 | 3300044684 | Bacteria | 15981 |
| 971 | Ga0466966_0006474 | 3300044684 | Bacteria | 7751 |
| 972 | Ga0466966_0061797 | 3300044684 | Bacteria | 2362 |
| 973 | Ga0466966_0080943 | 3300044684 | Bacteria | 2022 |
| 974 | Ga0466961_0001660 | 3300044693 | Bacteria | 13839 |
| 975 | Ga0466961_0002350 | 3300044693 | Bacteria | 11760 |
| 976 | Ga0466961_0002892 | 3300044693 | Bacteria | 10653 |
| 977 | Ga0466961_0005797 | 3300044693 | Bacteria | 7823 |
| 978 | Ga0466961_0021171 | 3300044693 | Bacteria | 4186 |
| 979 | Ga0466961_0024210 | 3300044693 | Bacteria | 3905 |
| 980 | Ga0466961_0029146 | 3300044693 | Bacteria | 3548 |
| 981 | Ga0466961_0049882 | 3300044693 | Bacteria | 2674 |
| 982 | Ga0466961_0062349 | 3300044693 | Bacteria | 2369 |
| 983 | Ga0466961_0073870 | 3300044693 | Bacteria | 2162 |
| 984 | Ga0466963_0001094 | 3300044694 | Bacteria | 14129 |
| 985 | Ga0466963_0003573 | 3300044694 | Bacteria | 8931 |
| 986 | Ga0466963_0010639 | 3300044694 | Bacteria | 5579 |
| 987 | Ga0466963_0016897 | 3300044694 | Bacteria | 4545 |
| 988 | Ga0466963_0019383 | 3300044694 | Bacteria | 4265 |
| 989 | Ga0466963_0032161 | 3300044694 | Bacteria | 3396 |
| 990 | Ga0466963_0034188 | 3300044694 | Bacteria | 3307 |
| 991 | Ga0466963_0040311 | 3300044694 | Bacteria | 3061 |
| 992 | Ga0466963_0074602 | 3300044694 | Bacteria | 2288 |
| 993 | Ga0466963_0083359 | 3300044694 | Bacteria | 2168 |
| 994 | Ga0466964_0019639 | 3300044706 | Bacteria | 2599 |
| 995 | Ga0466964_0024386 | 3300044706 | Bacteria | 2358 |
| 996 | Ga0466964_0025198 | 3300044706 | Bacteria | 2321 |
| 997 | Ga0466964_0071300 | 3300044706 | Bacteria | 1470 |
| 998 | Ga0466971_0000892 | 3300044719 | Bacteria | 12211 |
| 999 | Ga0466971_0003748 | 3300044719 | Bacteria | 6508 |
| 1000 | Ga0466971_0008516 | 3300044719 | Bacteria | 4474 |
| 1001 | Ga0466971_0028339 | 3300044719 | Bacteria | 2506 |
| 1002 | Ga0466971_0045012 | 3300044719 | Bacteria | 1982 |
| 1003 | Ga0466968_0003734 | 3300044735 | Bacteria | 5645 |
| 1004 | Ga0466968_0003834 | 3300044735 | Bacteria | 5579 |
| 1005 | Ga0466968_0016662 | 3300044735 | Bacteria | 2929 |
| 1006 | Ga0466968_0061106 | 3300044735 | Bacteria | 1625 |
| 1007 | Ga0466970_0014696 | 3300044765 | Bacteria | 4021 |
| 1008 | Ga0466970_0022106 | 3300044765 | Bacteria | 3320 |
| 1009 | Ga0466970_0032443 | 3300044765 | Bacteria | 2759 |
| 1010 | Ga0466970_0051351 | 3300044765 | Bacteria | 2200 |
| 1011 | Ga0466970_0054821 | 3300044765 | Bacteria | 2129 |
| 1012 | Ga0466970_0067744 | 3300044765 | Bacteria | 1917 |
| 1013 | Ga0466957_0012041 | 3300044842 | Bacteria | 5000 |
| 1014 | Ga0466957_0013266 | 3300044842 | Bacteria | 4779 |
| 1015 | Ga0466960_0000703 | 3300044901 | Bacteria | 11662 |
| 1016 | Ga0466960_0001139 | 3300044901 | Bacteria | 9536 |
| 1017 | Ga0466960_0001775 | 3300044901 | Bacteria | 7915 |
| 1018 | Ga0466960_0004561 | 3300044901 | Bacteria | 5432 |
| 1019 | Ga0466960_0007316 | 3300044901 | Bacteria | 4477 |
| 1020 | Ga0466960_0036259 | 3300044901 | Bacteria | 2309 |
| 1021 | Ga0466959_0000877 | 3300045049 | Bacteria | 17736 |
| 1022 | Ga0466959_0006347 | 3300045049 | Bacteria | 8181 |
| 1023 | Ga0466959_0018130 | 3300045049 | Bacteria | 5165 |
| 1024 | Ga0466959_0038655 | 3300045049 | Bacteria | 3526 |
| 1025 | Ga0466959_0059597 | 3300045049 | Bacteria | 2780 |
| 1026 | Ga0466959_0084429 | 3300045049 | Bacteria | 2286 |
| 1027 | Ga0466959_0089585 | 3300045049 | Bacteria | 2210 |
| 1028 | Ga0466959_0093383 | 3300045049 | Bacteria | 2159 |
| 1029 | Ga0466959_0099313 | 3300045049 | Bacteria | 2084 |
| 1030 | Ga0451576_0128588 | 3300045051 | Bacteria | 2640 |
| 1031 | Ga0466958_0003068 | 3300045836 | Bacteria | 8566 |
| 1032 | Ga0466958_0009782 | 3300045836 | Bacteria | 5350 |
| 1033 | Ga0466958_0011259 | 3300045836 | Bacteria | 5035 |
| 1034 | Ga0466958_0011623 | 3300045836 | Bacteria | 4962 |
| 1035 | Ga0466958_0019285 | 3300045836 | Bacteria | 3969 |
| 1036 | Ga0466958_0028208 | 3300045836 | Bacteria | 3327 |
| 1037 | Ga0466958_0034449 | 3300045836 | Bacteria | 3020 |
| 1038 | Ga0466958_0041184 | 3300045836 | Bacteria | 2778 |
| 1039 | Ga0466958_0042780 | 3300045836 | Bacteria | 2728 |
| 1040 | Ga0466958_0070299 | 3300045836 | Bacteria | 2142 |
| 1041 | Ga0466958_0087654 | 3300045836 | Bacteria | 1922 |
| 1042 | Ga0466967_0000595 | 3300045976 | Bacteria | 17954 |
| 1043 | Ga0466967_0001175 | 3300045976 | Bacteria | 14690 |
| 1044 | Ga0466967_0001407 | 3300045976 | Bacteria | 13915 |
| 1045 | Ga0466967_0002012 | 3300045976 | Bacteria | 12383 |
| 1046 | Ga0466967_0002261 | 3300045976 | Bacteria | 11871 |
| 1047 | Ga0466967_0005637 | 3300045976 | Bacteria | 8713 |
| 1048 | Ga0466967_0009226 | 3300045976 | Bacteria | 7304 |
| 1049 | Ga0466967_0009250 | 3300045976 | Bacteria | 7297 |
| 1050 | Ga0466967_0009629 | 3300045976 | Bacteria | 7182 |
| 1051 | Ga0466967_0009645 | 3300045976 | Bacteria | 7179 |
| 1052 | Ga0466967_0010064 | 3300045976 | Bacteria | 7067 |
| 1053 | Ga0466967_0017233 | 3300045976 | Bacteria | 5728 |
| 1054 | Ga0466967_0055472 | 3300045976 | Bacteria | 3490 |
| 1055 | Ga0466967_0059846 | 3300045976 | Bacteria | 3373 |
| 1056 | Ga0466967_0102881 | 3300045976 | Bacteria | 2613 |
| 1057 | Ga0466967_0147542 | 3300045976 | Bacteria | 2195 |
| 1058 | Ga0466967_0181544 | 3300045976 | Bacteria | 1985 |
| 1059 | Ga0466967_0266619 | 3300045976 | Bacteria | 1640 |
| 1060 | Ga0495627_008543 | 3300046453 | Bacteria | 3829 |
| 1061 | Ga0495592_0094071 | 3300046454 | Bacteria | 2145 |
| 1062 | Ga0495603_0009235 | 3300046455 | Bacteria | 5959 |
| 1063 | Ga0495603_0014289 | 3300046455 | Bacteria | 4803 |
| 1064 | Ga0495603_0027419 | 3300046455 | Bacteria | 3438 |
| 1065 | Ga0495629_0002245 | 3300046459 | Bacteria | 14890 |
| 1066 | Ga0495629_0032233 | 3300046459 | Bacteria | 3710 |
| 1067 | Ga0495629_0075214 | 3300046459 | Bacteria | 2359 |
| 1068 | Ga0495629_0122824 | 3300046459 | Bacteria | 1809 |
| 1069 | Ga0495641_0007399 | 3300046461 | Bacteria | 6864 |
| 1070 | Ga0495641_0009246 | 3300046461 | Bacteria | 5873 |
| 1071 | Ga0495651_0017471 | 3300046462 | Bacteria | 5555 |
| 1072 | Ga0495653_0004573 | 3300046463 | Bacteria | 11182 |
| 1073 | Ga0495653_0022314 | 3300046463 | Bacteria | 5123 |
| 1074 | Ga0495653_0066800 | 3300046463 | Bacteria | 2703 |
| 1075 | Ga0495653_0125370 | 3300046463 | Bacteria | 1824 |
| 1076 | Ga0495653_0158387 | 3300046463 | Bacteria | 1574 |
| 1077 | Ga0495650_0016688 | 3300046471 | Bacteria | 3707 |
| 1078 | Ga0495639_0003954 | 3300046475 | Bacteria | 6365 |
| 1079 | Ga0495639_0028677 | 3300046475 | Bacteria | 2467 |
| 1080 | Ga0495639_0062309 | 3300046475 | Bacteria | 1711 |
| 1081 | Ga0495662_0002349 | 3300046476 | Bacteria | 9532 |
| 1082 | Ga0495664_0008545 | 3300046477 | Bacteria | 5708 |
| 1083 | Ga0495664_0065266 | 3300046477 | Bacteria | 2169 |
| 1084 | Ga0495585_0017360 | 3300046492 | Bacteria | 4157 |
| 1085 | Ga0495594_0001342 | 3300046499 | Bacteria | 12775 |
| 1086 | Ga0495594_0045170 | 3300046499 | Bacteria | 2418 |
| 1087 | Ga0495607_0027985 | 3300046501 | Bacteria | 3480 |
| 1088 | Ga0495607_0070996 | 3300046501 | Bacteria | 1943 |
| 1089 | Ga0495583_0014310 | 3300046506 | Bacteria | 4383 |
| 1090 | Ga0495583_0069052 | 3300046506 | Bacteria | 1557 |
| 1091 | Ga0495606_0001359 | 3300046507 | Bacteria | 33075 |
| 1092 | Ga0495606_0021271 | 3300046507 | Bacteria | 4754 |
| 1093 | Ga0495606_0026257 | 3300046507 | Bacteria | 4153 |
| 1094 | Ga0495608_0012884 | 3300046511 | Bacteria | 5802 |
| 1095 | Ga0495608_0058655 | 3300046511 | Bacteria | 2537 |
| 1096 | Ga0495616_0004473 | 3300046513 | Bacteria | 8801 |
| 1097 | Ga0495620_0070009 | 3300046515 | Bacteria | 1437 |
| 1098 | Ga0495628_0055179 | 3300046516 | Bacteria | 3130 |
| 1099 | Ga0495628_0095450 | 3300046516 | Bacteria | 2297 |
| 1100 | Ga0495628_0225663 | 3300046516 | Bacteria | 1405 |
| 1101 | Ga0495630_0008465 | 3300046517 | Bacteria | 7383 |
| 1102 | Ga0495630_0018073 | 3300046517 | Bacteria | 5174 |
| 1103 | Ga0495631_0003096 | 3300046518 | Bacteria | 9166 |
| 1104 | Ga0495637_0015812 | 3300046520 | Bacteria | 3534 |
| 1105 | Ga0495648_0021577 | 3300046524 | Bacteria | 4455 |
| 1106 | Ga0495666_0003647 | 3300046526 | Bacteria | 7781 |
| 1107 | Ga0495652_0018073 | 3300046529 | Bacteria | 6290 |
| 1108 | Ga0495652_0086307 | 3300046529 | Bacteria | 2577 |
| 1109 | Ga0495654_0032188 | 3300046530 | Bacteria | 2659 |
| 1110 | Ga0495665_0010808 | 3300046531 | Bacteria | 4941 |
| 1111 | Ga0495665_0015610 | 3300046531 | Bacteria | 4087 |
| 1112 | Ga0495640_0045514 | 3300046533 | Bacteria | 3044 |
| 1113 | Ga0495640_0046303 | 3300046533 | Bacteria | 3014 |
| 1114 | Ga0495586_0008930 | 3300046535 | Bacteria | 5334 |
| 1115 | Ga0495587_0000907 | 3300046536 | Bacteria | 19603 |
| 1116 | Ga0495609_0007988 | 3300046538 | Bacteria | 5225 |
| 1117 | Ga0495597_0028324 | 3300046542 | Bacteria | 2564 |
| 1118 | Ga0495622_0006694 | 3300046557 | Bacteria | 5342 |
| 1119 | Ga0495667_0018746 | 3300046559 | Bacteria | 4670 |
| 1120 | Ga0495667_0038390 | 3300046559 | Bacteria | 3188 |
| 1121 | Ga0495668_0000519 | 3300046616 | Bacteria | 47924 |
| 1122 | Ga0495668_0064041 | 3300046616 | Bacteria | 2024 |
| 1123 | Ga0495634_0008927 | 3300046642 | Bacteria | 7422 |
| 1124 | Ga0495634_0057874 | 3300046642 | Bacteria | 2586 |
| 1125 | Ga0495634_0091681 | 3300046642 | Bacteria | 1972 |
| 1126 | Ga0495611_0030633 | 3300046648 | Bacteria | 2366 |
| 1127 | Ga0495625_0001636 | 3300046660 | Bacteria | 26330 |
| 1128 | Ga0495625_0044373 | 3300046660 | Bacteria | 3218 |
| 1129 | Ga0495635_0036284 | 3300046663 | Bacteria | 3417 |
| 1130 | Ga0495635_0055499 | 3300046663 | Bacteria | 2729 |
| 1131 | Ga0495635_0087728 | 3300046663 | Bacteria | 2129 |
| 1132 | Ga0495661_0007473 | 3300046665 | Bacteria | 7619 |
| 1133 | Ga0495588_0020166 | 3300046674 | Bacteria | 3273 |
| 1134 | Ga0495657_0053190 | 3300046675 | Bacteria | 2710 |
| 1135 | Ga0495657_0066629 | 3300046675 | Bacteria | 2365 |
| 1136 | Ga0495657_0080018 | 3300046675 | Bacteria | 2115 |
| 1137 | Ga0495599_0027522 | 3300046678 | Bacteria | 3563 |
| 1138 | Ga0495623_0012970 | 3300046679 | Bacteria | 5394 |
| 1139 | Ga0495623_0026038 | 3300046679 | Bacteria | 3767 |
| 1140 | Ga0495646_0002906 | 3300046680 | Bacteria | 10616 |
| 1141 | Ga0495646_0082841 | 3300046680 | Bacteria | 1866 |
| 1142 | Ga0495646_0177897 | 3300046680 | Bacteria | 1169 |
| 1143 | Ga0495658_0029170 | 3300046683 | Bacteria | 2983 |
| 1144 | Ga0495658_0074911 | 3300046683 | Bacteria | 1974 |
| 1145 | Ga0495669_0019460 | 3300046684 | Bacteria | 2930 |
| 1146 | Ga0495613_0003081 | 3300046689 | Bacteria | 12453 |
| 1147 | Ga0495613_0007268 | 3300046689 | Bacteria | 8244 |
| 1148 | Ga0495624_0000535 | 3300046690 | Bacteria | 29778 |
| 1149 | Ga0495624_0011184 | 3300046690 | Bacteria | 6175 |
| 1150 | Ga0495649_0036673 | 3300046694 | Bacteria | 2693 |
| 1151 | Ga0495589_0068244 | 3300046794 | Bacteria | 1739 |
| 1152 | Ga0495589_0068308 | 3300046794 | Bacteria | 1739 |
| 1153 | Ga0495600_0005439 | 3300046809 | Bacteria | 7677 |
| 1154 | Ga0495600_0021071 | 3300046809 | Bacteria | 4171 |
| 1155 | Ga0495600_0119154 | 3300046809 | Bacteria | 1717 |
| 1156 | Ga0495660_0055775 | 3300046810 | Bacteria | 2137 |
| 1157 | Ga0495581_0003107 | 3300047315 | Bacteria | 9509 |
| 1158 | Ga0495581_0068143 | 3300047315 | Bacteria | 2058 |
| 1159 | Ga0495604_0115329 | 3300047317 | Bacteria | 1952 |
| 1160 | Ga0495636_0021632 | 3300047318 | Bacteria | 2597 |
| 1161 | Ga0495674_0001362 | 3300047319 | Bacteria | 23834 |
| 1162 | Ga0495674_0055153 | 3300047319 | Bacteria | 3487 |
| 1163 | Ga0495674_0157529 | 3300047319 | Bacteria | 1901 |
| 1164 | Ga0495672_0024614 | 3300047320 | Bacteria | 3874 |
| 1165 | Ga0495676_0028819 | 3300047321 | Bacteria | 4736 |
| 1166 | Ga0495676_0058754 | 3300047321 | Bacteria | 3024 |
| 1167 | Ga0495680_0022892 | 3300047322 | Bacteria | 5202 |
| 1168 | Ga0495680_0034707 | 3300047322 | Bacteria | 4069 |
| 1169 | Ga0495680_0037991 | 3300047322 | Bacteria | 3852 |
| 1170 | Ga0495680_0042878 | 3300047322 | Bacteria | 3586 |
| 1171 | Ga0495687_001147 | 3300047443 | Bacteria | 25643 |
| 1172 | Ga0495687_003306 | 3300047443 | Bacteria | 11824 |
| 1173 | Ga0495687_024126 | 3300047443 | Bacteria | 2895 |
| 1174 | Ga0495675_0034556 | 3300047444 | Bacteria | 3227 |
| 1175 | Ga0495685_008578 | 3300047447 | Bacteria | 3396 |
| 1176 | Ga0495684_0000973 | 3300047471 | Bacteria | 23335 |
| 1177 | Ga0495684_0023120 | 3300047471 | Bacteria | 4780 |
| 1178 | Ga0495684_0042296 | 3300047471 | Bacteria | 3490 |
| 1179 | Ga0495684_0047712 | 3300047471 | Bacteria | 3275 |
| 1180 | Ga0495684_0106123 | 3300047471 | Bacteria | 2122 |
| 1181 | Ga0495686_0000637 | 3300047472 | Bacteria | 48296 |
| 1182 | Ga0495686_0042822 | 3300047472 | Bacteria | 2875 |
| 1183 | Ga0495593_0013292 | 3300047673 | Bacteria | 4698 |
| 1184 | Ga0495614_0017285 | 3300048089 | Bacteria | 3134 |
| 1185 | Ga0495614_0082573 | 3300048089 | Bacteria | 1393 |
| 1186 | Ga0495615_0005916 | 3300048090 | Bacteria | 2233 |
| 1187 | Ga0495626_0001401 | 3300048091 | Bacteria | 19307 |
| 1188 | Ga0495626_0007219 | 3300048091 | Bacteria | 6208 |
| 1189 | Ga0496100_0000067 | 3300048903 | Bacteria | 58703 |
| 1190 | Ga0496100_0000461 | 3300048903 | Bacteria | 19507 |
| 1191 | Ga0496100_0002943 | 3300048903 | Bacteria | 8762 |
| 1192 | Ga0496100_0015097 | 3300048903 | Bacteria | 4504 |
| 1193 | Ga0496100_0065715 | 3300048903 | Bacteria | 2404 |
| 1194 | Ga0496100_0147500 | 3300048903 | Bacteria | 1674 |
| 1195 | Ga0496100_0173793 | 3300048903 | Bacteria | 1553 |
| 1196 | Ga0496101_0000099 | 3300048904 | Bacteria | 90235 |
| 1197 | Ga0496101_0001394 | 3300048904 | Bacteria | 14462 |
| 1198 | Ga0496101_0045811 | 3300048904 | Bacteria | 3134 |
| 1199 | Ga0496101_0117477 | 3300048904 | Bacteria | 2008 |
| 1200 | Ga0496102_0000013 | 3300048905 | Bacteria | 311668 |
| 1201 | Ga0496102_0000048 | 3300048905 | Bacteria | 179713 |
| 1202 | Ga0496102_0000175 | 3300048905 | Bacteria | 87026 |
| 1203 | Ga0496102_0000390 | 3300048905 | Bacteria | 51759 |
| 1204 | Ga0496102_0003032 | 3300048905 | Bacteria | 14221 |
| 1205 | Ga0496102_0011278 | 3300048905 | Bacteria | 7701 |
| 1206 | Ga0496102_0027616 | 3300048905 | Bacteria | 5068 |
| 1207 | Ga0496102_0046711 | 3300048905 | Bacteria | 3932 |
| 1208 | Ga0496102_0064426 | 3300048905 | Bacteria | 3357 |
| 1209 | Ga0496102_0073478 | 3300048905 | Bacteria | 3142 |
| 1210 | Ga0496102_0081793 | 3300048905 | Bacteria | 2978 |
| 1211 | Ga0496102_0089145 | 3300048905 | Bacteria | 2853 |
| 1212 | Ga0496102_0127161 | 3300048905 | Bacteria | 2383 |
| 1213 | Ga0496103_0000018 | 3300048906 | Bacteria | 239585 |
| 1214 | Ga0496103_0000039 | 3300048906 | Bacteria | 174284 |
| 1215 | Ga0496103_0000116 | 3300048906 | Bacteria | 86969 |
| 1216 | Ga0496103_0011446 | 3300048906 | Bacteria | 5258 |
| 1217 | Ga0496104_0007024 | 3300048907 | Bacteria | 9927 |
| 1218 | Ga0496104_0040322 | 3300048907 | Bacteria | 4376 |
| 1219 | Ga0496104_0051650 | 3300048907 | Bacteria | 3880 |
| 1220 | Ga0496104_0133115 | 3300048907 | Bacteria | 2388 |
| 1221 | Ga0496105_0012606 | 3300048908 | Bacteria | 6695 |
| 1222 | Ga0496105_0020163 | 3300048908 | Bacteria | 5384 |
| 1223 | Ga0496105_0020716 | 3300048908 | Bacteria | 5315 |
| 1224 | Ga0496105_0024253 | 3300048908 | Bacteria | 4929 |
| 1225 | Ga0496105_0092674 | 3300048908 | Bacteria | 2494 |
| 1226 | Ga0496105_0112736 | 3300048908 | Bacteria | 2244 |
| 1227 | Ga0496105_0134693 | 3300048908 | Bacteria | 2035 |
| 1228 | Ga0496106_0000424 | 3300048909 | Bacteria | 30065 |
| 1229 | Ga0496106_0001155 | 3300048909 | Bacteria | 19580 |
| 1230 | Ga0496106_0002018 | 3300048909 | Bacteria | 15276 |
| 1231 | Ga0496106_0008649 | 3300048909 | Bacteria | 7534 |
| 1232 | Ga0496106_0019812 | 3300048909 | Bacteria | 4987 |
| 1233 | Ga0496106_0020907 | 3300048909 | Bacteria | 4857 |
| 1234 | Ga0496106_0101504 | 3300048909 | Bacteria | 2232 |
| 1235 | Ga0496107_0000079 | 3300048910 | Bacteria | 46405 |
| 1236 | Ga0496107_0000254 | 3300048910 | Bacteria | 28236 |
| 1237 | Ga0496107_0026359 | 3300048910 | Bacteria | 4119 |
| 1238 | Ga0496107_0027103 | 3300048910 | Bacteria | 4068 |
| 1239 | Ga0496108_0000035 | 3300048911 | Bacteria | 154937 |
| 1240 | Ga0496108_0000959 | 3300048911 | Bacteria | 22428 |
| 1241 | Ga0496108_0003817 | 3300048911 | Bacteria | 12072 |
| 1242 | Ga0496108_0005688 | 3300048911 | Bacteria | 10091 |
| 1243 | Ga0496108_0057509 | 3300048911 | Bacteria | 3268 |
| 1244 | Ga0496108_0065466 | 3300048911 | Bacteria | 3064 |
| 1245 | Ga0496108_0067004 | 3300048911 | Bacteria | 3028 |
| 1246 | Ga0496108_0177067 | 3300048911 | Bacteria | 1846 |
| 1247 | Ga0496109_0000159 | 3300048912 | Bacteria | 66124 |
| 1248 | Ga0496109_0004668 | 3300048912 | Bacteria | 11441 |
| 1249 | Ga0496109_0008285 | 3300048912 | Bacteria | 8824 |
| 1250 | Ga0496109_0012040 | 3300048912 | Bacteria | 7452 |
| 1251 | Ga0496109_0015418 | 3300048912 | Bacteria | 6660 |
| 1252 | Ga0496109_0054048 | 3300048912 | Bacteria | 3664 |
| 1253 | Ga0496109_0069929 | 3300048912 | Bacteria | 3220 |
| 1254 | Ga0496109_0075199 | 3300048912 | Bacteria | 3105 |
| 1255 | Ga0496109_0076274 | 3300048912 | Bacteria | 3083 |
| 1256 | Ga0496109_0118222 | 3300048912 | Bacteria | 2467 |
| 1257 | Ga0496110_0000220 | 3300048913 | Bacteria | 37013 |
| 1258 | Ga0496110_0004660 | 3300048913 | Bacteria | 10661 |
| 1259 | Ga0496110_0008200 | 3300048913 | Bacteria | 8395 |
| 1260 | Ga0496110_0011646 | 3300048913 | Bacteria | 7211 |
| 1261 | Ga0496110_0014056 | 3300048913 | Bacteria | 6636 |
| 1262 | Ga0496110_0026145 | 3300048913 | Bacteria | 4992 |
| 1263 | Ga0496110_0027265 | 3300048913 | Bacteria | 4895 |
| 1264 | Ga0496110_0074940 | 3300048913 | Bacteria | 3006 |
| 1265 | Ga0496110_0080252 | 3300048913 | Bacteria | 2906 |
| 1266 | Ga0496111_0000527 | 3300048914 | Bacteria | 19793 |
| 1267 | Ga0496111_0000575 | 3300048914 | Bacteria | 19168 |
| 1268 | Ga0496111_0000817 | 3300048914 | Bacteria | 16718 |
| 1269 | Ga0496111_0003344 | 3300048914 | Bacteria | 9916 |
| 1270 | Ga0496111_0028049 | 3300048914 | Bacteria | 3988 |
| 1271 | Ga0496111_0037721 | 3300048914 | Bacteria | 3460 |
| 1272 | Ga0496112_0004865 | 3300048915 | Bacteria | 11480 |
| 1273 | Ga0496112_0009854 | 3300048915 | Bacteria | 8632 |
| 1274 | Ga0496112_0061906 | 3300048915 | Bacteria | 3690 |
| 1275 | Ga0496112_0068854 | 3300048915 | Bacteria | 3495 |
| 1276 | Ga0496112_0130578 | 3300048915 | Bacteria | 2483 |
| 1277 | Ga0496112_0131147 | 3300048915 | Bacteria | 2477 |
| 1278 | Ga0496112_0194690 | 3300048915 | Bacteria | 1988 |
| 1279 | Ga0496112_0249612 | 3300048915 | Bacteria | 1726 |
| 1280 | Ga0496113_0004876 | 3300048916 | Bacteria | 8308 |
| 1281 | Ga0496113_0049946 | 3300048916 | Bacteria | 3116 |
| 1282 | Ga0496113_0092889 | 3300048916 | Bacteria | 2328 |
| 1283 | Ga0496113_0115480 | 3300048916 | Bacteria | 2094 |
| 1284 | Ga0496114_0000116 | 3300048917 | Bacteria | 57632 |
| 1285 | Ga0496114_0000286 | 3300048917 | Bacteria | 36864 |
| 1286 | Ga0496114_0011013 | 3300048917 | Bacteria | 7211 |
| 1287 | Ga0496114_0027001 | 3300048917 | Bacteria | 4703 |
| 1288 | Ga0496114_0036877 | 3300048917 | Bacteria | 4041 |
| 1289 | Ga0496114_0040866 | 3300048917 | Bacteria | 3841 |
| 1290 | Ga0496114_0050348 | 3300048917 | Bacteria | 3467 |
| 1291 | Ga0496114_0072131 | 3300048917 | Bacteria | 2903 |
| 1292 | Ga0496114_0140787 | 3300048917 | Bacteria | 2088 |
| 1293 | Ga0496115_0002425 | 3300048918 | Bacteria | 13379 |
| 1294 | Ga0496115_0002960 | 3300048918 | Bacteria | 12217 |
| 1295 | Ga0496115_0049446 | 3300048918 | Bacteria | 3366 |
| 1296 | Ga0496115_0060345 | 3300048918 | Bacteria | 3055 |
| 1297 | Ga0496115_0104371 | 3300048918 | Bacteria | 2326 |
| 1298 | Ga0496116_0000173 | 3300048919 | Bacteria | 129928 |
| 1299 | Ga0496116_0000182 | 3300048919 | Bacteria | 125343 |
| 1300 | Ga0496116_0001408 | 3300048919 | Bacteria | 27021 |
| 1301 | Ga0496116_0002098 | 3300048919 | Bacteria | 21291 |
| 1302 | Ga0496117_0000144 | 3300048920 | Bacteria | 153831 |
| 1303 | Ga0496117_0000278 | 3300048920 | Bacteria | 95496 |
| 1304 | Ga0496117_0001155 | 3300048920 | Bacteria | 39752 |
| 1305 | Ga0496117_0005163 | 3300048920 | Bacteria | 13934 |
| 1306 | Ga0496117_0041649 | 3300048920 | Bacteria | 3361 |
| 1307 | Ga0496117_0072589 | 3300048920 | Bacteria | 2299 |
| 1308 | Ga0496118_0000165 | 3300048921 | Bacteria | 119376 |
| 1309 | Ga0496118_0000466 | 3300048921 | Bacteria | 67173 |
| 1310 | Ga0496118_0019168 | 3300048921 | Bacteria | 6125 |
| 1311 | Ga0496118_0022954 | 3300048921 | Bacteria | 5436 |
| 1312 | Ga0496118_0094561 | 3300048921 | Bacteria | 2043 |
| 1313 | Ga0496119_0000449 | 3300048922 | Bacteria | 56334 |
| 1314 | Ga0496119_0001560 | 3300048922 | Bacteria | 27295 |
| 1315 | Ga0496119_0002247 | 3300048922 | Bacteria | 21487 |
| 1316 | Ga0496119_0003552 | 3300048922 | Bacteria | 16090 |
| 1317 | Ga0496119_0004224 | 3300048922 | Bacteria | 14409 |
| 1318 | Ga0496119_0009347 | 3300048922 | Bacteria | 8431 |
| 1319 | Ga0496119_0015383 | 3300048922 | Bacteria | 5896 |
| 1320 | Ga0496119_0051687 | 3300048922 | Bacteria | 2523 |
| 1321 | Ga0496120_0000663 | 3300048923 | Bacteria | 50609 |
| 1322 | Ga0496120_0002291 | 3300048923 | Bacteria | 19857 |
| 1323 | Ga0496120_0012354 | 3300048923 | Bacteria | 5818 |
| 1324 | Ga0496120_0029616 | 3300048923 | Bacteria | 3341 |
| 1325 | Ga0496121_0000016 | 3300048924 | Bacteria | 562911 |
| 1326 | Ga0496121_0009172 | 3300048924 | Bacteria | 11436 |
| 1327 | Ga0496121_0015653 | 3300048924 | Bacteria | 7913 |
| 1328 | Ga0496121_0016297 | 3300048924 | Bacteria | 7684 |
| 1329 | Ga0496121_0112226 | 3300048924 | Bacteria | 2077 |
| 1330 | Ga0496122_0000284 | 3300048925 | Bacteria | 113244 |
| 1331 | Ga0496122_0017733 | 3300048925 | Bacteria | 6628 |
| 1332 | Ga0496122_0018799 | 3300048925 | Bacteria | 6355 |
| 1333 | Ga0496123_0008217 | 3300048926 | Bacteria | 9623 |
| 1334 | Ga0496123_0028056 | 3300048926 | Bacteria | 4176 |
| 1335 | Ga0496124_0000015 | 3300048927 | Bacteria | 460700 |
| 1336 | Ga0496124_0005946 | 3300048927 | Bacteria | 13489 |
| 1337 | Ga0496125_0000021 | 3300048928 | Bacteria | 460688 |
| 1338 | Ga0496125_0007725 | 3300048928 | Bacteria | 11390 |
| 1339 | Ga0496125_0032094 | 3300048928 | Bacteria | 4669 |
| 1340 | Ga0496126_0000015 | 3300048929 | Bacteria | 663212 |
| 1341 | Ga0496126_0000039 | 3300048929 | Bacteria | 347353 |
| 1342 | Ga0496126_0000075 | 3300048929 | Bacteria | 235121 |
| 1343 | Ga0496126_0000677 | 3300048929 | Bacteria | 62685 |
| 1344 | Ga0496126_0000807 | 3300048929 | Bacteria | 56090 |
| 1345 | Ga0496126_0003990 | 3300048929 | Bacteria | 18027 |
| 1346 | Ga0496126_0008063 | 3300048929 | Bacteria | 11413 |
| 1347 | Ga0496126_0041523 | 3300048929 | Bacteria | 4256 |
| 1348 | Ga0496126_0045712 | 3300048929 | Bacteria | 4022 |
| 1349 | Ga0496126_0067728 | 3300048929 | Bacteria | 3189 |
| 1350 | Ga0496126_0071524 | 3300048929 | Bacteria | 3087 |
| 1351 | Ga0495682_0015944 | 3300049460 | Bacteria | 2845 |
| 1352 | Ga0501031_0000144 | 3300049568 | Bacteria | 40113 |
| 1353 | Ga0501031_0008167 | 3300049568 | Bacteria | 6813 |
| 1354 | Ga0501032_0002470 | 3300049569 | Bacteria | 14437 |
| 1355 | Ga0501032_0007497 | 3300049569 | Bacteria | 7969 |
| 1356 | Ga0501032_0011513 | 3300049569 | Bacteria | 6354 |
| 1357 | Ga0501032_0039210 | 3300049569 | Bacteria | 3222 |
| 1358 | Ga0501033_0002503 | 3300049570 | Bacteria | 15572 |
| 1359 | Ga0501034_0001101 | 3300049571 | Bacteria | 38016 |
| 1360 | Ga0501034_0007303 | 3300049571 | Bacteria | 11778 |
| 1361 | Ga0501034_0059693 | 3300049571 | Bacteria | 3831 |
| 1362 | Ga0501034_0091706 | 3300049571 | Bacteria | 3035 |
| 1363 | Ga0501034_0290035 | 3300049571 | Bacteria | 1575 |
| 1364 | Ga0501036_0003893 | 3300049572 | Bacteria | 11980 |
| 1365 | Ga0501036_0007139 | 3300049572 | Bacteria | 9097 |
| 1366 | Ga0501037_0000796 | 3300049573 | Bacteria | 23665 |
| 1367 | Ga0501037_0003517 | 3300049573 | Bacteria | 11374 |
| 1368 | Ga0501037_0003564 | 3300049573 | Bacteria | 11291 |
| 1369 | Ga0501037_0087309 | 3300049573 | Bacteria | 2257 |
| 1370 | Ga0501038_0001310 | 3300049574 | Bacteria | 22652 |
| 1371 | Ga0501038_0002811 | 3300049574 | Bacteria | 16213 |
| 1372 | Ga0501038_0003820 | 3300049574 | Bacteria | 14007 |
| 1373 | Ga0501038_0008860 | 3300049574 | Bacteria | 9233 |
| 1374 | Ga0501039_0001985 | 3300049575 | Bacteria | 15168 |
| 1375 | Ga0501039_0004366 | 3300049575 | Bacteria | 10657 |
| 1376 | Ga0501039_0081386 | 3300049575 | Bacteria | 2521 |
| 1377 | Ga0501040_0008828 | 3300049576 | Bacteria | 6551 |
| 1378 | Ga0501041_0018104 | 3300049577 | Bacteria | 4195 |
| 1379 | Ga0501042_0118887 | 3300049578 | Bacteria | 1902 |
| 1380 | Ga0501043_0000990 | 3300049579 | Bacteria | 25039 |
| 1381 | Ga0501043_0006893 | 3300049579 | Bacteria | 9066 |
| 1382 | Ga0501043_0038202 | 3300049579 | Bacteria | 3775 |
| 1383 | Ga0501043_0113935 | 3300049579 | Bacteria | 2123 |
| 1384 | Ga0501046_0000427 | 3300049580 | Bacteria | 42168 |
| 1385 | Ga0501046_0002722 | 3300049580 | Bacteria | 16457 |
| 1386 | Ga0501046_0077417 | 3300049580 | Bacteria | 2575 |
| 1387 | Ga0501047_0002484 | 3300049581 | Bacteria | 17594 |
| 1388 | Ga0501047_0034364 | 3300049581 | Bacteria | 4894 |
| 1389 | Ga0501047_0060268 | 3300049581 | Bacteria | 3663 |
| 1390 | Ga0501047_0071012 | 3300049581 | Bacteria | 3352 |
| 1391 | Ga0501047_0076929 | 3300049581 | Bacteria | 3211 |
| 1392 | Ga0501048_0000026 | 3300049582 | Bacteria | 66602 |
| 1393 | Ga0501048_0002590 | 3300049582 | Bacteria | 13851 |
| 1394 | Ga0501048_0004211 | 3300049582 | Bacteria | 10963 |
| 1395 | Ga0501067_0010708 | 3300049583 | Bacteria | 5073 |
| 1396 | Ga0501067_0056142 | 3300049583 | Bacteria | 2182 |
| 1397 | Ga0501067_0067902 | 3300049583 | Bacteria | 1974 |
| 1398 | Ga0501068_0008200 | 3300049584 | Bacteria | 5808 |
| 1399 | Ga0501069_0000223 | 3300049585 | Bacteria | 25278 |
| 1400 | Ga0501069_0000515 | 3300049585 | Bacteria | 17655 |
| 1401 | Ga0501070_0000766 | 3300049586 | Bacteria | 29273 |
| 1402 | Ga0501070_0001165 | 3300049586 | Bacteria | 23519 |
| 1403 | Ga0501070_0001589 | 3300049586 | Bacteria | 20181 |
| 1404 | Ga0501070_0001682 | 3300049586 | Bacteria | 19594 |
| 1405 | Ga0501070_0002601 | 3300049586 | Bacteria | 15774 |
| 1406 | Ga0501070_0003370 | 3300049586 | Bacteria | 13863 |
| 1407 | Ga0501070_0003504 | 3300049586 | Bacteria | 13581 |
| 1408 | Ga0501070_0038098 | 3300049586 | Bacteria | 4012 |
| 1409 | Ga0501071_0013695 | 3300049587 | Bacteria | 5532 |
| 1410 | Ga0501072_0003695 | 3300049588 | Bacteria | 11541 |
| 1411 | Ga0501074_0008363 | 3300049590 | Bacteria | 7501 |
| 1412 | Ga0501074_0014120 | 3300049590 | Bacteria | 5806 |
| 1413 | Ga0501076_0073923 | 3300049592 | Bacteria | 2730 |
| 1414 | Ga0501079_0000093 | 3300049741 | Bacteria | 43802 |
| 1415 | Ga0501080_0000266 | 3300049742 | Bacteria | 39496 |
| 1416 | Ga0501080_0003067 | 3300049742 | Bacteria | 14750 |
| 1417 | Ga0501080_0009512 | 3300049742 | Bacteria | 8868 |
| 1418 | Ga0501080_0010586 | 3300049742 | Bacteria | 8441 |
| 1419 | Ga0501080_0016463 | 3300049742 | Bacteria | 6828 |
| 1420 | Ga0501080_0170999 | 3300049742 | Bacteria | 2004 |
| 1421 | Ga0501083_0030883 | 3300049744 | Bacteria | 3677 |
| 1422 | Ga0501035_0001097 | 3300049822 | Bacteria | 28352 |
| 1423 | Ga0501035_0001386 | 3300049822 | Bacteria | 24909 |
| 1424 | Ga0501035_0016730 | 3300049822 | Bacteria | 6762 |
| 1425 | Ga0501035_0021620 | 3300049822 | Bacteria | 5915 |
| 1426 | Ga0501035_0044132 | 3300049822 | Bacteria | 4015 |
| 1427 | Ga0501035_0177973 | 3300049822 | Bacteria | 1834 |
| 1428 | Ga0501044_0001367 | 3300049823 | Bacteria | 28613 |
| 1429 | Ga0501044_0004810 | 3300049823 | Bacteria | 15100 |
| 1430 | Ga0501044_0008934 | 3300049823 | Bacteria | 10952 |
| 1431 | Ga0501044_0010160 | 3300049823 | Bacteria | 10228 |
| 1432 | Ga0501044_0100053 | 3300049823 | Bacteria | 2918 |
| 1433 | Ga0501045_0035134 | 3300049824 | Bacteria | 3639 |
| 1434 | Ga0501045_0077109 | 3300049824 | Bacteria | 2456 |
| 1435 | Ga0501045_0128149 | 3300049824 | Bacteria | 1886 |
| 1436 | nmdc:mga03683_3089_c1 | 3300050489 | Bacteria | 5293 |
| 1437 | nmdc:mga03n38_78836_c1 | 3300050490 | Bacteria | 1543 |
| 1438 | nmdc:mga00v17_152149_c1 | 3300050491 | Bacteria | 1487 |
| 1439 | nmdc:mga00v17_2947_c1 | 3300050491 | Bacteria | 8733 |
| 1440 | nmdc:mga00v17_48988_c1 | 3300050491 | Bacteria | 2561 |
| 1441 | nmdc:mga00v17_5845_c1 | 3300050491 | Bacteria | 6496 |
| 1442 | nmdc:mga0yw44_147755_c1 | 3300050492 | Bacteria | 1531 |
| 1443 | nmdc:mga0yw44_172183_c1 | 3300050492 | Bacteria | 1422 |
| 1444 | nmdc:mga0yw44_25015_c1 | 3300050492 | Bacteria | 3388 |
| 1445 | nmdc:mga0yw44_66507_c1 | 3300050492 | Bacteria | 2224 |
| 1446 | nmdc:mga0yw44_70038_c1 | 3300050492 | Bacteria | 2174 |
| 1447 | nmdc:mga07m45_101866_c1 | 3300050496 | Bacteria | 1211 |
| 1448 | nmdc:mga07m45_34034_c1 | 3300050496 | Bacteria | 2831 |
| 1449 | nmdc:mga07m45_36181_c1 | 3300050496 | Bacteria | 2749 |
| 1450 | nmdc:mga07m45_62048_c1 | 3300050496 | Bacteria | 2118 |
| 1451 | nmdc:mga05p37_110473_c1 | 3300050507 | Bacteria | 3382 |
| 1452 | nmdc:mga05p37_12466_c1 | 3300050507 | Bacteria | 10154 |
| 1453 | nmdc:mga05p37_160331_c1 | 3300050507 | Bacteria | 2748 |
| 1454 | nmdc:mga05p37_188068_c1 | 3300050507 | Bacteria | 2509 |
| 1455 | nmdc:mga05p37_2735_c1 | 3300050507 | Bacteria | 20505 |
| 1456 | nmdc:mga05p37_43393_c1 | 3300050507 | Bacteria | 5532 |
| 1457 | nmdc:mga05p37_610624_c1 | 3300050507 | Bacteria | 1229 |
| 1458 | nmdc:mga09592_115355_c1 | 3300050508 | Bacteria | 2305 |
| 1459 | nmdc:mga09592_120387_c1 | 3300050508 | Bacteria | 2254 |
| 1460 | nmdc:mga09592_138562_c1 | 3300050508 | Bacteria | 2096 |
| 1461 | nmdc:mga09592_16095_c1 | 3300050508 | Bacteria | 6113 |
| 1462 | nmdc:mga09592_46742_c1 | 3300050508 | Bacteria | 3646 |
| 1463 | nmdc:mga09592_80423_c1 | 3300050508 | Bacteria | 2775 |
| 1464 | nmdc:mga09592_87_c3 | 3300050508 | Bacteria | 23142 |
| 1465 | nmdc:mga0qj67_509_c1 | 3300050509 | Bacteria | 23236 |
| 1466 | nmdc:mga06r32_162003_c1 | 3300050510 | Bacteria | 2219 |
| 1467 | nmdc:mga06r32_172091_c1 | 3300050510 | Bacteria | 2149 |
| 1468 | nmdc:mga06r32_1913_c1 | 3300050510 | Bacteria | 18545 |
| 1469 | nmdc:mga06r32_692_c3 | 3300050510 | Bacteria | 10179 |
| 1470 | nmdc:mga08y16_28599_c1 | 3300050511 | Bacteria | 5876 |
| 1471 | nmdc:mga08y16_39956_c1 | 3300050511 | Bacteria | 4921 |
| 1472 | nmdc:mga08y16_41095_c1 | 3300050511 | Bacteria | 4845 |
| 1473 | nmdc:mga08x19_52346_c1 | 3300050514 | Bacteria | 2625 |
| 1474 | nmdc:mga08x19_5990_c1 | 3300050514 | Bacteria | 7190 |
| 1475 | nmdc:mga0a205_12444_c1 | 3300050515 | Bacteria | 7870 |
| 1476 | nmdc:mga0sz30_21727_c1 | 3300050516 | Bacteria | 2599 |
| 1477 | nmdc:mga0sz30_5944_c1 | 3300050516 | Bacteria | 4501 |
| 1478 | Ga0495601_0000602 | 3300053077 | Bacteria | 19111 |
| 1479 | Ga0495601_0010705 | 3300053077 | Bacteria | 5470 |
| 1480 | Ga0495612_0000929 | 3300053078 | Bacteria | 11998 |
| 1481 | Ga0500635_0021790 | 3300053080 | Bacteria | 1979 |
| 1482 | Ga0495619_0005371 | 3300053085 | Bacteria | 8113 |
| 1483 | Ga0495619_0054104 | 3300053085 | Bacteria | 2656 |
| 1484 | Ga0500643_003109 | 3300053087 | Bacteria | 8148 |
| 1485 | Ga0500646_0000357 | 3300053090 | Bacteria | 13753 |
| 1486 | Ga0500646_0029241 | 3300053090 | Bacteria | 1508 |
| 1487 | Ga0500583_0003525 | 3300053092 | Bacteria | 4939 |
| 1488 | Ga0500583_0071248 | 3300053092 | Bacteria | 1662 |
| 1489 | Ga0500559_0004201 | 3300053136 | Bacteria | 6901 |
| 1490 | Ga0500568_0000706 | 3300053139 | Bacteria | 23977 |
| 1491 | Ga0500573_0088921 | 3300053140 | Bacteria | 1747 |
| 1492 | Ga0500577_0074856 | 3300053142 | Bacteria | 1337 |
| 1493 | Ga0500588_0004867 | 3300053146 | Bacteria | 2939 |
| 1494 | Ga0500616_0009263 | 3300053153 | Bacteria | 6001 |
| 1495 | Ga0500627_0006875 | 3300053158 | Bacteria | 3913 |
| 1496 | Ga0500645_000032 | 3300053730 | Bacteria | 119506 |
| 1497 | Ga0501084_0000239 | 3300054114 | Bacteria | 41470 |
| 1498 | Ga0501084_0035629 | 3300054114 | Bacteria | 4160 |
| 1499 | Ga0466962_0000056 | 3300061719 | Bacteria | 46579 |
| 1500 | Ga0466962_0006087 | 3300061719 | Bacteria | 5802 |
| 1501 | Ga0466962_0009800 | 3300061719 | Bacteria | 4596 |
| 1502 | Ga0466962_0018078 | 3300061719 | Bacteria | 3391 |
| 1503 | Ga0466962_0018089 | 3300061719 | Bacteria | 3389 |
| 1504 | Ga0466962_0019198 | 3300061719 | Bacteria | 3282 |
| 1505 | Ga0530510_0051283 | 3300061734 | Bacteria | 2981 |
| 1506 | 8047719884 | 8047710418 | Bacteria | 11023148 |
| 1507 | 2501945555 | 2501939600 | Bacteria | 6907073 |
| 1508 | 2506868573 | 2506783011 | Bacteria | 5323186 |
| 1509 | 2508670694 | 2508501039 | Bacteria | 9978592 |
| 1510 | 2515497893 | 2515154088 | Bacteria | 5526283 |
| 1511 | 2515720789 | 2515154129 | Bacteria | 5584369 |
| 1512 | 2515759014 | 2515154137 | Bacteria | 5711575 |
| 1513 | 2515852236 | 2515154155 | Bacteria | 7985436 |
| 1514 | 2516085727 | 2515154202 | Bacteria | 5471270 |
| 1515 | 2516090690 | 2515154203 | Bacteria | 5458536 |
| 1516 | 2517762484 | 2517572101 | Bacteria | 6884336 |
| 1517 | 2528206638 | 2527291627 | Bacteria | 5309833 |
| 1518 | 2528212030 | 2527291629 | Bacteria | 5267418 |
| 1519 | 2546946947 | 2546825537 | Bacteria | 5389291 |
| 1520 | 2548696252 | 2547132424 | Bacteria | 8348532 |
| 1521 | 2552108222 | 2551306166 | Bacteria | 9731570 |
| 1522 | 2558912601 | 2558860112 | Bacteria | 9931328 |
| 1523 | 2559428650 | 2558860280 | Bacteria | 11429938 |
| 1524 | 2579747544 | 2576861822 | Bacteria | 5004595 |
| 1525 | 2579854552 | 2579778521 | Bacteria | 7624758 |
| 1526 | 2583148894 | 2582580736 | Bacteria | 5325865 |
| 1527 | 2585299412 | 2582581312 | Bacteria | 7308206 |
| 1528 | 2585319173 | 2582581314 | Bacteria | 11452267 |
| 1529 | 2586064689 | 2585427649 | Bacteria | 9053857 |
| 1530 | 2619853809 | 2619618881 | Bacteria | 7521104 |
| 1531 | 2620349509 | 2619619003 | Bacteria | 7619552 |
| 1532 | 2623497715 | 2622736605 | Bacteria | 4992138 |
| 1533 | 2623586153 | 2622736626 | Bacteria | 7181580 |
| 1534 | 2626634845 | 2626541554 | Bacteria | 7741902 |
| 1535 | 2643902794 | 2643221578 | Bacteria | 9213798 |
| 1536 | 2644017233 | 2643221601 | Bacteria | 7493239 |
| 1537 | 2644173806 | 2643221631 | Bacteria | 8168043 |
| 1538 | 2644404697 | 2643221673 | Bacteria | 9196637 |
| 1539 | 2644439217 | 2643221678 | Bacteria | 9540101 |
| 1540 | 2644489440 | 2643221687 | Bacteria | 6500351 |
| 1541 | 2644516049 | 2643221692 | Bacteria | 7282860 |
| 1542 | 2644633404 | 2643221714 | Bacteria | 9015452 |
| 1543 | 2644636244 | 2643221715 | Bacteria | 6671032 |
| 1544 | 2671835795 | 2671180195 | Bacteria | 9757215 |
| 1545 | 2676201272 | 2675902999 | Bacteria | 9438463 |
| 1546 | 2676474608 | 2675903058 | Bacteria | 6822861 |
| 1547 | 2676484056 | 2675903059 | Bacteria | 8644972 |
| 1548 | 2686539648 | 2684623035 | Bacteria | 8032739 |
| 1549 | 2686543539 | 2684623036 | Bacteria | 5199090 |
| 1550 | 2689960499 | 2687453737 | Bacteria | 11203906 |
| 1551 | 2689992300 | 2687453743 | Bacteria | 8361025 |
| 1552 | 2710602608 | 2710264753 | Bacteria | 5455564 |
| 1553 | 2738891357 | 2738541308 | Bacteria | 7020677 |
| 1554 | 2739205419 | 2738543005 | Bacteria | 5278128 |
| 1555 | 2739239476 | 2738543011 | Bacteria | 5731169 |
| 1556 | 2739362096 | 2738543034 | Bacteria | 6084756 |
| 1557 | 2753037140 | 2751185725 | Bacteria | 5740550 |
| 1558 | 2753069843 | 2751185734 | Bacteria | 8863695 |
| 1559 | 2753271021 | 2751185782 | Bacteria | 11227053 |
| 1560 | 2753325009 | 2751185792 | Bacteria | 5739090 |
| 1561 | 2768643398 | 2767802112 | Bacteria | 6465194 |
| 1562 | 2772641348 | 2772190715 | Bacteria | 6959372 |
| 1563 | 2774845848 | 2773857921 | Bacteria | 9435764 |
| 1564 | 2774853951 | 2773857922 | Bacteria | 9757215 |
| 1565 | 2774867069 | 2773857924 | Bacteria | 5256821 |
| 1566 | 2774902955 | 2773857933 | Bacteria | 5818019 |
| 1567 | 2776371566 | 2775506925 | Bacteria | 7237746 |
| 1568 | 2791914400 | 2791354901 | Bacteria | 8322202 |
| 1569 | 2795781345 | 2795385470 | Bacteria | 8317180 |
| 1570 | 2795791688 | 2795385472 | Bacteria | 6627535 |
| 1571 | 2808843222 | 2808606359 | Bacteria | 9866990 |
| 1572 | 2808912807 | 2808606375 | Bacteria | 9466072 |
| 1573 | 2808921570 | 2808606375 | Bacteria | 9466072 |
| 1574 | 2809586083 | 2808606522 | Bacteria | 9488490 |
| 1575 | 2811845203 | 2808606982 | Bacteria | 7791042 |
| 1576 | 2812356826 | 2811994879 | Bacteria | 9313447 |
| 1577 | 2816505690 | 2816332139 | Bacteria | 9138787 |
| 1578 | 2819741114 | 2818991472 | Bacteria | 10089953 |
| 1579 | 2827632918 | 2827628540 | Bacteria | 6858585 |
| 1580 | 2831938277 | 2831935698 | Bacteria | 5963223 |
| 1581 | 2832009697 | 2832004796 | Bacteria | 6538017 |
| 1582 | 2842138788 | 2842134933 | Bacteria | 5847019 |
| 1583 | 2855676681 | 2855670206 | Bacteria | 7120389 |
| 1584 | 2855683271 | 2855676851 | Bacteria | 7063653 |
| 1585 | 2855685019 | 2855683550 | Bacteria | 7134265 |
| 1586 | 2856746188 | 2856741275 | Bacteria | 8096094 |
| 1587 | 2856860054 | 2856858025 | Bacteria | 7255264 |
| 1588 | 2857295018 | 2857288857 | Bacteria | 7189066 |
| 1589 | 2858852275 | 2858848962 | Bacteria | 6963058 |
| 1590 | 2858868911 | 2858868258 | Bacteria | 7683772 |
| 1591 | 2858888208 | 2858882152 | Bacteria | 7230291 |
| 1592 | 2858890386 | 2858888857 | Bacteria | 7060307 |
| 1593 | 2858898961 | 2858895516 | Bacteria | 7378898 |
| 1594 | 2858905233 | 2858902515 | Bacteria | 7086037 |
| 1595 | 2861525285 | 2861520306 | Bacteria | 8348283 |
| 1596 | 2862286751 | 2862281513 | Bacteria | 9621493 |
| 1597 | 2862292202 | 2862290372 | Bacteria | 7471434 |
| 1598 | 2862387248 | 2862382967 | Bacteria | 10317375 |
| 1599 | 2862710215 | 2862705112 | Bacteria | 6563286 |
| 1600 | 2863070217 | 2863067949 | Bacteria | 8541735 |
| 1601 | 2863411672 | 2863404153 | Bacteria | 9672205 |
| 1602 | 2866068993 | 2866065130 | Bacteria | 6518152 |
| 1603 | 2866555677 | 2866552031 | Bacteria | 5824618 |
| 1604 | 2866617239 | 2866612099 | Bacteria | 7543886 |
| 1605 | 2867304310 | 2867302475 | Bacteria | 7087181 |
| 1606 | 2867313640 | 2867312974 | Bacteria | 7058875 |
| 1607 | 2867322535 | 2867319477 | Bacteria | 7069771 |
| 1608 | 2867351643 | 2867346516 | Bacteria | 7608576 |
| 1609 | 2867373116 | 2867369537 | Bacteria | 6501581 |
| 1610 | 2867479151 | 2867475112 | Bacteria | 6909112 |
| 1611 | 2867509696 | 2867507094 | Bacteria | 6506033 |
| 1612 | 2869052138 | 2869048445 | Bacteria | 6875584 |
| 1613 | 2869061989 | 2869061728 | Bacteria | 7112407 |
| 1614 | 2869073967 | 2869068681 | Bacteria | 7205615 |
| 1615 | 2870727646 | 2870721527 | Bacteria | 9689237 |
| 1616 | 2870788453 | 2870782633 | Bacteria | 9624083 |
| 1617 | 2873154783 | 2873151551 | Bacteria | 8625867 |
| 1618 | 2875395928 | 2875391855 | Bacteria | 7600475 |
| 1619 | 2880494103 | 2880489317 | Bacteria | 7096270 |
| 1620 | 2880498227 | 2880495981 | Bacteria | 7340502 |
| 1621 | 2883826516 | 2883821847 | Bacteria | 5121194 |
| 1622 | 2884694345 | 2884693830 | Bacteria | 11273186 |
| 1623 | 2887483547 | 2887478801 | Bacteria | 8972725 |
| 1624 | 2889301895 | 2889300758 | Bacteria | 5690814 |
| 1625 | 2891331593 | 2891326441 | Bacteria | 6439512 |
| 1626 | 2891402637 | 2891395885 | Bacteria | 9251614 |
| 1627 | 2891554964 | 2891554331 | Bacteria | 8812224 |
| 1628 | 2891562734 | 2891562705 | Bacteria | 8039471 |
| 1629 | 2895435587 | 2895427314 | Bacteria | 13147766 |
| 1630 | 2895444240 | 2895442618 | Bacteria | 11027144 |
| 1631 | 2895884875 | 2895880812 | Bacteria | 11255272 |
| 1632 | 2899364797 | 2899359706 | Bacteria | 10940472 |
| 1633 | 2899370663 | 2899370129 | Bacteria | 6781179 |
| 1634 | 2899373771 | 2899370129 | Bacteria | 6781179 |
| 1635 | 2902587479 | 2902582711 | Bacteria | 6187705 |
| 1636 | 2902799087 | 2902792274 | Bacteria | 7270173 |
| 1637 | 2902804385 | 2902799365 | Bacteria | 5419524 |
| 1638 | 2902812382 | 2902810491 | Bacteria | 6794147 |
| 1639 | 2902842205 | 2902837492 | Bacteria | 6697721 |
| 1640 | 2912718568 | 2912715099 | Bacteria | 9460473 |
| 1641 | 2912730885 | 2912723979 | Bacteria | 8557534 |
| 1642 | 2915362918 | 2915358134 | Bacteria | 6050864 |
| 1643 | 2915773507 | 2915768154 | Bacteria | 8424322 |
| 1644 | 2917741264 | 2917736166 | Bacteria | 9690793 |
| 1645 | 2919713859 | 2919713450 | Bacteria | 7431245 |
| 1646 | 2928144866 | 2928142448 | Bacteria | 5288925 |
| 1647 | 2929214389 | 2929212328 | Bacteria | 7708288 |
| 1648 | 2929220268 | 2929219909 | Bacteria | 6984360 |
| 1649 | 2929226803 | 2929226422 | Bacteria | 7248583 |
| 1650 | 2932400111 | 2932398195 | Bacteria | 3847976 |
| 1651 | 2939586276 | 2939582691 | Bacteria | 7088898 |
| 1652 | 2939747105 | 2939743619 | Bacteria | 5762299 |
| 1653 | 2946048707 | 2946045630 | Bacteria | 8527308 |
| 1654 | 2946069045 | 2946064051 | Bacteria | 8957905 |
| 1655 | 2956941385 | 2956939328 | Bacteria | 3474458 |
| 1656 | 2974319899 | 2974315732 | Bacteria | 4602776 |
| 1657 | 2990091294 | 2990088156 | Bacteria | 6657676 |
| 1658 | 2996226236 | 2996221748 | Bacteria | 6799777 |
| 1659 | 3001120186 | 3001119090 | Bacteria | 3449530 |
| 1660 | 3003000808 | 3002998708 | Bacteria | 11715108 |
| 1661 | 3006427226 | 3006425503 | Bacteria | 6491253 |
| 1662 | 3006499684 | 3006493962 | Bacteria | 8825450 |
| 1663 | 637877870 | 637000116 | Bacteria | 5433628 |
| 1664 | 649810539 | 649633069 | Bacteria | 6962533 |
| 1665 | 8001789401 | 8001781756 | Bacteria | 9586736 |
| 1666 | 8002781598 | 8002775197 | Bacteria | 10728764 |
| 1667 | 8002789843 | 8002784119 | Bacteria | 9788632 |
| 1668 | 8003316403 | 8003314358 | Bacteria | 10575343 |
| 1669 | 8003834810 | 8003830390 | Bacteria | 6541657 |
| 1670 | 8003860826 | 8003856774 | Bacteria | 7675274 |
| 1671 | 8003875000 | 8003870546 | Bacteria | 7396674 |
| 1672 | 8008490388 | 8008485437 | Bacteria | 7198341 |
| 1673 | 8008566431 | 8008558824 | Bacteria | 10610750 |
| 1674 | 8008577896 | 8008574985 | Bacteria | 7815457 |
| 1675 | 8025480867 | 8025478263 | Bacteria | 8209203 |
| 1676 | 8025529690 | 8025524527 | Bacteria | 7197316 |
| 1677 | 8033686785 | 8033684223 | Bacteria | 6906479 |
| 1678 | 8053948518 | 8053945823 | Bacteria | 8962862 |
| 1679 | 8054473473 | 8054472261 | Bacteria | 7464355 |
| 1680 | 8054707202 | 8054704163 | Bacteria | 7247792 |
| 1681 | 8054728157 | 8054727385 | Bacteria | 7558670 |
| 1682 | 8054736481 | 8054734606 | Bacteria | 6947278 |
| 1683 | 8054920573 | 8054913762 | Bacteria | 7713009 |
| 1684 | 8054922604 | 8054920844 | Bacteria | 7068637 |
| 1685 | 8055160552 | 8055157932 | Bacteria | 6429399 |
| 1686 | 8055415592 | 8055412473 | Bacteria | 6257500 |
| 1687 | 8056060064 | 8056054917 | Bacteria | 5736694 |
| 1688 | 8056212431 | 8056207758 | Bacteria | 8639239 |
| 1689 | 8056669307 | 8056667051 | Bacteria | 6953971 |
| 1690 | 8056833865 | 8056829672 | Bacteria | 9045328 |
| 1691 | 8057574016 | 8057568493 | Bacteria | 7221719 |
| 1692 | LJQas_1007077 | |||
| 1693 | JGI24752J21851_1003471 | |||
| 1694 | JGI24737J22298_10019288 | |||
| 1695 | JGI24743J22301_10007272 | |||
| 1696 | JGI24735J21928_10011371 | |||
| 1697 | JGI24745J21846_1003962 | |||
| 1698 | JGI24738J21930_10014650 | |||
| 1699 | JGI24744J21845_10000088 | |||
| 1700 | JGI24744J21845_10001304 | |||
| 1701 | JGI24742J22300_10000442 | |||
| 1702 | JGI24751J29686_10005336 | |||
| 1703 | JGI24751J29686_10016334 | |||
| 1704 | JGI25406J46586_10001934 | |||
| 1705 | JGI25406J46586_10015066 | |||
| 1706 | JGI25406J46586_10021225 | |||
| 1707 | JGI25160J50197_1021813 | |||
| 1708 | JGI25404J52841_10000389 | |||
| 1709 | Ga0055540_1000003 | |||
| 1710 | Ga0055540_1011637 | |||
| 1711 | Ga0070658_10000319 | |||
| 1712 | Ga0070658_10000776 | |||
| 1713 | Ga0070658_10010607 | |||
| 1714 | Ga0070658_10027200 | |||
| 1715 | Ga0070658_10045247 | |||
| 1716 | Ga0070676_10011568 | |||
| 1717 | Ga0070683_100017452 | |||
| 1718 | Ga0070683_100025549 | |||
| 1719 | Ga0070683_100074305 | |||
| 1720 | Ga0070683_100110779 | |||
| 1721 | Ga0070683_100151142 | |||
| 1722 | Ga0070690_100021350 | |||
| 1723 | Ga0070670_100046760 | |||
| 1724 | Ga0070670_100065296 | |||
| 1725 | Ga0068869_100001172 | |||
| 1726 | Ga0068869_100003836 | |||
| 1727 | Ga0068869_100015543 | |||
| 1728 | Ga0068869_100041488 | |||
| 1729 | Ga0068869_100086618 | |||
| 1730 | Ga0068869_100097501 | |||
| 1731 | Ga0070666_10017287 | |||
| 1732 | Ga0070666_10038699 | |||
| 1733 | Ga0070666_10076122 | |||
| 1734 | Ga0070680_100000061 | |||
| 1735 | Ga0070680_100000142 | |||
| 1736 | Ga0070682_100013085 | |||
| 1737 | Ga0070682_100015617 | |||
| 1738 | Ga0070682_100024558 | |||
| 1739 | Ga0070682_100034343 | |||
| 1740 | Ga0068868_100001480 | |||
| 1741 | Ga0068868_100016132 | |||
| 1742 | Ga0068868_100044260 | |||
| 1743 | Ga0068868_100052582 | |||
| 1744 | Ga0068868_100093418 | |||
| 1745 | Ga0068868_100095458 | |||
| 1746 | Ga0068868_100125388 | |||
| 1747 | Ga0070660_100009555 | |||
| 1748 | Ga0070660_100056785 | |||
| 1749 | Ga0070660_100093165 | |||
| 1750 | Ga0070689_100025866 | |||
| 1751 | Ga0070689_100026796 | |||
| 1752 | Ga0070691_10004160 | |||
| 1753 | Ga0070691_10056891 | |||
| 1754 | Ga0070687_100010502 | |||
| 1755 | Ga0070687_100066214 | |||
| 1756 | Ga0070661_100038413 | |||
| 1757 | Ga0070692_10010462 | |||
| 1758 | Ga0070692_10027337 | |||
| 1759 | Ga0070692_10038183 | |||
| 1760 | Ga0070668_100001192 | |||
| 1761 | Ga0070668_100001297 | |||
| 1762 | Ga0070668_100024803 | |||
| 1763 | Ga0070668_100030442 | |||
| 1764 | Ga0070668_100046862 | |||
| 1765 | Ga0070669_100004569 | |||
| 1766 | Ga0070669_100022235 | |||
| 1767 | Ga0070675_100000392 | |||
| 1768 | Ga0070675_100010873 | |||
| 1769 | Ga0070671_100001259 | |||
| 1770 | Ga0070671_100001780 | |||
| 1771 | Ga0070674_100000187 | |||
| 1772 | Ga0070674_100123412 | |||
| 1773 | Ga0070673_100022227 | |||
| 1774 | Ga0070673_100245360 | |||
| 1775 | Ga0070688_100057304 | |||
| 1776 | Ga0070659_100023288 | |||
| 1777 | Ga0070659_100032701 | |||
| 1778 | Ga0070659_100054109 | |||
| 1779 | Ga0070659_100107419 | |||
| 1780 | Ga0070667_100000056 | |||
| 1781 | Ga0070667_100000854 | |||
| 1782 | Ga0070667_100003985 | |||
| 1783 | Ga0070667_100012230 | |||
| 1784 | Ga0070667_100051103 | |||
| 1785 | Ga0070667_100134697 | |||
| 1786 | Ga0070703_10009742 | |||
| 1787 | Ga0070709_10045596 | |||
| 1788 | Ga0070714_100000011 | |||
| 1789 | Ga0070714_100006750 | |||
| 1790 | Ga0070714_100086997 | |||
| 1791 | Ga0070714_100110626 | |||
| 1792 | Ga0070714_100163353 | |||
| 1793 | Ga0070713_100003953 | |||
| 1794 | Ga0070713_100106097 | |||
| 1795 | Ga0070713_100152745 | |||
| 1796 | Ga0070710_10000264 | |||
| 1797 | Ga0070710_10000277 | |||
| 1798 | Ga0070701_10000584 | |||
| 1799 | Ga0070701_10003695 | |||
| 1800 | Ga0070711_100000493 | |||
| 1801 | Ga0070711_100154332 | |||
| 1802 | Ga0070705_100004099 | |||
| 1803 | Ga0070700_100000046 | |||
| 1804 | Ga0070700_100003730 | |||
| 1805 | Ga0070700_100005557 | |||
| 1806 | Ga0070700_100026657 | |||
| 1807 | Ga0070700_100090058 | |||
| 1808 | Ga0070694_100024042 | |||
| 1809 | Ga0070708_100000671 | |||
| 1810 | Ga0070708_100008205 | |||
| 1811 | Ga0070663_100015215 | |||
| 1812 | Ga0070663_100046120 | |||
| 1813 | Ga0070663_100065685 | |||
| 1814 | Ga0070678_100000280 | |||
| 1815 | Ga0070678_100059459 | |||
| 1816 | Ga0070662_100001491 | |||
| 1817 | Ga0070681_10000077 | |||
| 1818 | Ga0070681_10001025 | |||
| 1819 | Ga0070681_10071491 | |||
| 1820 | Ga0068867_100002048 | |||
| 1821 | Ga0068867_100003687 | |||
| 1822 | Ga0070685_10018850 | |||
| 1823 | Ga0070706_100009403 | |||
| 1824 | Ga0070706_100021841 | |||
| 1825 | Ga0070706_100028028 | |||
| 1826 | Ga0070706_100066875 | |||
| 1827 | Ga0070706_100085150 | |||
| 1828 | Ga0070706_100167265 | |||
| 1829 | Ga0070707_100001912 | |||
| 1830 | Ga0070707_100180704 | |||
| 1831 | Ga0070698_100008833 | |||
| 1832 | Ga0070698_100045276 | |||
| 1833 | Ga0070698_100053032 | |||
| 1834 | Ga0070679_100000135 | |||
| 1835 | Ga0070679_100001551 | |||
| 1836 | Ga0070679_100040221 | |||
| 1837 | Ga0070679_100067837 | |||
| 1838 | Ga0070679_100167285 | |||
| 1839 | Ga0070684_100003821 | |||
| 1840 | Ga0070684_100088166 | |||
| 1841 | Ga0070697_100002048 | |||
| 1842 | Ga0068853_100001367 | |||
| 1843 | Ga0068853_100017068 | |||
| 1844 | Ga0068853_100044645 | |||
| 1845 | Ga0070672_100003670 | |||
| 1846 | Ga0070695_100021815 | |||
| 1847 | Ga0070695_100036124 | |||
| 1848 | Ga0070696_100002977 | |||
| 1849 | Ga0070696_100030003 | |||
| 1850 | Ga0070693_100009341 | |||
| 1851 | Ga0070665_100001617 | |||
| 1852 | Ga0070665_100006813 | |||
| 1853 | Ga0070665_100056517 | |||
| 1854 | Ga0070665_100075774 | |||
| 1855 | Ga0070665_100113871 | |||
| 1856 | Ga0070665_100160653 | |||
| 1857 | Ga0070704_100001052 | |||
| 1858 | Ga0070704_100129626 | |||
| 1859 | Ga0068855_100010555 | |||
| 1860 | Ga0068855_100038437 | |||
| 1861 | Ga0068855_100050888 | |||
| 1862 | Ga0070664_100020153 | |||
| 1863 | Ga0070664_100031931 | |||
| 1864 | Ga0068857_100033853 | |||
| 1865 | Ga0068857_100057168 | |||
| 1866 | Ga0068854_100000458 | |||
| 1867 | Ga0068854_100069551 | |||
| 1868 | Ga0068856_100023376 | |||
| 1869 | Ga0068856_100068491 | |||
| 1870 | Ga0068856_100077717 | |||
| 1871 | Ga0068856_100081444 | |||
| 1872 | Ga0068856_100093039 | |||
| 1873 | Ga0068856_100139694 | |||
| 1874 | Ga0070702_100000308 | |||
| 1875 | Ga0070702_100016071 | |||
| 1876 | Ga0068852_100020000 | |||
| 1877 | Ga0068852_100046729 | |||
| 1878 | Ga0068859_100000596 | |||
| 1879 | Ga0068859_100000751 | |||
| 1880 | Ga0068859_100061973 | |||
| 1881 | Ga0068859_100064675 | |||
| 1882 | Ga0068859_100245302 | |||
| 1883 | Ga0068864_100010645 | |||
| 1884 | Ga0068864_100049976 | |||
| 1885 | Ga0068864_100143695 | |||
| 1886 | Ga0068866_10000187 | |||
| 1887 | Ga0068866_10039686 | |||
| 1888 | Ga0068866_10066629 | |||
| 1889 | Ga0068861_100000195 | |||
| 1890 | Ga0068861_100009645 | |||
| 1891 | Ga0068851_10044148 | |||
| 1892 | Ga0068863_100000345 | |||
| 1893 | Ga0068863_100001182 | |||
| 1894 | Ga0068863_100002092 | |||
| 1895 | Ga0068863_100009630 | |||
| 1896 | Ga0068863_100009994 | |||
| 1897 | Ga0068863_100014417 | |||
| 1898 | Ga0068863_100066840 | |||
| 1899 | Ga0068863_100076174 | |||
| 1900 | Ga0068863_100115358 | |||
| 1901 | Ga0068863_100249428 | |||
| 1902 | Ga0068858_100000010 | |||
| 1903 | Ga0068858_100000013 | |||
| 1904 | Ga0068858_100013843 | |||
| 1905 | Ga0068858_100047379 | |||
| 1906 | Ga0068858_100068586 | |||
| 1907 | Ga0068858_100070309 | |||
| 1908 | Ga0068858_100102867 | |||
| 1909 | Ga0068860_100000054 | |||
| 1910 | Ga0068860_100000092 | |||
| 1911 | Ga0068860_100001932 | |||
| 1912 | Ga0068860_100122269 | |||
| 1913 | Ga0068860_100184455 | |||
| 1914 | Ga0068860_100187925 | |||
| 1915 | Ga0068862_100000035 | |||
| 1916 | Ga0068862_100000358 | |||
| 1917 | Ga0068862_100033018 | |||
| 1918 | Ga0068862_100036238 | |||
| 1919 | Ga0081455_10000071 | |||
| 1920 | Ga0081455_10000262 | |||
| 1921 | Ga0081455_10001346 | |||
| 1922 | Ga0081455_10015182 | |||
| 1923 | Ga0081455_10015517 | |||
| 1924 | Ga0081455_10015911 | |||
| 1925 | Ga0081538_10000050 | |||
| 1926 | Ga0081538_10022725 | |||
| 1927 | Ga0081538_10070670 | |||
| 1928 | Ga0081540_1000522 | |||
| 1929 | Ga0081540_1000903 | |||
| 1930 | Ga0081540_1000912 | |||
| 1931 | Ga0081540_1002205 | |||
| 1932 | Ga0081540_1015235 | |||
| 1933 | Ga0081540_1028790 | |||
| 1934 | Ga0081539_10000086 | |||
| 1935 | Ga0081539_10000763 | |||
| 1936 | Ga0081539_10003492 | |||
| 1937 | Ga0081539_10004406 | |||
| 1938 | Ga0081539_10005222 | |||
| 1939 | Ga0081539_10010250 | |||
| 1940 | Ga0081539_10036577 | |||
| 1941 | Ga0081539_10044321 | |||
| 1942 | Ga0081539_10072764 | |||
| 1943 | Ga0070717_10040433 | |||
| 1944 | Ga0070717_10049357 | |||
| 1945 | Ga0070717_10161596 | |||
| 1946 | Ga0075365_10031640 | |||
| 1947 | Ga0075365_10040457 | |||
| 1948 | Ga0075365_10072687 | |||
| 1949 | Ga0075363_100019672 | |||
| 1950 | Ga0075363_100040686 | |||
| 1951 | Ga0075363_100058072 | |||
| 1952 | Ga0075364_10001965 | |||
| 1953 | Ga0075364_10003691 | |||
| 1954 | Ga0075364_10017939 | |||
| 1955 | Ga0075364_10051014 | |||
| 1956 | Ga0070715_10005907 | |||
| 1957 | Ga0070716_100007171 | |||
| 1958 | Ga0070716_100025356 | |||
| 1959 | Ga0070716_100116427 | |||
| 1960 | Ga0070712_100001061 | |||
| 1961 | Ga0070712_100009444 | |||
| 1962 | Ga0070712_100110988 | |||
| 1963 | Ga0075362_10021385 | |||
| 1964 | Ga0075369_10002244 | |||
| 1965 | Ga0075369_10006357 | |||
| 1966 | Ga0075369_10044254 | |||
| 1967 | Ga0075369_10046171 | |||
| 1968 | Ga0097621_100036611 | |||
| 1969 | Ga0075370_10001448 | |||
| 1970 | Ga0075370_10034607 | |||
| 1971 | Ga0075370_10063851 | |||
| 1972 | Ga0068871_100011221 | |||
| 1973 | Ga0068871_100093095 | |||
| 1974 | Ga0075428_100000610 | |||
| 1975 | Ga0075428_100007051 | |||
| 1976 | Ga0075428_100007414 | |||
| 1977 | Ga0075428_100030689 | |||
| 1978 | Ga0075428_100174888 | |||
| 1979 | Ga0075428_100311879 | |||
| 1980 | Ga0075428_100400186 | |||
| 1981 | Ga0075430_100007092 | |||
| 1982 | Ga0075430_100015607 | |||
| 1983 | Ga0075430_100034036 | |||
| 1984 | Ga0075430_100041690 | |||
| 1985 | Ga0075430_100067840 | |||
| 1986 | Ga0075431_100012865 | |||
| 1987 | Ga0075431_100056189 | |||
| 1988 | Ga0075431_100060345 | |||
| 1989 | Ga0075431_100068233 | |||
| 1990 | Ga0075431_100171475 | |||
| 1991 | Ga0075433_10007460 | |||
| 1992 | Ga0075434_100032312 | |||
| 1993 | Ga0075434_100291348 | |||
| 1994 | Ga0075429_100009820 | |||
| 1995 | Ga0075429_100016282 | |||
| 1996 | Ga0075429_100022283 | |||
| 1997 | Ga0075429_100051551 | |||
| 1998 | Ga0075429_100144942 | |||
| 1999 | Ga0068865_100003084 | |||
| 2000 | Ga0068865_100006359 | |||
| 2001 | Ga0068865_100053951 | |||
| 2002 | Ga0075436_100050482 | |||
| 2003 | Ga0097620_100000596 | |||
| 2004 | Ga0097620_100000751 | |||
| 2005 | Ga0097620_100061974 | |||
| 2006 | Ga0097620_100064675 | |||
| 2007 | Ga0097620_100245303 | |||
| 2008 | Ga0105251_10030178 | |||
| 2009 | Ga0105251_10053826 | |||
| 2010 | Ga0105250_10018756 | |||
| 2011 | Ga0105240_10003639 | |||
| 2012 | Ga0105240_10037111 | |||
| 2013 | Ga0105240_10194704 | |||
| 2014 | Ga0105240_10354671 | |||
| 2015 | Ga0111539_10001504 | |||
| 2016 | Ga0111539_10002724 | |||
| 2017 | Ga0111539_10009764 | |||
| 2018 | Ga0111539_10100066 | |||
| 2019 | Ga0105245_10000870 | |||
| 2020 | Ga0105245_10005605 | |||
| 2021 | Ga0105245_10005886 | |||
| 2022 | Ga0105245_10018820 | |||
| 2023 | Ga0105245_10097087 | |||
| 2024 | Ga0105245_10176509 | |||
| 2025 | Ga0105245_10263285 | |||
| 2026 | Ga0105247_10000038 | |||
| 2027 | Ga0105247_10000062 | |||
| 2028 | Ga0105247_10000637 | |||
| 2029 | Ga0105247_10009210 | |||
| 2030 | Ga0105247_10018328 | |||
| 2031 | Ga0105247_10022164 | |||
| 2032 | Ga0114129_10000852 | |||
| 2033 | Ga0114129_10001274 | |||
| 2034 | Ga0114129_10001724 | |||
| 2035 | Ga0114129_10091266 | |||
| 2036 | Ga0114129_10118258 | |||
| 2037 | Ga0114129_10185214 | |||
| 2038 | Ga0105243_10001020 | |||
| 2039 | Ga0105243_10021920 | |||
| 2040 | Ga0105243_10194003 | |||
| 2041 | Ga0105241_10025845 | |||
| 2042 | Ga0105241_10133231 | |||
| 2043 | Ga0105242_10000650 | |||
| 2044 | Ga0105242_10027971 | |||
| 2045 | Ga0105242_10041014 | |||
| 2046 | Ga0105242_10092703 | |||
| 2047 | Ga0105242_10103959 | |||
| 2048 | Ga0105242_10135768 | |||
| 2049 | Ga0105248_10000035 | |||
| 2050 | Ga0105248_10000036 | |||
| 2051 | Ga0105248_10003863 | |||
| 2052 | Ga0105248_10011321 | |||
| 2053 | Ga0105248_10033866 | |||
| 2054 | Ga0105248_10039835 | |||
| 2055 | Ga0105248_10045424 | |||
| 2056 | Ga0105248_10049682 | |||
| 2057 | Ga0105248_10075304 | |||
| 2058 | Ga0105248_10134247 | |||
| 2059 | Ga0105248_10201205 | |||
| 2060 | Ga0105248_10238833 | |||
| 2061 | Ga0105248_10241017 | |||
| 2062 | Ga0105237_10000467 | |||
| 2063 | Ga0105237_10014748 | |||
| 2064 | Ga0105237_10014930 | |||
| 2065 | Ga0105237_10044770 | |||
| 2066 | Ga0105238_10032638 | |||
| 2067 | Ga0105238_10085210 | |||
| 2068 | Ga0105238_10307532 | |||
| 2069 | Ga0105249_10000046 | |||
| 2070 | Ga0105249_10001186 | |||
| 2071 | Ga0105249_10005191 | |||
| 2072 | Ga0105249_10118937 | |||
| 2073 | Ga0099796_10029146 | |||
| 2074 | Ga0105239_10003093 | |||
| 2075 | Ga0105239_10008819 | |||
| 2076 | Ga0105239_10016946 | |||
| 2077 | Ga0105239_10147161 | |||
| 2078 | Ga0105239_10323128 | |||
| 2079 | Ga0105246_10014319 | |||
| 2080 | Ga0105246_10040638 | |||
| 2081 | Ga0105246_10062558 | |||
| 2082 | Ga0105246_10083890 | |||
| 2083 | Ga0105246_10094152 | |||
| 2084 | Ga0157373_10026116 | |||
| 2085 | Ga0157373_10034275 | |||
| 2086 | Ga0157371_10056311 | |||
| 2087 | Ga0157370_10014109 | |||
| 2088 | Ga0157370_10016416 | |||
| 2089 | Ga0157370_10040559 | |||
| 2090 | Ga0157370_10132940 | |||
| 2091 | Ga0157369_10000890 | |||
| 2092 | Ga0157369_10010203 | |||
| 2093 | Ga0157369_10048565 | |||
| 2094 | Ga0157369_10065749 | |||
| 2095 | Ga0157369_10098846 | |||
| 2096 | Ga0157369_10100808 | |||
| 2097 | Ga0157369_10235375 | |||
| 2098 | Ga0157369_10269053 | |||
| 2099 | Ga0157374_10203151 | |||
| 2100 | Ga0157378_10029056 | |||
| 2101 | Ga0163162_10001609 | |||
| 2102 | Ga0163162_10054540 | |||
| 2103 | Ga0163162_10094916 | |||
| 2104 | Ga0157372_10000069 | |||
| 2105 | Ga0157372_10004145 | |||
| 2106 | Ga0157372_10081467 | |||
| 2107 | Ga0157372_10252452 | |||
| 2108 | Ga0157372_10256371 | |||
| 2109 | Ga0157372_10466967 | |||
| 2110 | Ga0157375_10000419 | |||
| 2111 | Ga0157375_10097169 | |||
| 2112 | Ga0163163_10008079 | |||
| 2113 | Ga0163163_10013354 | |||
| 2114 | Ga0163163_10041882 | |||
| 2115 | Ga0163163_10095860 | |||
| 2116 | Ga0163163_10109215 | |||
| 2117 | Ga0163163_10141080 | |||
| 2118 | Ga0157380_10015814 | |||
| 2119 | Ga0157380_10056783 | |||
| 2120 | Ga0157380_10162506 | |||
| 2121 | Ga0157377_10003983 | |||
| 2122 | Ga0157377_10037198 | |||
| 2123 | Ga0157379_10000012 | |||
| 2124 | Ga0157379_10008843 | |||
| 2125 | Ga0157379_10020489 | |||
| 2126 | Ga0157379_10045149 | |||
| 2127 | Ga0157379_10185118 | |||
| 2128 | Ga0157376_10003944 | |||
| 2129 | Ga0182007_10006330 | |||
| 2130 | Ga0183367_1002 | |||
| 2131 | Ga0163161_10004818 | |||
| 2132 | Ga0163161_10021838 | |||
| 2133 | Ga0163161_10025906 | |||
| 2134 | Ga0197907_10125209 | |||
| 2135 | Ga0197907_10824310 | |||
| 2136 | Ga0197907_11041682 | |||
| 2137 | Ga0206356_11084540 | |||
| 2138 | Ga0206356_11251781 | |||
| 2139 | Ga0206356_11557117 | |||
| 2140 | Ga0206355_1061250 | |||
| 2141 | Ga0206351_10970124 | |||
| 2142 | Ga0206352_11163761 | |||
| 2143 | Ga0206350_11654720 | |||
| 2144 | Ga0206353_10041609 | |||
| 2145 | Ga0206353_10184723 | |||
| 2146 | Ga0206353_10976662 | |||
| 2147 | Ga0154015_1539966 | |||
| 2148 | Ga0154015_1634210 | |||
| 2149 | Ga0154015_1690007 | |||
| 2150 | Ga0213873_10000037 | |||
| 2151 | Ga0213876_10000793 | |||
| 2152 | Ga0213876_10019769 | |||
| 2153 | Ga0213876_10075381 | |||
| 2154 | Ga0213875_10002364 | |||
| 2155 | Ga0213875_10010278 | |||
| 2156 | Ga0213875_10011142 | |||
| 2157 | Ga0213875_10016187 | |||
| 2158 | Ga0213875_10017198 | |||
| 2159 | Ga0213875_10023525 | |||
| 2160 | Ga0213875_10035752 | |||
| 2161 | Ga0224712_10000640 | |||
| 2162 | Ga0224712_10000868 | |||
| 2163 | Ga0224712_10001321 | |||
| 2164 | Ga0224712_10002852 | |||
| 2165 | Ga0224712_10003615 | |||
| 2166 | Ga0224712_10008703 | |||
| 2167 | Ga0224712_10021348 | |||
| 2168 | Ga0228598_1007224 | |||
| 2169 | Ga0209758_1005072 | |||
| 2170 | Ga0207426_1002674 | |||
| 2171 | Ga0207426_1004723 | |||
| 2172 | Ga0209051_1000011 | |||
| 2173 | Ga0209051_1000620 | |||
| 2174 | Ga0209051_1000933 | |||
| 2175 | Ga0209051_1001428 | |||
| 2176 | Ga0209051_1042780 | |||
| 2177 | Ga0207713_1047252 | |||
| 2178 | Ga0207653_10019979 | |||
| 2179 | Ga0207692_10000049 | |||
| 2180 | Ga0207692_10006547 | |||
| 2181 | Ga0207692_10041273 | |||
| 2182 | Ga0207642_10000726 | |||
| 2183 | Ga0207642_10008157 | |||
| 2184 | Ga0207710_10000017 | |||
| 2185 | Ga0207710_10000048 | |||
| 2186 | Ga0207710_10000060 | |||
| 2187 | Ga0207710_10000890 | |||
| 2188 | Ga0207710_10017562 | |||
| 2189 | Ga0207710_10018265 | |||
| 2190 | Ga0207688_10000177 | |||
| 2191 | Ga0207688_10000985 | |||
| 2192 | Ga0207688_10001785 | |||
| 2193 | Ga0207688_10003133 | |||
| 2194 | Ga0207688_10069288 | |||
| 2195 | Ga0207688_10089663 | |||
| 2196 | Ga0207680_10004709 | |||
| 2197 | Ga0207680_10019714 | |||
| 2198 | Ga0207680_10055310 | |||
| 2199 | Ga0207680_10074674 | |||
| 2200 | Ga0207647_10041404 | |||
| 2201 | Ga0207647_10052506 | |||
| 2202 | Ga0207685_10001985 | |||
| 2203 | Ga0207685_10028071 | |||
| 2204 | Ga0207699_10044380 | |||
| 2205 | Ga0207699_10066505 | |||
| 2206 | Ga0207699_10071370 | |||
| 2207 | Ga0207645_10022095 | |||
| 2208 | Ga0207643_10000335 | |||
| 2209 | Ga0207643_10012832 | |||
| 2210 | Ga0207705_10000676 | |||
| 2211 | Ga0207705_10002002 | |||
| 2212 | Ga0207705_10014666 | |||
| 2213 | Ga0207705_10020763 | |||
| 2214 | Ga0207705_10020946 | |||
| 2215 | Ga0207705_10061174 | |||
| 2216 | Ga0207705_10138892 | |||
| 2217 | Ga0207684_10002893 | |||
| 2218 | Ga0207684_10143592 | |||
| 2219 | Ga0207707_10000089 | |||
| 2220 | Ga0207707_10009801 | |||
| 2221 | Ga0207707_10010633 | |||
| 2222 | Ga0207695_10017340 | |||
| 2223 | Ga0207695_10027984 | |||
| 2224 | Ga0207671_10038644 | |||
| 2225 | Ga0207671_10056241 | |||
| 2226 | Ga0207693_10000339 | |||
| 2227 | Ga0207693_10001185 | |||
| 2228 | Ga0207693_10029887 | |||
| 2229 | Ga0207693_10067864 | |||
| 2230 | Ga0207693_10075462 | |||
| 2231 | Ga0207693_10083640 | |||
| 2232 | Ga0207693_10118340 | |||
| 2233 | Ga0207693_10157566 | |||
| 2234 | Ga0207693_10170474 | |||
| 2235 | Ga0207663_10035253 | |||
| 2236 | Ga0207663_10062232 | |||
| 2237 | Ga0207660_10000115 | |||
| 2238 | Ga0207660_10000815 | |||
| 2239 | Ga0207660_10163950 | |||
| 2240 | Ga0207660_10194254 | |||
| 2241 | Ga0207662_10013813 | |||
| 2242 | Ga0207662_10020422 | |||
| 2243 | Ga0207662_10084502 | |||
| 2244 | Ga0207657_10002680 | |||
| 2245 | Ga0207657_10014660 | |||
| 2246 | Ga0207657_10020276 | |||
| 2247 | Ga0207657_10062164 | |||
| 2248 | Ga0207657_10084696 | |||
| 2249 | Ga0207657_10129847 | |||
| 2250 | Ga0207649_10004339 | |||
| 2251 | Ga0207649_10150627 | |||
| 2252 | Ga0207652_10000015 | |||
| 2253 | Ga0207652_10010364 | |||
| 2254 | Ga0207652_10016837 | |||
| 2255 | Ga0207652_10037921 | |||
| 2256 | Ga0207652_10047432 | |||
| 2257 | Ga0207646_10022954 | |||
| 2258 | Ga0207681_10000788 | |||
| 2259 | Ga0207694_10023506 | |||
| 2260 | Ga0207650_10007490 | |||
| 2261 | Ga0207650_10077853 | |||
| 2262 | Ga0207650_10208497 | |||
| 2263 | Ga0207659_10012720 | |||
| 2264 | Ga0207659_10014966 | |||
| 2265 | Ga0207687_10003312 | |||
| 2266 | Ga0207687_10024289 | |||
| 2267 | Ga0207687_10034677 | |||
| 2268 | Ga0207687_10077886 | |||
| 2269 | Ga0207687_10153233 | |||
| 2270 | Ga0207700_10063014 | |||
| 2271 | Ga0207700_10065136 | |||
| 2272 | Ga0207700_10122586 | |||
| 2273 | Ga0207700_10124281 | |||
| 2274 | Ga0207664_10000001 | |||
| 2275 | Ga0207664_10003864 | |||
| 2276 | Ga0207664_10016390 | |||
| 2277 | Ga0207664_10028564 | |||
| 2278 | Ga0207664_10044386 | |||
| 2279 | Ga0207664_10065900 | |||
| 2280 | Ga0207664_10130771 | |||
| 2281 | Ga0207664_10142941 | |||
| 2282 | Ga0207644_10000976 | |||
| 2283 | Ga0207644_10003155 | |||
| 2284 | Ga0207644_10107041 | |||
| 2285 | Ga0207690_10000171 | |||
| 2286 | Ga0207690_10022295 | |||
| 2287 | Ga0207706_10002589 | |||
| 2288 | Ga0207706_10007779 | |||
| 2289 | Ga0207706_10053435 | |||
| 2290 | Ga0207686_10001637 | |||
| 2291 | Ga0207686_10017197 | |||
| 2292 | Ga0207686_10070814 | |||
| 2293 | Ga0207686_10104898 | |||
| 2294 | Ga0207709_10001393 | |||
| 2295 | Ga0207709_10005302 | |||
| 2296 | Ga0207709_10008671 | |||
| 2297 | Ga0207670_10044191 | |||
| 2298 | Ga0207670_10142032 | |||
| 2299 | Ga0207669_10000205 | |||
| 2300 | Ga0207669_10003947 | |||
| 2301 | Ga0207704_10000618 | |||
| 2302 | Ga0207704_10005569 | |||
| 2303 | Ga0207704_10107026 | |||
| 2304 | Ga0207665_10006357 | |||
| 2305 | Ga0207665_10009000 | |||
| 2306 | Ga0207665_10019025 | |||
| 2307 | Ga0207665_10041528 | |||
| 2308 | Ga0207665_10043041 | |||
| 2309 | Ga0207665_10095785 | |||
| 2310 | Ga0207691_10000365 | |||
| 2311 | Ga0207691_10014980 | |||
| 2312 | Ga0207691_10123103 | |||
| 2313 | Ga0207711_10000073 | |||
| 2314 | Ga0207711_10000747 | |||
| 2315 | Ga0207711_10001409 | |||
| 2316 | Ga0207711_10006606 | |||
| 2317 | Ga0207711_10009126 | |||
| 2318 | Ga0207711_10010854 | |||
| 2319 | Ga0207711_10016330 | |||
| 2320 | Ga0207711_10099817 | |||
| 2321 | Ga0207711_10125273 | |||
| 2322 | Ga0207711_10160682 | |||
| 2323 | Ga0207689_10002913 | |||
| 2324 | Ga0207689_10006800 | |||
| 2325 | Ga0207689_10047196 | |||
| 2326 | Ga0207689_10071434 | |||
| 2327 | Ga0207661_10001912 | |||
| 2328 | Ga0207661_10025154 | |||
| 2329 | Ga0207661_10026607 | |||
| 2330 | Ga0207661_10064146 | |||
| 2331 | Ga0207661_10076749 | |||
| 2332 | Ga0207661_10123955 | |||
| 2333 | Ga0207661_10187600 | |||
| 2334 | Ga0207661_10234549 | |||
| 2335 | Ga0207679_10006663 | |||
| 2336 | Ga0207679_10024111 | |||
| 2337 | Ga0207679_10037555 | |||
| 2338 | Ga0207679_10260636 | |||
| 2339 | Ga0207667_10009549 | |||
| 2340 | Ga0207667_10027730 | |||
| 2341 | Ga0207667_10102345 | |||
| 2342 | Ga0207667_10146731 | |||
| 2343 | Ga0207667_10230340 | |||
| 2344 | Ga0207651_10040572 | |||
| 2345 | Ga0207651_10209457 | |||
| 2346 | Ga0207712_10000042 | |||
| 2347 | Ga0207712_10015171 | |||
| 2348 | Ga0207712_10076219 | |||
| 2349 | Ga0207712_10210514 | |||
| 2350 | Ga0207668_10000918 | |||
| 2351 | Ga0207668_10002531 | |||
| 2352 | Ga0207668_10003383 | |||
| 2353 | Ga0207668_10006483 | |||
| 2354 | Ga0207668_10011491 | |||
| 2355 | Ga0207668_10030292 | |||
| 2356 | Ga0207640_10003652 | |||
| 2357 | Ga0207640_10010659 | |||
| 2358 | Ga0207640_10068543 | |||
| 2359 | Ga0207658_10000449 | |||
| 2360 | Ga0207658_10005595 | |||
| 2361 | Ga0207658_10053121 | |||
| 2362 | Ga0207658_10076757 | |||
| 2363 | Ga0207658_10188247 | |||
| 2364 | Ga0207677_10003695 | |||
| 2365 | Ga0207677_10011197 | |||
| 2366 | Ga0207677_10027876 | |||
| 2367 | Ga0207677_10035072 | |||
| 2368 | Ga0207677_10036316 | |||
| 2369 | Ga0207677_10038832 | |||
| 2370 | Ga0207677_10043595 | |||
| 2371 | Ga0207703_10000002 | |||
| 2372 | Ga0207703_10000009 | |||
| 2373 | Ga0207703_10002964 | |||
| 2374 | Ga0207703_10061458 | |||
| 2375 | Ga0207639_10005809 | |||
| 2376 | Ga0207639_10045082 | |||
| 2377 | Ga0207639_10047931 | |||
| 2378 | Ga0207639_10050377 | |||
| 2379 | Ga0207639_10061070 | |||
| 2380 | Ga0207678_10000657 | |||
| 2381 | Ga0207678_10002619 | |||
| 2382 | Ga0207678_10008350 | |||
| 2383 | Ga0207678_10008815 | |||
| 2384 | Ga0207678_10037057 | |||
| 2385 | Ga0207678_10051777 | |||
| 2386 | Ga0207678_10121879 | |||
| 2387 | Ga0207708_10000002 | |||
| 2388 | Ga0207708_10000208 | |||
| 2389 | Ga0207708_10005701 | |||
| 2390 | Ga0207708_10013101 | |||
| 2391 | Ga0207702_10004196 | |||
| 2392 | Ga0207702_10009828 | |||
| 2393 | Ga0207702_10017665 | |||
| 2394 | Ga0207702_10096501 | |||
| 2395 | Ga0207702_10143824 | |||
| 2396 | Ga0207702_10239809 | |||
| 2397 | Ga0207641_10001094 | |||
| 2398 | Ga0207641_10001703 | |||
| 2399 | Ga0207641_10002959 | |||
| 2400 | Ga0207641_10013167 | |||
| 2401 | Ga0207641_10014228 | |||
| 2402 | Ga0207641_10057479 | |||
| 2403 | Ga0207641_10237589 | |||
| 2404 | Ga0207648_10000623 | |||
| 2405 | Ga0207648_10002531 | |||
| 2406 | Ga0207676_10003163 | |||
| 2407 | Ga0207674_10013076 | |||
| 2408 | Ga0207674_10015850 | |||
| 2409 | Ga0207674_10201721 | |||
| 2410 | Ga0207674_10300114 | |||
| 2411 | Ga0207675_100001672 | |||
| 2412 | Ga0207675_100022173 | |||
| 2413 | Ga0207675_100033946 | |||
| 2414 | Ga0207675_100115421 | |||
| 2415 | Ga0207683_10000539 | |||
| 2416 | Ga0207683_10000857 | |||
| 2417 | Ga0207683_10001164 | |||
| 2418 | Ga0207683_10001504 | |||
| 2419 | Ga0207683_10055797 | |||
| 2420 | Ga0207683_10068459 | |||
| 2421 | Ga0207698_10014728 | |||
| 2422 | Ga0207698_10040729 | |||
| 2423 | Ga0207698_10309789 | |||
| 2424 | Ga0207428_10005680 | |||
| 2425 | Ga0207428_10022479 | |||
| 2426 | Ga0207428_10030910 | |||
| 2427 | Ga0268266_10003190 | |||
| 2428 | Ga0268266_10005174 | |||
| 2429 | Ga0268266_10014863 | |||
| 2430 | Ga0268266_10084004 | |||
| 2431 | Ga0268266_10106405 | |||
| 2432 | Ga0268266_10146164 | |||
| 2433 | Ga0268265_10000051 | |||
| 2434 | Ga0268265_10000156 | |||
| 2435 | Ga0268265_10015530 | |||
| 2436 | Ga0268265_10036439 | |||
| 2437 | Ga0268264_10000097 | |||
| 2438 | Ga0268264_10000108 | |||
| 2439 | Ga0268264_10004939 | |||
| 2440 | Ga0268264_10075422 | |||
| 2441 | Ga0268264_10091589 | |||
| 2442 | Ga0307515_10000038 | |||
| 2443 | Ga0307515_10019047 | |||
| 2444 | Ga0307515_10033888 | |||
| 2445 | Ga0307515_10037382 | |||
| 2446 | Ga0307515_10070295 | |||
| 2447 | Ga0265338_10017927 | |||
| 2448 | Ga0265338_10038060 | |||
| 2449 | Ga0307511_10000590 | |||
| 2450 | Ga0307511_10002042 | |||
| 2451 | Ga0307512_10006290 | |||
| 2452 | Ga0307512_10024887 | |||
| 2453 | Ga0307512_10045352 | |||
| 2454 | Ga0316180_1157808 | |||
| 2455 | Ga0316183_1115972 | |||
| 2456 | Ga0265325_10003221 | |||
| 2457 | Ga0265325_10005156 | |||
| 2458 | Ga0265340_10019334 | |||
| 2459 | Ga0265339_10008767 | |||
| 2460 | Ga0265339_10049576 | |||
| 2461 | Ga0265327_10000021 | |||
| 2462 | Ga0265327_10000071 | |||
| 2463 | Ga0307513_10000002 | |||
| 2464 | Ga0307513_10007971 | |||
| 2465 | Ga0307513_10009861 | |||
| 2466 | Ga0307513_10015380 | |||
| 2467 | Ga0307513_10094607 | |||
| 2468 | Ga0307509_10015278 | |||
| 2469 | Ga0307509_10048348 | |||
| 2470 | Ga0307509_10149351 | |||
| 2471 | Ga0307408_100189282 | |||
| 2472 | Ga0307508_10000506 | |||
| 2473 | Ga0307508_10001775 | |||
| 2474 | Ga0307508_10070716 | |||
| 2475 | Ga0307514_10006847 | |||
| 2476 | Ga0307514_10075008 | |||
| 2477 | Ga0265314_10006663 | |||
| 2478 | Ga0265342_10042943 | |||
| 2479 | Ga0316576_10001518 | |||
| 2480 | Ga0316576_10004023 | |||
| 2481 | Ga0316576_10017633 | |||
| 2482 | Ga0316576_10114347 | |||
| 2483 | Ga0316578_10010142 | |||
| 2484 | Ga0316578_10069683 | |||
| 2485 | Ga0307516_10002871 | |||
| 2486 | Ga0307516_10093745 | |||
| 2487 | Ga0307516_10094321 | |||
| 2488 | Ga0307405_10000804 | |||
| 2489 | Ga0307405_10024124 | |||
| 2490 | Ga0307405_10127210 | |||
| 2491 | Ga0307413_10000862 | |||
| 2492 | Ga0307413_10018416 | |||
| 2493 | Ga0307413_10034067 | |||
| 2494 | Ga0307413_10160841 | |||
| 2495 | Ga0307518_10004772 | |||
| 2496 | Ga0307410_10015291 | |||
| 2497 | Ga0307410_10024255 | |||
| 2498 | Ga0307410_10045221 | |||
| 2499 | Ga0307410_10054371 | |||
| 2500 | Ga0307410_10096536 | |||
| 2501 | Ga0307410_10111554 | |||
| 2502 | Ga0307406_10004254 | |||
| 2503 | Ga0307406_10075140 | |||
| 2504 | Ga0307406_10082326 | |||
| 2505 | Ga0307406_10131537 | |||
| 2506 | Ga0307406_10181694 | |||
| 2507 | Ga0307407_10002514 | |||
| 2508 | Ga0307407_10003337 | |||
| 2509 | Ga0307409_100000406 | |||
| 2510 | Ga0307409_100000409 | |||
| 2511 | Ga0307409_100012688 | |||
| 2512 | Ga0307409_100089208 | |||
| 2513 | Ga0307409_100156524 | |||
| 2514 | Ga0307409_100256598 | |||
| 2515 | Ga0307416_100005536 | |||
| 2516 | Ga0307416_100006145 | |||
| 2517 | Ga0307416_100007073 | |||
| 2518 | Ga0307414_10089640 | |||
| 2519 | Ga0307414_10106356 | |||
| 2520 | Ga0307415_100000021 | |||
| 2521 | Ga0307415_100000422 | |||
| 2522 | Ga0307415_100003770 | |||
| 2523 | Ga0307415_100004822 | |||
| 2524 | Ga0307415_100039753 | |||
| 2525 | Ga0307415_100052948 | |||
| 2526 | Ga0316585_10004353 | |||
| 2527 | Ga0316580_10019075 | |||
| 2528 | Ga0316593_10000889 | |||
| 2529 | Ga0307507_10000732 | |||
| 2530 | Ga0307507_10016917 | |||
| 2531 | Ga0307507_10020822 | |||
| 2532 | Ga0307510_10055624 | |||
| 2533 | Ga0307510_10089223 | |||
| 2534 | Ga0307510_10116839 | |||
| 2535 | Ga0316214_1001544 | |||
| 2536 | Ga0373959_0014790 | |||
| 2537 | Ga0373926_0009791 | |||
| 2538 | Ga0373934_0003190 | |||
| 2539 | Ga0373944_0007599 | |||
| 2540 | Ga0373949_0005321 | |||
| 2541 | Ga0373951_0000115 | |||
| 2542 | Ga0373923_0001801 | |||
| 2543 | Ga0373936_0000466 | |||
| 2544 | Ga0373936_0051674 | |||
| 2545 | Ga0373945_0001125 | |||
| 2546 | Ga0373945_0005546 | |||
| 2547 | Ga0373953_0001306 | |||
| 2548 | Ga0373953_0002560 | |||
| 2549 | Ga0373953_0025343 | |||
| 2550 | Ga0373954_0025370 | |||
| 2551 | Ga0373956_0003065 | |||
| 2552 | Ga0373956_0033163 | |||
| 2553 | Ga0373960_0004283 | |||
| 2554 | Ga0373943_0001264 | |||
| 2555 | Ga0373946_0001321 | |||
| 2556 | Ga0373955_0003782 | |||
| 2557 | Ga0373955_0040542 | |||
| 2558 | Ga0373942_0000196 | |||
| 2559 | Ga0373942_0012372 | |||
| 2560 | Ga0373962_0011117 | |||
| 2561 | Ga0316574_0024953 | |||
| 2562 | Ga0316574_0058180 | |||
| 2563 | Ga0316574_0061945 | |||
| 2564 | Ga0373924_0005485 | |||
| 2565 | Ga0373924_0013950 | |||
| 2566 | Ga0373931_0008885 | |||
| 2567 | Ga0373931_0048658 | |||
| 2568 | Ga0373935_0004907 | |||
| 2569 | Ga0373935_0014322 | |||
| 2570 | Ga0373935_0015818 | |||
| 2571 | Ga0373935_0029064 | |||
| 2572 | Ga0373935_0151391 | |||
| 2573 | Ga0373927_0002894 | |||
| 2574 | Ga0373927_0093639 | |||
| 2575 | Ga0373933_0013288 | |||
| 2576 | Ga0373947_0000039 | |||
| 2577 | Ga0373947_0003402 | |||
| 2578 | Ga0373947_0009537 | |||
| 2579 | Ga0373937_0053491 | |||
| 2580 | Ga0373937_0070973 | |||
| 2581 | Ga0373937_0086281 | |||
| 2582 | Ga0265778_000400 | |||
| 2583 | Ga0316582_0097304 | |||
| 2584 | Ga0316584_0000281 | |||
| 2585 | Ga0316584_0005744 | |||
| 2586 | Ga0316584_0071624 | |||
| 2587 | Ga0316584_0102955 | |||
| 2588 | Ga0373925_0000006 | |||
| 2589 | Ga0373925_0050996 | |||
| 2590 | Ga0395899_0053281 | |||
| 2591 | Ga0395900_0003901 | |||
| 2592 | Ga0395900_0008791 | |||
| 2593 | Ga0395900_0042604 | |||
| 2594 | Ga0395900_0182565 | |||
| 2595 | Ga0395898_0011400 | |||
| 2596 | Ga0395898_0035335 | |||
| 2597 | Ga0395898_0119080 | |||
| 2598 | Ga0395898_0136410 | |||
| 2599 | Ga0395905_0023889 | |||
| 2600 | Ga0395905_0087531 | |||
| 2601 | Ga0395905_0254809 | |||
| 2602 | Ga0436364_0238775 | |||
| 2603 | Ga0436364_0516238 | |||
| 2604 | Ga0436364_0696641 | |||
| 2605 | Ga0436364_0735260 | |||
| 2606 | Ga0436364_0823558 | |||
| 2607 | Ga0436364_1039945 | |||
| 2608 | Ga0436364_1051432 | |||
| 2609 | Ga0436364_1086504 | |||
| 2610 | Ga0436364_1291536 | |||
| 2611 | Ga0395901_0033677 | |||
| 2612 | Ga0436365_0447055 | |||
| 2613 | Ga0436365_0567091 | |||
| 2614 | Ga0436365_0574117 | |||
| 2615 | Ga0436365_0939033 | |||
| 2616 | Ga0436365_1050647 | |||
| 2617 | Ga0436365_1284454 | |||
| 2618 | Ga0436365_1908396 | |||
| 2619 | Ga0436363_0129189 | |||
| 2620 | Ga0436363_0464660 | |||
| 2621 | Ga0436363_1431793 | |||
| 2622 | Ga0436362_0884990 | |||
| 2623 | Ga0439436_0000647 | |||
| 2624 | Ga0439436_0002022 | |||
| 2625 | Ga0439439_0010546 | |||
| 2626 | Ga0439461_0001991 | |||
| 2627 | Ga0439466_0004599 | |||
| 2628 | Ga0439465_0008298 | |||
| 2629 | Ga0439465_0009044 | |||
| 2630 | Ga0451789_0957144 | |||
| 2631 | Ga0451793_0254203 | |||
| 2632 | Ga0451795_0111892 | |||
| 2633 | Ga0451853_2614358 | |||
| 2634 | Ga0439431_0005807 | |||
| 2635 | Ga0439433_0001382 | |||
| 2636 | Ga0439433_0009801 | |||
| 2637 | Ga0439442_002424 | |||
| 2638 | Ga0439445_0003352 | |||
| 2639 | Ga0439432_020825 | |||
| 2640 | Ga0439457_000479 | |||
| 2641 | Ga0439457_004100 | |||
| 2642 | Ga0450894_000878 | |||
| 2643 | Ga0450899_000129 | |||
| 2644 | Ga0439459_0000473 | |||
| 2645 | Ga0451577_0066941 | |||
| 2646 | Ga0466969_0000632 | |||
| 2647 | Ga0466969_0002576 | |||
| 2648 | Ga0466969_0004118 | |||
| 2649 | Ga0466969_0049407 | |||
| 2650 | Ga0466972_0002173 | |||
| 2651 | Ga0466972_0011396 | |||
| 2652 | Ga0466972_0014915 | |||
| 2653 | Ga0466972_0028907 | |||
| 2654 | Ga0466972_0039438 | |||
| 2655 | Ga0466972_0057374 | |||
| 2656 | Ga0466965_0000194 | |||
| 2657 | Ga0466965_0007146 | |||
| 2658 | Ga0466965_0024585 | |||
| 2659 | Ga0466965_0024726 | |||
| 2660 | Ga0466965_0026949 | |||
| 2661 | Ga0466966_0001302 | |||
| 2662 | Ga0466966_0006474 | |||
| 2663 | Ga0466966_0061797 | |||
| 2664 | Ga0466966_0080943 | |||
| 2665 | Ga0466961_0001660 | |||
| 2666 | Ga0466961_0002350 | |||
| 2667 | Ga0466961_0002892 | |||
| 2668 | Ga0466961_0005797 | |||
| 2669 | Ga0466961_0021171 | |||
| 2670 | Ga0466961_0024210 | |||
| 2671 | Ga0466961_0029146 | |||
| 2672 | Ga0466961_0049882 | |||
| 2673 | Ga0466961_0062349 | |||
| 2674 | Ga0466961_0073870 | |||
| 2675 | Ga0466963_0001094 | |||
| 2676 | Ga0466963_0003573 | |||
| 2677 | Ga0466963_0010639 | |||
| 2678 | Ga0466963_0016897 | |||
| 2679 | Ga0466963_0019383 | |||
| 2680 | Ga0466963_0032161 | |||
| 2681 | Ga0466963_0034188 | |||
| 2682 | Ga0466963_0040311 | |||
| 2683 | Ga0466963_0074602 | |||
| 2684 | Ga0466963_0083359 | |||
| 2685 | Ga0466964_0019639 | |||
| 2686 | Ga0466964_0024386 | |||
| 2687 | Ga0466964_0025198 | |||
| 2688 | Ga0466964_0071300 | |||
| 2689 | Ga0466971_0000892 | |||
| 2690 | Ga0466971_0003748 | |||
| 2691 | Ga0466971_0008516 | |||
| 2692 | Ga0466971_0028339 | |||
| 2693 | Ga0466971_0045012 | |||
| 2694 | Ga0466968_0003734 | |||
| 2695 | Ga0466968_0003834 | |||
| 2696 | Ga0466968_0016662 | |||
| 2697 | Ga0466968_0061106 | |||
| 2698 | Ga0466970_0014696 | |||
| 2699 | Ga0466970_0022106 | |||
| 2700 | Ga0466970_0032443 | |||
| 2701 | Ga0466970_0051351 | |||
| 2702 | Ga0466970_0054821 | |||
| 2703 | Ga0466970_0067744 | |||
| 2704 | Ga0466957_0012041 | |||
| 2705 | Ga0466957_0013266 | |||
| 2706 | Ga0466960_0000703 | |||
| 2707 | Ga0466960_0001139 | |||
| 2708 | Ga0466960_0001775 | |||
| 2709 | Ga0466960_0004561 | |||
| 2710 | Ga0466960_0007316 | |||
| 2711 | Ga0466960_0036259 | |||
| 2712 | Ga0466959_0000877 | |||
| 2713 | Ga0466959_0006347 | |||
| 2714 | Ga0466959_0018130 | |||
| 2715 | Ga0466959_0038655 | |||
| 2716 | Ga0466959_0059597 | |||
| 2717 | Ga0466959_0084429 | |||
| 2718 | Ga0466959_0089585 | |||
| 2719 | Ga0466959_0093383 | |||
| 2720 | Ga0466959_0099313 | |||
| 2721 | Ga0451576_0128588 | |||
| 2722 | Ga0466958_0003068 | |||
| 2723 | Ga0466958_0009782 | |||
| 2724 | Ga0466958_0011259 | |||
| 2725 | Ga0466958_0011623 | |||
| 2726 | Ga0466958_0019285 | |||
| 2727 | Ga0466958_0028208 | |||
| 2728 | Ga0466958_0034449 | |||
| 2729 | Ga0466958_0041184 | |||
| 2730 | Ga0466958_0042780 | |||
| 2731 | Ga0466958_0070299 | |||
| 2732 | Ga0466958_0087654 | |||
| 2733 | Ga0466967_0000595 | |||
| 2734 | Ga0466967_0001175 | |||
| 2735 | Ga0466967_0001407 | |||
| 2736 | Ga0466967_0002012 | |||
| 2737 | Ga0466967_0002261 | |||
| 2738 | Ga0466967_0005637 | |||
| 2739 | Ga0466967_0009226 | |||
| 2740 | Ga0466967_0009250 | |||
| 2741 | Ga0466967_0009629 | |||
| 2742 | Ga0466967_0009645 | |||
| 2743 | Ga0466967_0010064 | |||
| 2744 | Ga0466967_0017233 | |||
| 2745 | Ga0466967_0055472 | |||
| 2746 | Ga0466967_0059846 | |||
| 2747 | Ga0466967_0102881 | |||
| 2748 | Ga0466967_0147542 | |||
| 2749 | Ga0466967_0181544 | |||
| 2750 | Ga0466967_0266619 | |||
| 2751 | Ga0495627_008543 | |||
| 2752 | Ga0495592_0094071 | |||
| 2753 | Ga0495603_0009235 | |||
| 2754 | Ga0495603_0014289 | |||
| 2755 | Ga0495603_0027419 | |||
| 2756 | Ga0495629_0002245 | |||
| 2757 | Ga0495629_0032233 | |||
| 2758 | Ga0495629_0075214 | |||
| 2759 | Ga0495629_0122824 | |||
| 2760 | Ga0495641_0007399 | |||
| 2761 | Ga0495641_0009246 | |||
| 2762 | Ga0495651_0017471 | |||
| 2763 | Ga0495653_0004573 | |||
| 2764 | Ga0495653_0022314 | |||
| 2765 | Ga0495653_0066800 | |||
| 2766 | Ga0495653_0125370 | |||
| 2767 | Ga0495653_0158387 | |||
| 2768 | Ga0495650_0016688 | |||
| 2769 | Ga0495639_0003954 | |||
| 2770 | Ga0495639_0028677 | |||
| 2771 | Ga0495639_0062309 | |||
| 2772 | Ga0495662_0002349 | |||
| 2773 | Ga0495664_0008545 | |||
| 2774 | Ga0495664_0065266 | |||
| 2775 | Ga0495585_0017360 | |||
| 2776 | Ga0495594_0001342 | |||
| 2777 | Ga0495594_0045170 | |||
| 2778 | Ga0495607_0027985 | |||
| 2779 | Ga0495607_0070996 | |||
| 2780 | Ga0495583_0014310 | |||
| 2781 | Ga0495583_0069052 | |||
| 2782 | Ga0495606_0001359 | |||
| 2783 | Ga0495606_0021271 | |||
| 2784 | Ga0495606_0026257 | |||
| 2785 | Ga0495608_0012884 | |||
| 2786 | Ga0495608_0058655 | |||
| 2787 | Ga0495616_0004473 | |||
| 2788 | Ga0495620_0070009 | |||
| 2789 | Ga0495628_0055179 | |||
| 2790 | Ga0495628_0095450 | |||
| 2791 | Ga0495628_0225663 | |||
| 2792 | Ga0495630_0008465 | |||
| 2793 | Ga0495630_0018073 | |||
| 2794 | Ga0495631_0003096 | |||
| 2795 | Ga0495637_0015812 | |||
| 2796 | Ga0495648_0021577 | |||
| 2797 | Ga0495666_0003647 | |||
| 2798 | Ga0495652_0018073 | |||
| 2799 | Ga0495652_0086307 | |||
| 2800 | Ga0495654_0032188 | |||
| 2801 | Ga0495665_0010808 | |||
| 2802 | Ga0495665_0015610 | |||
| 2803 | Ga0495640_0045514 | |||
| 2804 | Ga0495640_0046303 | |||
| 2805 | Ga0495586_0008930 | |||
| 2806 | Ga0495587_0000907 | |||
| 2807 | Ga0495609_0007988 | |||
| 2808 | Ga0495597_0028324 | |||
| 2809 | Ga0495622_0006694 | |||
| 2810 | Ga0495667_0018746 | |||
| 2811 | Ga0495667_0038390 | |||
| 2812 | Ga0495668_0000519 | |||
| 2813 | Ga0495668_0064041 | |||
| 2814 | Ga0495634_0008927 | |||
| 2815 | Ga0495634_0057874 | |||
| 2816 | Ga0495634_0091681 | |||
| 2817 | Ga0495611_0030633 | |||
| 2818 | Ga0495625_0001636 | |||
| 2819 | Ga0495625_0044373 | |||
| 2820 | Ga0495635_0036284 | |||
| 2821 | Ga0495635_0055499 | |||
| 2822 | Ga0495635_0087728 | |||
| 2823 | Ga0495661_0007473 | |||
| 2824 | Ga0495588_0020166 | |||
| 2825 | Ga0495657_0053190 | |||
| 2826 | Ga0495657_0066629 | |||
| 2827 | Ga0495657_0080018 | |||
| 2828 | Ga0495599_0027522 | |||
| 2829 | Ga0495623_0012970 | |||
| 2830 | Ga0495623_0026038 | |||
| 2831 | Ga0495646_0002906 | |||
| 2832 | Ga0495646_0082841 | |||
| 2833 | Ga0495646_0177897 | |||
| 2834 | Ga0495658_0029170 | |||
| 2835 | Ga0495658_0074911 | |||
| 2836 | Ga0495669_0019460 | |||
| 2837 | Ga0495613_0003081 | |||
| 2838 | Ga0495613_0007268 | |||
| 2839 | Ga0495624_0000535 | |||
| 2840 | Ga0495624_0011184 | |||
| 2841 | Ga0495649_0036673 | |||
| 2842 | Ga0495589_0068244 | |||
| 2843 | Ga0495589_0068308 | |||
| 2844 | Ga0495600_0005439 | |||
| 2845 | Ga0495600_0021071 | |||
| 2846 | Ga0495600_0119154 | |||
| 2847 | Ga0495660_0055775 | |||
| 2848 | Ga0495581_0003107 | |||
| 2849 | Ga0495581_0068143 | |||
| 2850 | Ga0495604_0115329 | |||
| 2851 | Ga0495636_0021632 | |||
| 2852 | Ga0495674_0001362 | |||
| 2853 | Ga0495674_0055153 | |||
| 2854 | Ga0495674_0157529 | |||
| 2855 | Ga0495672_0024614 | |||
| 2856 | Ga0495676_0028819 | |||
| 2857 | Ga0495676_0058754 | |||
| 2858 | Ga0495680_0022892 | |||
| 2859 | Ga0495680_0034707 | |||
| 2860 | Ga0495680_0037991 | |||
| 2861 | Ga0495680_0042878 | |||
| 2862 | Ga0495687_001147 | |||
| 2863 | Ga0495687_003306 | |||
| 2864 | Ga0495687_024126 | |||
| 2865 | Ga0495675_0034556 | |||
| 2866 | Ga0495685_008578 | |||
| 2867 | Ga0495684_0000973 | |||
| 2868 | Ga0495684_0023120 | |||
| 2869 | Ga0495684_0042296 | |||
| 2870 | Ga0495684_0047712 | |||
| 2871 | Ga0495684_0106123 | |||
| 2872 | Ga0495686_0000637 | |||
| 2873 | Ga0495686_0042822 | |||
| 2874 | Ga0495593_0013292 | |||
| 2875 | Ga0495614_0017285 | |||
| 2876 | Ga0495614_0082573 | |||
| 2877 | Ga0495615_0005916 | |||
| 2878 | Ga0495626_0001401 | |||
| 2879 | Ga0495626_0007219 | |||
| 2880 | Ga0496100_0000067 | |||
| 2881 | Ga0496100_0000461 | |||
| 2882 | Ga0496100_0002943 | |||
| 2883 | Ga0496100_0015097 | |||
| 2884 | Ga0496100_0065715 | |||
| 2885 | Ga0496100_0147500 | |||
| 2886 | Ga0496100_0173793 | |||
| 2887 | Ga0496101_0000099 | |||
| 2888 | Ga0496101_0001394 | |||
| 2889 | Ga0496101_0045811 | |||
| 2890 | Ga0496101_0117477 | |||
| 2891 | Ga0496102_0000013 | |||
| 2892 | Ga0496102_0000048 | |||
| 2893 | Ga0496102_0000175 | |||
| 2894 | Ga0496102_0000390 | |||
| 2895 | Ga0496102_0003032 | |||
| 2896 | Ga0496102_0011278 | |||
| 2897 | Ga0496102_0027616 | |||
| 2898 | Ga0496102_0046711 | |||
| 2899 | Ga0496102_0064426 | |||
| 2900 | Ga0496102_0073478 | |||
| 2901 | Ga0496102_0081793 | |||
| 2902 | Ga0496102_0089145 | |||
| 2903 | Ga0496102_0127161 | |||
| 2904 | Ga0496103_0000018 | |||
| 2905 | Ga0496103_0000039 | |||
| 2906 | Ga0496103_0000116 | |||
| 2907 | Ga0496103_0011446 | |||
| 2908 | Ga0496104_0007024 | |||
| 2909 | Ga0496104_0040322 | |||
| 2910 | Ga0496104_0051650 | |||
| 2911 | Ga0496104_0133115 | |||
| 2912 | Ga0496105_0012606 | |||
| 2913 | Ga0496105_0020163 | |||
| 2914 | Ga0496105_0020716 | |||
| 2915 | Ga0496105_0024253 | |||
| 2916 | Ga0496105_0092674 | |||
| 2917 | Ga0496105_0112736 | |||
| 2918 | Ga0496105_0134693 | |||
| 2919 | Ga0496106_0000424 | |||
| 2920 | Ga0496106_0001155 | |||
| 2921 | Ga0496106_0002018 | |||
| 2922 | Ga0496106_0008649 | |||
| 2923 | Ga0496106_0019812 | |||
| 2924 | Ga0496106_0020907 | |||
| 2925 | Ga0496106_0101504 | |||
| 2926 | Ga0496107_0000079 | |||
| 2927 | Ga0496107_0000254 | |||
| 2928 | Ga0496107_0026359 | |||
| 2929 | Ga0496107_0027103 | |||
| 2930 | Ga0496108_0000035 | |||
| 2931 | Ga0496108_0000959 | |||
| 2932 | Ga0496108_0003817 | |||
| 2933 | Ga0496108_0005688 | |||
| 2934 | Ga0496108_0057509 | |||
| 2935 | Ga0496108_0065466 | |||
| 2936 | Ga0496108_0067004 | |||
| 2937 | Ga0496108_0177067 | |||
| 2938 | Ga0496109_0000159 | |||
| 2939 | Ga0496109_0004668 | |||
| 2940 | Ga0496109_0008285 | |||
| 2941 | Ga0496109_0012040 | |||
| 2942 | Ga0496109_0015418 | |||
| 2943 | Ga0496109_0054048 | |||
| 2944 | Ga0496109_0069929 | |||
| 2945 | Ga0496109_0075199 | |||
| 2946 | Ga0496109_0076274 | |||
| 2947 | Ga0496109_0118222 | |||
| 2948 | Ga0496110_0000220 | |||
| 2949 | Ga0496110_0004660 | |||
| 2950 | Ga0496110_0008200 | |||
| 2951 | Ga0496110_0011646 | |||
| 2952 | Ga0496110_0014056 | |||
| 2953 | Ga0496110_0026145 | |||
| 2954 | Ga0496110_0027265 | |||
| 2955 | Ga0496110_0074940 | |||
| 2956 | Ga0496110_0080252 | |||
| 2957 | Ga0496111_0000527 | |||
| 2958 | Ga0496111_0000575 | |||
| 2959 | Ga0496111_0000817 | |||
| 2960 | Ga0496111_0003344 | |||
| 2961 | Ga0496111_0028049 | |||
| 2962 | Ga0496111_0037721 | |||
| 2963 | Ga0496112_0004865 | |||
| 2964 | Ga0496112_0009854 | |||
| 2965 | Ga0496112_0061906 | |||
| 2966 | Ga0496112_0068854 | |||
| 2967 | Ga0496112_0130578 | |||
| 2968 | Ga0496112_0131147 | |||
| 2969 | Ga0496112_0194690 | |||
| 2970 | Ga0496112_0249612 | |||
| 2971 | Ga0496113_0004876 | |||
| 2972 | Ga0496113_0049946 | |||
| 2973 | Ga0496113_0092889 | |||
| 2974 | Ga0496113_0115480 | |||
| 2975 | Ga0496114_0000116 | |||
| 2976 | Ga0496114_0000286 | |||
| 2977 | Ga0496114_0011013 | |||
| 2978 | Ga0496114_0027001 | |||
| 2979 | Ga0496114_0036877 | |||
| 2980 | Ga0496114_0040866 | |||
| 2981 | Ga0496114_0050348 | |||
| 2982 | Ga0496114_0072131 | |||
| 2983 | Ga0496114_0140787 | |||
| 2984 | Ga0496115_0002425 | |||
| 2985 | Ga0496115_0002960 | |||
| 2986 | Ga0496115_0049446 | |||
| 2987 | Ga0496115_0060345 | |||
| 2988 | Ga0496115_0104371 | |||
| 2989 | Ga0496116_0000173 | |||
| 2990 | Ga0496116_0000182 | |||
| 2991 | Ga0496116_0001408 | |||
| 2992 | Ga0496116_0002098 | |||
| 2993 | Ga0496117_0000144 | |||
| 2994 | Ga0496117_0000278 | |||
| 2995 | Ga0496117_0001155 | |||
| 2996 | Ga0496117_0005163 | |||
| 2997 | Ga0496117_0041649 | |||
| 2998 | Ga0496117_0072589 | |||
| 2999 | Ga0496118_0000165 | |||
| 3000 | Ga0496118_0000466 | |||
| 3001 | Ga0496118_0019168 | |||
| 3002 | Ga0496118_0022954 | |||
| 3003 | Ga0496118_0094561 | |||
| 3004 | Ga0496119_0000449 | |||
| 3005 | Ga0496119_0001560 | |||
| 3006 | Ga0496119_0002247 | |||
| 3007 | Ga0496119_0003552 | |||
| 3008 | Ga0496119_0004224 | |||
| 3009 | Ga0496119_0009347 | |||
| 3010 | Ga0496119_0015383 | |||
| 3011 | Ga0496119_0051687 | |||
| 3012 | Ga0496120_0000663 | |||
| 3013 | Ga0496120_0002291 | |||
| 3014 | Ga0496120_0012354 | |||
| 3015 | Ga0496120_0029616 | |||
| 3016 | Ga0496121_0000016 | |||
| 3017 | Ga0496121_0009172 | |||
| 3018 | Ga0496121_0015653 | |||
| 3019 | Ga0496121_0016297 | |||
| 3020 | Ga0496121_0112226 | |||
| 3021 | Ga0496122_0000284 | |||
| 3022 | Ga0496122_0017733 | |||
| 3023 | Ga0496122_0018799 | |||
| 3024 | Ga0496123_0008217 | |||
| 3025 | Ga0496123_0028056 | |||
| 3026 | Ga0496124_0000015 | |||
| 3027 | Ga0496124_0005946 | |||
| 3028 | Ga0496125_0000021 | |||
| 3029 | Ga0496125_0007725 | |||
| 3030 | Ga0496125_0032094 | |||
| 3031 | Ga0496126_0000015 | |||
| 3032 | Ga0496126_0000039 | |||
| 3033 | Ga0496126_0000075 | |||
| 3034 | Ga0496126_0000677 | |||
| 3035 | Ga0496126_0000807 | |||
| 3036 | Ga0496126_0003990 | |||
| 3037 | Ga0496126_0008063 | |||
| 3038 | Ga0496126_0041523 | |||
| 3039 | Ga0496126_0045712 | |||
| 3040 | Ga0496126_0067728 | |||
| 3041 | Ga0496126_0071524 | |||
| 3042 | Ga0495682_0015944 | |||
| 3043 | Ga0501031_0000144 | |||
| 3044 | Ga0501031_0008167 | |||
| 3045 | Ga0501032_0002470 | |||
| 3046 | Ga0501032_0007497 | |||
| 3047 | Ga0501032_0011513 | |||
| 3048 | Ga0501032_0039210 | |||
| 3049 | Ga0501033_0002503 | |||
| 3050 | Ga0501034_0001101 | |||
| 3051 | Ga0501034_0007303 | |||
| 3052 | Ga0501034_0059693 | |||
| 3053 | Ga0501034_0091706 | |||
| 3054 | Ga0501034_0290035 | |||
| 3055 | Ga0501036_0003893 | |||
| 3056 | Ga0501036_0007139 | |||
| 3057 | Ga0501037_0000796 | |||
| 3058 | Ga0501037_0003517 | |||
| 3059 | Ga0501037_0003564 | |||
| 3060 | Ga0501037_0087309 | |||
| 3061 | Ga0501038_0001310 | |||
| 3062 | Ga0501038_0002811 | |||
| 3063 | Ga0501038_0003820 | |||
| 3064 | Ga0501038_0008860 | |||
| 3065 | Ga0501039_0001985 | |||
| 3066 | Ga0501039_0004366 | |||
| 3067 | Ga0501039_0081386 | |||
| 3068 | Ga0501040_0008828 | |||
| 3069 | Ga0501041_0018104 | |||
| 3070 | Ga0501042_0118887 | |||
| 3071 | Ga0501043_0000990 | |||
| 3072 | Ga0501043_0006893 | |||
| 3073 | Ga0501043_0038202 | |||
| 3074 | Ga0501043_0113935 | |||
| 3075 | Ga0501046_0000427 | |||
| 3076 | Ga0501046_0002722 | |||
| 3077 | Ga0501046_0077417 | |||
| 3078 | Ga0501047_0002484 | |||
| 3079 | Ga0501047_0034364 | |||
| 3080 | Ga0501047_0060268 | |||
| 3081 | Ga0501047_0071012 | |||
| 3082 | Ga0501047_0076929 | |||
| 3083 | Ga0501048_0000026 | |||
| 3084 | Ga0501048_0002590 | |||
| 3085 | Ga0501048_0004211 | |||
| 3086 | Ga0501067_0010708 | |||
| 3087 | Ga0501067_0056142 | |||
| 3088 | Ga0501067_0067902 | |||
| 3089 | Ga0501068_0008200 | |||
| 3090 | Ga0501069_0000223 | |||
| 3091 | Ga0501069_0000515 | |||
| 3092 | Ga0501070_0000766 | |||
| 3093 | Ga0501070_0001165 | |||
| 3094 | Ga0501070_0001589 | |||
| 3095 | Ga0501070_0001682 | |||
| 3096 | Ga0501070_0002601 | |||
| 3097 | Ga0501070_0003370 | |||
| 3098 | Ga0501070_0003504 | |||
| 3099 | Ga0501070_0038098 | |||
| 3100 | Ga0501071_0013695 | |||
| 3101 | Ga0501072_0003695 | |||
| 3102 | Ga0501074_0008363 | |||
| 3103 | Ga0501074_0014120 | |||
| 3104 | Ga0501076_0073923 | |||
| 3105 | Ga0501079_0000093 | |||
| 3106 | Ga0501080_0000266 | |||
| 3107 | Ga0501080_0003067 | |||
| 3108 | Ga0501080_0009512 | |||
| 3109 | Ga0501080_0010586 | |||
| 3110 | Ga0501080_0016463 | |||
| 3111 | Ga0501080_0170999 | |||
| 3112 | Ga0501083_0030883 | |||
| 3113 | Ga0501035_0001097 | |||
| 3114 | Ga0501035_0001386 | |||
| 3115 | Ga0501035_0016730 | |||
| 3116 | Ga0501035_0021620 | |||
| 3117 | Ga0501035_0044132 | |||
| 3118 | Ga0501035_0177973 | |||
| 3119 | Ga0501044_0001367 | |||
| 3120 | Ga0501044_0004810 | |||
| 3121 | Ga0501044_0008934 | |||
| 3122 | Ga0501044_0010160 | |||
| 3123 | Ga0501044_0100053 | |||
| 3124 | Ga0501045_0035134 | |||
| 3125 | Ga0501045_0077109 | |||
| 3126 | Ga0501045_0128149 | |||
| 3127 | nmdc:mga03683_3089_c1 | |||
| 3128 | nmdc:mga03n38_78836_c1 | |||
| 3129 | nmdc:mga00v17_152149_c1 | |||
| 3130 | nmdc:mga00v17_2947_c1 | |||
| 3131 | nmdc:mga00v17_48988_c1 | |||
| 3132 | nmdc:mga00v17_5845_c1 | |||
| 3133 | nmdc:mga0yw44_147755_c1 | |||
| 3134 | nmdc:mga0yw44_172183_c1 | |||
| 3135 | nmdc:mga0yw44_25015_c1 | |||
| 3136 | nmdc:mga0yw44_66507_c1 | |||
| 3137 | nmdc:mga0yw44_70038_c1 | |||
| 3138 | nmdc:mga07m45_101866_c1 | |||
| 3139 | nmdc:mga07m45_34034_c1 | |||
| 3140 | nmdc:mga07m45_36181_c1 | |||
| 3141 | nmdc:mga07m45_62048_c1 | |||
| 3142 | nmdc:mga05p37_110473_c1 | |||
| 3143 | nmdc:mga05p37_12466_c1 | |||
| 3144 | nmdc:mga05p37_160331_c1 | |||
| 3145 | nmdc:mga05p37_188068_c1 | |||
| 3146 | nmdc:mga05p37_2735_c1 | |||
| 3147 | nmdc:mga05p37_43393_c1 | |||
| 3148 | nmdc:mga05p37_610624_c1 | |||
| 3149 | nmdc:mga09592_115355_c1 | |||
| 3150 | nmdc:mga09592_120387_c1 | |||
| 3151 | nmdc:mga09592_138562_c1 | |||
| 3152 | nmdc:mga09592_16095_c1 | |||
| 3153 | nmdc:mga09592_46742_c1 | |||
| 3154 | nmdc:mga09592_80423_c1 | |||
| 3155 | nmdc:mga09592_87_c3 | |||
| 3156 | nmdc:mga0qj67_509_c1 | |||
| 3157 | nmdc:mga06r32_162003_c1 | |||
| 3158 | nmdc:mga06r32_172091_c1 | |||
| 3159 | nmdc:mga06r32_1913_c1 | |||
| 3160 | nmdc:mga06r32_692_c3 | |||
| 3161 | nmdc:mga08y16_28599_c1 | |||
| 3162 | nmdc:mga08y16_39956_c1 | |||
| 3163 | nmdc:mga08y16_41095_c1 | |||
| 3164 | nmdc:mga08x19_52346_c1 | |||
| 3165 | nmdc:mga08x19_5990_c1 | |||
| 3166 | nmdc:mga0a205_12444_c1 | |||
| 3167 | nmdc:mga0sz30_21727_c1 | |||
| 3168 | nmdc:mga0sz30_5944_c1 | |||
| 3169 | Ga0495601_0000602 | |||
| 3170 | Ga0495601_0010705 | |||
| 3171 | Ga0495612_0000929 | |||
| 3172 | Ga0500635_0021790 | |||
| 3173 | Ga0495619_0005371 | |||
| 3174 | Ga0495619_0054104 | |||
| 3175 | Ga0500643_003109 | |||
| 3176 | Ga0500646_0000357 | |||
| 3177 | Ga0500646_0029241 | |||
| 3178 | Ga0500583_0003525 | |||
| 3179 | Ga0500583_0071248 | |||
| 3180 | Ga0500559_0004201 | |||
| 3181 | Ga0500568_0000706 | |||
| 3182 | Ga0500573_0088921 | |||
| 3183 | Ga0500577_0074856 | |||
| 3184 | Ga0500588_0004867 | |||
| 3185 | Ga0500616_0009263 | |||
| 3186 | Ga0500627_0006875 | |||
| 3187 | Ga0500645_000032 | |||
| 3188 | Ga0501084_0000239 | |||
| 3189 | Ga0501084_0035629 | |||
| 3190 | Ga0466962_0000056 | |||
| 3191 | Ga0466962_0006087 | |||
| 3192 | Ga0466962_0009800 | |||
| 3193 | Ga0466962_0018078 | |||
| 3194 | Ga0466962_0018089 | |||
| 3195 | Ga0466962_0019198 | |||
| 3196 | Ga0530510_0051283 | |||
| 3197 | 8047719884 | |||
| 3198 | 2501945555 | |||
| 3199 | 2506868573 | |||
| 3200 | 2508670694 | |||
| 3201 | 2515497893 | |||
| 3202 | 2515720789 | |||
| 3203 | 2515759014 | |||
| 3204 | 2515852236 | |||
| 3205 | 2516085727 | |||
| 3206 | 2516090690 | |||
| 3207 | 2517762484 | |||
| 3208 | 2528206638 | |||
| 3209 | 2528212030 | |||
| 3210 | 2546946947 | |||
| 3211 | 2548696252 | |||
| 3212 | 2552108222 | |||
| 3213 | 2558912601 | |||
| 3214 | 2559428650 | |||
| 3215 | 2579747544 | |||
| 3216 | 2579854552 | |||
| 3217 | 2583148894 | |||
| 3218 | 2585299412 | |||
| 3219 | 2585319173 | |||
| 3220 | 2586064689 | |||
| 3221 | 2619853809 | |||
| 3222 | 2620349509 | |||
| 3223 | 2623497715 | |||
| 3224 | 2623586153 | |||
| 3225 | 2626634845 | |||
| 3226 | 2643902794 | |||
| 3227 | 2644017233 | |||
| 3228 | 2644173806 | |||
| 3229 | 2644404697 | |||
| 3230 | 2644439217 | |||
| 3231 | 2644489440 | |||
| 3232 | 2644516049 | |||
| 3233 | 2644633404 | |||
| 3234 | 2644636244 | |||
| 3235 | 2671835795 | |||
| 3236 | 2676201272 | |||
| 3237 | 2676474608 | |||
| 3238 | 2676484056 | |||
| 3239 | 2686539648 | |||
| 3240 | 2686543539 | |||
| 3241 | 2689960499 | |||
| 3242 | 2689992300 | |||
| 3243 | 2710602608 | |||
| 3244 | 2738891357 | |||
| 3245 | 2739205419 | |||
| 3246 | 2739239476 | |||
| 3247 | 2739362096 | |||
| 3248 | 2753037140 | |||
| 3249 | 2753069843 | |||
| 3250 | 2753271021 | |||
| 3251 | 2753325009 | |||
| 3252 | 2768643398 | |||
| 3253 | 2772641348 | |||
| 3254 | 2774845848 | |||
| 3255 | 2774853951 | |||
| 3256 | 2774867069 | |||
| 3257 | 2774902955 | |||
| 3258 | 2776371566 | |||
| 3259 | 2791914400 | |||
| 3260 | 2795781345 | |||
| 3261 | 2795791688 | |||
| 3262 | 2808843222 | |||
| 3263 | 2808912807 | |||
| 3264 | 2808921570 | |||
| 3265 | 2809586083 | |||
| 3266 | 2811845203 | |||
| 3267 | 2812356826 | |||
| 3268 | 2816505690 | |||
| 3269 | 2819741114 | |||
| 3270 | 2827632918 | |||
| 3271 | 2831938277 | |||
| 3272 | 2832009697 | |||
| 3273 | 2842138788 | |||
| 3274 | 2855676681 | |||
| 3275 | 2855683271 | |||
| 3276 | 2855685019 | |||
| 3277 | 2856746188 | |||
| 3278 | 2856860054 | |||
| 3279 | 2857295018 | |||
| 3280 | 2858852275 | |||
| 3281 | 2858868911 | |||
| 3282 | 2858888208 | |||
| 3283 | 2858890386 | |||
| 3284 | 2858898961 | |||
| 3285 | 2858905233 | |||
| 3286 | 2861525285 | |||
| 3287 | 2862286751 | |||
| 3288 | 2862292202 | |||
| 3289 | 2862387248 | |||
| 3290 | 2862710215 | |||
| 3291 | 2863070217 | |||
| 3292 | 2863411672 | |||
| 3293 | 2866068993 | |||
| 3294 | 2866555677 | |||
| 3295 | 2866617239 | |||
| 3296 | 2867304310 | |||
| 3297 | 2867313640 | |||
| 3298 | 2867322535 | |||
| 3299 | 2867351643 | |||
| 3300 | 2867373116 | |||
| 3301 | 2867479151 | |||
| 3302 | 2867509696 | |||
| 3303 | 2869052138 | |||
| 3304 | 2869061989 | |||
| 3305 | 2869073967 | |||
| 3306 | 2870727646 | |||
| 3307 | 2870788453 | |||
| 3308 | 2873154783 | |||
| 3309 | 2875395928 | |||
| 3310 | 2880494103 | |||
| 3311 | 2880498227 | |||
| 3312 | 2883826516 | |||
| 3313 | 2884694345 | |||
| 3314 | 2887483547 | |||
| 3315 | 2889301895 | |||
| 3316 | 2891331593 | |||
| 3317 | 2891402637 | |||
| 3318 | 2891554964 | |||
| 3319 | 2891562734 | |||
| 3320 | 2895435587 | |||
| 3321 | 2895444240 | |||
| 3322 | 2895884875 | |||
| 3323 | 2899364797 | |||
| 3324 | 2899370663 | |||
| 3325 | 2899373771 | |||
| 3326 | 2902587479 | |||
| 3327 | 2902799087 | |||
| 3328 | 2902804385 | |||
| 3329 | 2902812382 | |||
| 3330 | 2902842205 | |||
| 3331 | 2912718568 | |||
| 3332 | 2912730885 | |||
| 3333 | 2915362918 | |||
| 3334 | 2915773507 | |||
| 3335 | 2917741264 | |||
| 3336 | 2919713859 | |||
| 3337 | 2928144866 | |||
| 3338 | 2929214389 | |||
| 3339 | 2929220268 | |||
| 3340 | 2929226803 | |||
| 3341 | 2932400111 | |||
| 3342 | 2939586276 | |||
| 3343 | 2939747105 | |||
| 3344 | 2946048707 | |||
| 3345 | 2946069045 | |||
| 3346 | 2956941385 | |||
| 3347 | 2974319899 | |||
| 3348 | 2990091294 | |||
| 3349 | 2996226236 | |||
| 3350 | 3001120186 | |||
| 3351 | 3003000808 | |||
| 3352 | 3006427226 | |||
| 3353 | 3006499684 | |||
| 3354 | 637877870 | |||
| 3355 | 649810539 | |||
| 3356 | 8001789401 | |||
| 3357 | 8002781598 | |||
| 3358 | 8002789843 | |||
| 3359 | 8003316403 | |||
| 3360 | 8003834810 | |||
| 3361 | 8003860826 | |||
| 3362 | 8003875000 | |||
| 3363 | 8008490388 | |||
| 3364 | 8008566431 | |||
| 3365 | 8008577896 | |||
| 3366 | 8025480867 | |||
| 3367 | 8025529690 | |||
| 3368 | 8033686785 | |||
| 3369 | 8053948518 | |||
| 3370 | 8054473473 | |||
| 3371 | 8054707202 | |||
| 3372 | 8054728157 | |||
| 3373 | 8054736481 | |||
| 3374 | 8054920573 | |||
| 3375 | 8054922604 | |||
| 3376 | 8055160552 | |||
| 3377 | 8055415592 | |||
| 3378 | 8056060064 | |||
| 3379 | 8056212431 | |||
| 3380 | 8056669307 | |||
| 3381 | 8056833865 | |||
| 3382 | 8057574016 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8e9h-assembly1.cif.gz_D | mycobacterial respiratory complex i, fully-inserted quinone | 0.9709 | 40 | 440 |
| 8e73-assembly1.cif.gz_S2 | vigna radiata supercomplex i+iii2 (full bridge) | 0.968 | 56 | 440 |
| 7qsn-assembly1.cif.gz_D | bovine complex i in lipid nanodisc, deactive-apo | 0.9654 | 61 | 440 |
| 7ard-assembly1.cif.gz_D | cryo-em structure of polytomella complex-i (complete composition) | 0.9647 | 44 | 440 |
| 8bq6-assembly1.cif.gz_D | cryo-em structure of the arabidopsis thaliana i+iii2 supercomplex (complete conformation 2 composition) | 0.9634 | 42 | 440 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WJH5_38_440_1.10.645.10 | Mainly Alpha;Orthogonal Bundle;Cytochrome-c3 Hydrogenase; chain B;Cytochrome-c3 Hydrogenase, chain B | 0.9708 | 40 | 440 | 1.10.645.10 |
| af_P9WJH5_38_440_1.10.645.10 | Mainly Alpha;Orthogonal Bundle;Cytochrome-c3 Hydrogenase; chain B;Cytochrome-c3 Hydrogenase, chain B | 0.9637 | 40 | 440 | 1.10.645.10 |
| af_P33599_211_596_1.10.645.10 | Mainly Alpha;Orthogonal Bundle;Cytochrome-c3 Hydrogenase; chain B;Cytochrome-c3 Hydrogenase, chain B | 0.9538 | 42 | 440 | 1.10.645.10 |
| af_P33599_211_596_1.10.645.10 | Mainly Alpha;Orthogonal Bundle;Cytochrome-c3 Hydrogenase; chain B;Cytochrome-c3 Hydrogenase, chain B | 0.9466 | 42 | 440 | 1.10.645.10 |
| af_P16431_180_537_1.10.645.10 | Mainly Alpha;Orthogonal Bundle;Cytochrome-c3 Hydrogenase; chain B;Cytochrome-c3 Hydrogenase, chain B | 0.9465 | 42 | 431 | 1.10.645.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6G3WKU9-F1-model_v4 | NADH dehydrogenase subunit D | 0.9889 | 157 | 325 |
GO:0016651
GO:0048038 GO:0051287 |
| AF-A0A5K1HSC0-F1-model_v4 | NADH-quinone oxidoreductase subunit D domain-containing protein | 0.9881 | 195 | 319 |
GO:0009535
GO:0016651 GO:0048038 GO:0051287 |
| AF-A0A7V9PQV1-F1-model_v4 | NADH-quinone oxidoreductase subunit D (EC 1.6.5.11) | 0.9854 | 58 | 440 |
GO:0016651
GO:0048038 GO:0051287 |
| AF-A0A5Q0UUT2-F1-model_v4 | NADH-plastoquinone oxidoreductase subunit 7 | 0.9853 | 106 | 321 |
GO:0009535
GO:0016651 GO:0048038 GO:0051287 |
| AF-A0A4R2U8P3-F1-model_v4 | deleted | 0.9851 | 86 | 440 |
|