F495376
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1696 | 744 | 3392 | 294 |
Family's Representative Sequence
| Representative Sequence | 3300021384|Ga0213876_10013947|Ga0213876_100139471 |
| Length | 333 |
| Sequence | MSSIATDRADPDAAIGAALVQAASVTADTVLPPEPATTFTPPPRPTAPRQSGLAATLSHIRYVLSENLVTGFAFALFLLIVLAAVFGPALVPYDPLASDTVAALKPPSAQHWFGTDQLGRDIFSRVVVATRLDFGIAVASVVLVFLMGGLAGVAAGFYGGWTDRIVGRLADTIMAFPLFVLAMGIVAALGNTVQNIVLATAIVNFPLYARVARAEANVRREAGFVEAARLSGNSEFRIVSFQVLPNVFPILVVQMSLTMGYAILNAAGLSFIGLGVRPPTAEWGIMVAEGAAFIVSGEWWIALFPGLALMIAVFCFNLLGDGVRDIVDPRRRT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 2 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 3 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 4 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 5 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 6 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 7 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 8 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 9 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 10 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 11 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 12 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 13 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 14 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 15 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 16 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 17 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 18 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 19 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 20 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 21 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 22 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 23 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 24 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 25 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 26 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 27 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 34 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 45 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 60 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 67 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 68 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 71 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 73 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 74 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 75 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 77 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 78 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 79 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 80 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 81 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 82 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 83 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 84 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 85 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 86 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 87 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 88 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 89 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 90 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 92 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 93 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 94 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 95 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 96 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 97 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 98 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 99 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 100 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 101 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 102 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 104 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 105 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 106 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 107 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 108 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 109 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 110 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 111 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 113 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 114 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 115 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 116 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 128 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 138 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 140 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 141 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 142 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 143 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 144 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 145 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 146 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 147 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 152 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 154 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 156 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 221 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 222 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 223 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 224 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 227 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 228 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 229 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 233 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 234 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 235 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 236 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 237 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 238 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 239 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 240 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 241 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 242 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 243 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 244 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 245 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 246 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 247 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 248 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 249 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 250 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 251 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 252 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 253 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 254 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 255 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 256 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 257 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 258 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 259 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 260 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 261 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 262 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 263 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 264 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 265 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 266 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 267 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 268 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 269 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 270 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 271 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 272 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 273 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 274 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 275 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 276 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 277 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 278 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 279 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 280 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 281 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 282 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 283 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 284 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 285 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 286 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 287 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 288 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 289 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 290 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 291 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 292 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 293 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 294 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 295 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 296 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 297 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 298 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 299 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 300 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 301 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 302 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 303 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 304 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 305 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 306 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 307 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 308 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 309 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 310 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 311 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 312 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 313 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 314 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 315 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 316 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 317 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 318 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 319 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 401 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 402 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 403 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 404 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 405 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 406 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 407 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 408 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 409 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 410 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 411 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 412 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 413 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 414 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 415 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 416 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 417 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 418 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 419 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 420 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 421 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 422 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 423 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 424 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 425 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 426 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 427 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 429 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 430 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 431 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 432 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 433 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 434 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 435 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 436 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 437 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 438 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 439 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 440 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 441 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 442 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 443 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 444 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 445 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 446 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 447 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 448 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 449 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 450 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 453 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 455 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 456 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 457 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 458 | 3300053089 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere | Metagenome | Endosphere |
| 459 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 460 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 461 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 462 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 463 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 464 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 465 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 466 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 467 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 468 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 469 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 470 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 471 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 472 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 473 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 474 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 475 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 476 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 477 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 478 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 479 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 480 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 481 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 482 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 483 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 484 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 485 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 486 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 487 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 488 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 489 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 490 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 491 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 492 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 493 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 494 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 495 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 496 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 497 | 3300053723 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere | Metagenome | Endosphere |
| 498 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 499 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 500 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 501 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 502 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 503 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 504 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 505 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 506 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 507 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 508 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 509 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 510 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 511 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 512 | 2513237087 | Azorhizobium doebereinerae UFLA1-100 | Isolate | Nodule |
| 513 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 514 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 515 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 516 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 517 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 518 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 519 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 520 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 521 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 522 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 523 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 524 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 525 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 526 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 527 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 528 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 529 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 530 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 531 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 532 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 533 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 534 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 535 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 536 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 537 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 538 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 539 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 540 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 541 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 542 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 543 | 2791355199 | |||
| 544 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 545 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 546 | 2818991467 | Bosea vestrisii 3192 | Isolate | Unclassified |
| 547 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 548 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 549 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 550 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 551 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 552 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 553 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 554 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 555 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 556 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 557 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 558 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 559 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 560 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 561 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 562 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 563 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 564 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 565 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 566 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 567 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 568 | 2841911363 | Bosea caraganae RCAM04685 | Isolate | Nodule |
| 569 | 2841917233 | Bosea caraganae RCAM04680 | Isolate | Nodule |
| 570 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 571 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 572 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 573 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 574 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 575 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 576 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 577 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 578 | 2842694124 | Methylopila sp. R-72369 | Isolate | Unclassified |
| 579 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 580 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 581 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 582 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 583 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 584 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 585 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 586 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 587 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 588 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 589 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 590 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 591 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 592 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 593 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 594 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 595 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 596 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 597 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 598 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 599 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 600 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 601 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 602 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 603 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 604 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 605 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 606 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 607 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 608 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 609 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 610 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 611 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 612 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 613 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 614 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 615 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 616 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 617 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 618 | 2904699407 | |||
| 619 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 620 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 621 | 2906610324 | |||
| 622 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 623 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 624 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 625 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 626 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 627 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 628 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 629 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 630 | 2922368715 | |||
| 631 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 632 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 633 | 2922425934 | |||
| 634 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 635 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 636 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 637 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 638 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 639 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 640 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 641 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 642 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 643 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 644 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 645 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 646 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 647 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 648 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 649 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 650 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 651 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 652 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 653 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 654 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 655 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 656 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 657 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 658 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 659 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 660 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 661 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 662 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 663 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 664 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 665 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 666 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 667 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 668 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 669 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 670 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 671 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 672 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 673 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 674 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 675 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 676 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 677 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 678 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 679 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 680 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 681 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 682 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 683 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 684 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 685 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 686 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 687 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 688 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 689 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 690 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 691 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 692 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 693 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 694 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 695 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 696 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 697 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 698 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 699 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 700 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 701 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 702 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 703 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 704 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 705 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 706 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 707 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 708 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 709 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 710 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 711 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 712 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 713 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 714 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 715 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 716 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 717 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 718 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 719 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 720 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 721 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 722 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 723 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 724 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 725 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 726 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 727 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 728 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 729 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 730 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 731 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 732 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 733 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 734 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 735 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 736 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 737 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 738 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 739 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 740 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 741 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 742 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 743 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 744 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 86.22 |
| Metatranscriptomes | 0.06 |
| Isolates | 13.72 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 14.09 |
| Nodule | 10.55 |
| Rhizoplane | 7.9 |
| Rhizosphere | 57.67 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0213876_10013947 | 3300021384 | Bacteria | 4259 |
| 2 | JGI24752J21851_1010227 | 3300001976 | Bacteria | 1225 |
| 3 | JGI24746J21847_1008694 | 3300001977 | Bacteria | 1529 |
| 4 | JGI24740J21852_10005522 | 3300001979 | Bacteria | 5334 |
| 5 | JGI24739J22299_10013653 | 3300001989 | Bacteria | 2961 |
| 6 | JGI24739J22299_10039948 | 3300001989 | Bacteria | 1568 |
| 7 | JGI24737J22298_10000407 | 3300001990 | Bacteria | 14732 |
| 8 | JGI24737J22298_10046503 | 3300001990 | Bacteria | 1324 |
| 9 | JGI24735J21928_10020499 | 3300002067 | Bacteria | 2024 |
| 10 | JGI24750J21931_1001542 | 3300002070 | Bacteria | 2837 |
| 11 | JGI24745J21846_1004626 | 3300002073 | Bacteria | 1479 |
| 12 | JGI24749J21850_1013662 | 3300002076 | Bacteria | 1140 |
| 13 | JGI24034J26672_10012021 | 3300002239 | Bacteria | 1301 |
| 14 | JGI24742J22300_10006282 | 3300002244 | Bacteria | 1962 |
| 15 | JGI25151J46595_10000021 | 3300003187 | Bacteria | 227826 |
| 16 | JGI25406J46586_10000471 | 3300003203 | Bacteria | 18790 |
| 17 | JGI25406J46586_10012262 | 3300003203 | Bacteria | 3727 |
| 18 | JGI25406J46586_10032321 | 3300003203 | Bacteria | 1945 |
| 19 | JGI25153J46596_10002109 | 3300003215 | Bacteria | 11645 |
| 20 | JGI25153J46596_10004526 | 3300003215 | Bacteria | 7477 |
| 21 | JGI25153J46596_10006239 | 3300003215 | Bacteria | 6098 |
| 22 | rootH2_10041169 | 3300003320 | Bacteria | 13340 |
| 23 | rootH2_10310578 | 3300003320 | Bacteria | 1763 |
| 24 | rootH1_10181803 | 3300003323 | Bacteria | 2859 |
| 25 | JGI25160J50197_1007366 | 3300003354 | Bacteria | 4316 |
| 26 | JGI25160J50197_1009546 | 3300003354 | Bacteria | 3587 |
| 27 | JGI25160J50197_1020686 | 3300003354 | Bacteria | 1977 |
| 28 | JGI25404J52841_10006128 | 3300003659 | Bacteria | 2505 |
| 29 | JGI25404J52841_10007547 | 3300003659 | Bacteria | 2302 |
| 30 | JGI25404J52841_10008577 | 3300003659 | Bacteria | 2179 |
| 31 | Ga0055542_1003668 | 3300003762 | Bacteria | 4036 |
| 32 | Ga0055526_1004359 | 3300003771 | Bacteria | 8546 |
| 33 | Ga0055524_1000035 | 3300003775 | Bacteria | 174636 |
| 34 | Ga0055531_10003847 | 3300003794 | Bacteria | 9398 |
| 35 | Ga0055543_1005535 | 3300004625 | Bacteria | 3205 |
| 36 | Ga0065165_1001304 | 3300005262 | Bacteria | 27869 |
| 37 | Ga0065165_1001405 | 3300005262 | Bacteria | 26282 |
| 38 | Ga0065165_1002635 | 3300005262 | Bacteria | 14588 |
| 39 | Ga0065165_1026191 | 3300005262 | Bacteria | 1922 |
| 40 | Ga0065165_1057318 | 3300005262 | Bacteria | 1080 |
| 41 | Ga0065712_10011010 | 3300005290 | Bacteria | 2159 |
| 42 | Ga0070658_10128348 | 3300005327 | Bacteria | 2112 |
| 43 | Ga0070676_10029115 | 3300005328 | Bacteria | 3139 |
| 44 | Ga0070676_10069728 | 3300005328 | Bacteria | 2108 |
| 45 | Ga0070676_10142015 | 3300005328 | Bacteria | 1530 |
| 46 | Ga0070683_100155493 | 3300005329 | Bacteria | 2168 |
| 47 | Ga0070690_100001480 | 3300005330 | Bacteria | 12289 |
| 48 | Ga0070690_100044230 | 3300005330 | Bacteria | 2826 |
| 49 | Ga0070670_100038656 | 3300005331 | Bacteria | 4103 |
| 50 | Ga0070670_100075323 | 3300005331 | Bacteria | 2899 |
| 51 | Ga0070670_100495953 | 3300005331 | Bacteria | 1085 |
| 52 | Ga0070677_10023030 | 3300005333 | Bacteria | 2302 |
| 53 | Ga0068869_100021007 | 3300005334 | Bacteria | 4487 |
| 54 | Ga0070666_10033290 | 3300005335 | Bacteria | 3409 |
| 55 | Ga0070660_100271379 | 3300005339 | Bacteria | 1386 |
| 56 | Ga0070691_10150544 | 3300005341 | Bacteria | 1193 |
| 57 | Ga0070687_100003576 | 3300005343 | Bacteria | 6056 |
| 58 | Ga0070661_100058235 | 3300005344 | Bacteria | 2831 |
| 59 | Ga0070661_100178791 | 3300005344 | Bacteria | 1613 |
| 60 | Ga0070668_100087567 | 3300005347 | Bacteria | 2450 |
| 61 | Ga0070668_100088760 | 3300005347 | Bacteria | 2434 |
| 62 | Ga0070668_100439538 | 3300005347 | Bacteria | 1120 |
| 63 | Ga0070669_100048090 | 3300005353 | Bacteria | 3113 |
| 64 | Ga0070669_100197949 | 3300005353 | Bacteria | 1580 |
| 65 | Ga0070671_100018157 | 3300005355 | Bacteria | 5711 |
| 66 | Ga0070671_100114268 | 3300005355 | Bacteria | 2269 |
| 67 | Ga0070674_100009734 | 3300005356 | Bacteria | 5772 |
| 68 | Ga0070674_100030919 | 3300005356 | Bacteria | 3543 |
| 69 | Ga0070674_100047259 | 3300005356 | Bacteria | 2947 |
| 70 | Ga0070674_100125974 | 3300005356 | Bacteria | 1902 |
| 71 | Ga0070674_100240279 | 3300005356 | Bacteria | 1418 |
| 72 | Ga0070673_100232842 | 3300005364 | Bacteria | 1598 |
| 73 | Ga0070673_100247850 | 3300005364 | Bacteria | 1551 |
| 74 | Ga0070688_100426597 | 3300005365 | Bacteria | 987 |
| 75 | Ga0070659_100057085 | 3300005366 | Bacteria | 3078 |
| 76 | Ga0070659_100073622 | 3300005366 | Bacteria | 2719 |
| 77 | Ga0070667_100163219 | 3300005367 | Bacteria | 1963 |
| 78 | Ga0070667_100431209 | 3300005367 | Bacteria | 1203 |
| 79 | Ga0070667_100486156 | 3300005367 | Bacteria | 1131 |
| 80 | Ga0070709_10001435 | 3300005434 | Bacteria | 12865 |
| 81 | Ga0070709_10018623 | 3300005434 | Bacteria | 4002 |
| 82 | Ga0070709_10028519 | 3300005434 | Bacteria | 3330 |
| 83 | Ga0070709_10031766 | 3300005434 | Bacteria | 3179 |
| 84 | Ga0070714_100028593 | 3300005435 | Bacteria | 4628 |
| 85 | Ga0070714_100037350 | 3300005435 | Bacteria | 4081 |
| 86 | Ga0070714_100064833 | 3300005435 | Bacteria | 3146 |
| 87 | Ga0070714_100066789 | 3300005435 | Bacteria | 3099 |
| 88 | Ga0070714_100143642 | 3300005435 | Bacteria | 2144 |
| 89 | Ga0070713_100010045 | 3300005436 | Bacteria | 6822 |
| 90 | Ga0070713_100020133 | 3300005436 | Bacteria | 5109 |
| 91 | Ga0070713_100023379 | 3300005436 | Bacteria | 4796 |
| 92 | Ga0070713_100026553 | 3300005436 | Bacteria | 4549 |
| 93 | Ga0070713_100029310 | 3300005436 | Bacteria | 4357 |
| 94 | Ga0070713_100139238 | 3300005436 | Bacteria | 2148 |
| 95 | Ga0070713_100156058 | 3300005436 | Bacteria | 2034 |
| 96 | Ga0070713_100251525 | 3300005436 | Bacteria | 1612 |
| 97 | Ga0070713_100419325 | 3300005436 | Bacteria | 1253 |
| 98 | Ga0070710_10003070 | 3300005437 | Bacteria | 7934 |
| 99 | Ga0070710_10007821 | 3300005437 | Bacteria | 5188 |
| 100 | Ga0070710_10025405 | 3300005437 | Bacteria | 3137 |
| 101 | Ga0070710_10049485 | 3300005437 | Bacteria | 2351 |
| 102 | Ga0070710_10333289 | 3300005437 | Bacteria | 1000 |
| 103 | Ga0070711_100007255 | 3300005439 | Bacteria | 6734 |
| 104 | Ga0070711_100010158 | 3300005439 | Bacteria | 5816 |
| 105 | Ga0070705_100137607 | 3300005440 | Bacteria | 1603 |
| 106 | Ga0070700_100051096 | 3300005441 | Bacteria | 2572 |
| 107 | Ga0070694_100320059 | 3300005444 | Bacteria | 1193 |
| 108 | Ga0070708_100069725 | 3300005445 | Bacteria | 3162 |
| 109 | Ga0070663_100022794 | 3300005455 | Bacteria | 4190 |
| 110 | Ga0070663_100071811 | 3300005455 | Bacteria | 2520 |
| 111 | Ga0070663_100094017 | 3300005455 | Bacteria | 2225 |
| 112 | Ga0070663_100421720 | 3300005455 | Bacteria | 1094 |
| 113 | Ga0070678_100007756 | 3300005456 | Bacteria | 6383 |
| 114 | Ga0070678_100058009 | 3300005456 | Bacteria | 2839 |
| 115 | Ga0070678_100103787 | 3300005456 | Bacteria | 2209 |
| 116 | Ga0070678_100122156 | 3300005456 | Bacteria | 2056 |
| 117 | Ga0070678_100205342 | 3300005456 | Bacteria | 1629 |
| 118 | Ga0070678_100247360 | 3300005456 | Bacteria | 1494 |
| 119 | Ga0070662_100020979 | 3300005457 | Bacteria | 4456 |
| 120 | Ga0070662_100123072 | 3300005457 | Bacteria | 1990 |
| 121 | Ga0070662_100353274 | 3300005457 | Bacteria | 1205 |
| 122 | Ga0068867_100074089 | 3300005459 | Bacteria | 2551 |
| 123 | Ga0068867_100128336 | 3300005459 | Bacteria | 1967 |
| 124 | Ga0070685_10013574 | 3300005466 | Bacteria | 4300 |
| 125 | Ga0070685_10094745 | 3300005466 | Bacteria | 1814 |
| 126 | Ga0070706_100038324 | 3300005467 | Bacteria | 4424 |
| 127 | Ga0070707_100061272 | 3300005468 | Bacteria | 3608 |
| 128 | Ga0070707_100182951 | 3300005468 | Bacteria | 2043 |
| 129 | Ga0070698_100001256 | 3300005471 | Bacteria | 28317 |
| 130 | Ga0070698_100056924 | 3300005471 | Bacteria | 3958 |
| 131 | Ga0070698_100077624 | 3300005471 | Bacteria | 3320 |
| 132 | Ga0070699_100101414 | 3300005518 | Bacteria | 2523 |
| 133 | Ga0070699_100201380 | 3300005518 | Bacteria | 1770 |
| 134 | Ga0070697_100088394 | 3300005536 | Bacteria | 2559 |
| 135 | Ga0068853_100002466 | 3300005539 | Bacteria | 13857 |
| 136 | Ga0070686_100058643 | 3300005544 | Bacteria | 2477 |
| 137 | Ga0070686_100151107 | 3300005544 | Bacteria | 1626 |
| 138 | Ga0070686_100171722 | 3300005544 | Bacteria | 1534 |
| 139 | Ga0070665_100100771 | 3300005548 | Bacteria | 2892 |
| 140 | Ga0070665_100197862 | 3300005548 | Bacteria | 2010 |
| 141 | Ga0070665_100375703 | 3300005548 | Bacteria | 1428 |
| 142 | Ga0070665_100712718 | 3300005548 | Bacteria | 1016 |
| 143 | Ga0070704_100112829 | 3300005549 | Bacteria | 2072 |
| 144 | Ga0070704_100507766 | 3300005549 | Bacteria | 1047 |
| 145 | Ga0068855_100019962 | 3300005563 | Bacteria | 8049 |
| 146 | Ga0068855_100090841 | 3300005563 | Bacteria | 3523 |
| 147 | Ga0068855_100187886 | 3300005563 | Bacteria | 2332 |
| 148 | Ga0068855_100781952 | 3300005563 | Bacteria | 1016 |
| 149 | Ga0070664_100114591 | 3300005564 | Bacteria | 2355 |
| 150 | Ga0068857_100001764 | 3300005577 | Bacteria | 17398 |
| 151 | Ga0068857_100066536 | 3300005577 | Bacteria | 3206 |
| 152 | Ga0068857_100131046 | 3300005577 | Bacteria | 2261 |
| 153 | Ga0068854_100003702 | 3300005578 | Bacteria | 9566 |
| 154 | Ga0068854_100009437 | 3300005578 | Bacteria | 6301 |
| 155 | Ga0068856_100002751 | 3300005614 | Bacteria | 18008 |
| 156 | Ga0068856_100003801 | 3300005614 | Bacteria | 15121 |
| 157 | Ga0068856_100014815 | 3300005614 | Bacteria | 7527 |
| 158 | Ga0068856_100175841 | 3300005614 | Bacteria | 2153 |
| 159 | Ga0068856_100381878 | 3300005614 | Bacteria | 1428 |
| 160 | Ga0068856_100471965 | 3300005614 | Bacteria | 1275 |
| 161 | Ga0070702_100007182 | 3300005615 | Bacteria | 5320 |
| 162 | Ga0070702_100024775 | 3300005615 | Bacteria | 3205 |
| 163 | Ga0068852_100010588 | 3300005616 | Bacteria | 6900 |
| 164 | Ga0068852_100018932 | 3300005616 | Bacteria | 5438 |
| 165 | Ga0068852_100190570 | 3300005616 | Bacteria | 1934 |
| 166 | Ga0068859_100005143 | 3300005617 | Bacteria | 13279 |
| 167 | Ga0068859_100161666 | 3300005617 | Bacteria | 2318 |
| 168 | Ga0068859_100424083 | 3300005617 | Bacteria | 1426 |
| 169 | Ga0068864_100066351 | 3300005618 | Bacteria | 3132 |
| 170 | Ga0068864_100367086 | 3300005618 | Bacteria | 1361 |
| 171 | Ga0068861_100020081 | 3300005719 | Bacteria | 4779 |
| 172 | Ga0068861_100026916 | 3300005719 | Bacteria | 4184 |
| 173 | Ga0068861_100030834 | 3300005719 | Bacteria | 3933 |
| 174 | Ga0068861_100066886 | 3300005719 | Bacteria | 2771 |
| 175 | Ga0068861_100090784 | 3300005719 | Bacteria | 2410 |
| 176 | Ga0068861_100117093 | 3300005719 | Bacteria | 2143 |
| 177 | Ga0068851_10000998 | 3300005834 | Bacteria | 12268 |
| 178 | Ga0068870_10012535 | 3300005840 | Bacteria | 3965 |
| 179 | Ga0068870_10144352 | 3300005840 | Bacteria | 1396 |
| 180 | Ga0068870_10214031 | 3300005840 | Bacteria | 1176 |
| 181 | Ga0068863_100038224 | 3300005841 | Bacteria | 4567 |
| 182 | Ga0068858_100009054 | 3300005842 | Bacteria | 9519 |
| 183 | Ga0068858_100105049 | 3300005842 | Bacteria | 2635 |
| 184 | Ga0068860_100002058 | 3300005843 | Bacteria | 21189 |
| 185 | Ga0068860_100089568 | 3300005843 | Bacteria | 2929 |
| 186 | Ga0068860_100171857 | 3300005843 | Bacteria | 2093 |
| 187 | Ga0068862_100018243 | 3300005844 | Bacteria | 5842 |
| 188 | Ga0068862_100108764 | 3300005844 | Bacteria | 2431 |
| 189 | Ga0068862_100164815 | 3300005844 | Bacteria | 1980 |
| 190 | Ga0068862_100252521 | 3300005844 | Bacteria | 1608 |
| 191 | Ga0068862_100613990 | 3300005844 | Bacteria | 1045 |
| 192 | Ga0081455_10000015 | 3300005937 | Bacteria | 189655 |
| 193 | Ga0081455_10006198 | 3300005937 | Bacteria | 12894 |
| 194 | Ga0081455_10021542 | 3300005937 | Bacteria | 6043 |
| 195 | Ga0081455_10033433 | 3300005937 | Bacteria | 4621 |
| 196 | Ga0081455_10121889 | 3300005937 | Bacteria | 2053 |
| 197 | Ga0081455_10138084 | 3300005937 | Bacteria | 1897 |
| 198 | Ga0081455_10178983 | 3300005937 | Bacteria | 1608 |
| 199 | Ga0081538_10010377 | 3300005981 | Bacteria | 7637 |
| 200 | Ga0081538_10085548 | 3300005981 | Bacteria | 1656 |
| 201 | Ga0081540_1000459 | 3300005983 | Bacteria | 40435 |
| 202 | Ga0081540_1002269 | 3300005983 | Bacteria | 15807 |
| 203 | Ga0081540_1002282 | 3300005983 | Bacteria | 15746 |
| 204 | Ga0081540_1004494 | 3300005983 | Bacteria | 10596 |
| 205 | Ga0081540_1004784 | 3300005983 | Bacteria | 10207 |
| 206 | Ga0081540_1006449 | 3300005983 | Bacteria | 8541 |
| 207 | Ga0081540_1006666 | 3300005983 | Bacteria | 8358 |
| 208 | Ga0081540_1007254 | 3300005983 | Bacteria | 7943 |
| 209 | Ga0081540_1007646 | 3300005983 | Bacteria | 7669 |
| 210 | Ga0081540_1009916 | 3300005983 | Bacteria | 6498 |
| 211 | Ga0081540_1017080 | 3300005983 | Bacteria | 4509 |
| 212 | Ga0081539_10000048 | 3300005985 | Bacteria | 272906 |
| 213 | Ga0081539_10000466 | 3300005985 | Bacteria | 85716 |
| 214 | Ga0081539_10004314 | 3300005985 | Bacteria | 15887 |
| 215 | Ga0081539_10021149 | 3300005985 | Bacteria | 4358 |
| 216 | Ga0081539_10062699 | 3300005985 | Bacteria | 2031 |
| 217 | Ga0081539_10074323 | 3300005985 | Bacteria | 1810 |
| 218 | Ga0070717_10002608 | 3300006028 | Bacteria | 12713 |
| 219 | Ga0070717_10042632 | 3300006028 | Bacteria | 3701 |
| 220 | Ga0070717_10093928 | 3300006028 | Bacteria | 2536 |
| 221 | Ga0070717_10153827 | 3300006028 | Bacteria | 1991 |
| 222 | Ga0070717_10201699 | 3300006028 | Bacteria | 1743 |
| 223 | Ga0070717_10258003 | 3300006028 | Bacteria | 1542 |
| 224 | Ga0070717_10420841 | 3300006028 | Bacteria | 1202 |
| 225 | Ga0075365_10022006 | 3300006038 | Bacteria | 3986 |
| 226 | Ga0075365_10038669 | 3300006038 | Bacteria | 3103 |
| 227 | Ga0075365_10052107 | 3300006038 | Bacteria | 2705 |
| 228 | Ga0075365_10066663 | 3300006038 | Bacteria | 2416 |
| 229 | Ga0075365_10068611 | 3300006038 | Bacteria | 2382 |
| 230 | Ga0075365_10080643 | 3300006038 | Bacteria | 2203 |
| 231 | Ga0075368_10017075 | 3300006042 | Bacteria | 2712 |
| 232 | Ga0075368_10034166 | 3300006042 | Bacteria | 1980 |
| 233 | Ga0075363_100002145 | 3300006048 | Bacteria | 7931 |
| 234 | Ga0075363_100021620 | 3300006048 | Bacteria | 3244 |
| 235 | Ga0075363_100036579 | 3300006048 | Bacteria | 2576 |
| 236 | Ga0075363_100040437 | 3300006048 | Bacteria | 2458 |
| 237 | Ga0075363_100099922 | 3300006048 | Bacteria | 1605 |
| 238 | Ga0075363_100135741 | 3300006048 | Bacteria | 1382 |
| 239 | Ga0075364_10029682 | 3300006051 | Bacteria | 3508 |
| 240 | Ga0075364_10089660 | 3300006051 | Bacteria | 2039 |
| 241 | Ga0075364_10103781 | 3300006051 | Bacteria | 1894 |
| 242 | Ga0075364_10119495 | 3300006051 | Bacteria | 1763 |
| 243 | Ga0075364_10151415 | 3300006051 | Bacteria | 1563 |
| 244 | Ga0075364_10186549 | 3300006051 | Bacteria | 1404 |
| 245 | Ga0075364_10217615 | 3300006051 | Bacteria | 1296 |
| 246 | Ga0075364_10352855 | 3300006051 | Bacteria | 1003 |
| 247 | Ga0070715_10002100 | 3300006163 | Bacteria | 6022 |
| 248 | Ga0070715_10077355 | 3300006163 | Bacteria | 1502 |
| 249 | Ga0070716_100010030 | 3300006173 | Bacteria | 4737 |
| 250 | Ga0070716_100039116 | 3300006173 | Bacteria | 2630 |
| 251 | Ga0070716_100066067 | 3300006173 | Bacteria | 2108 |
| 252 | Ga0070712_100007483 | 3300006175 | Bacteria | 6819 |
| 253 | Ga0070712_100009194 | 3300006175 | Bacteria | 6225 |
| 254 | Ga0070712_100085241 | 3300006175 | Bacteria | 2299 |
| 255 | Ga0075362_10008683 | 3300006177 | Bacteria | 3901 |
| 256 | Ga0075362_10053901 | 3300006177 | Bacteria | 1806 |
| 257 | Ga0075362_10099250 | 3300006177 | Bacteria | 1360 |
| 258 | Ga0075367_10010679 | 3300006178 | Bacteria | 4833 |
| 259 | Ga0075367_10012056 | 3300006178 | Bacteria | 4594 |
| 260 | Ga0075367_10032962 | 3300006178 | Bacteria | 2983 |
| 261 | Ga0075367_10093726 | 3300006178 | Bacteria | 1829 |
| 262 | Ga0075367_10106413 | 3300006178 | Bacteria | 1719 |
| 263 | Ga0075367_10265601 | 3300006178 | Bacteria | 1077 |
| 264 | Ga0075367_10271415 | 3300006178 | Bacteria | 1065 |
| 265 | Ga0075369_10012200 | 3300006186 | Bacteria | 3393 |
| 266 | Ga0075369_10028615 | 3300006186 | Bacteria | 2336 |
| 267 | Ga0075369_10058463 | 3300006186 | Bacteria | 1679 |
| 268 | Ga0075369_10063893 | 3300006186 | Bacteria | 1611 |
| 269 | Ga0075369_10068667 | 3300006186 | Bacteria | 1558 |
| 270 | Ga0075369_10082234 | 3300006186 | Bacteria | 1429 |
| 271 | Ga0075366_10050584 | 3300006195 | Bacteria | 2468 |
| 272 | Ga0075366_10087531 | 3300006195 | Bacteria | 1864 |
| 273 | Ga0075366_10129353 | 3300006195 | Bacteria | 1523 |
| 274 | Ga0075366_10129511 | 3300006195 | Bacteria | 1522 |
| 275 | Ga0097621_100043350 | 3300006237 | Bacteria | 3626 |
| 276 | Ga0097621_100063124 | 3300006237 | Bacteria | 3043 |
| 277 | Ga0097621_100303904 | 3300006237 | Bacteria | 1410 |
| 278 | Ga0075370_10023979 | 3300006353 | Bacteria | 3366 |
| 279 | Ga0075370_10034636 | 3300006353 | Bacteria | 2830 |
| 280 | Ga0075370_10035109 | 3300006353 | Bacteria | 2813 |
| 281 | Ga0075370_10056900 | 3300006353 | Bacteria | 2222 |
| 282 | Ga0075370_10097115 | 3300006353 | Bacteria | 1703 |
| 283 | Ga0068871_100069401 | 3300006358 | Bacteria | 2894 |
| 284 | Ga0068871_100389103 | 3300006358 | Bacteria | 1240 |
| 285 | Ga0075428_100126914 | 3300006844 | Bacteria | 2776 |
| 286 | Ga0075428_100219808 | 3300006844 | Bacteria | 2052 |
| 287 | Ga0075428_100454510 | 3300006844 | Bacteria | 1372 |
| 288 | Ga0075430_100003805 | 3300006846 | Bacteria | 12703 |
| 289 | Ga0075430_100061792 | 3300006846 | Bacteria | 3147 |
| 290 | Ga0075430_100148719 | 3300006846 | Bacteria | 1950 |
| 291 | Ga0075431_100008501 | 3300006847 | Bacteria | 10278 |
| 292 | Ga0075431_100127583 | 3300006847 | Bacteria | 2625 |
| 293 | Ga0075431_100465316 | 3300006847 | Bacteria | 1259 |
| 294 | Ga0075434_100108893 | 3300006871 | Bacteria | 2780 |
| 295 | Ga0075434_100243277 | 3300006871 | Bacteria | 1819 |
| 296 | Ga0075434_100452194 | 3300006871 | Bacteria | 1306 |
| 297 | Ga0075434_100659338 | 3300006871 | Bacteria | 1065 |
| 298 | Ga0068865_100017612 | 3300006881 | Bacteria | 4597 |
| 299 | Ga0068865_100137402 | 3300006881 | Bacteria | 1839 |
| 300 | Ga0075436_100153078 | 3300006914 | Bacteria | 1623 |
| 301 | Ga0097620_100005143 | 3300006931 | Bacteria | 13279 |
| 302 | Ga0097620_100161662 | 3300006931 | Bacteria | 2318 |
| 303 | Ga0097620_100424100 | 3300006931 | Bacteria | 1426 |
| 304 | Ga0099824_1004372 | 3300006942 | Bacteria | 20372 |
| 305 | Ga0099823_1053765 | 3300006944 | Bacteria | 2347 |
| 306 | Ga0075435_100280507 | 3300007076 | Bacteria | 1422 |
| 307 | Ga0099795_10025142 | 3300007788 | Bacteria | 1994 |
| 308 | Ga0099795_10060531 | 3300007788 | Bacteria | 1403 |
| 309 | Ga0099795_10064618 | 3300007788 | Bacteria | 1367 |
| 310 | Ga0105240_10009595 | 3300009093 | Bacteria | 13695 |
| 311 | Ga0105240_10055652 | 3300009093 | Bacteria | 4953 |
| 312 | Ga0105240_10806247 | 3300009093 | Bacteria | 1017 |
| 313 | Ga0111539_10132770 | 3300009094 | Bacteria | 2915 |
| 314 | Ga0105245_10018387 | 3300009098 | Bacteria | 6110 |
| 315 | Ga0105245_10077260 | 3300009098 | Bacteria | 3035 |
| 316 | Ga0105247_10074757 | 3300009101 | Bacteria | 2126 |
| 317 | Ga0114129_10028215 | 3300009147 | Bacteria | 7952 |
| 318 | Ga0114129_10050504 | 3300009147 | Bacteria | 5841 |
| 319 | Ga0114129_10236575 | 3300009147 | Bacteria | 2457 |
| 320 | Ga0114129_10237884 | 3300009147 | Bacteria | 2449 |
| 321 | Ga0114129_10329886 | 3300009147 | Bacteria | 2026 |
| 322 | Ga0105241_10002508 | 3300009174 | Bacteria | 13787 |
| 323 | Ga0105241_10055998 | 3300009174 | Bacteria | 3022 |
| 324 | Ga0105241_10091913 | 3300009174 | Bacteria | 2395 |
| 325 | Ga0105241_10099417 | 3300009174 | Bacteria | 2310 |
| 326 | Ga0105242_10048183 | 3300009176 | Bacteria | 3463 |
| 327 | Ga0105248_10026102 | 3300009177 | Bacteria | 6499 |
| 328 | Ga0105248_10235666 | 3300009177 | Bacteria | 2060 |
| 329 | Ga0105248_10274419 | 3300009177 | Bacteria | 1898 |
| 330 | Ga0105237_10023360 | 3300009545 | Bacteria | 6337 |
| 331 | Ga0105237_10045757 | 3300009545 | Bacteria | 4403 |
| 332 | Ga0105237_10077993 | 3300009545 | Bacteria | 3302 |
| 333 | Ga0105237_10136081 | 3300009545 | Bacteria | 2451 |
| 334 | Ga0105237_10436933 | 3300009545 | Bacteria | 1314 |
| 335 | Ga0105238_10013064 | 3300009551 | Bacteria | 8379 |
| 336 | Ga0105238_10032374 | 3300009551 | Bacteria | 5320 |
| 337 | Ga0105238_10058953 | 3300009551 | Bacteria | 3847 |
| 338 | Ga0105238_10220379 | 3300009551 | Bacteria | 1873 |
| 339 | Ga0105249_10104567 | 3300009553 | Bacteria | 2668 |
| 340 | Ga0105249_10325248 | 3300009553 | Bacteria | 1550 |
| 341 | Ga0099796_10002833 | 3300010159 | Bacteria | 3902 |
| 342 | Ga0099796_10011208 | 3300010159 | Bacteria | 2493 |
| 343 | Ga0099796_10013605 | 3300010159 | Bacteria | 2328 |
| 344 | Ga0099796_10055234 | 3300010159 | Bacteria | 1390 |
| 345 | Ga0099796_10057378 | 3300010159 | Bacteria | 1369 |
| 346 | Ga0105239_10023710 | 3300010375 | Bacteria | 6756 |
| 347 | Ga0105239_10041130 | 3300010375 | Bacteria | 5065 |
| 348 | Ga0105239_10125755 | 3300010375 | Bacteria | 2849 |
| 349 | Ga0105239_10287272 | 3300010375 | Bacteria | 1852 |
| 350 | Ga0105246_10193446 | 3300011119 | Bacteria | 1576 |
| 351 | Ga0105246_10328939 | 3300011119 | Bacteria | 1245 |
| 352 | Ga0105246_10364412 | 3300011119 | Bacteria | 1189 |
| 353 | Ga0157374_10065407 | 3300013296 | Bacteria | 3414 |
| 354 | Ga0157374_10439508 | 3300013296 | Bacteria | 1305 |
| 355 | Ga0157378_10052575 | 3300013297 | Bacteria | 3624 |
| 356 | Ga0157378_10107994 | 3300013297 | Bacteria | 2547 |
| 357 | Ga0157378_10734915 | 3300013297 | Bacteria | 1009 |
| 358 | Ga0163162_10080918 | 3300013306 | Bacteria | 3318 |
| 359 | Ga0163162_10463199 | 3300013306 | Bacteria | 1399 |
| 360 | Ga0157375_10022892 | 3300013308 | Bacteria | 5757 |
| 361 | Ga0157375_10153214 | 3300013308 | Bacteria | 2442 |
| 362 | Ga0157375_10274654 | 3300013308 | Bacteria | 1847 |
| 363 | Ga0163163_10062889 | 3300014325 | Bacteria | 3679 |
| 364 | Ga0163163_10166955 | 3300014325 | Bacteria | 2247 |
| 365 | Ga0157379_10371260 | 3300014968 | Bacteria | 1312 |
| 366 | Ga0157379_10671791 | 3300014968 | Bacteria | 971 |
| 367 | Ga0157376_10175081 | 3300014969 | Bacteria | 1957 |
| 368 | Ga0157376_10189499 | 3300014969 | Bacteria | 1885 |
| 369 | Ga0157376_10226961 | 3300014969 | Bacteria | 1733 |
| 370 | Ga0157376_10314533 | 3300014969 | Bacteria | 1487 |
| 371 | Ga0182007_10043534 | 3300015262 | Bacteria | 1492 |
| 372 | Ga0163161_10114351 | 3300017792 | Bacteria | 2021 |
| 373 | Ga0163161_10328618 | 3300017792 | Bacteria | 1210 |
| 374 | Ga0214544_1000003 | 3300021320 | Bacteria | 643752 |
| 375 | Ga0214542_1000003 | 3300021321 | Bacteria | 435700 |
| 376 | Ga0214545_1000004 | 3300021324 | Bacteria | 453352 |
| 377 | Ga0214545_1020700 | 3300021324 | Bacteria | 5173 |
| 378 | Ga0214543_1000007 | 3300021327 | Bacteria | 414744 |
| 379 | Ga0213872_10013101 | 3300021361 | Bacteria | 3887 |
| 380 | Ga0213872_10105557 | 3300021361 | Bacteria | 1254 |
| 381 | Ga0213876_10014535 | 3300021384 | Bacteria | 4172 |
| 382 | Ga0213876_10027233 | 3300021384 | Bacteria | 3017 |
| 383 | Ga0213876_10038656 | 3300021384 | Bacteria | 2519 |
| 384 | Ga0213876_10046054 | 3300021384 | Bacteria | 2306 |
| 385 | Ga0213876_10213934 | 3300021384 | Bacteria | 1025 |
| 386 | Ga0213875_10000138 | 3300021388 | Bacteria | 79866 |
| 387 | Ga0213871_10000343 | 3300021441 | Bacteria | 5979 |
| 388 | Ga0224572_1001925 | 3300024225 | Bacteria | 3228 |
| 389 | Ga0209563_105273 | 3300025230 | Bacteria | 2365 |
| 390 | Ga0209677_102298 | 3300025253 | Bacteria | 7359 |
| 391 | Ga0209677_104782 | 3300025253 | Bacteria | 3761 |
| 392 | Ga0209677_105656 | 3300025253 | Bacteria | 3199 |
| 393 | Ga0209148_1000351 | 3300025254 | Bacteria | 59739 |
| 394 | Ga0209455_1001952 | 3300025272 | Bacteria | 8497 |
| 395 | Ga0209455_1007569 | 3300025272 | Bacteria | 3050 |
| 396 | Ga0209675_1000347 | 3300025291 | Bacteria | 40287 |
| 397 | Ga0209675_1001333 | 3300025291 | Bacteria | 14605 |
| 398 | Ga0209025_1000010 | 3300025294 | Bacteria | 986612 |
| 399 | Ga0209025_1092622 | 3300025294 | Bacteria | 983 |
| 400 | Ga0209564_1000049 | 3300025295 | Bacteria | 362075 |
| 401 | Ga0209564_1003721 | 3300025295 | Bacteria | 9997 |
| 402 | Ga0209564_1010578 | 3300025295 | Bacteria | 4232 |
| 403 | Ga0209758_1000015 | 3300025297 | Bacteria | 851943 |
| 404 | Ga0209758_1000224 | 3300025297 | Bacteria | 121530 |
| 405 | Ga0209758_1001252 | 3300025297 | Bacteria | 31479 |
| 406 | Ga0209758_1001877 | 3300025297 | Bacteria | 23026 |
| 407 | Ga0209758_1007694 | 3300025297 | Bacteria | 7239 |
| 408 | Ga0209758_1019413 | 3300025297 | Bacteria | 3277 |
| 409 | Ga0209758_1030260 | 3300025297 | Bacteria | 2246 |
| 410 | Ga0209758_1068127 | 3300025297 | Bacteria | 1135 |
| 411 | Ga0209256_1000014 | 3300025299 | Bacteria | 687409 |
| 412 | Ga0209256_1009667 | 3300025299 | Bacteria | 4181 |
| 413 | Ga0207426_1000552 | 3300025302 | Bacteria | 51852 |
| 414 | Ga0207426_1000585 | 3300025302 | Bacteria | 48529 |
| 415 | Ga0207426_1000940 | 3300025302 | Bacteria | 28937 |
| 416 | Ga0207426_1013654 | 3300025302 | Bacteria | 3000 |
| 417 | Ga0207426_1023802 | 3300025302 | Bacteria | 2086 |
| 418 | Ga0209257_1000440 | 3300025304 | Bacteria | 79182 |
| 419 | Ga0207696_1065859 | 3300025711 | Bacteria | 1013 |
| 420 | Ga0207682_10025490 | 3300025893 | Bacteria | 2345 |
| 421 | Ga0207692_10000547 | 3300025898 | Bacteria | 13349 |
| 422 | Ga0207692_10043898 | 3300025898 | Bacteria | 2227 |
| 423 | Ga0207642_10182465 | 3300025899 | Bacteria | 1145 |
| 424 | Ga0207710_10035650 | 3300025900 | Bacteria | 2190 |
| 425 | Ga0207710_10052378 | 3300025900 | Bacteria | 1835 |
| 426 | Ga0207688_10001018 | 3300025901 | Bacteria | 14321 |
| 427 | Ga0207688_10139847 | 3300025901 | Bacteria | 1424 |
| 428 | Ga0207647_10047034 | 3300025904 | Bacteria | 2685 |
| 429 | Ga0207685_10062853 | 3300025905 | Bacteria | 1477 |
| 430 | Ga0207685_10108855 | 3300025905 | Bacteria | 1198 |
| 431 | Ga0207699_10000386 | 3300025906 | Bacteria | 23177 |
| 432 | Ga0207699_10001899 | 3300025906 | Bacteria | 9840 |
| 433 | Ga0207699_10003779 | 3300025906 | Bacteria | 7226 |
| 434 | Ga0207645_10030013 | 3300025907 | Bacteria | 3503 |
| 435 | Ga0207645_10035040 | 3300025907 | Bacteria | 3223 |
| 436 | Ga0207645_10041151 | 3300025907 | Bacteria | 2959 |
| 437 | Ga0207645_10271358 | 3300025907 | Bacteria | 1125 |
| 438 | Ga0207643_10143592 | 3300025908 | Bacteria | 1427 |
| 439 | Ga0207705_10124768 | 3300025909 | Bacteria | 1913 |
| 440 | Ga0207705_10200854 | 3300025909 | Bacteria | 1510 |
| 441 | Ga0207684_10003003 | 3300025910 | Bacteria | 16721 |
| 442 | Ga0207684_10194294 | 3300025910 | Bacteria | 1750 |
| 443 | Ga0207654_10003583 | 3300025911 | Bacteria | 7852 |
| 444 | Ga0207654_10010023 | 3300025911 | Bacteria | 4818 |
| 445 | Ga0207654_10058758 | 3300025911 | Bacteria | 2240 |
| 446 | Ga0207654_10157307 | 3300025911 | Bacteria | 1465 |
| 447 | Ga0207707_10000816 | 3300025912 | Bacteria | 30547 |
| 448 | Ga0207707_10462289 | 3300025912 | Bacteria | 1085 |
| 449 | Ga0207695_10000065 | 3300025913 | Bacteria | 336949 |
| 450 | Ga0207695_10000968 | 3300025913 | Bacteria | 51180 |
| 451 | Ga0207695_10246090 | 3300025913 | Bacteria | 1688 |
| 452 | Ga0207671_10007223 | 3300025914 | Bacteria | 9676 |
| 453 | Ga0207671_10011255 | 3300025914 | Bacteria | 7300 |
| 454 | Ga0207671_10135319 | 3300025914 | Bacteria | 1894 |
| 455 | Ga0207693_10000774 | 3300025915 | Bacteria | 28742 |
| 456 | Ga0207693_10003450 | 3300025915 | Bacteria | 13491 |
| 457 | Ga0207693_10011795 | 3300025915 | Bacteria | 7063 |
| 458 | Ga0207693_10018699 | 3300025915 | Bacteria | 5516 |
| 459 | Ga0207693_10025504 | 3300025915 | Bacteria | 4687 |
| 460 | Ga0207693_10189713 | 3300025915 | Bacteria | 1618 |
| 461 | Ga0207663_10001349 | 3300025916 | Bacteria | 11352 |
| 462 | Ga0207663_10044415 | 3300025916 | Bacteria | 2727 |
| 463 | Ga0207662_10002530 | 3300025918 | Bacteria | 9207 |
| 464 | Ga0207657_10080554 | 3300025919 | Bacteria | 2737 |
| 465 | Ga0207657_10157830 | 3300025919 | Bacteria | 1844 |
| 466 | Ga0207649_10054012 | 3300025920 | Bacteria | 2499 |
| 467 | Ga0207649_10120391 | 3300025920 | Bacteria | 1769 |
| 468 | Ga0207652_10005821 | 3300025921 | Bacteria | 9997 |
| 469 | Ga0207646_10108874 | 3300025922 | Bacteria | 2486 |
| 470 | Ga0207681_10017858 | 3300025923 | Bacteria | 4460 |
| 471 | Ga0207694_10000213 | 3300025924 | Bacteria | 56487 |
| 472 | Ga0207694_10036548 | 3300025924 | Bacteria | 3770 |
| 473 | Ga0207650_10020260 | 3300025925 | Bacteria | 4689 |
| 474 | Ga0207659_10064515 | 3300025926 | Bacteria | 2650 |
| 475 | Ga0207659_10534690 | 3300025926 | Bacteria | 995 |
| 476 | Ga0207687_10029730 | 3300025927 | Bacteria | 3677 |
| 477 | Ga0207687_10043769 | 3300025927 | Bacteria | 3086 |
| 478 | Ga0207687_10219441 | 3300025927 | Bacteria | 1496 |
| 479 | Ga0207700_10002201 | 3300025928 | Bacteria | 11181 |
| 480 | Ga0207700_10011224 | 3300025928 | Bacteria | 5704 |
| 481 | Ga0207700_10022359 | 3300025928 | Bacteria | 4339 |
| 482 | Ga0207700_10036944 | 3300025928 | Bacteria | 3533 |
| 483 | Ga0207700_10046045 | 3300025928 | Bacteria | 3223 |
| 484 | Ga0207700_10063057 | 3300025928 | Bacteria | 2817 |
| 485 | Ga0207664_10050317 | 3300025929 | Bacteria | 3285 |
| 486 | Ga0207664_10161846 | 3300025929 | Bacteria | 1909 |
| 487 | Ga0207664_10345364 | 3300025929 | Bacteria | 1316 |
| 488 | Ga0207644_10043351 | 3300025931 | Bacteria | 3192 |
| 489 | Ga0207644_10068452 | 3300025931 | Bacteria | 2590 |
| 490 | Ga0207644_10272542 | 3300025931 | Bacteria | 1356 |
| 491 | Ga0207690_10072098 | 3300025932 | Bacteria | 2385 |
| 492 | Ga0207706_10007301 | 3300025933 | Bacteria | 10216 |
| 493 | Ga0207706_10081510 | 3300025933 | Bacteria | 2843 |
| 494 | Ga0207706_10141867 | 3300025933 | Bacteria | 2114 |
| 495 | Ga0207706_10255463 | 3300025933 | Bacteria | 1530 |
| 496 | Ga0207686_10017480 | 3300025934 | Bacteria | 4042 |
| 497 | Ga0207709_10111415 | 3300025935 | Bacteria | 1830 |
| 498 | Ga0207709_10126258 | 3300025935 | Bacteria | 1736 |
| 499 | Ga0207709_10145800 | 3300025935 | Bacteria | 1633 |
| 500 | Ga0207709_10372132 | 3300025935 | Bacteria | 1085 |
| 501 | Ga0207670_10021668 | 3300025936 | Bacteria | 3969 |
| 502 | Ga0207669_10003709 | 3300025937 | Bacteria | 6646 |
| 503 | Ga0207669_10012917 | 3300025937 | Bacteria | 4126 |
| 504 | Ga0207669_10079031 | 3300025937 | Bacteria | 2098 |
| 505 | Ga0207669_10116285 | 3300025937 | Bacteria | 1804 |
| 506 | Ga0207669_10156636 | 3300025937 | Bacteria | 1603 |
| 507 | Ga0207669_10257152 | 3300025937 | Bacteria | 1304 |
| 508 | Ga0207704_10046324 | 3300025938 | Bacteria | 2591 |
| 509 | Ga0207665_10000289 | 3300025939 | Bacteria | 34924 |
| 510 | Ga0207665_10001425 | 3300025939 | Bacteria | 16086 |
| 511 | Ga0207665_10001510 | 3300025939 | Bacteria | 15663 |
| 512 | Ga0207665_10003729 | 3300025939 | Bacteria | 10182 |
| 513 | Ga0207665_10097212 | 3300025939 | Bacteria | 2050 |
| 514 | Ga0207665_10175217 | 3300025939 | Bacteria | 1551 |
| 515 | Ga0207665_10238951 | 3300025939 | Bacteria | 1338 |
| 516 | Ga0207691_10013884 | 3300025940 | Bacteria | 7686 |
| 517 | Ga0207691_10143212 | 3300025940 | Bacteria | 2105 |
| 518 | Ga0207691_10536001 | 3300025940 | Bacteria | 993 |
| 519 | Ga0207711_10038123 | 3300025941 | Bacteria | 4086 |
| 520 | Ga0207711_10048181 | 3300025941 | Bacteria | 3646 |
| 521 | Ga0207711_10124403 | 3300025941 | Bacteria | 2305 |
| 522 | Ga0207711_10183618 | 3300025941 | Bacteria | 1903 |
| 523 | Ga0207711_10257495 | 3300025941 | Bacteria | 1603 |
| 524 | Ga0207689_10036089 | 3300025942 | Bacteria | 4104 |
| 525 | Ga0207689_10054040 | 3300025942 | Bacteria | 3308 |
| 526 | Ga0207689_10217966 | 3300025942 | Bacteria | 1577 |
| 527 | Ga0207661_10082840 | 3300025944 | Bacteria | 2653 |
| 528 | Ga0207661_10587079 | 3300025944 | Bacteria | 1022 |
| 529 | Ga0207679_10027684 | 3300025945 | Bacteria | 3923 |
| 530 | Ga0207679_10080457 | 3300025945 | Bacteria | 2488 |
| 531 | Ga0207667_10079331 | 3300025949 | Bacteria | 3403 |
| 532 | Ga0207667_10219652 | 3300025949 | Bacteria | 1947 |
| 533 | Ga0207667_10224943 | 3300025949 | Bacteria | 1922 |
| 534 | Ga0207667_10384194 | 3300025949 | Bacteria | 1430 |
| 535 | Ga0207651_10179218 | 3300025960 | Bacteria | 1679 |
| 536 | Ga0207651_10213983 | 3300025960 | Bacteria | 1553 |
| 537 | Ga0207712_10027778 | 3300025961 | Bacteria | 3781 |
| 538 | Ga0207712_10030143 | 3300025961 | Bacteria | 3645 |
| 539 | Ga0207668_10051796 | 3300025972 | Bacteria | 2837 |
| 540 | Ga0207668_10136239 | 3300025972 | Bacteria | 1882 |
| 541 | Ga0207668_10140121 | 3300025972 | Bacteria | 1858 |
| 542 | Ga0207668_10198817 | 3300025972 | Bacteria | 1594 |
| 543 | Ga0207668_10355903 | 3300025972 | Bacteria | 1225 |
| 544 | Ga0207677_10015799 | 3300026023 | Bacteria | 4452 |
| 545 | Ga0207677_10104825 | 3300026023 | Bacteria | 2091 |
| 546 | Ga0207703_10285436 | 3300026035 | Bacteria | 1500 |
| 547 | Ga0207703_10503468 | 3300026035 | Bacteria | 1137 |
| 548 | Ga0207639_10019353 | 3300026041 | Bacteria | 4854 |
| 549 | Ga0207639_10069817 | 3300026041 | Bacteria | 2742 |
| 550 | Ga0207678_10037422 | 3300026067 | Bacteria | 4220 |
| 551 | Ga0207678_10063278 | 3300026067 | Bacteria | 3179 |
| 552 | Ga0207678_10071220 | 3300026067 | Bacteria | 2981 |
| 553 | Ga0207678_10092481 | 3300026067 | Bacteria | 2585 |
| 554 | Ga0207678_10207334 | 3300026067 | Bacteria | 1677 |
| 555 | Ga0207708_10003151 | 3300026075 | Bacteria | 12142 |
| 556 | Ga0207708_10302960 | 3300026075 | Bacteria | 1300 |
| 557 | Ga0207708_10337924 | 3300026075 | Bacteria | 1233 |
| 558 | Ga0207702_10000094 | 3300026078 | Bacteria | 103202 |
| 559 | Ga0207702_10000095 | 3300026078 | Bacteria | 102704 |
| 560 | Ga0207702_10000539 | 3300026078 | Bacteria | 42329 |
| 561 | Ga0207702_10009972 | 3300026078 | Bacteria | 7965 |
| 562 | Ga0207702_10116279 | 3300026078 | Bacteria | 2386 |
| 563 | Ga0207702_10201888 | 3300026078 | Bacteria | 1843 |
| 564 | Ga0207641_10019053 | 3300026088 | Bacteria | 5628 |
| 565 | Ga0207648_10009796 | 3300026089 | Bacteria | 9155 |
| 566 | Ga0207648_10065982 | 3300026089 | Bacteria | 3156 |
| 567 | Ga0207648_10073497 | 3300026089 | Bacteria | 2979 |
| 568 | Ga0207676_10032685 | 3300026095 | Bacteria | 3923 |
| 569 | Ga0207676_10194012 | 3300026095 | Bacteria | 1789 |
| 570 | Ga0207674_10000578 | 3300026116 | Bacteria | 48259 |
| 571 | Ga0207674_10004408 | 3300026116 | Bacteria | 16958 |
| 572 | Ga0207674_10035720 | 3300026116 | Bacteria | 5186 |
| 573 | Ga0207674_10232416 | 3300026116 | Bacteria | 1792 |
| 574 | Ga0207674_10349879 | 3300026116 | Bacteria | 1429 |
| 575 | Ga0207675_100007420 | 3300026118 | Bacteria | 10361 |
| 576 | Ga0207675_100030164 | 3300026118 | Bacteria | 5050 |
| 577 | Ga0207675_100065878 | 3300026118 | Bacteria | 3385 |
| 578 | Ga0207675_100097179 | 3300026118 | Bacteria | 2773 |
| 579 | Ga0207683_10039973 | 3300026121 | Bacteria | 4092 |
| 580 | Ga0207683_10074617 | 3300026121 | Bacteria | 3001 |
| 581 | Ga0207683_10080049 | 3300026121 | Bacteria | 2898 |
| 582 | Ga0207683_10102921 | 3300026121 | Bacteria | 2550 |
| 583 | Ga0207683_10141110 | 3300026121 | Bacteria | 2171 |
| 584 | Ga0207683_10325126 | 3300026121 | Bacteria | 1409 |
| 585 | Ga0207698_10171001 | 3300026142 | Bacteria | 1913 |
| 586 | Ga0207698_10394753 | 3300026142 | Bacteria | 1320 |
| 587 | Ga0207698_10399432 | 3300026142 | Bacteria | 1313 |
| 588 | Ga0209389_1000029 | 3300027296 | Bacteria | 140337 |
| 589 | Ga0209389_1000076 | 3300027296 | Bacteria | 92447 |
| 590 | Ga0209589_1000012 | 3300027357 | Bacteria | 229451 |
| 591 | Ga0209589_1000013 | 3300027357 | Bacteria | 229273 |
| 592 | Ga0209489_100013 | 3300027361 | Bacteria | 229831 |
| 593 | Ga0209489_100416 | 3300027361 | Bacteria | 77981 |
| 594 | Ga0209700_100014 | 3300027363 | Bacteria | 299349 |
| 595 | Ga0209179_1001813 | 3300027512 | Bacteria | 2728 |
| 596 | Ga0209588_1012833 | 3300027671 | Bacteria | 2549 |
| 597 | Ga0209813_10000669 | 3300027866 | Bacteria | 7833 |
| 598 | Ga0209813_10031992 | 3300027866 | Bacteria | 1556 |
| 599 | Ga0207428_10238879 | 3300027907 | Bacteria | 1358 |
| 600 | Ga0207428_10244724 | 3300027907 | Bacteria | 1339 |
| 601 | Ga0265356_1006070 | 3300028017 | Bacteria | 1422 |
| 602 | Ga0268266_10001689 | 3300028379 | Bacteria | 25367 |
| 603 | Ga0268266_10026887 | 3300028379 | Bacteria | 4895 |
| 604 | Ga0268266_10107655 | 3300028379 | Bacteria | 2465 |
| 605 | Ga0268266_10118594 | 3300028379 | Bacteria | 2352 |
| 606 | Ga0268266_10200622 | 3300028379 | Bacteria | 1825 |
| 607 | Ga0268266_10499369 | 3300028379 | Bacteria | 1161 |
| 608 | Ga0268265_10040614 | 3300028380 | Bacteria | 3437 |
| 609 | Ga0268265_10116158 | 3300028380 | Bacteria | 2195 |
| 610 | Ga0268265_10511088 | 3300028380 | Bacteria | 1134 |
| 611 | Ga0268265_10695953 | 3300028380 | Bacteria | 981 |
| 612 | Ga0268264_10000049 | 3300028381 | Bacteria | 329992 |
| 613 | Ga0268264_10364191 | 3300028381 | Bacteria | 1380 |
| 614 | Ga0265337_1012592 | 3300028556 | Bacteria | 2868 |
| 615 | Ga0265319_1007105 | 3300028563 | Bacteria | 5078 |
| 616 | Ga0265334_10001581 | 3300028573 | Bacteria | 10962 |
| 617 | Ga0265318_10009274 | 3300028577 | Bacteria | 4338 |
| 618 | Ga0265323_10003611 | 3300028653 | Bacteria | 6791 |
| 619 | Ga0265322_10011291 | 3300028654 | Bacteria | 2591 |
| 620 | Ga0265336_10001012 | 3300028666 | Bacteria | 13808 |
| 621 | Ga0307517_10000766 | 3300028786 | Bacteria | 55210 |
| 622 | Ga0307515_10015099 | 3300028794 | Bacteria | 14254 |
| 623 | Ga0307515_10324519 | 3300028794 | Bacteria | 1203 |
| 624 | Ga0265338_10000024 | 3300028800 | Bacteria | 297778 |
| 625 | Ga0265324_10011216 | 3300029957 | Bacteria | 3423 |
| 626 | Ga0265770_1005620 | 3300030878 | Bacteria | 1734 |
| 627 | Ga0265330_10030730 | 3300031235 | Bacteria | 2410 |
| 628 | Ga0265332_10001539 | 3300031238 | Bacteria | 12742 |
| 629 | Ga0265332_10013992 | 3300031238 | Bacteria | 3550 |
| 630 | Ga0265320_10015232 | 3300031240 | Bacteria | 4351 |
| 631 | Ga0265325_10002052 | 3300031241 | Bacteria | 13828 |
| 632 | Ga0265325_10005467 | 3300031241 | Bacteria | 7836 |
| 633 | Ga0265325_10037542 | 3300031241 | Bacteria | 2561 |
| 634 | Ga0265329_10042012 | 3300031242 | Bacteria | 1465 |
| 635 | Ga0265340_10000694 | 3300031247 | Bacteria | 18937 |
| 636 | Ga0265340_10005839 | 3300031247 | Bacteria | 6812 |
| 637 | Ga0265340_10037432 | 3300031247 | Bacteria | 2403 |
| 638 | Ga0265340_10046022 | 3300031247 | Bacteria | 2129 |
| 639 | Ga0265339_10001969 | 3300031249 | Bacteria | 15094 |
| 640 | Ga0265339_10004309 | 3300031249 | Bacteria | 9731 |
| 641 | Ga0265339_10170567 | 3300031249 | Bacteria | 1089 |
| 642 | Ga0265331_10054802 | 3300031250 | Bacteria | 1898 |
| 643 | Ga0265331_10063819 | 3300031250 | Bacteria | 1735 |
| 644 | Ga0307513_10207965 | 3300031456 | Bacteria | 1791 |
| 645 | Ga0307509_10011299 | 3300031507 | Bacteria | 10828 |
| 646 | Ga0307509_10261457 | 3300031507 | Bacteria | 1506 |
| 647 | Ga0307408_100208005 | 3300031548 | Bacteria | 1588 |
| 648 | Ga0265313_10004767 | 3300031595 | Bacteria | 10226 |
| 649 | Ga0265313_10146705 | 3300031595 | Bacteria | 1011 |
| 650 | Ga0307508_10000046 | 3300031616 | Bacteria | 139709 |
| 651 | Ga0307508_10063610 | 3300031616 | Bacteria | 3255 |
| 652 | Ga0265314_10002061 | 3300031711 | Bacteria | 21230 |
| 653 | Ga0265314_10006588 | 3300031711 | Bacteria | 10231 |
| 654 | Ga0265314_10043659 | 3300031711 | Bacteria | 3185 |
| 655 | Ga0265314_10189388 | 3300031711 | Bacteria | 1226 |
| 656 | Ga0265342_10000178 | 3300031712 | Bacteria | 70648 |
| 657 | Ga0265342_10028149 | 3300031712 | Bacteria | 3504 |
| 658 | Ga0265342_10056469 | 3300031712 | Bacteria | 2327 |
| 659 | Ga0265342_10100660 | 3300031712 | Bacteria | 1646 |
| 660 | Ga0265342_10123090 | 3300031712 | Bacteria | 1459 |
| 661 | Ga0265342_10124229 | 3300031712 | Bacteria | 1451 |
| 662 | Ga0265342_10170509 | 3300031712 | Bacteria | 1197 |
| 663 | Ga0316578_10016976 | 3300031728 | Bacteria | 3952 |
| 664 | Ga0307516_10016335 | 3300031730 | Bacteria | 7767 |
| 665 | Ga0307516_10022356 | 3300031730 | Bacteria | 6496 |
| 666 | Ga0307516_10056447 | 3300031730 | Bacteria | 3829 |
| 667 | Ga0307516_10272985 | 3300031730 | Bacteria | 1376 |
| 668 | Ga0307412_10332525 | 3300031911 | Bacteria | 1213 |
| 669 | Ga0307409_100758087 | 3300031995 | Bacteria | 975 |
| 670 | Ga0307507_10129822 | 3300033179 | Bacteria | 1977 |
| 671 | Ga0307510_10007534 | 3300033180 | Bacteria | 12965 |
| 672 | Ga0307510_10011049 | 3300033180 | Bacteria | 10732 |
| 673 | Ga0307510_10030284 | 3300033180 | Bacteria | 6136 |
| 674 | Ga0307510_10094994 | 3300033180 | Bacteria | 2804 |
| 675 | Ga0307510_10245668 | 3300033180 | Bacteria | 1281 |
| 676 | Ga0307510_10263591 | 3300033180 | Bacteria | 1203 |
| 677 | Ga0315911_1000024 | 3300033442 | Bacteria | 97712 |
| 678 | Ga0373938_0010308 | 3300034957 | Bacteria | 1715 |
| 679 | Ga0373926_0029845 | 3300035083 | Bacteria | 1918 |
| 680 | Ga0373926_0047541 | 3300035083 | Bacteria | 1541 |
| 681 | Ga0373926_0082365 | 3300035083 | Bacteria | 1191 |
| 682 | Ga0373934_0101394 | 3300035086 | Bacteria | 1164 |
| 683 | Ga0373944_0000833 | 3300035089 | Bacteria | 7570 |
| 684 | Ga0373944_0084537 | 3300035089 | Bacteria | 1053 |
| 685 | Ga0373923_0000022 | 3300035111 | Bacteria | 23262 |
| 686 | Ga0373923_0006016 | 3300035111 | Bacteria | 4161 |
| 687 | Ga0373923_0162102 | 3300035111 | Bacteria | 1021 |
| 688 | Ga0373936_0023248 | 3300035113 | Bacteria | 2414 |
| 689 | Ga0373936_0039715 | 3300035113 | Bacteria | 1884 |
| 690 | Ga0373936_0066598 | 3300035113 | Bacteria | 1479 |
| 691 | Ga0373936_0111610 | 3300035113 | Bacteria | 1161 |
| 692 | Ga0373945_0006815 | 3300035116 | Bacteria | 3691 |
| 693 | Ga0373945_0023683 | 3300035116 | Bacteria | 2123 |
| 694 | Ga0373945_0051997 | 3300035116 | Bacteria | 1508 |
| 695 | Ga0373953_0000468 | 3300035117 | Bacteria | 11120 |
| 696 | Ga0373953_0023144 | 3300035117 | Bacteria | 2350 |
| 697 | Ga0373954_0000519 | 3300035118 | Bacteria | 14460 |
| 698 | Ga0373954_0016654 | 3300035118 | Bacteria | 3293 |
| 699 | Ga0373954_0043971 | 3300035118 | Bacteria | 2083 |
| 700 | Ga0373954_0069110 | 3300035118 | Bacteria | 1676 |
| 701 | Ga0373954_0071910 | 3300035118 | Bacteria | 1644 |
| 702 | Ga0373954_0102158 | 3300035118 | Bacteria | 1384 |
| 703 | Ga0373956_0113378 | 3300035119 | Bacteria | 1263 |
| 704 | Ga0373956_0120863 | 3300035119 | Bacteria | 1223 |
| 705 | Ga0373957_0010201 | 3300035120 | Bacteria | 3098 |
| 706 | Ga0373957_0024318 | 3300035120 | Bacteria | 2175 |
| 707 | Ga0373957_0103363 | 3300035120 | Bacteria | 1142 |
| 708 | Ga0373943_0001832 | 3300035170 | Bacteria | 9614 |
| 709 | Ga0373943_0007592 | 3300035170 | Bacteria | 4869 |
| 710 | Ga0373943_0041582 | 3300035170 | Bacteria | 2223 |
| 711 | Ga0373943_0192818 | 3300035170 | Bacteria | 1124 |
| 712 | Ga0373946_0016673 | 3300035171 | Bacteria | 2801 |
| 713 | Ga0373946_0020193 | 3300035171 | Bacteria | 2573 |
| 714 | Ga0373955_0000402 | 3300035172 | Bacteria | 18349 |
| 715 | Ga0373955_0003617 | 3300035172 | Bacteria | 6803 |
| 716 | Ga0373955_0019856 | 3300035172 | Bacteria | 3367 |
| 717 | Ga0373955_0038256 | 3300035172 | Bacteria | 2555 |
| 718 | Ga0373962_0018109 | 3300035242 | Bacteria | 1830 |
| 719 | Ga0316574_0002046 | 3300035398 | Bacteria | 9958 |
| 720 | Ga0373924_0002920 | 3300035410 | Bacteria | 5796 |
| 721 | Ga0373924_0004843 | 3300035410 | Bacteria | 4732 |
| 722 | Ga0373924_0107398 | 3300035410 | Bacteria | 1204 |
| 723 | Ga0373931_0058705 | 3300035691 | Bacteria | 2067 |
| 724 | Ga0373931_0186049 | 3300035691 | Bacteria | 1233 |
| 725 | Ga0373935_0000244 | 3300035692 | Bacteria | 26819 |
| 726 | Ga0373935_0020883 | 3300035692 | Bacteria | 4005 |
| 727 | Ga0373935_0021933 | 3300035692 | Bacteria | 3910 |
| 728 | Ga0373935_0060125 | 3300035692 | Bacteria | 2430 |
| 729 | Ga0373927_0001820 | 3300035695 | Bacteria | 15839 |
| 730 | Ga0373927_0003221 | 3300035695 | Bacteria | 11752 |
| 731 | Ga0373927_0007112 | 3300035695 | Bacteria | 7592 |
| 732 | Ga0373927_0081034 | 3300035695 | Bacteria | 2103 |
| 733 | Ga0373927_0280831 | 3300035695 | Bacteria | 1095 |
| 734 | Ga0373933_0000114 | 3300035724 | Bacteria | 52016 |
| 735 | Ga0373933_0000374 | 3300035724 | Bacteria | 28691 |
| 736 | Ga0373933_0006739 | 3300035724 | Bacteria | 6261 |
| 737 | Ga0373933_0024593 | 3300035724 | Bacteria | 3448 |
| 738 | Ga0373933_0185468 | 3300035724 | Bacteria | 1328 |
| 739 | Ga0373947_0004892 | 3300035725 | Bacteria | 7840 |
| 740 | Ga0373947_0008108 | 3300035725 | Bacteria | 6055 |
| 741 | Ga0373947_0011337 | 3300035725 | Bacteria | 5117 |
| 742 | Ga0373947_0043417 | 3300035725 | Bacteria | 2685 |
| 743 | Ga0373947_0069836 | 3300035725 | Bacteria | 2151 |
| 744 | Ga0373947_0187371 | 3300035725 | Bacteria | 1349 |
| 745 | Ga0373937_0001469 | 3300036401 | Bacteria | 19735 |
| 746 | Ga0373937_0003416 | 3300036401 | Bacteria | 13330 |
| 747 | Ga0373937_0004831 | 3300036401 | Bacteria | 11454 |
| 748 | Ga0373937_0022308 | 3300036401 | Bacteria | 5692 |
| 749 | Ga0373937_0043053 | 3300036401 | Bacteria | 4121 |
| 750 | Ga0373937_0048738 | 3300036401 | Bacteria | 3878 |
| 751 | Ga0373937_0106793 | 3300036401 | Bacteria | 2602 |
| 752 | Ga0373937_0165064 | 3300036401 | Bacteria | 2076 |
| 753 | Ga0373937_0204572 | 3300036401 | Bacteria | 1856 |
| 754 | Ga0373937_0395092 | 3300036401 | Bacteria | 1312 |
| 755 | Ga0316584_0002434 | 3300036712 | Bacteria | 11775 |
| 756 | Ga0373925_0014715 | 3300037068 | Bacteria | 5652 |
| 757 | Ga0373925_0085545 | 3300037068 | Bacteria | 2404 |
| 758 | Ga0373925_0123338 | 3300037068 | Bacteria | 2013 |
| 759 | Ga0395898_0295430 | 3300037466 | Bacteria | 1546 |
| 760 | Ga0395898_0340814 | 3300037466 | Bacteria | 1430 |
| 761 | Ga0395905_0033085 | 3300037471 | Bacteria | 4860 |
| 762 | Ga0395905_0068527 | 3300037471 | Bacteria | 3323 |
| 763 | Ga0395905_0410962 | 3300037471 | Bacteria | 1249 |
| 764 | Ga0436364_0048041 | 3300037853 | Bacteria | 30704 |
| 765 | Ga0436364_1046390 | 3300037853 | Bacteria | 2036 |
| 766 | Ga0395901_0172375 | 3300038443 | Bacteria | 2270 |
| 767 | Ga0395901_0205715 | 3300038443 | Bacteria | 2062 |
| 768 | Ga0395901_0676645 | 3300038443 | Bacteria | 1032 |
| 769 | Ga0436365_0191440 | 3300039437 | Bacteria | 2528 |
| 770 | Ga0436365_0241841 | 3300039437 | Bacteria | 5746 |
| 771 | Ga0436365_0285454 | 3300039437 | Bacteria | 5399 |
| 772 | Ga0436365_0725015 | 3300039437 | Bacteria | 1548 |
| 773 | Ga0436365_0989879 | 3300039437 | Bacteria | 21862 |
| 774 | Ga0436365_1338721 | 3300039437 | Bacteria | 1631 |
| 775 | Ga0436365_1708547 | 3300039437 | Bacteria | 5402 |
| 776 | Ga0436360_0310216 | 3300039438 | Bacteria | 6523 |
| 777 | Ga0436360_0458549 | 3300039438 | Bacteria | 992 |
| 778 | Ga0436360_0872213 | 3300039438 | Bacteria | 1696 |
| 779 | Ga0436360_0875496 | 3300039438 | Bacteria | 2383 |
| 780 | Ga0436361_0240915 | 3300039447 | Bacteria | 2026 |
| 781 | Ga0436361_0863829 | 3300039447 | Bacteria | 1754 |
| 782 | Ga0436361_1092466 | 3300039447 | Bacteria | 5526 |
| 783 | Ga0436363_0151139 | 3300039450 | Bacteria | 1177 |
| 784 | Ga0436363_1043486 | 3300039450 | Bacteria | 2271 |
| 785 | Ga0436363_1360117 | 3300039450 | Bacteria | 1344 |
| 786 | Ga0439465_0076397 | 3300041413 | Bacteria | 1129 |
| 787 | Ga0451833_0242002 | 3300041491 | Bacteria | 1017 |
| 788 | Ga0439443_005520 | 3300042003 | Bacteria | 1694 |
| 789 | Ga0439435_0032036 | 3300042436 | Bacteria | 1433 |
| 790 | Ga0439460_0003551 | 3300042461 | Bacteria | 3768 |
| 791 | Ga0466969_0049520 | 3300044656 | Bacteria | 2073 |
| 792 | Ga0466972_0000048 | 3300044658 | Bacteria | 119165 |
| 793 | Ga0466965_0098425 | 3300044683 | Bacteria | 1494 |
| 794 | Ga0466966_0000238 | 3300044684 | Bacteria | 36401 |
| 795 | Ga0466966_0144923 | 3300044684 | Bacteria | 1450 |
| 796 | Ga0466961_0000044 | 3300044693 | Bacteria | 76071 |
| 797 | Ga0466963_0054300 | 3300044694 | Bacteria | 2662 |
| 798 | Ga0466964_0098777 | 3300044706 | Bacteria | 1283 |
| 799 | Ga0466968_0028990 | 3300044735 | Bacteria | 2286 |
| 800 | Ga0466970_0076533 | 3300044765 | Bacteria | 1803 |
| 801 | Ga0466957_0067374 | 3300044842 | Bacteria | 2208 |
| 802 | Ga0466960_0081361 | 3300044901 | Bacteria | 1633 |
| 803 | Ga0466959_0000963 | 3300045049 | Bacteria | 17121 |
| 804 | Ga0466959_0017608 | 3300045049 | Bacteria | 5239 |
| 805 | Ga0451576_0001156 | 3300045051 | Bacteria | 47552 |
| 806 | Ga0451576_0496630 | 3300045051 | Bacteria | 1282 |
| 807 | Ga0466958_0328904 | 3300045836 | Bacteria | 983 |
| 808 | Ga0466967_0142993 | 3300045976 | Bacteria | 2229 |
| 809 | Ga0466967_0271045 | 3300045976 | Bacteria | 1627 |
| 810 | Ga0495617_020921 | 3300046452 | Bacteria | 2211 |
| 811 | Ga0495627_049161 | 3300046453 | Bacteria | 1274 |
| 812 | Ga0495592_0002074 | 3300046454 | Bacteria | 14129 |
| 813 | Ga0495592_0032704 | 3300046454 | Bacteria | 3922 |
| 814 | Ga0495592_0040311 | 3300046454 | Bacteria | 3505 |
| 815 | Ga0495603_0000370 | 3300046455 | Bacteria | 24383 |
| 816 | Ga0495603_0006854 | 3300046455 | Bacteria | 6834 |
| 817 | Ga0495603_0025017 | 3300046455 | Bacteria | 3611 |
| 818 | Ga0495603_0032180 | 3300046455 | Bacteria | 3156 |
| 819 | Ga0495590_0029439 | 3300046457 | Bacteria | 1925 |
| 820 | Ga0495590_0046024 | 3300046457 | Bacteria | 1522 |
| 821 | Ga0495629_0000081 | 3300046459 | Bacteria | 85305 |
| 822 | Ga0495629_0000380 | 3300046459 | Bacteria | 37205 |
| 823 | Ga0495629_0001124 | 3300046459 | Bacteria | 21212 |
| 824 | Ga0495629_0170162 | 3300046459 | Bacteria | 1512 |
| 825 | Ga0495629_0218504 | 3300046459 | Bacteria | 1315 |
| 826 | Ga0495638_0031456 | 3300046460 | Bacteria | 3411 |
| 827 | Ga0495641_0007097 | 3300046461 | Bacteria | 7091 |
| 828 | Ga0495641_0124184 | 3300046461 | Bacteria | 1152 |
| 829 | Ga0495651_0001523 | 3300046462 | Bacteria | 17910 |
| 830 | Ga0495651_0009321 | 3300046462 | Bacteria | 7534 |
| 831 | Ga0495651_0017237 | 3300046462 | Bacteria | 5597 |
| 832 | Ga0495651_0033842 | 3300046462 | Bacteria | 3985 |
| 833 | Ga0495651_0035032 | 3300046462 | Bacteria | 3911 |
| 834 | Ga0495651_0036906 | 3300046462 | Bacteria | 3805 |
| 835 | Ga0495651_0098692 | 3300046462 | Bacteria | 2179 |
| 836 | Ga0495651_0147119 | 3300046462 | Bacteria | 1702 |
| 837 | Ga0495651_0161790 | 3300046462 | Bacteria | 1603 |
| 838 | Ga0495651_0203471 | 3300046462 | Bacteria | 1384 |
| 839 | Ga0495653_0000807 | 3300046463 | Bacteria | 24078 |
| 840 | Ga0495653_0004588 | 3300046463 | Bacteria | 11168 |
| 841 | Ga0495653_0008281 | 3300046463 | Bacteria | 8525 |
| 842 | Ga0495653_0080323 | 3300046463 | Bacteria | 2413 |
| 843 | Ga0495650_0030451 | 3300046471 | Bacteria | 2445 |
| 844 | Ga0495580_0040123 | 3300046472 | Bacteria | 3347 |
| 845 | Ga0495580_0254571 | 3300046472 | Bacteria | 1201 |
| 846 | Ga0495582_0000051 | 3300046473 | Bacteria | 59010 |
| 847 | Ga0495582_0011691 | 3300046473 | Bacteria | 4837 |
| 848 | Ga0495582_0060346 | 3300046473 | Bacteria | 2093 |
| 849 | Ga0495605_0044972 | 3300046474 | Bacteria | 2179 |
| 850 | Ga0495639_0000010 | 3300046475 | Bacteria | 93685 |
| 851 | Ga0495639_0003638 | 3300046475 | Bacteria | 6641 |
| 852 | Ga0495639_0006195 | 3300046475 | Bacteria | 5137 |
| 853 | Ga0495639_0047817 | 3300046475 | Bacteria | 1939 |
| 854 | Ga0495639_0080272 | 3300046475 | Bacteria | 1518 |
| 855 | Ga0495662_0007880 | 3300046476 | Bacteria | 5243 |
| 856 | Ga0495662_0023141 | 3300046476 | Bacteria | 3000 |
| 857 | Ga0495662_0049960 | 3300046476 | Bacteria | 2018 |
| 858 | Ga0495662_0107253 | 3300046476 | Bacteria | 1368 |
| 859 | Ga0495664_0003734 | 3300046477 | Bacteria | 8306 |
| 860 | Ga0495664_0010817 | 3300046477 | Bacteria | 5131 |
| 861 | Ga0495664_0020718 | 3300046477 | Bacteria | 3794 |
| 862 | Ga0495664_0021685 | 3300046477 | Bacteria | 3711 |
| 863 | Ga0495664_0030030 | 3300046477 | Bacteria | 3183 |
| 864 | Ga0495584_0109513 | 3300046491 | Bacteria | 1397 |
| 865 | Ga0495585_0004363 | 3300046492 | Bacteria | 9196 |
| 866 | Ga0495585_0022427 | 3300046492 | Bacteria | 3624 |
| 867 | Ga0495585_0052914 | 3300046492 | Bacteria | 2247 |
| 868 | Ga0495585_0075849 | 3300046492 | Bacteria | 1827 |
| 869 | Ga0495594_0001074 | 3300046499 | Bacteria | 14256 |
| 870 | Ga0495594_0012226 | 3300046499 | Bacteria | 4470 |
| 871 | Ga0495594_0102654 | 3300046499 | Bacteria | 1609 |
| 872 | Ga0495607_0044870 | 3300046501 | Bacteria | 2603 |
| 873 | Ga0495607_0092938 | 3300046501 | Bacteria | 1631 |
| 874 | Ga0495607_0105301 | 3300046501 | Bacteria | 1504 |
| 875 | Ga0495606_0000265 | 3300046507 | Bacteria | 92526 |
| 876 | Ga0495606_0051543 | 3300046507 | Bacteria | 2683 |
| 877 | Ga0495606_0194748 | 3300046507 | Bacteria | 1159 |
| 878 | Ga0495608_0008172 | 3300046511 | Bacteria | 7348 |
| 879 | Ga0495608_0008410 | 3300046511 | Bacteria | 7230 |
| 880 | Ga0495608_0047354 | 3300046511 | Bacteria | 2858 |
| 881 | Ga0495610_0014371 | 3300046512 | Bacteria | 4652 |
| 882 | Ga0495616_0042659 | 3300046513 | Bacteria | 2308 |
| 883 | Ga0495618_0046111 | 3300046514 | Bacteria | 2750 |
| 884 | Ga0495618_0066259 | 3300046514 | Bacteria | 2296 |
| 885 | Ga0495618_0157063 | 3300046514 | Bacteria | 1451 |
| 886 | Ga0495628_0000115 | 3300046516 | Bacteria | 65159 |
| 887 | Ga0495628_0026354 | 3300046516 | Bacteria | 4741 |
| 888 | Ga0495628_0054423 | 3300046516 | Bacteria | 3155 |
| 889 | Ga0495628_0061993 | 3300046516 | Bacteria | 2932 |
| 890 | Ga0495628_0095564 | 3300046516 | Bacteria | 2296 |
| 891 | Ga0495628_0121237 | 3300046516 | Bacteria | 2005 |
| 892 | Ga0495628_0430908 | 3300046516 | Bacteria | 960 |
| 893 | Ga0495630_0011435 | 3300046517 | Bacteria | 6429 |
| 894 | Ga0495630_0017568 | 3300046517 | Bacteria | 5241 |
| 895 | Ga0495630_0177953 | 3300046517 | Bacteria | 1621 |
| 896 | Ga0495632_0085709 | 3300046519 | Bacteria | 1498 |
| 897 | Ga0495643_0030597 | 3300046522 | Bacteria | 3004 |
| 898 | Ga0495643_0034671 | 3300046522 | Bacteria | 2784 |
| 899 | Ga0495644_0039229 | 3300046523 | Bacteria | 1785 |
| 900 | Ga0495648_0000271 | 3300046524 | Bacteria | 58164 |
| 901 | Ga0495648_0007795 | 3300046524 | Bacteria | 8519 |
| 902 | Ga0495648_0059977 | 3300046524 | Bacteria | 2266 |
| 903 | Ga0495648_0198579 | 3300046524 | Bacteria | 1006 |
| 904 | Ga0495663_0041401 | 3300046525 | Bacteria | 1401 |
| 905 | Ga0495663_0046639 | 3300046525 | Bacteria | 1332 |
| 906 | Ga0495666_0015984 | 3300046526 | Bacteria | 3737 |
| 907 | Ga0495666_0056425 | 3300046526 | Bacteria | 1881 |
| 908 | Ga0495666_0201053 | 3300046526 | Bacteria | 916 |
| 909 | Ga0495642_0040013 | 3300046528 | Bacteria | 1903 |
| 910 | Ga0495652_0007397 | 3300046529 | Bacteria | 10125 |
| 911 | Ga0495652_0020559 | 3300046529 | Bacteria | 5867 |
| 912 | Ga0495652_0068933 | 3300046529 | Bacteria | 2962 |
| 913 | Ga0495652_0084882 | 3300046529 | Bacteria | 2603 |
| 914 | Ga0495652_0130893 | 3300046529 | Bacteria | 1986 |
| 915 | Ga0495654_0024723 | 3300046530 | Bacteria | 3100 |
| 916 | Ga0495665_0000005 | 3300046531 | Bacteria | 86491 |
| 917 | Ga0495665_0023984 | 3300046531 | Bacteria | 3277 |
| 918 | Ga0495665_0026680 | 3300046531 | Bacteria | 3102 |
| 919 | Ga0495640_0000301 | 3300046533 | Bacteria | 33996 |
| 920 | Ga0495640_0009451 | 3300046533 | Bacteria | 7596 |
| 921 | Ga0495640_0012766 | 3300046533 | Bacteria | 6412 |
| 922 | Ga0495640_0019216 | 3300046533 | Bacteria | 5047 |
| 923 | Ga0495587_0002764 | 3300046536 | Bacteria | 11712 |
| 924 | Ga0495587_0037268 | 3300046536 | Bacteria | 2920 |
| 925 | Ga0495587_0042194 | 3300046536 | Bacteria | 2721 |
| 926 | Ga0495587_0072019 | 3300046536 | Bacteria | 2009 |
| 927 | Ga0495598_0004502 | 3300046537 | Bacteria | 3022 |
| 928 | Ga0495598_0025576 | 3300046537 | Bacteria | 1611 |
| 929 | Ga0495598_0050375 | 3300046537 | Bacteria | 1251 |
| 930 | Ga0495621_0030961 | 3300046539 | Bacteria | 1832 |
| 931 | Ga0495597_0142002 | 3300046542 | Bacteria | 990 |
| 932 | Ga0495645_0000994 | 3300046543 | Bacteria | 19292 |
| 933 | Ga0495645_0010387 | 3300046543 | Bacteria | 6525 |
| 934 | Ga0495645_0014229 | 3300046543 | Bacteria | 5643 |
| 935 | Ga0495645_0039260 | 3300046543 | Bacteria | 3454 |
| 936 | Ga0495645_0067971 | 3300046543 | Bacteria | 2573 |
| 937 | Ga0495622_0036869 | 3300046557 | Bacteria | 2278 |
| 938 | Ga0495622_0057834 | 3300046557 | Bacteria | 1796 |
| 939 | Ga0495633_0009170 | 3300046558 | Bacteria | 5491 |
| 940 | Ga0495633_0127635 | 3300046558 | Bacteria | 1177 |
| 941 | Ga0495633_0137651 | 3300046558 | Bacteria | 1129 |
| 942 | Ga0495667_0002081 | 3300046559 | Bacteria | 13300 |
| 943 | Ga0495667_0002874 | 3300046559 | Bacteria | 11538 |
| 944 | Ga0495667_0002956 | 3300046559 | Bacteria | 11399 |
| 945 | Ga0495667_0004975 | 3300046559 | Bacteria | 8988 |
| 946 | Ga0495667_0013842 | 3300046559 | Bacteria | 5448 |
| 947 | Ga0495667_0055145 | 3300046559 | Bacteria | 2614 |
| 948 | Ga0495667_0090933 | 3300046559 | Bacteria | 1977 |
| 949 | Ga0495656_0000981 | 3300046615 | Bacteria | 9245 |
| 950 | Ga0495656_0001491 | 3300046615 | Bacteria | 7662 |
| 951 | Ga0495656_0011915 | 3300046615 | Bacteria | 3199 |
| 952 | Ga0495668_0111830 | 3300046616 | Bacteria | 1494 |
| 953 | Ga0495634_0000764 | 3300046642 | Bacteria | 31101 |
| 954 | Ga0495634_0008147 | 3300046642 | Bacteria | 7807 |
| 955 | Ga0495634_0016602 | 3300046642 | Bacteria | 5262 |
| 956 | Ga0495634_0127514 | 3300046642 | Bacteria | 1625 |
| 957 | Ga0495634_0129531 | 3300046642 | Bacteria | 1609 |
| 958 | Ga0495625_0028874 | 3300046660 | Bacteria | 4153 |
| 959 | Ga0495635_0000213 | 3300046663 | Bacteria | 36809 |
| 960 | Ga0495635_0000259 | 3300046663 | Bacteria | 33960 |
| 961 | Ga0495635_0016975 | 3300046663 | Bacteria | 5084 |
| 962 | Ga0495635_0030094 | 3300046663 | Bacteria | 3774 |
| 963 | Ga0495635_0049090 | 3300046663 | Bacteria | 2909 |
| 964 | Ga0495635_0065423 | 3300046663 | Bacteria | 2494 |
| 965 | Ga0495635_0249981 | 3300046663 | Bacteria | 1195 |
| 966 | Ga0495659_0001624 | 3300046664 | Bacteria | 7546 |
| 967 | Ga0495659_0007589 | 3300046664 | Bacteria | 3440 |
| 968 | Ga0495659_0032403 | 3300046664 | Bacteria | 1829 |
| 969 | Ga0495661_0009639 | 3300046665 | Bacteria | 6617 |
| 970 | Ga0495661_0065688 | 3300046665 | Bacteria | 2137 |
| 971 | Ga0495661_0196732 | 3300046665 | Bacteria | 1058 |
| 972 | Ga0495588_0024498 | 3300046674 | Bacteria | 2998 |
| 973 | Ga0495588_0024537 | 3300046674 | Bacteria | 2996 |
| 974 | Ga0495657_0002844 | 3300046675 | Bacteria | 14362 |
| 975 | Ga0495657_0016391 | 3300046675 | Bacteria | 5399 |
| 976 | Ga0495657_0016908 | 3300046675 | Bacteria | 5303 |
| 977 | Ga0495657_0025579 | 3300046675 | Bacteria | 4190 |
| 978 | Ga0495657_0082646 | 3300046675 | Bacteria | 2075 |
| 979 | Ga0495599_0007346 | 3300046678 | Bacteria | 6680 |
| 980 | Ga0495599_0014241 | 3300046678 | Bacteria | 4923 |
| 981 | Ga0495599_0014708 | 3300046678 | Bacteria | 4846 |
| 982 | Ga0495599_0014832 | 3300046678 | Bacteria | 4826 |
| 983 | Ga0495623_0005373 | 3300046679 | Bacteria | 8381 |
| 984 | Ga0495646_0004387 | 3300046680 | Bacteria | 8886 |
| 985 | Ga0495646_0029664 | 3300046680 | Bacteria | 3419 |
| 986 | Ga0495646_0067197 | 3300046680 | Bacteria | 2119 |
| 987 | Ga0495647_0000671 | 3300046681 | Bacteria | 10182 |
| 988 | Ga0495647_0009031 | 3300046681 | Bacteria | 3363 |
| 989 | Ga0495647_0018362 | 3300046681 | Bacteria | 2489 |
| 990 | Ga0495658_0001217 | 3300046683 | Bacteria | 13511 |
| 991 | Ga0495658_0003377 | 3300046683 | Bacteria | 7909 |
| 992 | Ga0495658_0015731 | 3300046683 | Bacteria | 3885 |
| 993 | Ga0495658_0039662 | 3300046683 | Bacteria | 2614 |
| 994 | Ga0495658_0044760 | 3300046683 | Bacteria | 2481 |
| 995 | Ga0495658_0055581 | 3300046683 | Bacteria | 2255 |
| 996 | Ga0495658_0150455 | 3300046683 | Bacteria | 1429 |
| 997 | Ga0495669_0017236 | 3300046684 | Bacteria | 3098 |
| 998 | Ga0495613_0001985 | 3300046689 | Bacteria | 15542 |
| 999 | Ga0495613_0008073 | 3300046689 | Bacteria | 7825 |
| 1000 | Ga0495613_0029070 | 3300046689 | Bacteria | 4109 |
| 1001 | Ga0495613_0039681 | 3300046689 | Bacteria | 3490 |
| 1002 | Ga0495613_0040397 | 3300046689 | Bacteria | 3457 |
| 1003 | Ga0495624_0000094 | 3300046690 | Bacteria | 59911 |
| 1004 | Ga0495624_0005832 | 3300046690 | Bacteria | 8812 |
| 1005 | Ga0495624_0039916 | 3300046690 | Bacteria | 3008 |
| 1006 | Ga0495624_0105692 | 3300046690 | Bacteria | 1732 |
| 1007 | Ga0495624_0221826 | 3300046690 | Bacteria | 1146 |
| 1008 | Ga0495670_0006395 | 3300046691 | Bacteria | 5787 |
| 1009 | Ga0495670_0020245 | 3300046691 | Bacteria | 3279 |
| 1010 | Ga0495670_0035981 | 3300046691 | Bacteria | 2466 |
| 1011 | Ga0495670_0079467 | 3300046691 | Bacteria | 1669 |
| 1012 | Ga0495649_0045404 | 3300046694 | Bacteria | 2395 |
| 1013 | Ga0495649_0150303 | 3300046694 | Bacteria | 1224 |
| 1014 | Ga0495589_0082575 | 3300046794 | Bacteria | 1562 |
| 1015 | Ga0495600_0001029 | 3300046809 | Bacteria | 15081 |
| 1016 | Ga0495600_0001162 | 3300046809 | Bacteria | 14346 |
| 1017 | Ga0495600_0002671 | 3300046809 | Bacteria | 10307 |
| 1018 | Ga0495600_0010441 | 3300046809 | Bacteria | 5764 |
| 1019 | Ga0495600_0077585 | 3300046809 | Bacteria | 2169 |
| 1020 | Ga0495600_0197916 | 3300046809 | Bacteria | 1291 |
| 1021 | Ga0495600_0244756 | 3300046809 | Bacteria | 1142 |
| 1022 | Ga0495581_0001146 | 3300047315 | Bacteria | 14489 |
| 1023 | Ga0495581_0039890 | 3300047315 | Bacteria | 2718 |
| 1024 | Ga0495581_0054963 | 3300047315 | Bacteria | 2298 |
| 1025 | Ga0495581_0059405 | 3300047315 | Bacteria | 2210 |
| 1026 | Ga0495581_0062688 | 3300047315 | Bacteria | 2148 |
| 1027 | Ga0495581_0120994 | 3300047315 | Bacteria | 1523 |
| 1028 | Ga0495581_0233294 | 3300047315 | Bacteria | 1076 |
| 1029 | Ga0495604_0002338 | 3300047317 | Bacteria | 15198 |
| 1030 | Ga0495604_0002686 | 3300047317 | Bacteria | 14260 |
| 1031 | Ga0495604_0005951 | 3300047317 | Bacteria | 9677 |
| 1032 | Ga0495604_0015525 | 3300047317 | Bacteria | 6078 |
| 1033 | Ga0495604_0061087 | 3300047317 | Bacteria | 2883 |
| 1034 | Ga0495604_0150464 | 3300047317 | Bacteria | 1654 |
| 1035 | Ga0495636_0044370 | 3300047318 | Bacteria | 1851 |
| 1036 | Ga0495674_0000955 | 3300047319 | Bacteria | 27621 |
| 1037 | Ga0495674_0015736 | 3300047319 | Bacteria | 7061 |
| 1038 | Ga0495674_0033074 | 3300047319 | Bacteria | 4686 |
| 1039 | Ga0495674_0093291 | 3300047319 | Bacteria | 2569 |
| 1040 | Ga0495672_0016111 | 3300047320 | Bacteria | 5050 |
| 1041 | Ga0495672_0085617 | 3300047320 | Bacteria | 1746 |
| 1042 | Ga0495676_0067157 | 3300047321 | Bacteria | 2775 |
| 1043 | Ga0495680_0002637 | 3300047322 | Bacteria | 18206 |
| 1044 | Ga0495680_0013217 | 3300047322 | Bacteria | 7212 |
| 1045 | Ga0495680_0014747 | 3300047322 | Bacteria | 6755 |
| 1046 | Ga0495680_0077921 | 3300047322 | Bacteria | 2509 |
| 1047 | Ga0495680_0095688 | 3300047322 | Bacteria | 2219 |
| 1048 | Ga0495680_0135662 | 3300047322 | Bacteria | 1804 |
| 1049 | Ga0495675_0000756 | 3300047444 | Bacteria | 20233 |
| 1050 | Ga0495675_0009113 | 3300047444 | Bacteria | 6169 |
| 1051 | Ga0495675_0020522 | 3300047444 | Bacteria | 4204 |
| 1052 | Ga0495675_0042090 | 3300047444 | Bacteria | 2909 |
| 1053 | Ga0495679_023599 | 3300047446 | Bacteria | 2084 |
| 1054 | Ga0495679_057589 | 3300047446 | Bacteria | 1149 |
| 1055 | Ga0495673_0046413 | 3300047469 | Bacteria | 1925 |
| 1056 | Ga0495684_0000052 | 3300047471 | Bacteria | 85125 |
| 1057 | Ga0495684_0005982 | 3300047471 | Bacteria | 9452 |
| 1058 | Ga0495684_0021687 | 3300047471 | Bacteria | 4946 |
| 1059 | Ga0495684_0034401 | 3300047471 | Bacteria | 3887 |
| 1060 | Ga0495684_0039927 | 3300047471 | Bacteria | 3598 |
| 1061 | Ga0495593_0000084 | 3300047673 | Bacteria | 41155 |
| 1062 | Ga0495593_0000518 | 3300047673 | Bacteria | 21864 |
| 1063 | Ga0495593_0030920 | 3300047673 | Bacteria | 2927 |
| 1064 | Ga0495593_0044493 | 3300047673 | Bacteria | 2374 |
| 1065 | Ga0495602_0005240 | 3300048088 | Bacteria | 13587 |
| 1066 | Ga0495602_0017645 | 3300048088 | Bacteria | 7150 |
| 1067 | Ga0495602_0067122 | 3300048088 | Bacteria | 3087 |
| 1068 | Ga0495602_0172220 | 3300048088 | Bacteria | 1679 |
| 1069 | Ga0496100_0002070 | 3300048903 | Bacteria | 10081 |
| 1070 | Ga0496100_0003202 | 3300048903 | Bacteria | 8501 |
| 1071 | Ga0496100_0007436 | 3300048903 | Bacteria | 6043 |
| 1072 | Ga0496100_0011757 | 3300048903 | Bacteria | 4992 |
| 1073 | Ga0496100_0074702 | 3300048903 | Bacteria | 2272 |
| 1074 | Ga0496101_0010499 | 3300048904 | Bacteria | 6116 |
| 1075 | Ga0496101_0013727 | 3300048904 | Bacteria | 5433 |
| 1076 | Ga0496101_0086452 | 3300048904 | Bacteria | 2325 |
| 1077 | Ga0496101_0112749 | 3300048904 | Bacteria | 2048 |
| 1078 | Ga0496101_0190511 | 3300048904 | Bacteria | 1582 |
| 1079 | Ga0496101_0190527 | 3300048904 | Bacteria | 1582 |
| 1080 | Ga0496102_0002260 | 3300048905 | Bacteria | 16503 |
| 1081 | Ga0496102_0008445 | 3300048905 | Bacteria | 8828 |
| 1082 | Ga0496102_0012347 | 3300048905 | Bacteria | 7391 |
| 1083 | Ga0496102_0028962 | 3300048905 | Bacteria | 4950 |
| 1084 | Ga0496102_0085393 | 3300048905 | Bacteria | 2914 |
| 1085 | Ga0496102_0133391 | 3300048905 | Bacteria | 2326 |
| 1086 | Ga0496102_0213438 | 3300048905 | Bacteria | 1819 |
| 1087 | Ga0496102_0264513 | 3300048905 | Bacteria | 1621 |
| 1088 | Ga0496102_0287089 | 3300048905 | Bacteria | 1551 |
| 1089 | Ga0496103_0010418 | 3300048906 | Bacteria | 5501 |
| 1090 | Ga0496103_0190253 | 3300048906 | Bacteria | 1319 |
| 1091 | Ga0496103_0232674 | 3300048906 | Bacteria | 1185 |
| 1092 | Ga0496104_0000355 | 3300048907 | Bacteria | 40904 |
| 1093 | Ga0496104_0002092 | 3300048907 | Bacteria | 17331 |
| 1094 | Ga0496104_0002505 | 3300048907 | Bacteria | 15804 |
| 1095 | Ga0496104_0005097 | 3300048907 | Bacteria | 11465 |
| 1096 | Ga0496104_0013196 | 3300048907 | Bacteria | 7447 |
| 1097 | Ga0496104_0013207 | 3300048907 | Bacteria | 7444 |
| 1098 | Ga0496104_0031130 | 3300048907 | Bacteria | 4960 |
| 1099 | Ga0496104_0100268 | 3300048907 | Bacteria | 2772 |
| 1100 | Ga0496104_0111701 | 3300048907 | Bacteria | 2620 |
| 1101 | Ga0496104_0115091 | 3300048907 | Bacteria | 2580 |
| 1102 | Ga0496104_0154112 | 3300048907 | Bacteria | 2205 |
| 1103 | Ga0496104_0169359 | 3300048907 | Bacteria | 2094 |
| 1104 | Ga0496104_0196077 | 3300048907 | Bacteria | 1931 |
| 1105 | Ga0496104_0252609 | 3300048907 | Bacteria | 1676 |
| 1106 | Ga0496104_0280421 | 3300048907 | Bacteria | 1579 |
| 1107 | Ga0496105_0007792 | 3300048908 | Bacteria | 8312 |
| 1108 | Ga0496105_0009967 | 3300048908 | Bacteria | 7454 |
| 1109 | Ga0496105_0036325 | 3300048908 | Bacteria | 4058 |
| 1110 | Ga0496105_0043466 | 3300048908 | Bacteria | 3705 |
| 1111 | Ga0496105_0047162 | 3300048908 | Bacteria | 3555 |
| 1112 | Ga0496105_0103471 | 3300048908 | Bacteria | 2351 |
| 1113 | Ga0496105_0107881 | 3300048908 | Bacteria | 2299 |
| 1114 | Ga0496106_0000262 | 3300048909 | Bacteria | 36919 |
| 1115 | Ga0496106_0005300 | 3300048909 | Bacteria | 9553 |
| 1116 | Ga0496106_0007107 | 3300048909 | Bacteria | 8273 |
| 1117 | Ga0496106_0009020 | 3300048909 | Bacteria | 7369 |
| 1118 | Ga0496106_0031238 | 3300048909 | Bacteria | 3968 |
| 1119 | Ga0496106_0130848 | 3300048909 | Bacteria | 1968 |
| 1120 | Ga0496106_0141426 | 3300048909 | Bacteria | 1893 |
| 1121 | Ga0496106_0283172 | 3300048909 | Bacteria | 1328 |
| 1122 | Ga0496106_0286362 | 3300048909 | Bacteria | 1320 |
| 1123 | Ga0496107_0006402 | 3300048910 | Bacteria | 8092 |
| 1124 | Ga0496107_0008145 | 3300048910 | Bacteria | 7249 |
| 1125 | Ga0496107_0026340 | 3300048910 | Bacteria | 4121 |
| 1126 | Ga0496107_0095745 | 3300048910 | Bacteria | 2172 |
| 1127 | Ga0496107_0180235 | 3300048910 | Bacteria | 1568 |
| 1128 | Ga0496107_0189534 | 3300048910 | Bacteria | 1527 |
| 1129 | Ga0496108_0000357 | 3300048911 | Bacteria | 38614 |
| 1130 | Ga0496108_0002206 | 3300048911 | Bacteria | 15586 |
| 1131 | Ga0496108_0019692 | 3300048911 | Bacteria | 5542 |
| 1132 | Ga0496108_0036720 | 3300048911 | Bacteria | 4077 |
| 1133 | Ga0496108_0128267 | 3300048911 | Bacteria | 2179 |
| 1134 | Ga0496108_0152555 | 3300048911 | Bacteria | 1994 |
| 1135 | Ga0496108_0255222 | 3300048911 | Bacteria | 1525 |
| 1136 | Ga0496108_0334821 | 3300048911 | Bacteria | 1320 |
| 1137 | Ga0496108_0381278 | 3300048911 | Bacteria | 1231 |
| 1138 | Ga0496109_0001120 | 3300048912 | Bacteria | 22267 |
| 1139 | Ga0496109_0002394 | 3300048912 | Bacteria | 15685 |
| 1140 | Ga0496109_0003393 | 3300048912 | Bacteria | 13328 |
| 1141 | Ga0496109_0019820 | 3300048912 | Bacteria | 5934 |
| 1142 | Ga0496109_0033231 | 3300048912 | Bacteria | 4640 |
| 1143 | Ga0496109_0068095 | 3300048912 | Bacteria | 3262 |
| 1144 | Ga0496109_0073170 | 3300048912 | Bacteria | 3149 |
| 1145 | Ga0496109_0115139 | 3300048912 | Bacteria | 2501 |
| 1146 | Ga0496109_0171529 | 3300048912 | Bacteria | 2035 |
| 1147 | Ga0496109_0200548 | 3300048912 | Bacteria | 1875 |
| 1148 | Ga0496109_0303959 | 3300048912 | Bacteria | 1504 |
| 1149 | Ga0496109_0311271 | 3300048912 | Bacteria | 1486 |
| 1150 | Ga0496109_0450813 | 3300048912 | Bacteria | 1215 |
| 1151 | Ga0496110_0000205 | 3300048913 | Bacteria | 37706 |
| 1152 | Ga0496110_0000214 | 3300048913 | Bacteria | 37211 |
| 1153 | Ga0496110_0003778 | 3300048913 | Bacteria | 11663 |
| 1154 | Ga0496110_0011003 | 3300048913 | Bacteria | 7383 |
| 1155 | Ga0496110_0033779 | 3300048913 | Bacteria | 4427 |
| 1156 | Ga0496110_0059615 | 3300048913 | Bacteria | 3365 |
| 1157 | Ga0496110_0234627 | 3300048913 | Bacteria | 1669 |
| 1158 | Ga0496111_0009382 | 3300048914 | Bacteria | 6526 |
| 1159 | Ga0496111_0017446 | 3300048914 | Bacteria | 4963 |
| 1160 | Ga0496111_0021207 | 3300048914 | Bacteria | 4533 |
| 1161 | Ga0496111_0029313 | 3300048914 | Bacteria | 3908 |
| 1162 | Ga0496111_0074574 | 3300048914 | Bacteria | 2471 |
| 1163 | Ga0496111_0118345 | 3300048914 | Bacteria | 1955 |
| 1164 | Ga0496112_0000019 | 3300048915 | Bacteria | 185531 |
| 1165 | Ga0496112_0006469 | 3300048915 | Bacteria | 10288 |
| 1166 | Ga0496112_0008306 | 3300048915 | Bacteria | 9290 |
| 1167 | Ga0496112_0014600 | 3300048915 | Bacteria | 7297 |
| 1168 | Ga0496112_0018368 | 3300048915 | Bacteria | 6583 |
| 1169 | Ga0496112_0049850 | 3300048915 | Bacteria | 4104 |
| 1170 | Ga0496112_0051135 | 3300048915 | Bacteria | 4053 |
| 1171 | Ga0496112_0060871 | 3300048915 | Bacteria | 3720 |
| 1172 | Ga0496112_0081318 | 3300048915 | Bacteria | 3204 |
| 1173 | Ga0496112_0115121 | 3300048915 | Bacteria | 2659 |
| 1174 | Ga0496112_0161353 | 3300048915 | Bacteria | 2208 |
| 1175 | Ga0496113_0006975 | 3300048916 | Bacteria | 7223 |
| 1176 | Ga0496113_0010586 | 3300048916 | Bacteria | 6104 |
| 1177 | Ga0496113_0012822 | 3300048916 | Bacteria | 5649 |
| 1178 | Ga0496113_0014335 | 3300048916 | Bacteria | 5405 |
| 1179 | Ga0496113_0100574 | 3300048916 | Bacteria | 2240 |
| 1180 | Ga0496113_0121802 | 3300048916 | Bacteria | 2040 |
| 1181 | Ga0496113_0182381 | 3300048916 | Bacteria | 1664 |
| 1182 | Ga0496113_0247459 | 3300048916 | Bacteria | 1423 |
| 1183 | Ga0496114_0001228 | 3300048917 | Bacteria | 19391 |
| 1184 | Ga0496114_0029582 | 3300048917 | Bacteria | 4505 |
| 1185 | Ga0496114_0033066 | 3300048917 | Bacteria | 4260 |
| 1186 | Ga0496114_0089379 | 3300048917 | Bacteria | 2614 |
| 1187 | Ga0496114_0210258 | 3300048917 | Bacteria | 1706 |
| 1188 | Ga0496114_0275296 | 3300048917 | Bacteria | 1483 |
| 1189 | Ga0496114_0352468 | 3300048917 | Bacteria | 1302 |
| 1190 | Ga0496114_0455267 | 3300048917 | Bacteria | 1133 |
| 1191 | Ga0496114_0656683 | 3300048917 | Bacteria | 922 |
| 1192 | Ga0496115_0004229 | 3300048918 | Bacteria | 10380 |
| 1193 | Ga0496115_0008048 | 3300048918 | Bacteria | 7783 |
| 1194 | Ga0496115_0021524 | 3300048918 | Bacteria | 4983 |
| 1195 | Ga0496115_0029321 | 3300048918 | Bacteria | 4321 |
| 1196 | Ga0496115_0080259 | 3300048918 | Bacteria | 2656 |
| 1197 | Ga0496115_0084242 | 3300048918 | Bacteria | 2592 |
| 1198 | Ga0496115_0152003 | 3300048918 | Bacteria | 1912 |
| 1199 | Ga0496115_0287002 | 3300048918 | Bacteria | 1350 |
| 1200 | Ga0496115_0316617 | 3300048918 | Bacteria | 1277 |
| 1201 | Ga0496116_0002417 | 3300048919 | Bacteria | 19673 |
| 1202 | Ga0496116_0050987 | 3300048919 | Bacteria | 2752 |
| 1203 | Ga0496117_0018002 | 3300048920 | Bacteria | 5878 |
| 1204 | Ga0496117_0023389 | 3300048920 | Bacteria | 4927 |
| 1205 | Ga0496117_0087055 | 3300048920 | Bacteria | 2026 |
| 1206 | Ga0496117_0088117 | 3300048920 | Bacteria | 2009 |
| 1207 | Ga0496118_0012386 | 3300048921 | Bacteria | 8194 |
| 1208 | Ga0496118_0049433 | 3300048921 | Bacteria | 3238 |
| 1209 | Ga0496118_0053446 | 3300048921 | Bacteria | 3070 |
| 1210 | Ga0496118_0103252 | 3300048921 | Bacteria | 1918 |
| 1211 | Ga0496118_0108023 | 3300048921 | Bacteria | 1856 |
| 1212 | Ga0496118_0202765 | 3300048921 | Bacteria | 1173 |
| 1213 | Ga0496119_0054246 | 3300048922 | Bacteria | 2442 |
| 1214 | Ga0496119_0054585 | 3300048922 | Bacteria | 2432 |
| 1215 | Ga0496120_0075070 | 3300048923 | Bacteria | 1846 |
| 1216 | Ga0496121_0001792 | 3300048924 | Bacteria | 34718 |
| 1217 | Ga0496121_0002340 | 3300048924 | Bacteria | 29257 |
| 1218 | Ga0496121_0009331 | 3300048924 | Bacteria | 11311 |
| 1219 | Ga0496121_0010594 | 3300048924 | Bacteria | 10360 |
| 1220 | Ga0496121_0021376 | 3300048924 | Bacteria | 6340 |
| 1221 | Ga0496121_0023069 | 3300048924 | Bacteria | 6011 |
| 1222 | Ga0496121_0038228 | 3300048924 | Bacteria | 4254 |
| 1223 | Ga0496121_0069240 | 3300048924 | Bacteria | 2849 |
| 1224 | Ga0496121_0078424 | 3300048924 | Bacteria | 2626 |
| 1225 | Ga0496121_0128909 | 3300048924 | Bacteria | 1897 |
| 1226 | Ga0496121_0139294 | 3300048924 | Bacteria | 1802 |
| 1227 | Ga0496121_0170352 | 3300048924 | Bacteria | 1582 |
| 1228 | Ga0496121_0182789 | 3300048924 | Bacteria | 1511 |
| 1229 | Ga0496122_0043715 | 3300048925 | Bacteria | 3506 |
| 1230 | Ga0496122_0061496 | 3300048925 | Bacteria | 2756 |
| 1231 | Ga0496122_0062910 | 3300048925 | Bacteria | 2713 |
| 1232 | Ga0496123_0044422 | 3300048926 | Bacteria | 3038 |
| 1233 | Ga0496123_0059825 | 3300048926 | Bacteria | 2460 |
| 1234 | Ga0496124_0002998 | 3300048927 | Bacteria | 21122 |
| 1235 | Ga0496124_0116329 | 3300048927 | Bacteria | 2144 |
| 1236 | Ga0496124_0117952 | 3300048927 | Bacteria | 2125 |
| 1237 | Ga0496124_0141815 | 3300048927 | Bacteria | 1895 |
| 1238 | Ga0496124_0311228 | 3300048927 | Bacteria | 1132 |
| 1239 | Ga0496125_0000048 | 3300048928 | Bacteria | 290651 |
| 1240 | Ga0496125_0003042 | 3300048928 | Bacteria | 20965 |
| 1241 | Ga0496125_0020421 | 3300048928 | Bacteria | 6217 |
| 1242 | Ga0496125_0020601 | 3300048928 | Bacteria | 6186 |
| 1243 | Ga0496125_0033975 | 3300048928 | Bacteria | 4503 |
| 1244 | Ga0496125_0045631 | 3300048928 | Bacteria | 3685 |
| 1245 | Ga0496125_0048395 | 3300048928 | Bacteria | 3546 |
| 1246 | Ga0496125_0125076 | 3300048928 | Bacteria | 1824 |
| 1247 | Ga0496126_0001531 | 3300048929 | Bacteria | 35598 |
| 1248 | Ga0496126_0007269 | 3300048929 | Bacteria | 12174 |
| 1249 | Ga0496126_0022191 | 3300048929 | Bacteria | 6182 |
| 1250 | Ga0496126_0053197 | 3300048929 | Bacteria | 3675 |
| 1251 | Ga0496126_0063890 | 3300048929 | Bacteria | 3298 |
| 1252 | Ga0496126_0084610 | 3300048929 | Bacteria | 2797 |
| 1253 | Ga0496126_0085677 | 3300048929 | Bacteria | 2777 |
| 1254 | Ga0496126_0201529 | 3300048929 | Bacteria | 1680 |
| 1255 | Ga0496126_0386822 | 3300048929 | Bacteria | 1137 |
| 1256 | Ga0495682_0106530 | 3300049460 | Bacteria | 1005 |
| 1257 | Ga0501040_0205804 | 3300049576 | Bacteria | 1398 |
| 1258 | Ga0501040_0232929 | 3300049576 | Bacteria | 1312 |
| 1259 | Ga0501072_0012253 | 3300049588 | Bacteria | 6553 |
| 1260 | Ga0501072_0178888 | 3300049588 | Bacteria | 1692 |
| 1261 | Ga0501076_0360227 | 3300049592 | Bacteria | 1195 |
| 1262 | Ga0501079_0158269 | 3300049741 | Bacteria | 1766 |
| 1263 | Ga0501080_0189941 | 3300049742 | Bacteria | 1888 |
| 1264 | Ga0501081_0023726 | 3300049743 | Bacteria | 4113 |
| 1265 | nmdc:mga03683_115613_c1 | 3300050489 | Bacteria | 1190 |
| 1266 | nmdc:mga03683_12165_c1 | 3300050489 | Bacteria | 3136 |
| 1267 | nmdc:mga03683_5238_c1 | 3300050489 | Bacteria | 4367 |
| 1268 | nmdc:mga03683_61544_c1 | 3300050489 | Bacteria | 1588 |
| 1269 | nmdc:mga03n38_110650_c1 | 3300050490 | Bacteria | 1337 |
| 1270 | nmdc:mga03n38_1386_c1 | 3300050490 | Bacteria | 6887 |
| 1271 | nmdc:mga03n38_152415_c1 | 3300050490 | Bacteria | 1164 |
| 1272 | nmdc:mga03n38_38856_c1 | 3300050490 | Bacteria | 2061 |
| 1273 | nmdc:mga03n38_93275_c1 | 3300050490 | Bacteria | 1438 |
| 1274 | nmdc:mga00v17_161423_c1 | 3300050491 | Bacteria | 1443 |
| 1275 | nmdc:mga00v17_193505_c1 | 3300050491 | Bacteria | 1314 |
| 1276 | nmdc:mga00v17_235422_c1 | 3300050491 | Bacteria | 1187 |
| 1277 | nmdc:mga00v17_318133_c1 | 3300050491 | Bacteria | 1011 |
| 1278 | nmdc:mga00v17_358939_c1 | 3300050491 | Bacteria | 947 |
| 1279 | nmdc:mga00v17_82162_c1 | 3300050491 | Bacteria | 2013 |
| 1280 | nmdc:mga0yw44_127834_c1 | 3300050492 | Bacteria | 1642 |
| 1281 | nmdc:mga0yw44_330496_c1 | 3300050492 | Bacteria | 1024 |
| 1282 | nmdc:mga0yw44_403898_c1 | 3300050492 | Bacteria | 924 |
| 1283 | nmdc:mga0yw44_59246_c1 | 3300050492 | Bacteria | 2342 |
| 1284 | nmdc:mga0yw44_92609_c1 | 3300050492 | Bacteria | 1913 |
| 1285 | nmdc:mga0k408_18266_c1 | 3300050493 | Bacteria | 3913 |
| 1286 | nmdc:mga0k408_27566_c1 | 3300050493 | Bacteria | 3227 |
| 1287 | nmdc:mga0k408_29533_c1 | 3300050493 | Bacteria | 3121 |
| 1288 | nmdc:mga0k408_77148_c1 | 3300050493 | Bacteria | 1948 |
| 1289 | nmdc:mga06z11_207236_c1 | 3300050494 | Bacteria | 1141 |
| 1290 | nmdc:mga06z11_46885_c1 | 3300050494 | Bacteria | 2192 |
| 1291 | nmdc:mga06z11_60561_c1 | 3300050494 | Bacteria | 1971 |
| 1292 | nmdc:mga06z11_672_c1 | 3300050494 | Bacteria | 12432 |
| 1293 | nmdc:mga04h51_38042_c1 | 3300050495 | Bacteria | 1556 |
| 1294 | nmdc:mga04h51_42884_c1 | 3300050495 | Bacteria | 1486 |
| 1295 | nmdc:mga04h51_671_c1 | 3300050495 | Bacteria | 7931 |
| 1296 | nmdc:mga07m45_103435_c1 | 3300050496 | Bacteria | 1637 |
| 1297 | nmdc:mga07m45_8956_c1 | 3300050496 | Bacteria | 5168 |
| 1298 | nmdc:mga05p37_277222_c1 | 3300050507 | Bacteria | 2001 |
| 1299 | nmdc:mga05p37_289475_c1 | 3300050507 | Bacteria | 1950 |
| 1300 | nmdc:mga05p37_337234_c1 | 3300050507 | Bacteria | 1779 |
| 1301 | nmdc:mga05p37_33971_c1 | 3300050507 | Bacteria | 6247 |
| 1302 | nmdc:mga05p37_63416_c1 | 3300050507 | Bacteria | 4547 |
| 1303 | nmdc:mga0qj67_20_c1 | 3300050509 | Bacteria | 109238 |
| 1304 | nmdc:mga0qj67_93234_c1 | 3300050509 | Bacteria | 2421 |
| 1305 | nmdc:mga06r32_102633_c1 | 3300050510 | Bacteria | 2808 |
| 1306 | nmdc:mga06r32_113971_c1 | 3300050510 | Bacteria | 2661 |
| 1307 | nmdc:mga06r32_415863_c1 | 3300050510 | Bacteria | 1326 |
| 1308 | nmdc:mga06r32_86776_c1 | 3300050510 | Bacteria | 3052 |
| 1309 | nmdc:mga08y16_125408_c1 | 3300050511 | Bacteria | 2671 |
| 1310 | nmdc:mga08y16_159658_c1 | 3300050511 | Bacteria | 2342 |
| 1311 | nmdc:mga0n895_170663_c1 | 3300050512 | Bacteria | 2207 |
| 1312 | nmdc:mga0n895_216861_c1 | 3300050512 | Bacteria | 1943 |
| 1313 | nmdc:mga0n895_244620_c1 | 3300050512 | Bacteria | 1821 |
| 1314 | nmdc:mga0rr50_88932_c1 | 3300050513 | Bacteria | 2400 |
| 1315 | nmdc:mga0a205_123013_c1 | 3300050515 | Bacteria | 2494 |
| 1316 | nmdc:mga0a205_170388_c1 | 3300050515 | Bacteria | 2073 |
| 1317 | nmdc:mga0sz30_1011_c1 | 3300050516 | Bacteria | 3247 |
| 1318 | nmdc:mga0sz30_13780_c1 | 3300050516 | Bacteria | 3171 |
| 1319 | nmdc:mga0sz30_63010_c1 | 3300050516 | Bacteria | 1587 |
| 1320 | nmdc:mga0sz30_66381_c1 | 3300050516 | Bacteria | 1548 |
| 1321 | nmdc:mga0sz30_72291_c1 | 3300050516 | Bacteria | 1486 |
| 1322 | nmdc:mga0sz30_88011_c1 | 3300050516 | Bacteria | 1349 |
| 1323 | Ga0495601_0000305 | 3300053077 | Bacteria | 26104 |
| 1324 | Ga0495601_0011287 | 3300053077 | Bacteria | 5340 |
| 1325 | Ga0495601_0018567 | 3300053077 | Bacteria | 4234 |
| 1326 | Ga0495601_0029678 | 3300053077 | Bacteria | 3394 |
| 1327 | Ga0495601_0046252 | 3300053077 | Bacteria | 2739 |
| 1328 | Ga0495601_0049541 | 3300053077 | Bacteria | 2648 |
| 1329 | Ga0495601_0097121 | 3300053077 | Bacteria | 1900 |
| 1330 | Ga0495601_0134956 | 3300053077 | Bacteria | 1608 |
| 1331 | Ga0495612_0001062 | 3300053078 | Bacteria | 11245 |
| 1332 | Ga0495612_0010200 | 3300053078 | Bacteria | 3800 |
| 1333 | Ga0495612_0137247 | 3300053078 | Bacteria | 1059 |
| 1334 | Ga0500635_0002948 | 3300053080 | Bacteria | 4241 |
| 1335 | Ga0495595_0000258 | 3300053084 | Bacteria | 21114 |
| 1336 | Ga0495595_0000279 | 3300053084 | Bacteria | 20119 |
| 1337 | Ga0495595_0005878 | 3300053084 | Bacteria | 4974 |
| 1338 | Ga0495595_0007822 | 3300053084 | Bacteria | 4378 |
| 1339 | Ga0495595_0034009 | 3300053084 | Bacteria | 2303 |
| 1340 | Ga0495619_0000159 | 3300053085 | Bacteria | 49689 |
| 1341 | Ga0495619_0000377 | 3300053085 | Bacteria | 30766 |
| 1342 | Ga0495619_0000870 | 3300053085 | Bacteria | 19823 |
| 1343 | Ga0495619_0000913 | 3300053085 | Bacteria | 19380 |
| 1344 | Ga0495619_0018863 | 3300053085 | Bacteria | 4380 |
| 1345 | Ga0495619_0025691 | 3300053085 | Bacteria | 3784 |
| 1346 | Ga0495619_0032296 | 3300053085 | Bacteria | 3396 |
| 1347 | Ga0495619_0041017 | 3300053085 | Bacteria | 3027 |
| 1348 | Ga0495619_0080962 | 3300053085 | Bacteria | 2186 |
| 1349 | Ga0495619_0151021 | 3300053085 | Bacteria | 1602 |
| 1350 | Ga0495619_0160939 | 3300053085 | Bacteria | 1550 |
| 1351 | Ga0495619_0242024 | 3300053085 | Bacteria | 1250 |
| 1352 | Ga0500578_0154231 | 3300053086 | Bacteria | 1429 |
| 1353 | Ga0500578_0191848 | 3300053086 | Bacteria | 1254 |
| 1354 | Ga0500643_000091 | 3300053087 | Bacteria | 93825 |
| 1355 | Ga0500644_0014191 | 3300053088 | Bacteria | 2243 |
| 1356 | Ga0500581_003120 | 3300053089 | Bacteria | 7361 |
| 1357 | Ga0500646_0007849 | 3300053090 | Bacteria | 2728 |
| 1358 | Ga0500646_0085887 | 3300053090 | Bacteria | 967 |
| 1359 | Ga0500647_0019458 | 3300053091 | Bacteria | 3153 |
| 1360 | Ga0500647_0035940 | 3300053091 | Bacteria | 2368 |
| 1361 | Ga0500583_0061791 | 3300053092 | Bacteria | 1770 |
| 1362 | Ga0500583_0075530 | 3300053092 | Bacteria | 1619 |
| 1363 | Ga0500651_0003570 | 3300053093 | Bacteria | 8523 |
| 1364 | Ga0500651_0021493 | 3300053093 | Bacteria | 4023 |
| 1365 | Ga0500651_0041703 | 3300053093 | Bacteria | 2893 |
| 1366 | Ga0500651_0044167 | 3300053093 | Bacteria | 2807 |
| 1367 | Ga0500566_0000199 | 3300053094 | Bacteria | 31473 |
| 1368 | Ga0500566_0001862 | 3300053094 | Bacteria | 12407 |
| 1369 | Ga0500566_0005554 | 3300053094 | Bacteria | 7494 |
| 1370 | Ga0500566_0011591 | 3300053094 | Bacteria | 5190 |
| 1371 | Ga0500566_0147602 | 3300053094 | Bacteria | 1241 |
| 1372 | Ga0500640_000362 | 3300053095 | Bacteria | 10622 |
| 1373 | Ga0500641_0009296 | 3300053096 | Bacteria | 3533 |
| 1374 | Ga0500650_0019978 | 3300053098 | Bacteria | 2932 |
| 1375 | Ga0500554_052233 | 3300053102 | Bacteria | 1289 |
| 1376 | Ga0500555_026618 | 3300053103 | Bacteria | 1652 |
| 1377 | Ga0500555_034857 | 3300053103 | Bacteria | 1416 |
| 1378 | Ga0500556_0000091 | 3300053104 | Bacteria | 83564 |
| 1379 | Ga0500556_0032128 | 3300053104 | Bacteria | 1791 |
| 1380 | Ga0500556_0036442 | 3300053104 | Bacteria | 1706 |
| 1381 | Ga0500557_000043 | 3300053105 | Bacteria | 63389 |
| 1382 | Ga0500562_041040 | 3300053108 | Bacteria | 1230 |
| 1383 | Ga0500569_000764 | 3300053109 | Bacteria | 5632 |
| 1384 | Ga0500572_000254 | 3300053111 | Bacteria | 19130 |
| 1385 | Ga0500572_001685 | 3300053111 | Bacteria | 5771 |
| 1386 | Ga0500572_002479 | 3300053111 | Bacteria | 4425 |
| 1387 | Ga0500593_015527 | 3300053117 | Bacteria | 3284 |
| 1388 | Ga0500594_0023858 | 3300053118 | Bacteria | 1554 |
| 1389 | Ga0500594_0024902 | 3300053118 | Bacteria | 1529 |
| 1390 | Ga0500595_000001 | 3300053119 | Bacteria | 1088438 |
| 1391 | Ga0500595_001153 | 3300053119 | Bacteria | 14657 |
| 1392 | Ga0500595_001894 | 3300053119 | Bacteria | 10778 |
| 1393 | Ga0500595_006741 | 3300053119 | Bacteria | 4841 |
| 1394 | Ga0500595_009741 | 3300053119 | Bacteria | 3862 |
| 1395 | Ga0500595_022147 | 3300053119 | Bacteria | 2255 |
| 1396 | Ga0500608_024017 | 3300053122 | Bacteria | 2842 |
| 1397 | Ga0500608_108111 | 3300053122 | Bacteria | 1278 |
| 1398 | Ga0500614_002002 | 3300053123 | Bacteria | 4660 |
| 1399 | Ga0500618_015870 | 3300053125 | Bacteria | 1894 |
| 1400 | Ga0500642_0000046 | 3300053130 | Bacteria | 82391 |
| 1401 | Ga0500642_0000129 | 3300053130 | Bacteria | 34204 |
| 1402 | Ga0500642_0098851 | 3300053130 | Bacteria | 1355 |
| 1403 | Ga0500652_008962 | 3300053131 | Bacteria | 3362 |
| 1404 | Ga0500652_012313 | 3300053131 | Bacteria | 2997 |
| 1405 | Ga0500655_017301 | 3300053133 | Bacteria | 1333 |
| 1406 | Ga0500658_0061763 | 3300053134 | Bacteria | 1559 |
| 1407 | Ga0500658_0095634 | 3300053134 | Bacteria | 1290 |
| 1408 | Ga0500559_0000201 | 3300053136 | Bacteria | 47715 |
| 1409 | Ga0500559_0000287 | 3300053136 | Bacteria | 38965 |
| 1410 | Ga0500559_0000803 | 3300053136 | Bacteria | 20545 |
| 1411 | Ga0500559_0015771 | 3300053136 | Bacteria | 3191 |
| 1412 | Ga0500559_0029076 | 3300053136 | Bacteria | 2364 |
| 1413 | Ga0500568_0002999 | 3300053139 | Bacteria | 9656 |
| 1414 | Ga0500568_0025139 | 3300053139 | Bacteria | 2516 |
| 1415 | Ga0500568_0033886 | 3300053139 | Bacteria | 2092 |
| 1416 | Ga0500577_0039113 | 3300053142 | Bacteria | 1717 |
| 1417 | Ga0500577_0042885 | 3300053142 | Bacteria | 1659 |
| 1418 | Ga0500589_107840 | 3300053147 | Bacteria | 1199 |
| 1419 | Ga0500590_044248 | 3300053148 | Bacteria | 2281 |
| 1420 | Ga0500590_151712 | 3300053148 | Bacteria | 1044 |
| 1421 | Ga0500603_000119 | 3300053150 | Bacteria | 18463 |
| 1422 | Ga0500603_000839 | 3300053150 | Bacteria | 7338 |
| 1423 | Ga0500603_001632 | 3300053150 | Bacteria | 5060 |
| 1424 | Ga0500616_0000022 | 3300053153 | Bacteria | 460463 |
| 1425 | Ga0500616_0000283 | 3300053153 | Bacteria | 74456 |
| 1426 | Ga0500616_0002182 | 3300053153 | Bacteria | 16877 |
| 1427 | Ga0500622_0016789 | 3300053156 | Bacteria | 3907 |
| 1428 | Ga0500622_0017072 | 3300053156 | Bacteria | 3869 |
| 1429 | Ga0500622_0035115 | 3300053156 | Bacteria | 2625 |
| 1430 | Ga0500622_0049796 | 3300053156 | Bacteria | 2159 |
| 1431 | Ga0500627_0017230 | 3300053158 | Bacteria | 2834 |
| 1432 | Ga0500627_0089282 | 3300053158 | Bacteria | 1379 |
| 1433 | Ga0500630_003337 | 3300053159 | Bacteria | 7777 |
| 1434 | Ga0500639_004881 | 3300053163 | Bacteria | 6826 |
| 1435 | Ga0500636_0000291 | 3300053177 | Bacteria | 27724 |
| 1436 | Ga0500636_0000970 | 3300053177 | Bacteria | 15430 |
| 1437 | Ga0500636_0003204 | 3300053177 | Bacteria | 9163 |
| 1438 | Ga0500636_0010476 | 3300053177 | Bacteria | 5410 |
| 1439 | Ga0500636_0108023 | 3300053177 | Bacteria | 1575 |
| 1440 | Ga0500637_0000757 | 3300053178 | Bacteria | 12952 |
| 1441 | Ga0500637_0001082 | 3300053178 | Bacteria | 11204 |
| 1442 | Ga0500637_0042820 | 3300053178 | Bacteria | 2560 |
| 1443 | Ga0500567_104933 | 3300053723 | Bacteria | 1165 |
| 1444 | Ga0500576_058468 | 3300053725 | Bacteria | 1693 |
| 1445 | Ga0500576_092761 | 3300053725 | Bacteria | 1250 |
| 1446 | Ga0500576_124916 | 3300053725 | Bacteria | 1007 |
| 1447 | Ga0500645_000371 | 3300053730 | Bacteria | 31603 |
| 1448 | Ga0500645_019793 | 3300053730 | Bacteria | 2091 |
| 1449 | Ga0500609_001958 | 3300053731 | Bacteria | 2972 |
| 1450 | Ga0500552_000588 | 3300053733 | Bacteria | 3408 |
| 1451 | Ga0500596_000981 | 3300053735 | Bacteria | 5698 |
| 1452 | Ga0500596_008877 | 3300053735 | Bacteria | 1589 |
| 1453 | Ga0500601_000421 | 3300053737 | Bacteria | 7093 |
| 1454 | Ga0501084_0048521 | 3300054114 | Bacteria | 3554 |
| 1455 | Ga0501084_0068030 | 3300054114 | Bacteria | 2982 |
| 1456 | Ga0501084_0346291 | 3300054114 | Bacteria | 1255 |
| 1457 | Ga0500661_002205 | 3300055283 | Bacteria | 3680 |
| 1458 | Ga0501082_0248233 | 3300060353 | Bacteria | 1549 |
| 1459 | Ga0530510_0205009 | 3300061734 | Bacteria | 1465 |
| 1460 | 2507504817 | 2507262055 | Bacteria | 8048963 |
| 1461 | 2508546169 | 2508501009 | Bacteria | 7784016 |
| 1462 | 2508695103 | 2508501042 | Bacteria | 8719808 |
| 1463 | 2511399022 | 2511231028 | Bacteria | 8046582 |
| 1464 | 2513589571 | 2513237087 | Bacteria | 5817514 |
| 1465 | 2513626159 | 2513237092 | Bacteria | 8341956 |
| 1466 | 2513641884 | 2513237094 | Bacteria | 8789602 |
| 1467 | 2513647990 | 2513237095 | Bacteria | 8976980 |
| 1468 | 2513656475 | 2513237096 | Bacteria | 8722461 |
| 1469 | 2513673007 | 2513237098 | Bacteria | 9902361 |
| 1470 | 2513694892 | 2513237101 | Bacteria | 7952346 |
| 1471 | 2513705995 | 2513237102 | Bacteria | 7703324 |
| 1472 | 2513715683 | 2513237104 | Bacteria | 10034502 |
| 1473 | 2513858951 | 2513237137 | Bacteria | 9558895 |
| 1474 | 2513873939 | 2513237139 | Bacteria | 8737671 |
| 1475 | 2513890431 | 2513237141 | Bacteria | 8496279 |
| 1476 | 2513917346 | 2513237145 | Bacteria | 8979722 |
| 1477 | 2514012913 | 2513237161 | Bacteria | 8871253 |
| 1478 | 2515625893 | 2515154112 | Bacteria | 8294334 |
| 1479 | 2517102415 | 2517093001 | Bacteria | 9002274 |
| 1480 | 2517889569 | 2517572143 | Bacteria | 9484767 |
| 1481 | 2524435718 | 2524023205 | Bacteria | 8918781 |
| 1482 | 2524466481 | 2524023210 | Bacteria | 9029266 |
| 1483 | 2524539555 | 2524023228 | Bacteria | 10118060 |
| 1484 | 2528855164 | 2528768022 | Bacteria | 10457665 |
| 1485 | 2603861859 | 2602042107 | Bacteria | 6226103 |
| 1486 | 2617351675 | 2617270735 | Bacteria | 9163226 |
| 1487 | 2617374157 | 2617270741 | Bacteria | 8201522 |
| 1488 | 2671121241 | 2667528175 | Bacteria | 7532676 |
| 1489 | 2723842055 | 2721755755 | Bacteria | 8322773 |
| 1490 | 2738885832 | 2738541307 | Bacteria | 8606193 |
| 1491 | 2739282594 | 2738543019 | Bacteria | 7459457 |
| 1492 | 2745079014 | 2744054633 | Bacteria | 8678936 |
| 1493 | 2793063127 | 2791355196 | Bacteria | 7323613 |
| 1494 | 2793073656 | 2791355197 | Bacteria | 8420563 |
| 1495 | 2793077395 | |||
| 1496 | 2805919474 | 2802429603 | Bacteria | 8777136 |
| 1497 | 2818237252 | 2816332527 | Bacteria | 8933356 |
| 1498 | 2819719442 | 2818991467 | Bacteria | 5893227 |
| 1499 | 2824602548 | 2824600985 | Bacteria | 8488197 |
| 1500 | 2824612672 | 2824609381 | Bacteria | 8672835 |
| 1501 | 2824624779 | 2824617872 | Bacteria | 8814715 |
| 1502 | 2824633651 | 2824626560 | Bacteria | 8813858 |
| 1503 | 2824643259 | 2824635225 | Bacteria | 8785348 |
| 1504 | 2824651470 | 2824644064 | Bacteria | 8743947 |
| 1505 | 2824654486 | 2824653114 | Bacteria | 8493680 |
| 1506 | 2824663637 | 2824661429 | Bacteria | 9877870 |
| 1507 | 2824674880 | 2824671348 | Bacteria | 8369588 |
| 1508 | 2824685488 | 2824679649 | Bacteria | 8248951 |
| 1509 | 2824691948 | 2824687955 | Bacteria | 8360029 |
| 1510 | 2824700438 | 2824696289 | Bacteria | 8335049 |
| 1511 | 2824708482 | 2824704595 | Bacteria | 9667483 |
| 1512 | 2824721584 | 2824714736 | Bacteria | 8717648 |
| 1513 | 2824731518 | 2824723954 | Bacteria | 8758240 |
| 1514 | 2824734841 | 2824732956 | Bacteria | 7810675 |
| 1515 | 2824748153 | 2824746037 | Bacteria | 7911610 |
| 1516 | 2824757142 | 2824753945 | Bacteria | 9787441 |
| 1517 | 2824772081 | 2824763712 | Bacteria | 9792355 |
| 1518 | 2824774969 | 2824773399 | Bacteria | 8360218 |
| 1519 | 2838129531 | 2838122688 | Bacteria | 8803140 |
| 1520 | 2841913941 | 2841911363 | Bacteria | 6173697 |
| 1521 | 2841920506 | 2841917233 | Bacteria | 6173500 |
| 1522 | 2841944432 | 2841941048 | Bacteria | 8688029 |
| 1523 | 2841951573 | 2841949485 | Bacteria | 8680857 |
| 1524 | 2841964641 | 2841957949 | Bacteria | 8652217 |
| 1525 | 2841969209 | 2841966195 | Bacteria | 8673214 |
| 1526 | 2841982874 | 2841974524 | Bacteria | 8931498 |
| 1527 | 2841991044 | 2841983080 | Bacteria | 8395090 |
| 1528 | 2842043909 | 2842038055 | Bacteria | 8002051 |
| 1529 | 2842052101 | 2842045827 | Bacteria | 8006841 |
| 1530 | 2842695329 | 2842694124 | Bacteria | 4063419 |
| 1531 | 2844321796 | 2844315083 | Bacteria | 8138177 |
| 1532 | 2847931495 | 2847930680 | Bacteria | 9342022 |
| 1533 | 2847941727 | 2847939898 | Bacteria | 8606328 |
| 1534 | 2849082645 | 2849076700 | Bacteria | 7039503 |
| 1535 | 2857511542 | 2857509624 | Bacteria | 7472071 |
| 1536 | 2857526029 | 2857524615 | Bacteria | 6615449 |
| 1537 | 2874594224 | 2874590934 | Bacteria | 8299676 |
| 1538 | 2874610327 | 2874604998 | Bacteria | 7834745 |
| 1539 | 2874617946 | 2874612657 | Bacteria | 8252029 |
| 1540 | 2874624395 | 2874620515 | Bacteria | 8290088 |
| 1541 | 2874636679 | 2874628541 | Bacteria | 8630250 |
| 1542 | 2874647650 | 2874645413 | Bacteria | 8214782 |
| 1543 | 2876765015 | 2876761206 | Bacteria | 10111113 |
| 1544 | 2876771872 | 2876771140 | Bacteria | 8287509 |
| 1545 | 2876812804 | 2876808645 | Bacteria | 8824342 |
| 1546 | 2876819178 | 2876818435 | Bacteria | 8274608 |
| 1547 | 2879075723 | 2879074833 | Bacteria | 8279565 |
| 1548 | 2879087467 | 2879083081 | Bacteria | 8587928 |
| 1549 | 2879101273 | 2879099564 | Bacteria | 10442239 |
| 1550 | 2879111648 | 2879110137 | Bacteria | 8907982 |
| 1551 | 2879130746 | 2879127579 | Bacteria | 8294491 |
| 1552 | 2879146094 | 2879142872 | Bacteria | 8267021 |
| 1553 | 2881371029 | 2881364244 | Bacteria | 7710352 |
| 1554 | 2881665668 | 2881665667 | Bacteria | 8175609 |
| 1555 | 2885371423 | 2885366525 | Bacteria | 8326213 |
| 1556 | 2885375075 | 2885374607 | Bacteria | 8927485 |
| 1557 | 2885385388 | 2885383462 | Bacteria | 9473874 |
| 1558 | 2885410823 | 2885409591 | Bacteria | 9235467 |
| 1559 | 2888379994 | 2888378607 | Bacteria | 9652610 |
| 1560 | 2888391070 | 2888388044 | Bacteria | 7304136 |
| 1561 | 2888420799 | 2888419890 | Bacteria | 7857137 |
| 1562 | 2889035039 | 2889033259 | Bacteria | 9099371 |
| 1563 | 2893067698 | 2893066018 | Bacteria | 6158120 |
| 1564 | 2899931519 | 2899924645 | Bacteria | 7487985 |
| 1565 | 2903727654 | 2903727486 | Bacteria | 8281579 |
| 1566 | 2903756146 | 2903748898 | Bacteria | 9972761 |
| 1567 | 2903772294 | 2903768456 | Bacteria | 9749579 |
| 1568 | 2904672266 | 2904666416 | Bacteria | 8226587 |
| 1569 | 2904692128 | 2904690495 | Bacteria | 9412302 |
| 1570 | 2904709394 | |||
| 1571 | 2904716155 | 2904711408 | Bacteria | 9771557 |
| 1572 | 2906602856 | 2906602504 | Bacteria | 8295279 |
| 1573 | 2906613048 | |||
| 1574 | 2906627040 | 2906626472 | Bacteria | 8826946 |
| 1575 | 2906641156 | 2906635258 | Bacteria | 8601019 |
| 1576 | 2906652363 | 2906643746 | Bacteria | 8722424 |
| 1577 | 2906665712 | 2906660503 | Bacteria | 8595048 |
| 1578 | 2908748069 | 2908739725 | Bacteria | 8628932 |
| 1579 | 2908757410 | 2908756301 | Bacteria | 8864324 |
| 1580 | 2908776631 | 2908775508 | Bacteria | 8092255 |
| 1581 | 2922366926 | 2922361189 | Bacteria | 7436256 |
| 1582 | 2922378377 | |||
| 1583 | 2922388582 | 2922386360 | Bacteria | 7017218 |
| 1584 | 2922400338 | 2922393267 | Bacteria | 8285685 |
| 1585 | 2922433518 | |||
| 1586 | 2928056517 | 2928051484 | Bacteria | 7773759 |
| 1587 | 2928069014 | 2928064002 | Bacteria | 7419480 |
| 1588 | 2929622523 | 2929615660 | Bacteria | 9193770 |
| 1589 | 2929631259 | 2929624759 | Bacteria | 9339455 |
| 1590 | 2932786320 | 2932784394 | Bacteria | 9704911 |
| 1591 | 2932794712 | 2932794094 | Bacteria | 7915132 |
| 1592 | 2932805477 | 2932801729 | Bacteria | 7987968 |
| 1593 | 2932812605 | 2932809354 | Bacteria | 9135765 |
| 1594 | 2932822967 | 2932818245 | Bacteria | 9955613 |
| 1595 | 2932829558 | 2932828146 | Bacteria | 9745859 |
| 1596 | 2933584398 | 2933577622 | Bacteria | 9116884 |
| 1597 | 2935614985 | 2935608549 | Bacteria | 8203142 |
| 1598 | 2935618076 | 2935616580 | Bacteria | 9032984 |
| 1599 | 2935635061 | 2935630451 | Bacteria | 8169952 |
| 1600 | 2935641526 | 2935638405 | Bacteria | 10015038 |
| 1601 | 2935651667 | 2935648319 | Bacteria | 8801166 |
| 1602 | 2935659566 | 2935656913 | Bacteria | 8965014 |
| 1603 | 2935669416 | 2935665750 | Bacteria | 9571747 |
| 1604 | 2935677986 | 2935675223 | Bacteria | 9928132 |
| 1605 | 2935689563 | 2935684952 | Bacteria | 9590419 |
| 1606 | 2935701775 | 2935694250 | Bacteria | 9291695 |
| 1607 | 2935707240 | 2935703347 | Bacteria | 10242284 |
| 1608 | 2935717082 | 2935713505 | Bacteria | 9608509 |
| 1609 | 2935730084 | 2935722832 | Bacteria | 9608746 |
| 1610 | 2935738497 | 2935732158 | Bacteria | 9706831 |
| 1611 | 2935749255 | 2935741537 | Bacteria | 9707219 |
| 1612 | 2935756916 | 2935750917 | Bacteria | 9590372 |
| 1613 | 2935764470 | 2935760218 | Bacteria | 9817913 |
| 1614 | 2935772802 | 2935769743 | Bacteria | 7878163 |
| 1615 | 2935778062 | 2935777560 | Bacteria | 8077691 |
| 1616 | 2935787289 | 2935785616 | Bacteria | 7962367 |
| 1617 | 2935795923 | 2935793552 | Bacteria | 8012592 |
| 1618 | 2935804380 | 2935801545 | Bacteria | 9301974 |
| 1619 | 2935817241 | 2935810662 | Bacteria | 9401221 |
| 1620 | 2935825976 | 2935819856 | Bacteria | 8261050 |
| 1621 | 2935831257 | 2935827899 | Bacteria | 10038562 |
| 1622 | 2935841866 | 2935837841 | Bacteria | 9454360 |
| 1623 | 2935851595 | 2935847175 | Bacteria | 8228321 |
| 1624 | 2935856425 | 2935855204 | Bacteria | 9035059 |
| 1625 | 2935871052 | 2935864058 | Bacteria | 9784707 |
| 1626 | 2935874549 | 2935873716 | Bacteria | 9632195 |
| 1627 | 2935888926 | 2935883170 | Bacteria | 7964738 |
| 1628 | 2935910382 | 2935908558 | Bacteria | 8568796 |
| 1629 | 2935918332 | 2935916978 | Bacteria | 9113783 |
| 1630 | 2935927707 | 2935926038 | Bacteria | 8601059 |
| 1631 | 2935936421 | 2935934488 | Bacteria | 8602579 |
| 1632 | 2935944026 | 2935942939 | Bacteria | 8599779 |
| 1633 | 2935952463 | 2935951376 | Bacteria | 8602333 |
| 1634 | 2935964171 | 2935959822 | Bacteria | 7869783 |
| 1635 | 2935969303 | 2935967501 | Bacteria | 8603075 |
| 1636 | 2935977935 | 2935975950 | Bacteria | 8347125 |
| 1637 | 2935984764 | 2935984226 | Bacteria | 8302647 |
| 1638 | 2935994010 | 2935992306 | Bacteria | 9802711 |
| 1639 | 2936004979 | 2936002035 | Bacteria | 9362176 |
| 1640 | 2936013981 | 2936011229 | Bacteria | 8801034 |
| 1641 | 2936023109 | 2936019824 | Bacteria | 8804134 |
| 1642 | 2936031246 | 2936028420 | Bacteria | 8965941 |
| 1643 | 2936044037 | 2936037263 | Bacteria | 9446081 |
| 1644 | 2936049368 | 2936046547 | Bacteria | 8903709 |
| 1645 | 2936055934 | 2936055302 | Bacteria | 8785755 |
| 1646 | 2940562830 | 2940556831 | Bacteria | 9590747 |
| 1647 | 2941511660 | 2941507105 | Bacteria | 8166816 |
| 1648 | 2941519357 | 2941515067 | Bacteria | 8166720 |
| 1649 | 2941527519 | 2941523033 | Bacteria | 8169134 |
| 1650 | 2941532327 | 2941531003 | Bacteria | 7653939 |
| 1651 | 2941543939 | 2941538514 | Bacteria | 9402094 |
| 1652 | 3005483200 | 3005474847 | Bacteria | 9259049 |
| 1653 | 3005488940 | 3005483717 | Bacteria | 7877331 |
| 1654 | 3005509571 | 3005506211 | Bacteria | 6943378 |
| 1655 | 3005594167 | 3005587118 | Bacteria | 7794411 |
| 1656 | 3005602145 | 3005594810 | Bacteria | 8716512 |
| 1657 | 3005717901 | 3005710791 | Bacteria | 7622528 |
| 1658 | 3005724934 | 3005718088 | Bacteria | 8283608 |
| 1659 | 8006929263 | 8006926726 | Bacteria | 6749210 |
| 1660 | 8006935570 | 8006933436 | Bacteria | 10410654 |
| 1661 | 8006968346 | 8006964411 | Bacteria | 8966052 |
| 1662 | 8006975496 | 8006973647 | Bacteria | 10679141 |
| 1663 | 8006985899 | 8006984368 | Bacteria | 9651211 |
| 1664 | 8007000279 | 8006994254 | Bacteria | 8309700 |
| 1665 | 8016518670 | 8016511872 | Bacteria | 9921665 |
| 1666 | 8016526631 | 8016522445 | Bacteria | 8156687 |
| 1667 | 8016557159 | 8016548790 | Bacteria | 8155074 |
| 1668 | 8016565509 | 8016557553 | Bacteria | 8154380 |
| 1669 | 8016582562 | 8016575299 | Bacteria | 8154085 |
| 1670 | 8016586842 | 8016583857 | Bacteria | 10421953 |
| 1671 | 8016603136 | 8016595262 | Bacteria | 8149947 |
| 1672 | 8016606050 | 8016603502 | Bacteria | 8731218 |
| 1673 | 8016617933 | 8016613128 | Bacteria | 8794220 |
| 1674 | 8016623638 | 8016622563 | Bacteria | 7999408 |
| 1675 | 8016636114 | 8016630954 | Bacteria | 9217207 |
| 1676 | 8017058003 | 8017057580 | Bacteria | 10023680 |
| 1677 | 8019531539 | 8019530166 | Bacteria | 8155624 |
| 1678 | 8019550659 | 8019547302 | Bacteria | 7996444 |
| 1679 | 8019563237 | 8019555841 | Bacteria | 9642137 |
| 1680 | 8019573317 | 8019565922 | Bacteria | 9639779 |
| 1681 | 8019577716 | 8019576017 | Bacteria | 10049540 |
| 1682 | 8019595818 | 8019586578 | Bacteria | 10212056 |
| 1683 | 8019605942 | 8019597564 | Bacteria | 10041141 |
| 1684 | 8019612590 | 8019608314 | Bacteria | 10042931 |
| 1685 | 8019622526 | 8019619141 | Bacteria | 9218857 |
| 1686 | 8019630591 | 8019629233 | Bacteria | 8687553 |
| 1687 | 8019640025 | 8019638758 | Bacteria | 9062356 |
| 1688 | 8019652054 | 8019648815 | Bacteria | 10014479 |
| 1689 | 8019667418 | 8019659431 | Bacteria | 8577854 |
| 1690 | 8019677187 | 8019668869 | Bacteria | 8791617 |
| 1691 | 8019678795 | 8019678201 | Bacteria | 8863603 |
| 1692 | 8019696730 | 8019687851 | Bacteria | 8712826 |
| 1693 | 8055750974 | 8055742211 | Bacteria | 9226248 |
| 1694 | 8056677760 | 8056673599 | Bacteria | 7871253 |
| 1695 | 8056692775 | 8056689827 | Bacteria | 6712655 |
| 1696 | 8056970887 | 8056967851 | Bacteria | 9038162 |
| 1697 | Ga0213876_10013947 | |||
| 1698 | JGI24752J21851_1010227 | |||
| 1699 | JGI24746J21847_1008694 | |||
| 1700 | JGI24740J21852_10005522 | |||
| 1701 | JGI24739J22299_10013653 | |||
| 1702 | JGI24739J22299_10039948 | |||
| 1703 | JGI24737J22298_10000407 | |||
| 1704 | JGI24737J22298_10046503 | |||
| 1705 | JGI24735J21928_10020499 | |||
| 1706 | JGI24750J21931_1001542 | |||
| 1707 | JGI24745J21846_1004626 | |||
| 1708 | JGI24749J21850_1013662 | |||
| 1709 | JGI24034J26672_10012021 | |||
| 1710 | JGI24742J22300_10006282 | |||
| 1711 | JGI25151J46595_10000021 | |||
| 1712 | JGI25406J46586_10000471 | |||
| 1713 | JGI25406J46586_10012262 | |||
| 1714 | JGI25406J46586_10032321 | |||
| 1715 | JGI25153J46596_10002109 | |||
| 1716 | JGI25153J46596_10004526 | |||
| 1717 | JGI25153J46596_10006239 | |||
| 1718 | rootH2_10041169 | |||
| 1719 | rootH2_10310578 | |||
| 1720 | rootH1_10181803 | |||
| 1721 | JGI25160J50197_1007366 | |||
| 1722 | JGI25160J50197_1009546 | |||
| 1723 | JGI25160J50197_1020686 | |||
| 1724 | JGI25404J52841_10006128 | |||
| 1725 | JGI25404J52841_10007547 | |||
| 1726 | JGI25404J52841_10008577 | |||
| 1727 | Ga0055542_1003668 | |||
| 1728 | Ga0055526_1004359 | |||
| 1729 | Ga0055524_1000035 | |||
| 1730 | Ga0055531_10003847 | |||
| 1731 | Ga0055543_1005535 | |||
| 1732 | Ga0065165_1001304 | |||
| 1733 | Ga0065165_1001405 | |||
| 1734 | Ga0065165_1002635 | |||
| 1735 | Ga0065165_1026191 | |||
| 1736 | Ga0065165_1057318 | |||
| 1737 | Ga0065712_10011010 | |||
| 1738 | Ga0070658_10128348 | |||
| 1739 | Ga0070676_10029115 | |||
| 1740 | Ga0070676_10069728 | |||
| 1741 | Ga0070676_10142015 | |||
| 1742 | Ga0070683_100155493 | |||
| 1743 | Ga0070690_100001480 | |||
| 1744 | Ga0070690_100044230 | |||
| 1745 | Ga0070670_100038656 | |||
| 1746 | Ga0070670_100075323 | |||
| 1747 | Ga0070670_100495953 | |||
| 1748 | Ga0070677_10023030 | |||
| 1749 | Ga0068869_100021007 | |||
| 1750 | Ga0070666_10033290 | |||
| 1751 | Ga0070660_100271379 | |||
| 1752 | Ga0070691_10150544 | |||
| 1753 | Ga0070687_100003576 | |||
| 1754 | Ga0070661_100058235 | |||
| 1755 | Ga0070661_100178791 | |||
| 1756 | Ga0070668_100087567 | |||
| 1757 | Ga0070668_100088760 | |||
| 1758 | Ga0070668_100439538 | |||
| 1759 | Ga0070669_100048090 | |||
| 1760 | Ga0070669_100197949 | |||
| 1761 | Ga0070671_100018157 | |||
| 1762 | Ga0070671_100114268 | |||
| 1763 | Ga0070674_100009734 | |||
| 1764 | Ga0070674_100030919 | |||
| 1765 | Ga0070674_100047259 | |||
| 1766 | Ga0070674_100125974 | |||
| 1767 | Ga0070674_100240279 | |||
| 1768 | Ga0070673_100232842 | |||
| 1769 | Ga0070673_100247850 | |||
| 1770 | Ga0070688_100426597 | |||
| 1771 | Ga0070659_100057085 | |||
| 1772 | Ga0070659_100073622 | |||
| 1773 | Ga0070667_100163219 | |||
| 1774 | Ga0070667_100431209 | |||
| 1775 | Ga0070667_100486156 | |||
| 1776 | Ga0070709_10001435 | |||
| 1777 | Ga0070709_10018623 | |||
| 1778 | Ga0070709_10028519 | |||
| 1779 | Ga0070709_10031766 | |||
| 1780 | Ga0070714_100028593 | |||
| 1781 | Ga0070714_100037350 | |||
| 1782 | Ga0070714_100064833 | |||
| 1783 | Ga0070714_100066789 | |||
| 1784 | Ga0070714_100143642 | |||
| 1785 | Ga0070713_100010045 | |||
| 1786 | Ga0070713_100020133 | |||
| 1787 | Ga0070713_100023379 | |||
| 1788 | Ga0070713_100026553 | |||
| 1789 | Ga0070713_100029310 | |||
| 1790 | Ga0070713_100139238 | |||
| 1791 | Ga0070713_100156058 | |||
| 1792 | Ga0070713_100251525 | |||
| 1793 | Ga0070713_100419325 | |||
| 1794 | Ga0070710_10003070 | |||
| 1795 | Ga0070710_10007821 | |||
| 1796 | Ga0070710_10025405 | |||
| 1797 | Ga0070710_10049485 | |||
| 1798 | Ga0070710_10333289 | |||
| 1799 | Ga0070711_100007255 | |||
| 1800 | Ga0070711_100010158 | |||
| 1801 | Ga0070705_100137607 | |||
| 1802 | Ga0070700_100051096 | |||
| 1803 | Ga0070694_100320059 | |||
| 1804 | Ga0070708_100069725 | |||
| 1805 | Ga0070663_100022794 | |||
| 1806 | Ga0070663_100071811 | |||
| 1807 | Ga0070663_100094017 | |||
| 1808 | Ga0070663_100421720 | |||
| 1809 | Ga0070678_100007756 | |||
| 1810 | Ga0070678_100058009 | |||
| 1811 | Ga0070678_100103787 | |||
| 1812 | Ga0070678_100122156 | |||
| 1813 | Ga0070678_100205342 | |||
| 1814 | Ga0070678_100247360 | |||
| 1815 | Ga0070662_100020979 | |||
| 1816 | Ga0070662_100123072 | |||
| 1817 | Ga0070662_100353274 | |||
| 1818 | Ga0068867_100074089 | |||
| 1819 | Ga0068867_100128336 | |||
| 1820 | Ga0070685_10013574 | |||
| 1821 | Ga0070685_10094745 | |||
| 1822 | Ga0070706_100038324 | |||
| 1823 | Ga0070707_100061272 | |||
| 1824 | Ga0070707_100182951 | |||
| 1825 | Ga0070698_100001256 | |||
| 1826 | Ga0070698_100056924 | |||
| 1827 | Ga0070698_100077624 | |||
| 1828 | Ga0070699_100101414 | |||
| 1829 | Ga0070699_100201380 | |||
| 1830 | Ga0070697_100088394 | |||
| 1831 | Ga0068853_100002466 | |||
| 1832 | Ga0070686_100058643 | |||
| 1833 | Ga0070686_100151107 | |||
| 1834 | Ga0070686_100171722 | |||
| 1835 | Ga0070665_100100771 | |||
| 1836 | Ga0070665_100197862 | |||
| 1837 | Ga0070665_100375703 | |||
| 1838 | Ga0070665_100712718 | |||
| 1839 | Ga0070704_100112829 | |||
| 1840 | Ga0070704_100507766 | |||
| 1841 | Ga0068855_100019962 | |||
| 1842 | Ga0068855_100090841 | |||
| 1843 | Ga0068855_100187886 | |||
| 1844 | Ga0068855_100781952 | |||
| 1845 | Ga0070664_100114591 | |||
| 1846 | Ga0068857_100001764 | |||
| 1847 | Ga0068857_100066536 | |||
| 1848 | Ga0068857_100131046 | |||
| 1849 | Ga0068854_100003702 | |||
| 1850 | Ga0068854_100009437 | |||
| 1851 | Ga0068856_100002751 | |||
| 1852 | Ga0068856_100003801 | |||
| 1853 | Ga0068856_100014815 | |||
| 1854 | Ga0068856_100175841 | |||
| 1855 | Ga0068856_100381878 | |||
| 1856 | Ga0068856_100471965 | |||
| 1857 | Ga0070702_100007182 | |||
| 1858 | Ga0070702_100024775 | |||
| 1859 | Ga0068852_100010588 | |||
| 1860 | Ga0068852_100018932 | |||
| 1861 | Ga0068852_100190570 | |||
| 1862 | Ga0068859_100005143 | |||
| 1863 | Ga0068859_100161666 | |||
| 1864 | Ga0068859_100424083 | |||
| 1865 | Ga0068864_100066351 | |||
| 1866 | Ga0068864_100367086 | |||
| 1867 | Ga0068861_100020081 | |||
| 1868 | Ga0068861_100026916 | |||
| 1869 | Ga0068861_100030834 | |||
| 1870 | Ga0068861_100066886 | |||
| 1871 | Ga0068861_100090784 | |||
| 1872 | Ga0068861_100117093 | |||
| 1873 | Ga0068851_10000998 | |||
| 1874 | Ga0068870_10012535 | |||
| 1875 | Ga0068870_10144352 | |||
| 1876 | Ga0068870_10214031 | |||
| 1877 | Ga0068863_100038224 | |||
| 1878 | Ga0068858_100009054 | |||
| 1879 | Ga0068858_100105049 | |||
| 1880 | Ga0068860_100002058 | |||
| 1881 | Ga0068860_100089568 | |||
| 1882 | Ga0068860_100171857 | |||
| 1883 | Ga0068862_100018243 | |||
| 1884 | Ga0068862_100108764 | |||
| 1885 | Ga0068862_100164815 | |||
| 1886 | Ga0068862_100252521 | |||
| 1887 | Ga0068862_100613990 | |||
| 1888 | Ga0081455_10000015 | |||
| 1889 | Ga0081455_10006198 | |||
| 1890 | Ga0081455_10021542 | |||
| 1891 | Ga0081455_10033433 | |||
| 1892 | Ga0081455_10121889 | |||
| 1893 | Ga0081455_10138084 | |||
| 1894 | Ga0081455_10178983 | |||
| 1895 | Ga0081538_10010377 | |||
| 1896 | Ga0081538_10085548 | |||
| 1897 | Ga0081540_1000459 | |||
| 1898 | Ga0081540_1002269 | |||
| 1899 | Ga0081540_1002282 | |||
| 1900 | Ga0081540_1004494 | |||
| 1901 | Ga0081540_1004784 | |||
| 1902 | Ga0081540_1006449 | |||
| 1903 | Ga0081540_1006666 | |||
| 1904 | Ga0081540_1007254 | |||
| 1905 | Ga0081540_1007646 | |||
| 1906 | Ga0081540_1009916 | |||
| 1907 | Ga0081540_1017080 | |||
| 1908 | Ga0081539_10000048 | |||
| 1909 | Ga0081539_10000466 | |||
| 1910 | Ga0081539_10004314 | |||
| 1911 | Ga0081539_10021149 | |||
| 1912 | Ga0081539_10062699 | |||
| 1913 | Ga0081539_10074323 | |||
| 1914 | Ga0070717_10002608 | |||
| 1915 | Ga0070717_10042632 | |||
| 1916 | Ga0070717_10093928 | |||
| 1917 | Ga0070717_10153827 | |||
| 1918 | Ga0070717_10201699 | |||
| 1919 | Ga0070717_10258003 | |||
| 1920 | Ga0070717_10420841 | |||
| 1921 | Ga0075365_10022006 | |||
| 1922 | Ga0075365_10038669 | |||
| 1923 | Ga0075365_10052107 | |||
| 1924 | Ga0075365_10066663 | |||
| 1925 | Ga0075365_10068611 | |||
| 1926 | Ga0075365_10080643 | |||
| 1927 | Ga0075368_10017075 | |||
| 1928 | Ga0075368_10034166 | |||
| 1929 | Ga0075363_100002145 | |||
| 1930 | Ga0075363_100021620 | |||
| 1931 | Ga0075363_100036579 | |||
| 1932 | Ga0075363_100040437 | |||
| 1933 | Ga0075363_100099922 | |||
| 1934 | Ga0075363_100135741 | |||
| 1935 | Ga0075364_10029682 | |||
| 1936 | Ga0075364_10089660 | |||
| 1937 | Ga0075364_10103781 | |||
| 1938 | Ga0075364_10119495 | |||
| 1939 | Ga0075364_10151415 | |||
| 1940 | Ga0075364_10186549 | |||
| 1941 | Ga0075364_10217615 | |||
| 1942 | Ga0075364_10352855 | |||
| 1943 | Ga0070715_10002100 | |||
| 1944 | Ga0070715_10077355 | |||
| 1945 | Ga0070716_100010030 | |||
| 1946 | Ga0070716_100039116 | |||
| 1947 | Ga0070716_100066067 | |||
| 1948 | Ga0070712_100007483 | |||
| 1949 | Ga0070712_100009194 | |||
| 1950 | Ga0070712_100085241 | |||
| 1951 | Ga0075362_10008683 | |||
| 1952 | Ga0075362_10053901 | |||
| 1953 | Ga0075362_10099250 | |||
| 1954 | Ga0075367_10010679 | |||
| 1955 | Ga0075367_10012056 | |||
| 1956 | Ga0075367_10032962 | |||
| 1957 | Ga0075367_10093726 | |||
| 1958 | Ga0075367_10106413 | |||
| 1959 | Ga0075367_10265601 | |||
| 1960 | Ga0075367_10271415 | |||
| 1961 | Ga0075369_10012200 | |||
| 1962 | Ga0075369_10028615 | |||
| 1963 | Ga0075369_10058463 | |||
| 1964 | Ga0075369_10063893 | |||
| 1965 | Ga0075369_10068667 | |||
| 1966 | Ga0075369_10082234 | |||
| 1967 | Ga0075366_10050584 | |||
| 1968 | Ga0075366_10087531 | |||
| 1969 | Ga0075366_10129353 | |||
| 1970 | Ga0075366_10129511 | |||
| 1971 | Ga0097621_100043350 | |||
| 1972 | Ga0097621_100063124 | |||
| 1973 | Ga0097621_100303904 | |||
| 1974 | Ga0075370_10023979 | |||
| 1975 | Ga0075370_10034636 | |||
| 1976 | Ga0075370_10035109 | |||
| 1977 | Ga0075370_10056900 | |||
| 1978 | Ga0075370_10097115 | |||
| 1979 | Ga0068871_100069401 | |||
| 1980 | Ga0068871_100389103 | |||
| 1981 | Ga0075428_100126914 | |||
| 1982 | Ga0075428_100219808 | |||
| 1983 | Ga0075428_100454510 | |||
| 1984 | Ga0075430_100003805 | |||
| 1985 | Ga0075430_100061792 | |||
| 1986 | Ga0075430_100148719 | |||
| 1987 | Ga0075431_100008501 | |||
| 1988 | Ga0075431_100127583 | |||
| 1989 | Ga0075431_100465316 | |||
| 1990 | Ga0075434_100108893 | |||
| 1991 | Ga0075434_100243277 | |||
| 1992 | Ga0075434_100452194 | |||
| 1993 | Ga0075434_100659338 | |||
| 1994 | Ga0068865_100017612 | |||
| 1995 | Ga0068865_100137402 | |||
| 1996 | Ga0075436_100153078 | |||
| 1997 | Ga0097620_100005143 | |||
| 1998 | Ga0097620_100161662 | |||
| 1999 | Ga0097620_100424100 | |||
| 2000 | Ga0099824_1004372 | |||
| 2001 | Ga0099823_1053765 | |||
| 2002 | Ga0075435_100280507 | |||
| 2003 | Ga0099795_10025142 | |||
| 2004 | Ga0099795_10060531 | |||
| 2005 | Ga0099795_10064618 | |||
| 2006 | Ga0105240_10009595 | |||
| 2007 | Ga0105240_10055652 | |||
| 2008 | Ga0105240_10806247 | |||
| 2009 | Ga0111539_10132770 | |||
| 2010 | Ga0105245_10018387 | |||
| 2011 | Ga0105245_10077260 | |||
| 2012 | Ga0105247_10074757 | |||
| 2013 | Ga0114129_10028215 | |||
| 2014 | Ga0114129_10050504 | |||
| 2015 | Ga0114129_10236575 | |||
| 2016 | Ga0114129_10237884 | |||
| 2017 | Ga0114129_10329886 | |||
| 2018 | Ga0105241_10002508 | |||
| 2019 | Ga0105241_10055998 | |||
| 2020 | Ga0105241_10091913 | |||
| 2021 | Ga0105241_10099417 | |||
| 2022 | Ga0105242_10048183 | |||
| 2023 | Ga0105248_10026102 | |||
| 2024 | Ga0105248_10235666 | |||
| 2025 | Ga0105248_10274419 | |||
| 2026 | Ga0105237_10023360 | |||
| 2027 | Ga0105237_10045757 | |||
| 2028 | Ga0105237_10077993 | |||
| 2029 | Ga0105237_10136081 | |||
| 2030 | Ga0105237_10436933 | |||
| 2031 | Ga0105238_10013064 | |||
| 2032 | Ga0105238_10032374 | |||
| 2033 | Ga0105238_10058953 | |||
| 2034 | Ga0105238_10220379 | |||
| 2035 | Ga0105249_10104567 | |||
| 2036 | Ga0105249_10325248 | |||
| 2037 | Ga0099796_10002833 | |||
| 2038 | Ga0099796_10011208 | |||
| 2039 | Ga0099796_10013605 | |||
| 2040 | Ga0099796_10055234 | |||
| 2041 | Ga0099796_10057378 | |||
| 2042 | Ga0105239_10023710 | |||
| 2043 | Ga0105239_10041130 | |||
| 2044 | Ga0105239_10125755 | |||
| 2045 | Ga0105239_10287272 | |||
| 2046 | Ga0105246_10193446 | |||
| 2047 | Ga0105246_10328939 | |||
| 2048 | Ga0105246_10364412 | |||
| 2049 | Ga0157374_10065407 | |||
| 2050 | Ga0157374_10439508 | |||
| 2051 | Ga0157378_10052575 | |||
| 2052 | Ga0157378_10107994 | |||
| 2053 | Ga0157378_10734915 | |||
| 2054 | Ga0163162_10080918 | |||
| 2055 | Ga0163162_10463199 | |||
| 2056 | Ga0157375_10022892 | |||
| 2057 | Ga0157375_10153214 | |||
| 2058 | Ga0157375_10274654 | |||
| 2059 | Ga0163163_10062889 | |||
| 2060 | Ga0163163_10166955 | |||
| 2061 | Ga0157379_10371260 | |||
| 2062 | Ga0157379_10671791 | |||
| 2063 | Ga0157376_10175081 | |||
| 2064 | Ga0157376_10189499 | |||
| 2065 | Ga0157376_10226961 | |||
| 2066 | Ga0157376_10314533 | |||
| 2067 | Ga0182007_10043534 | |||
| 2068 | Ga0163161_10114351 | |||
| 2069 | Ga0163161_10328618 | |||
| 2070 | Ga0214544_1000003 | |||
| 2071 | Ga0214542_1000003 | |||
| 2072 | Ga0214545_1000004 | |||
| 2073 | Ga0214545_1020700 | |||
| 2074 | Ga0214543_1000007 | |||
| 2075 | Ga0213872_10013101 | |||
| 2076 | Ga0213872_10105557 | |||
| 2077 | Ga0213876_10014535 | |||
| 2078 | Ga0213876_10027233 | |||
| 2079 | Ga0213876_10038656 | |||
| 2080 | Ga0213876_10046054 | |||
| 2081 | Ga0213876_10213934 | |||
| 2082 | Ga0213875_10000138 | |||
| 2083 | Ga0213871_10000343 | |||
| 2084 | Ga0224572_1001925 | |||
| 2085 | Ga0209563_105273 | |||
| 2086 | Ga0209677_102298 | |||
| 2087 | Ga0209677_104782 | |||
| 2088 | Ga0209677_105656 | |||
| 2089 | Ga0209148_1000351 | |||
| 2090 | Ga0209455_1001952 | |||
| 2091 | Ga0209455_1007569 | |||
| 2092 | Ga0209675_1000347 | |||
| 2093 | Ga0209675_1001333 | |||
| 2094 | Ga0209025_1000010 | |||
| 2095 | Ga0209025_1092622 | |||
| 2096 | Ga0209564_1000049 | |||
| 2097 | Ga0209564_1003721 | |||
| 2098 | Ga0209564_1010578 | |||
| 2099 | Ga0209758_1000015 | |||
| 2100 | Ga0209758_1000224 | |||
| 2101 | Ga0209758_1001252 | |||
| 2102 | Ga0209758_1001877 | |||
| 2103 | Ga0209758_1007694 | |||
| 2104 | Ga0209758_1019413 | |||
| 2105 | Ga0209758_1030260 | |||
| 2106 | Ga0209758_1068127 | |||
| 2107 | Ga0209256_1000014 | |||
| 2108 | Ga0209256_1009667 | |||
| 2109 | Ga0207426_1000552 | |||
| 2110 | Ga0207426_1000585 | |||
| 2111 | Ga0207426_1000940 | |||
| 2112 | Ga0207426_1013654 | |||
| 2113 | Ga0207426_1023802 | |||
| 2114 | Ga0209257_1000440 | |||
| 2115 | Ga0207696_1065859 | |||
| 2116 | Ga0207682_10025490 | |||
| 2117 | Ga0207692_10000547 | |||
| 2118 | Ga0207692_10043898 | |||
| 2119 | Ga0207642_10182465 | |||
| 2120 | Ga0207710_10035650 | |||
| 2121 | Ga0207710_10052378 | |||
| 2122 | Ga0207688_10001018 | |||
| 2123 | Ga0207688_10139847 | |||
| 2124 | Ga0207647_10047034 | |||
| 2125 | Ga0207685_10062853 | |||
| 2126 | Ga0207685_10108855 | |||
| 2127 | Ga0207699_10000386 | |||
| 2128 | Ga0207699_10001899 | |||
| 2129 | Ga0207699_10003779 | |||
| 2130 | Ga0207645_10030013 | |||
| 2131 | Ga0207645_10035040 | |||
| 2132 | Ga0207645_10041151 | |||
| 2133 | Ga0207645_10271358 | |||
| 2134 | Ga0207643_10143592 | |||
| 2135 | Ga0207705_10124768 | |||
| 2136 | Ga0207705_10200854 | |||
| 2137 | Ga0207684_10003003 | |||
| 2138 | Ga0207684_10194294 | |||
| 2139 | Ga0207654_10003583 | |||
| 2140 | Ga0207654_10010023 | |||
| 2141 | Ga0207654_10058758 | |||
| 2142 | Ga0207654_10157307 | |||
| 2143 | Ga0207707_10000816 | |||
| 2144 | Ga0207707_10462289 | |||
| 2145 | Ga0207695_10000065 | |||
| 2146 | Ga0207695_10000968 | |||
| 2147 | Ga0207695_10246090 | |||
| 2148 | Ga0207671_10007223 | |||
| 2149 | Ga0207671_10011255 | |||
| 2150 | Ga0207671_10135319 | |||
| 2151 | Ga0207693_10000774 | |||
| 2152 | Ga0207693_10003450 | |||
| 2153 | Ga0207693_10011795 | |||
| 2154 | Ga0207693_10018699 | |||
| 2155 | Ga0207693_10025504 | |||
| 2156 | Ga0207693_10189713 | |||
| 2157 | Ga0207663_10001349 | |||
| 2158 | Ga0207663_10044415 | |||
| 2159 | Ga0207662_10002530 | |||
| 2160 | Ga0207657_10080554 | |||
| 2161 | Ga0207657_10157830 | |||
| 2162 | Ga0207649_10054012 | |||
| 2163 | Ga0207649_10120391 | |||
| 2164 | Ga0207652_10005821 | |||
| 2165 | Ga0207646_10108874 | |||
| 2166 | Ga0207681_10017858 | |||
| 2167 | Ga0207694_10000213 | |||
| 2168 | Ga0207694_10036548 | |||
| 2169 | Ga0207650_10020260 | |||
| 2170 | Ga0207659_10064515 | |||
| 2171 | Ga0207659_10534690 | |||
| 2172 | Ga0207687_10029730 | |||
| 2173 | Ga0207687_10043769 | |||
| 2174 | Ga0207687_10219441 | |||
| 2175 | Ga0207700_10002201 | |||
| 2176 | Ga0207700_10011224 | |||
| 2177 | Ga0207700_10022359 | |||
| 2178 | Ga0207700_10036944 | |||
| 2179 | Ga0207700_10046045 | |||
| 2180 | Ga0207700_10063057 | |||
| 2181 | Ga0207664_10050317 | |||
| 2182 | Ga0207664_10161846 | |||
| 2183 | Ga0207664_10345364 | |||
| 2184 | Ga0207644_10043351 | |||
| 2185 | Ga0207644_10068452 | |||
| 2186 | Ga0207644_10272542 | |||
| 2187 | Ga0207690_10072098 | |||
| 2188 | Ga0207706_10007301 | |||
| 2189 | Ga0207706_10081510 | |||
| 2190 | Ga0207706_10141867 | |||
| 2191 | Ga0207706_10255463 | |||
| 2192 | Ga0207686_10017480 | |||
| 2193 | Ga0207709_10111415 | |||
| 2194 | Ga0207709_10126258 | |||
| 2195 | Ga0207709_10145800 | |||
| 2196 | Ga0207709_10372132 | |||
| 2197 | Ga0207670_10021668 | |||
| 2198 | Ga0207669_10003709 | |||
| 2199 | Ga0207669_10012917 | |||
| 2200 | Ga0207669_10079031 | |||
| 2201 | Ga0207669_10116285 | |||
| 2202 | Ga0207669_10156636 | |||
| 2203 | Ga0207669_10257152 | |||
| 2204 | Ga0207704_10046324 | |||
| 2205 | Ga0207665_10000289 | |||
| 2206 | Ga0207665_10001425 | |||
| 2207 | Ga0207665_10001510 | |||
| 2208 | Ga0207665_10003729 | |||
| 2209 | Ga0207665_10097212 | |||
| 2210 | Ga0207665_10175217 | |||
| 2211 | Ga0207665_10238951 | |||
| 2212 | Ga0207691_10013884 | |||
| 2213 | Ga0207691_10143212 | |||
| 2214 | Ga0207691_10536001 | |||
| 2215 | Ga0207711_10038123 | |||
| 2216 | Ga0207711_10048181 | |||
| 2217 | Ga0207711_10124403 | |||
| 2218 | Ga0207711_10183618 | |||
| 2219 | Ga0207711_10257495 | |||
| 2220 | Ga0207689_10036089 | |||
| 2221 | Ga0207689_10054040 | |||
| 2222 | Ga0207689_10217966 | |||
| 2223 | Ga0207661_10082840 | |||
| 2224 | Ga0207661_10587079 | |||
| 2225 | Ga0207679_10027684 | |||
| 2226 | Ga0207679_10080457 | |||
| 2227 | Ga0207667_10079331 | |||
| 2228 | Ga0207667_10219652 | |||
| 2229 | Ga0207667_10224943 | |||
| 2230 | Ga0207667_10384194 | |||
| 2231 | Ga0207651_10179218 | |||
| 2232 | Ga0207651_10213983 | |||
| 2233 | Ga0207712_10027778 | |||
| 2234 | Ga0207712_10030143 | |||
| 2235 | Ga0207668_10051796 | |||
| 2236 | Ga0207668_10136239 | |||
| 2237 | Ga0207668_10140121 | |||
| 2238 | Ga0207668_10198817 | |||
| 2239 | Ga0207668_10355903 | |||
| 2240 | Ga0207677_10015799 | |||
| 2241 | Ga0207677_10104825 | |||
| 2242 | Ga0207703_10285436 | |||
| 2243 | Ga0207703_10503468 | |||
| 2244 | Ga0207639_10019353 | |||
| 2245 | Ga0207639_10069817 | |||
| 2246 | Ga0207678_10037422 | |||
| 2247 | Ga0207678_10063278 | |||
| 2248 | Ga0207678_10071220 | |||
| 2249 | Ga0207678_10092481 | |||
| 2250 | Ga0207678_10207334 | |||
| 2251 | Ga0207708_10003151 | |||
| 2252 | Ga0207708_10302960 | |||
| 2253 | Ga0207708_10337924 | |||
| 2254 | Ga0207702_10000094 | |||
| 2255 | Ga0207702_10000095 | |||
| 2256 | Ga0207702_10000539 | |||
| 2257 | Ga0207702_10009972 | |||
| 2258 | Ga0207702_10116279 | |||
| 2259 | Ga0207702_10201888 | |||
| 2260 | Ga0207641_10019053 | |||
| 2261 | Ga0207648_10009796 | |||
| 2262 | Ga0207648_10065982 | |||
| 2263 | Ga0207648_10073497 | |||
| 2264 | Ga0207676_10032685 | |||
| 2265 | Ga0207676_10194012 | |||
| 2266 | Ga0207674_10000578 | |||
| 2267 | Ga0207674_10004408 | |||
| 2268 | Ga0207674_10035720 | |||
| 2269 | Ga0207674_10232416 | |||
| 2270 | Ga0207674_10349879 | |||
| 2271 | Ga0207675_100007420 | |||
| 2272 | Ga0207675_100030164 | |||
| 2273 | Ga0207675_100065878 | |||
| 2274 | Ga0207675_100097179 | |||
| 2275 | Ga0207683_10039973 | |||
| 2276 | Ga0207683_10074617 | |||
| 2277 | Ga0207683_10080049 | |||
| 2278 | Ga0207683_10102921 | |||
| 2279 | Ga0207683_10141110 | |||
| 2280 | Ga0207683_10325126 | |||
| 2281 | Ga0207698_10171001 | |||
| 2282 | Ga0207698_10394753 | |||
| 2283 | Ga0207698_10399432 | |||
| 2284 | Ga0209389_1000029 | |||
| 2285 | Ga0209389_1000076 | |||
| 2286 | Ga0209589_1000012 | |||
| 2287 | Ga0209589_1000013 | |||
| 2288 | Ga0209489_100013 | |||
| 2289 | Ga0209489_100416 | |||
| 2290 | Ga0209700_100014 | |||
| 2291 | Ga0209179_1001813 | |||
| 2292 | Ga0209588_1012833 | |||
| 2293 | Ga0209813_10000669 | |||
| 2294 | Ga0209813_10031992 | |||
| 2295 | Ga0207428_10238879 | |||
| 2296 | Ga0207428_10244724 | |||
| 2297 | Ga0265356_1006070 | |||
| 2298 | Ga0268266_10001689 | |||
| 2299 | Ga0268266_10026887 | |||
| 2300 | Ga0268266_10107655 | |||
| 2301 | Ga0268266_10118594 | |||
| 2302 | Ga0268266_10200622 | |||
| 2303 | Ga0268266_10499369 | |||
| 2304 | Ga0268265_10040614 | |||
| 2305 | Ga0268265_10116158 | |||
| 2306 | Ga0268265_10511088 | |||
| 2307 | Ga0268265_10695953 | |||
| 2308 | Ga0268264_10000049 | |||
| 2309 | Ga0268264_10364191 | |||
| 2310 | Ga0265337_1012592 | |||
| 2311 | Ga0265319_1007105 | |||
| 2312 | Ga0265334_10001581 | |||
| 2313 | Ga0265318_10009274 | |||
| 2314 | Ga0265323_10003611 | |||
| 2315 | Ga0265322_10011291 | |||
| 2316 | Ga0265336_10001012 | |||
| 2317 | Ga0307517_10000766 | |||
| 2318 | Ga0307515_10015099 | |||
| 2319 | Ga0307515_10324519 | |||
| 2320 | Ga0265338_10000024 | |||
| 2321 | Ga0265324_10011216 | |||
| 2322 | Ga0265770_1005620 | |||
| 2323 | Ga0265330_10030730 | |||
| 2324 | Ga0265332_10001539 | |||
| 2325 | Ga0265332_10013992 | |||
| 2326 | Ga0265320_10015232 | |||
| 2327 | Ga0265325_10002052 | |||
| 2328 | Ga0265325_10005467 | |||
| 2329 | Ga0265325_10037542 | |||
| 2330 | Ga0265329_10042012 | |||
| 2331 | Ga0265340_10000694 | |||
| 2332 | Ga0265340_10005839 | |||
| 2333 | Ga0265340_10037432 | |||
| 2334 | Ga0265340_10046022 | |||
| 2335 | Ga0265339_10001969 | |||
| 2336 | Ga0265339_10004309 | |||
| 2337 | Ga0265339_10170567 | |||
| 2338 | Ga0265331_10054802 | |||
| 2339 | Ga0265331_10063819 | |||
| 2340 | Ga0307513_10207965 | |||
| 2341 | Ga0307509_10011299 | |||
| 2342 | Ga0307509_10261457 | |||
| 2343 | Ga0307408_100208005 | |||
| 2344 | Ga0265313_10004767 | |||
| 2345 | Ga0265313_10146705 | |||
| 2346 | Ga0307508_10000046 | |||
| 2347 | Ga0307508_10063610 | |||
| 2348 | Ga0265314_10002061 | |||
| 2349 | Ga0265314_10006588 | |||
| 2350 | Ga0265314_10043659 | |||
| 2351 | Ga0265314_10189388 | |||
| 2352 | Ga0265342_10000178 | |||
| 2353 | Ga0265342_10028149 | |||
| 2354 | Ga0265342_10056469 | |||
| 2355 | Ga0265342_10100660 | |||
| 2356 | Ga0265342_10123090 | |||
| 2357 | Ga0265342_10124229 | |||
| 2358 | Ga0265342_10170509 | |||
| 2359 | Ga0316578_10016976 | |||
| 2360 | Ga0307516_10016335 | |||
| 2361 | Ga0307516_10022356 | |||
| 2362 | Ga0307516_10056447 | |||
| 2363 | Ga0307516_10272985 | |||
| 2364 | Ga0307412_10332525 | |||
| 2365 | Ga0307409_100758087 | |||
| 2366 | Ga0307507_10129822 | |||
| 2367 | Ga0307510_10007534 | |||
| 2368 | Ga0307510_10011049 | |||
| 2369 | Ga0307510_10030284 | |||
| 2370 | Ga0307510_10094994 | |||
| 2371 | Ga0307510_10245668 | |||
| 2372 | Ga0307510_10263591 | |||
| 2373 | Ga0315911_1000024 | |||
| 2374 | Ga0373938_0010308 | |||
| 2375 | Ga0373926_0029845 | |||
| 2376 | Ga0373926_0047541 | |||
| 2377 | Ga0373926_0082365 | |||
| 2378 | Ga0373934_0101394 | |||
| 2379 | Ga0373944_0000833 | |||
| 2380 | Ga0373944_0084537 | |||
| 2381 | Ga0373923_0000022 | |||
| 2382 | Ga0373923_0006016 | |||
| 2383 | Ga0373923_0162102 | |||
| 2384 | Ga0373936_0023248 | |||
| 2385 | Ga0373936_0039715 | |||
| 2386 | Ga0373936_0066598 | |||
| 2387 | Ga0373936_0111610 | |||
| 2388 | Ga0373945_0006815 | |||
| 2389 | Ga0373945_0023683 | |||
| 2390 | Ga0373945_0051997 | |||
| 2391 | Ga0373953_0000468 | |||
| 2392 | Ga0373953_0023144 | |||
| 2393 | Ga0373954_0000519 | |||
| 2394 | Ga0373954_0016654 | |||
| 2395 | Ga0373954_0043971 | |||
| 2396 | Ga0373954_0069110 | |||
| 2397 | Ga0373954_0071910 | |||
| 2398 | Ga0373954_0102158 | |||
| 2399 | Ga0373956_0113378 | |||
| 2400 | Ga0373956_0120863 | |||
| 2401 | Ga0373957_0010201 | |||
| 2402 | Ga0373957_0024318 | |||
| 2403 | Ga0373957_0103363 | |||
| 2404 | Ga0373943_0001832 | |||
| 2405 | Ga0373943_0007592 | |||
| 2406 | Ga0373943_0041582 | |||
| 2407 | Ga0373943_0192818 | |||
| 2408 | Ga0373946_0016673 | |||
| 2409 | Ga0373946_0020193 | |||
| 2410 | Ga0373955_0000402 | |||
| 2411 | Ga0373955_0003617 | |||
| 2412 | Ga0373955_0019856 | |||
| 2413 | Ga0373955_0038256 | |||
| 2414 | Ga0373962_0018109 | |||
| 2415 | Ga0316574_0002046 | |||
| 2416 | Ga0373924_0002920 | |||
| 2417 | Ga0373924_0004843 | |||
| 2418 | Ga0373924_0107398 | |||
| 2419 | Ga0373931_0058705 | |||
| 2420 | Ga0373931_0186049 | |||
| 2421 | Ga0373935_0000244 | |||
| 2422 | Ga0373935_0020883 | |||
| 2423 | Ga0373935_0021933 | |||
| 2424 | Ga0373935_0060125 | |||
| 2425 | Ga0373927_0001820 | |||
| 2426 | Ga0373927_0003221 | |||
| 2427 | Ga0373927_0007112 | |||
| 2428 | Ga0373927_0081034 | |||
| 2429 | Ga0373927_0280831 | |||
| 2430 | Ga0373933_0000114 | |||
| 2431 | Ga0373933_0000374 | |||
| 2432 | Ga0373933_0006739 | |||
| 2433 | Ga0373933_0024593 | |||
| 2434 | Ga0373933_0185468 | |||
| 2435 | Ga0373947_0004892 | |||
| 2436 | Ga0373947_0008108 | |||
| 2437 | Ga0373947_0011337 | |||
| 2438 | Ga0373947_0043417 | |||
| 2439 | Ga0373947_0069836 | |||
| 2440 | Ga0373947_0187371 | |||
| 2441 | Ga0373937_0001469 | |||
| 2442 | Ga0373937_0003416 | |||
| 2443 | Ga0373937_0004831 | |||
| 2444 | Ga0373937_0022308 | |||
| 2445 | Ga0373937_0043053 | |||
| 2446 | Ga0373937_0048738 | |||
| 2447 | Ga0373937_0106793 | |||
| 2448 | Ga0373937_0165064 | |||
| 2449 | Ga0373937_0204572 | |||
| 2450 | Ga0373937_0395092 | |||
| 2451 | Ga0316584_0002434 | |||
| 2452 | Ga0373925_0014715 | |||
| 2453 | Ga0373925_0085545 | |||
| 2454 | Ga0373925_0123338 | |||
| 2455 | Ga0395898_0295430 | |||
| 2456 | Ga0395898_0340814 | |||
| 2457 | Ga0395905_0033085 | |||
| 2458 | Ga0395905_0068527 | |||
| 2459 | Ga0395905_0410962 | |||
| 2460 | Ga0436364_0048041 | |||
| 2461 | Ga0436364_1046390 | |||
| 2462 | Ga0395901_0172375 | |||
| 2463 | Ga0395901_0205715 | |||
| 2464 | Ga0395901_0676645 | |||
| 2465 | Ga0436365_0191440 | |||
| 2466 | Ga0436365_0241841 | |||
| 2467 | Ga0436365_0285454 | |||
| 2468 | Ga0436365_0725015 | |||
| 2469 | Ga0436365_0989879 | |||
| 2470 | Ga0436365_1338721 | |||
| 2471 | Ga0436365_1708547 | |||
| 2472 | Ga0436360_0310216 | |||
| 2473 | Ga0436360_0458549 | |||
| 2474 | Ga0436360_0872213 | |||
| 2475 | Ga0436360_0875496 | |||
| 2476 | Ga0436361_0240915 | |||
| 2477 | Ga0436361_0863829 | |||
| 2478 | Ga0436361_1092466 | |||
| 2479 | Ga0436363_0151139 | |||
| 2480 | Ga0436363_1043486 | |||
| 2481 | Ga0436363_1360117 | |||
| 2482 | Ga0439465_0076397 | |||
| 2483 | Ga0451833_0242002 | |||
| 2484 | Ga0439443_005520 | |||
| 2485 | Ga0439435_0032036 | |||
| 2486 | Ga0439460_0003551 | |||
| 2487 | Ga0466969_0049520 | |||
| 2488 | Ga0466972_0000048 | |||
| 2489 | Ga0466965_0098425 | |||
| 2490 | Ga0466966_0000238 | |||
| 2491 | Ga0466966_0144923 | |||
| 2492 | Ga0466961_0000044 | |||
| 2493 | Ga0466963_0054300 | |||
| 2494 | Ga0466964_0098777 | |||
| 2495 | Ga0466968_0028990 | |||
| 2496 | Ga0466970_0076533 | |||
| 2497 | Ga0466957_0067374 | |||
| 2498 | Ga0466960_0081361 | |||
| 2499 | Ga0466959_0000963 | |||
| 2500 | Ga0466959_0017608 | |||
| 2501 | Ga0451576_0001156 | |||
| 2502 | Ga0451576_0496630 | |||
| 2503 | Ga0466958_0328904 | |||
| 2504 | Ga0466967_0142993 | |||
| 2505 | Ga0466967_0271045 | |||
| 2506 | Ga0495617_020921 | |||
| 2507 | Ga0495627_049161 | |||
| 2508 | Ga0495592_0002074 | |||
| 2509 | Ga0495592_0032704 | |||
| 2510 | Ga0495592_0040311 | |||
| 2511 | Ga0495603_0000370 | |||
| 2512 | Ga0495603_0006854 | |||
| 2513 | Ga0495603_0025017 | |||
| 2514 | Ga0495603_0032180 | |||
| 2515 | Ga0495590_0029439 | |||
| 2516 | Ga0495590_0046024 | |||
| 2517 | Ga0495629_0000081 | |||
| 2518 | Ga0495629_0000380 | |||
| 2519 | Ga0495629_0001124 | |||
| 2520 | Ga0495629_0170162 | |||
| 2521 | Ga0495629_0218504 | |||
| 2522 | Ga0495638_0031456 | |||
| 2523 | Ga0495641_0007097 | |||
| 2524 | Ga0495641_0124184 | |||
| 2525 | Ga0495651_0001523 | |||
| 2526 | Ga0495651_0009321 | |||
| 2527 | Ga0495651_0017237 | |||
| 2528 | Ga0495651_0033842 | |||
| 2529 | Ga0495651_0035032 | |||
| 2530 | Ga0495651_0036906 | |||
| 2531 | Ga0495651_0098692 | |||
| 2532 | Ga0495651_0147119 | |||
| 2533 | Ga0495651_0161790 | |||
| 2534 | Ga0495651_0203471 | |||
| 2535 | Ga0495653_0000807 | |||
| 2536 | Ga0495653_0004588 | |||
| 2537 | Ga0495653_0008281 | |||
| 2538 | Ga0495653_0080323 | |||
| 2539 | Ga0495650_0030451 | |||
| 2540 | Ga0495580_0040123 | |||
| 2541 | Ga0495580_0254571 | |||
| 2542 | Ga0495582_0000051 | |||
| 2543 | Ga0495582_0011691 | |||
| 2544 | Ga0495582_0060346 | |||
| 2545 | Ga0495605_0044972 | |||
| 2546 | Ga0495639_0000010 | |||
| 2547 | Ga0495639_0003638 | |||
| 2548 | Ga0495639_0006195 | |||
| 2549 | Ga0495639_0047817 | |||
| 2550 | Ga0495639_0080272 | |||
| 2551 | Ga0495662_0007880 | |||
| 2552 | Ga0495662_0023141 | |||
| 2553 | Ga0495662_0049960 | |||
| 2554 | Ga0495662_0107253 | |||
| 2555 | Ga0495664_0003734 | |||
| 2556 | Ga0495664_0010817 | |||
| 2557 | Ga0495664_0020718 | |||
| 2558 | Ga0495664_0021685 | |||
| 2559 | Ga0495664_0030030 | |||
| 2560 | Ga0495584_0109513 | |||
| 2561 | Ga0495585_0004363 | |||
| 2562 | Ga0495585_0022427 | |||
| 2563 | Ga0495585_0052914 | |||
| 2564 | Ga0495585_0075849 | |||
| 2565 | Ga0495594_0001074 | |||
| 2566 | Ga0495594_0012226 | |||
| 2567 | Ga0495594_0102654 | |||
| 2568 | Ga0495607_0044870 | |||
| 2569 | Ga0495607_0092938 | |||
| 2570 | Ga0495607_0105301 | |||
| 2571 | Ga0495606_0000265 | |||
| 2572 | Ga0495606_0051543 | |||
| 2573 | Ga0495606_0194748 | |||
| 2574 | Ga0495608_0008172 | |||
| 2575 | Ga0495608_0008410 | |||
| 2576 | Ga0495608_0047354 | |||
| 2577 | Ga0495610_0014371 | |||
| 2578 | Ga0495616_0042659 | |||
| 2579 | Ga0495618_0046111 | |||
| 2580 | Ga0495618_0066259 | |||
| 2581 | Ga0495618_0157063 | |||
| 2582 | Ga0495628_0000115 | |||
| 2583 | Ga0495628_0026354 | |||
| 2584 | Ga0495628_0054423 | |||
| 2585 | Ga0495628_0061993 | |||
| 2586 | Ga0495628_0095564 | |||
| 2587 | Ga0495628_0121237 | |||
| 2588 | Ga0495628_0430908 | |||
| 2589 | Ga0495630_0011435 | |||
| 2590 | Ga0495630_0017568 | |||
| 2591 | Ga0495630_0177953 | |||
| 2592 | Ga0495632_0085709 | |||
| 2593 | Ga0495643_0030597 | |||
| 2594 | Ga0495643_0034671 | |||
| 2595 | Ga0495644_0039229 | |||
| 2596 | Ga0495648_0000271 | |||
| 2597 | Ga0495648_0007795 | |||
| 2598 | Ga0495648_0059977 | |||
| 2599 | Ga0495648_0198579 | |||
| 2600 | Ga0495663_0041401 | |||
| 2601 | Ga0495663_0046639 | |||
| 2602 | Ga0495666_0015984 | |||
| 2603 | Ga0495666_0056425 | |||
| 2604 | Ga0495666_0201053 | |||
| 2605 | Ga0495642_0040013 | |||
| 2606 | Ga0495652_0007397 | |||
| 2607 | Ga0495652_0020559 | |||
| 2608 | Ga0495652_0068933 | |||
| 2609 | Ga0495652_0084882 | |||
| 2610 | Ga0495652_0130893 | |||
| 2611 | Ga0495654_0024723 | |||
| 2612 | Ga0495665_0000005 | |||
| 2613 | Ga0495665_0023984 | |||
| 2614 | Ga0495665_0026680 | |||
| 2615 | Ga0495640_0000301 | |||
| 2616 | Ga0495640_0009451 | |||
| 2617 | Ga0495640_0012766 | |||
| 2618 | Ga0495640_0019216 | |||
| 2619 | Ga0495587_0002764 | |||
| 2620 | Ga0495587_0037268 | |||
| 2621 | Ga0495587_0042194 | |||
| 2622 | Ga0495587_0072019 | |||
| 2623 | Ga0495598_0004502 | |||
| 2624 | Ga0495598_0025576 | |||
| 2625 | Ga0495598_0050375 | |||
| 2626 | Ga0495621_0030961 | |||
| 2627 | Ga0495597_0142002 | |||
| 2628 | Ga0495645_0000994 | |||
| 2629 | Ga0495645_0010387 | |||
| 2630 | Ga0495645_0014229 | |||
| 2631 | Ga0495645_0039260 | |||
| 2632 | Ga0495645_0067971 | |||
| 2633 | Ga0495622_0036869 | |||
| 2634 | Ga0495622_0057834 | |||
| 2635 | Ga0495633_0009170 | |||
| 2636 | Ga0495633_0127635 | |||
| 2637 | Ga0495633_0137651 | |||
| 2638 | Ga0495667_0002081 | |||
| 2639 | Ga0495667_0002874 | |||
| 2640 | Ga0495667_0002956 | |||
| 2641 | Ga0495667_0004975 | |||
| 2642 | Ga0495667_0013842 | |||
| 2643 | Ga0495667_0055145 | |||
| 2644 | Ga0495667_0090933 | |||
| 2645 | Ga0495656_0000981 | |||
| 2646 | Ga0495656_0001491 | |||
| 2647 | Ga0495656_0011915 | |||
| 2648 | Ga0495668_0111830 | |||
| 2649 | Ga0495634_0000764 | |||
| 2650 | Ga0495634_0008147 | |||
| 2651 | Ga0495634_0016602 | |||
| 2652 | Ga0495634_0127514 | |||
| 2653 | Ga0495634_0129531 | |||
| 2654 | Ga0495625_0028874 | |||
| 2655 | Ga0495635_0000213 | |||
| 2656 | Ga0495635_0000259 | |||
| 2657 | Ga0495635_0016975 | |||
| 2658 | Ga0495635_0030094 | |||
| 2659 | Ga0495635_0049090 | |||
| 2660 | Ga0495635_0065423 | |||
| 2661 | Ga0495635_0249981 | |||
| 2662 | Ga0495659_0001624 | |||
| 2663 | Ga0495659_0007589 | |||
| 2664 | Ga0495659_0032403 | |||
| 2665 | Ga0495661_0009639 | |||
| 2666 | Ga0495661_0065688 | |||
| 2667 | Ga0495661_0196732 | |||
| 2668 | Ga0495588_0024498 | |||
| 2669 | Ga0495588_0024537 | |||
| 2670 | Ga0495657_0002844 | |||
| 2671 | Ga0495657_0016391 | |||
| 2672 | Ga0495657_0016908 | |||
| 2673 | Ga0495657_0025579 | |||
| 2674 | Ga0495657_0082646 | |||
| 2675 | Ga0495599_0007346 | |||
| 2676 | Ga0495599_0014241 | |||
| 2677 | Ga0495599_0014708 | |||
| 2678 | Ga0495599_0014832 | |||
| 2679 | Ga0495623_0005373 | |||
| 2680 | Ga0495646_0004387 | |||
| 2681 | Ga0495646_0029664 | |||
| 2682 | Ga0495646_0067197 | |||
| 2683 | Ga0495647_0000671 | |||
| 2684 | Ga0495647_0009031 | |||
| 2685 | Ga0495647_0018362 | |||
| 2686 | Ga0495658_0001217 | |||
| 2687 | Ga0495658_0003377 | |||
| 2688 | Ga0495658_0015731 | |||
| 2689 | Ga0495658_0039662 | |||
| 2690 | Ga0495658_0044760 | |||
| 2691 | Ga0495658_0055581 | |||
| 2692 | Ga0495658_0150455 | |||
| 2693 | Ga0495669_0017236 | |||
| 2694 | Ga0495613_0001985 | |||
| 2695 | Ga0495613_0008073 | |||
| 2696 | Ga0495613_0029070 | |||
| 2697 | Ga0495613_0039681 | |||
| 2698 | Ga0495613_0040397 | |||
| 2699 | Ga0495624_0000094 | |||
| 2700 | Ga0495624_0005832 | |||
| 2701 | Ga0495624_0039916 | |||
| 2702 | Ga0495624_0105692 | |||
| 2703 | Ga0495624_0221826 | |||
| 2704 | Ga0495670_0006395 | |||
| 2705 | Ga0495670_0020245 | |||
| 2706 | Ga0495670_0035981 | |||
| 2707 | Ga0495670_0079467 | |||
| 2708 | Ga0495649_0045404 | |||
| 2709 | Ga0495649_0150303 | |||
| 2710 | Ga0495589_0082575 | |||
| 2711 | Ga0495600_0001029 | |||
| 2712 | Ga0495600_0001162 | |||
| 2713 | Ga0495600_0002671 | |||
| 2714 | Ga0495600_0010441 | |||
| 2715 | Ga0495600_0077585 | |||
| 2716 | Ga0495600_0197916 | |||
| 2717 | Ga0495600_0244756 | |||
| 2718 | Ga0495581_0001146 | |||
| 2719 | Ga0495581_0039890 | |||
| 2720 | Ga0495581_0054963 | |||
| 2721 | Ga0495581_0059405 | |||
| 2722 | Ga0495581_0062688 | |||
| 2723 | Ga0495581_0120994 | |||
| 2724 | Ga0495581_0233294 | |||
| 2725 | Ga0495604_0002338 | |||
| 2726 | Ga0495604_0002686 | |||
| 2727 | Ga0495604_0005951 | |||
| 2728 | Ga0495604_0015525 | |||
| 2729 | Ga0495604_0061087 | |||
| 2730 | Ga0495604_0150464 | |||
| 2731 | Ga0495636_0044370 | |||
| 2732 | Ga0495674_0000955 | |||
| 2733 | Ga0495674_0015736 | |||
| 2734 | Ga0495674_0033074 | |||
| 2735 | Ga0495674_0093291 | |||
| 2736 | Ga0495672_0016111 | |||
| 2737 | Ga0495672_0085617 | |||
| 2738 | Ga0495676_0067157 | |||
| 2739 | Ga0495680_0002637 | |||
| 2740 | Ga0495680_0013217 | |||
| 2741 | Ga0495680_0014747 | |||
| 2742 | Ga0495680_0077921 | |||
| 2743 | Ga0495680_0095688 | |||
| 2744 | Ga0495680_0135662 | |||
| 2745 | Ga0495675_0000756 | |||
| 2746 | Ga0495675_0009113 | |||
| 2747 | Ga0495675_0020522 | |||
| 2748 | Ga0495675_0042090 | |||
| 2749 | Ga0495679_023599 | |||
| 2750 | Ga0495679_057589 | |||
| 2751 | Ga0495673_0046413 | |||
| 2752 | Ga0495684_0000052 | |||
| 2753 | Ga0495684_0005982 | |||
| 2754 | Ga0495684_0021687 | |||
| 2755 | Ga0495684_0034401 | |||
| 2756 | Ga0495684_0039927 | |||
| 2757 | Ga0495593_0000084 | |||
| 2758 | Ga0495593_0000518 | |||
| 2759 | Ga0495593_0030920 | |||
| 2760 | Ga0495593_0044493 | |||
| 2761 | Ga0495602_0005240 | |||
| 2762 | Ga0495602_0017645 | |||
| 2763 | Ga0495602_0067122 | |||
| 2764 | Ga0495602_0172220 | |||
| 2765 | Ga0496100_0002070 | |||
| 2766 | Ga0496100_0003202 | |||
| 2767 | Ga0496100_0007436 | |||
| 2768 | Ga0496100_0011757 | |||
| 2769 | Ga0496100_0074702 | |||
| 2770 | Ga0496101_0010499 | |||
| 2771 | Ga0496101_0013727 | |||
| 2772 | Ga0496101_0086452 | |||
| 2773 | Ga0496101_0112749 | |||
| 2774 | Ga0496101_0190511 | |||
| 2775 | Ga0496101_0190527 | |||
| 2776 | Ga0496102_0002260 | |||
| 2777 | Ga0496102_0008445 | |||
| 2778 | Ga0496102_0012347 | |||
| 2779 | Ga0496102_0028962 | |||
| 2780 | Ga0496102_0085393 | |||
| 2781 | Ga0496102_0133391 | |||
| 2782 | Ga0496102_0213438 | |||
| 2783 | Ga0496102_0264513 | |||
| 2784 | Ga0496102_0287089 | |||
| 2785 | Ga0496103_0010418 | |||
| 2786 | Ga0496103_0190253 | |||
| 2787 | Ga0496103_0232674 | |||
| 2788 | Ga0496104_0000355 | |||
| 2789 | Ga0496104_0002092 | |||
| 2790 | Ga0496104_0002505 | |||
| 2791 | Ga0496104_0005097 | |||
| 2792 | Ga0496104_0013196 | |||
| 2793 | Ga0496104_0013207 | |||
| 2794 | Ga0496104_0031130 | |||
| 2795 | Ga0496104_0100268 | |||
| 2796 | Ga0496104_0111701 | |||
| 2797 | Ga0496104_0115091 | |||
| 2798 | Ga0496104_0154112 | |||
| 2799 | Ga0496104_0169359 | |||
| 2800 | Ga0496104_0196077 | |||
| 2801 | Ga0496104_0252609 | |||
| 2802 | Ga0496104_0280421 | |||
| 2803 | Ga0496105_0007792 | |||
| 2804 | Ga0496105_0009967 | |||
| 2805 | Ga0496105_0036325 | |||
| 2806 | Ga0496105_0043466 | |||
| 2807 | Ga0496105_0047162 | |||
| 2808 | Ga0496105_0103471 | |||
| 2809 | Ga0496105_0107881 | |||
| 2810 | Ga0496106_0000262 | |||
| 2811 | Ga0496106_0005300 | |||
| 2812 | Ga0496106_0007107 | |||
| 2813 | Ga0496106_0009020 | |||
| 2814 | Ga0496106_0031238 | |||
| 2815 | Ga0496106_0130848 | |||
| 2816 | Ga0496106_0141426 | |||
| 2817 | Ga0496106_0283172 | |||
| 2818 | Ga0496106_0286362 | |||
| 2819 | Ga0496107_0006402 | |||
| 2820 | Ga0496107_0008145 | |||
| 2821 | Ga0496107_0026340 | |||
| 2822 | Ga0496107_0095745 | |||
| 2823 | Ga0496107_0180235 | |||
| 2824 | Ga0496107_0189534 | |||
| 2825 | Ga0496108_0000357 | |||
| 2826 | Ga0496108_0002206 | |||
| 2827 | Ga0496108_0019692 | |||
| 2828 | Ga0496108_0036720 | |||
| 2829 | Ga0496108_0128267 | |||
| 2830 | Ga0496108_0152555 | |||
| 2831 | Ga0496108_0255222 | |||
| 2832 | Ga0496108_0334821 | |||
| 2833 | Ga0496108_0381278 | |||
| 2834 | Ga0496109_0001120 | |||
| 2835 | Ga0496109_0002394 | |||
| 2836 | Ga0496109_0003393 | |||
| 2837 | Ga0496109_0019820 | |||
| 2838 | Ga0496109_0033231 | |||
| 2839 | Ga0496109_0068095 | |||
| 2840 | Ga0496109_0073170 | |||
| 2841 | Ga0496109_0115139 | |||
| 2842 | Ga0496109_0171529 | |||
| 2843 | Ga0496109_0200548 | |||
| 2844 | Ga0496109_0303959 | |||
| 2845 | Ga0496109_0311271 | |||
| 2846 | Ga0496109_0450813 | |||
| 2847 | Ga0496110_0000205 | |||
| 2848 | Ga0496110_0000214 | |||
| 2849 | Ga0496110_0003778 | |||
| 2850 | Ga0496110_0011003 | |||
| 2851 | Ga0496110_0033779 | |||
| 2852 | Ga0496110_0059615 | |||
| 2853 | Ga0496110_0234627 | |||
| 2854 | Ga0496111_0009382 | |||
| 2855 | Ga0496111_0017446 | |||
| 2856 | Ga0496111_0021207 | |||
| 2857 | Ga0496111_0029313 | |||
| 2858 | Ga0496111_0074574 | |||
| 2859 | Ga0496111_0118345 | |||
| 2860 | Ga0496112_0000019 | |||
| 2861 | Ga0496112_0006469 | |||
| 2862 | Ga0496112_0008306 | |||
| 2863 | Ga0496112_0014600 | |||
| 2864 | Ga0496112_0018368 | |||
| 2865 | Ga0496112_0049850 | |||
| 2866 | Ga0496112_0051135 | |||
| 2867 | Ga0496112_0060871 | |||
| 2868 | Ga0496112_0081318 | |||
| 2869 | Ga0496112_0115121 | |||
| 2870 | Ga0496112_0161353 | |||
| 2871 | Ga0496113_0006975 | |||
| 2872 | Ga0496113_0010586 | |||
| 2873 | Ga0496113_0012822 | |||
| 2874 | Ga0496113_0014335 | |||
| 2875 | Ga0496113_0100574 | |||
| 2876 | Ga0496113_0121802 | |||
| 2877 | Ga0496113_0182381 | |||
| 2878 | Ga0496113_0247459 | |||
| 2879 | Ga0496114_0001228 | |||
| 2880 | Ga0496114_0029582 | |||
| 2881 | Ga0496114_0033066 | |||
| 2882 | Ga0496114_0089379 | |||
| 2883 | Ga0496114_0210258 | |||
| 2884 | Ga0496114_0275296 | |||
| 2885 | Ga0496114_0352468 | |||
| 2886 | Ga0496114_0455267 | |||
| 2887 | Ga0496114_0656683 | |||
| 2888 | Ga0496115_0004229 | |||
| 2889 | Ga0496115_0008048 | |||
| 2890 | Ga0496115_0021524 | |||
| 2891 | Ga0496115_0029321 | |||
| 2892 | Ga0496115_0080259 | |||
| 2893 | Ga0496115_0084242 | |||
| 2894 | Ga0496115_0152003 | |||
| 2895 | Ga0496115_0287002 | |||
| 2896 | Ga0496115_0316617 | |||
| 2897 | Ga0496116_0002417 | |||
| 2898 | Ga0496116_0050987 | |||
| 2899 | Ga0496117_0018002 | |||
| 2900 | Ga0496117_0023389 | |||
| 2901 | Ga0496117_0087055 | |||
| 2902 | Ga0496117_0088117 | |||
| 2903 | Ga0496118_0012386 | |||
| 2904 | Ga0496118_0049433 | |||
| 2905 | Ga0496118_0053446 | |||
| 2906 | Ga0496118_0103252 | |||
| 2907 | Ga0496118_0108023 | |||
| 2908 | Ga0496118_0202765 | |||
| 2909 | Ga0496119_0054246 | |||
| 2910 | Ga0496119_0054585 | |||
| 2911 | Ga0496120_0075070 | |||
| 2912 | Ga0496121_0001792 | |||
| 2913 | Ga0496121_0002340 | |||
| 2914 | Ga0496121_0009331 | |||
| 2915 | Ga0496121_0010594 | |||
| 2916 | Ga0496121_0021376 | |||
| 2917 | Ga0496121_0023069 | |||
| 2918 | Ga0496121_0038228 | |||
| 2919 | Ga0496121_0069240 | |||
| 2920 | Ga0496121_0078424 | |||
| 2921 | Ga0496121_0128909 | |||
| 2922 | Ga0496121_0139294 | |||
| 2923 | Ga0496121_0170352 | |||
| 2924 | Ga0496121_0182789 | |||
| 2925 | Ga0496122_0043715 | |||
| 2926 | Ga0496122_0061496 | |||
| 2927 | Ga0496122_0062910 | |||
| 2928 | Ga0496123_0044422 | |||
| 2929 | Ga0496123_0059825 | |||
| 2930 | Ga0496124_0002998 | |||
| 2931 | Ga0496124_0116329 | |||
| 2932 | Ga0496124_0117952 | |||
| 2933 | Ga0496124_0141815 | |||
| 2934 | Ga0496124_0311228 | |||
| 2935 | Ga0496125_0000048 | |||
| 2936 | Ga0496125_0003042 | |||
| 2937 | Ga0496125_0020421 | |||
| 2938 | Ga0496125_0020601 | |||
| 2939 | Ga0496125_0033975 | |||
| 2940 | Ga0496125_0045631 | |||
| 2941 | Ga0496125_0048395 | |||
| 2942 | Ga0496125_0125076 | |||
| 2943 | Ga0496126_0001531 | |||
| 2944 | Ga0496126_0007269 | |||
| 2945 | Ga0496126_0022191 | |||
| 2946 | Ga0496126_0053197 | |||
| 2947 | Ga0496126_0063890 | |||
| 2948 | Ga0496126_0084610 | |||
| 2949 | Ga0496126_0085677 | |||
| 2950 | Ga0496126_0201529 | |||
| 2951 | Ga0496126_0386822 | |||
| 2952 | Ga0495682_0106530 | |||
| 2953 | Ga0501040_0205804 | |||
| 2954 | Ga0501040_0232929 | |||
| 2955 | Ga0501072_0012253 | |||
| 2956 | Ga0501072_0178888 | |||
| 2957 | Ga0501076_0360227 | |||
| 2958 | Ga0501079_0158269 | |||
| 2959 | Ga0501080_0189941 | |||
| 2960 | Ga0501081_0023726 | |||
| 2961 | nmdc:mga03683_115613_c1 | |||
| 2962 | nmdc:mga03683_12165_c1 | |||
| 2963 | nmdc:mga03683_5238_c1 | |||
| 2964 | nmdc:mga03683_61544_c1 | |||
| 2965 | nmdc:mga03n38_110650_c1 | |||
| 2966 | nmdc:mga03n38_1386_c1 | |||
| 2967 | nmdc:mga03n38_152415_c1 | |||
| 2968 | nmdc:mga03n38_38856_c1 | |||
| 2969 | nmdc:mga03n38_93275_c1 | |||
| 2970 | nmdc:mga00v17_161423_c1 | |||
| 2971 | nmdc:mga00v17_193505_c1 | |||
| 2972 | nmdc:mga00v17_235422_c1 | |||
| 2973 | nmdc:mga00v17_318133_c1 | |||
| 2974 | nmdc:mga00v17_358939_c1 | |||
| 2975 | nmdc:mga00v17_82162_c1 | |||
| 2976 | nmdc:mga0yw44_127834_c1 | |||
| 2977 | nmdc:mga0yw44_330496_c1 | |||
| 2978 | nmdc:mga0yw44_403898_c1 | |||
| 2979 | nmdc:mga0yw44_59246_c1 | |||
| 2980 | nmdc:mga0yw44_92609_c1 | |||
| 2981 | nmdc:mga0k408_18266_c1 | |||
| 2982 | nmdc:mga0k408_27566_c1 | |||
| 2983 | nmdc:mga0k408_29533_c1 | |||
| 2984 | nmdc:mga0k408_77148_c1 | |||
| 2985 | nmdc:mga06z11_207236_c1 | |||
| 2986 | nmdc:mga06z11_46885_c1 | |||
| 2987 | nmdc:mga06z11_60561_c1 | |||
| 2988 | nmdc:mga06z11_672_c1 | |||
| 2989 | nmdc:mga04h51_38042_c1 | |||
| 2990 | nmdc:mga04h51_42884_c1 | |||
| 2991 | nmdc:mga04h51_671_c1 | |||
| 2992 | nmdc:mga07m45_103435_c1 | |||
| 2993 | nmdc:mga07m45_8956_c1 | |||
| 2994 | nmdc:mga05p37_277222_c1 | |||
| 2995 | nmdc:mga05p37_289475_c1 | |||
| 2996 | nmdc:mga05p37_337234_c1 | |||
| 2997 | nmdc:mga05p37_33971_c1 | |||
| 2998 | nmdc:mga05p37_63416_c1 | |||
| 2999 | nmdc:mga0qj67_20_c1 | |||
| 3000 | nmdc:mga0qj67_93234_c1 | |||
| 3001 | nmdc:mga06r32_102633_c1 | |||
| 3002 | nmdc:mga06r32_113971_c1 | |||
| 3003 | nmdc:mga06r32_415863_c1 | |||
| 3004 | nmdc:mga06r32_86776_c1 | |||
| 3005 | nmdc:mga08y16_125408_c1 | |||
| 3006 | nmdc:mga08y16_159658_c1 | |||
| 3007 | nmdc:mga0n895_170663_c1 | |||
| 3008 | nmdc:mga0n895_216861_c1 | |||
| 3009 | nmdc:mga0n895_244620_c1 | |||
| 3010 | nmdc:mga0rr50_88932_c1 | |||
| 3011 | nmdc:mga0a205_123013_c1 | |||
| 3012 | nmdc:mga0a205_170388_c1 | |||
| 3013 | nmdc:mga0sz30_1011_c1 | |||
| 3014 | nmdc:mga0sz30_13780_c1 | |||
| 3015 | nmdc:mga0sz30_63010_c1 | |||
| 3016 | nmdc:mga0sz30_66381_c1 | |||
| 3017 | nmdc:mga0sz30_72291_c1 | |||
| 3018 | nmdc:mga0sz30_88011_c1 | |||
| 3019 | Ga0495601_0000305 | |||
| 3020 | Ga0495601_0011287 | |||
| 3021 | Ga0495601_0018567 | |||
| 3022 | Ga0495601_0029678 | |||
| 3023 | Ga0495601_0046252 | |||
| 3024 | Ga0495601_0049541 | |||
| 3025 | Ga0495601_0097121 | |||
| 3026 | Ga0495601_0134956 | |||
| 3027 | Ga0495612_0001062 | |||
| 3028 | Ga0495612_0010200 | |||
| 3029 | Ga0495612_0137247 | |||
| 3030 | Ga0500635_0002948 | |||
| 3031 | Ga0495595_0000258 | |||
| 3032 | Ga0495595_0000279 | |||
| 3033 | Ga0495595_0005878 | |||
| 3034 | Ga0495595_0007822 | |||
| 3035 | Ga0495595_0034009 | |||
| 3036 | Ga0495619_0000159 | |||
| 3037 | Ga0495619_0000377 | |||
| 3038 | Ga0495619_0000870 | |||
| 3039 | Ga0495619_0000913 | |||
| 3040 | Ga0495619_0018863 | |||
| 3041 | Ga0495619_0025691 | |||
| 3042 | Ga0495619_0032296 | |||
| 3043 | Ga0495619_0041017 | |||
| 3044 | Ga0495619_0080962 | |||
| 3045 | Ga0495619_0151021 | |||
| 3046 | Ga0495619_0160939 | |||
| 3047 | Ga0495619_0242024 | |||
| 3048 | Ga0500578_0154231 | |||
| 3049 | Ga0500578_0191848 | |||
| 3050 | Ga0500643_000091 | |||
| 3051 | Ga0500644_0014191 | |||
| 3052 | Ga0500581_003120 | |||
| 3053 | Ga0500646_0007849 | |||
| 3054 | Ga0500646_0085887 | |||
| 3055 | Ga0500647_0019458 | |||
| 3056 | Ga0500647_0035940 | |||
| 3057 | Ga0500583_0061791 | |||
| 3058 | Ga0500583_0075530 | |||
| 3059 | Ga0500651_0003570 | |||
| 3060 | Ga0500651_0021493 | |||
| 3061 | Ga0500651_0041703 | |||
| 3062 | Ga0500651_0044167 | |||
| 3063 | Ga0500566_0000199 | |||
| 3064 | Ga0500566_0001862 | |||
| 3065 | Ga0500566_0005554 | |||
| 3066 | Ga0500566_0011591 | |||
| 3067 | Ga0500566_0147602 | |||
| 3068 | Ga0500640_000362 | |||
| 3069 | Ga0500641_0009296 | |||
| 3070 | Ga0500650_0019978 | |||
| 3071 | Ga0500554_052233 | |||
| 3072 | Ga0500555_026618 | |||
| 3073 | Ga0500555_034857 | |||
| 3074 | Ga0500556_0000091 | |||
| 3075 | Ga0500556_0032128 | |||
| 3076 | Ga0500556_0036442 | |||
| 3077 | Ga0500557_000043 | |||
| 3078 | Ga0500562_041040 | |||
| 3079 | Ga0500569_000764 | |||
| 3080 | Ga0500572_000254 | |||
| 3081 | Ga0500572_001685 | |||
| 3082 | Ga0500572_002479 | |||
| 3083 | Ga0500593_015527 | |||
| 3084 | Ga0500594_0023858 | |||
| 3085 | Ga0500594_0024902 | |||
| 3086 | Ga0500595_000001 | |||
| 3087 | Ga0500595_001153 | |||
| 3088 | Ga0500595_001894 | |||
| 3089 | Ga0500595_006741 | |||
| 3090 | Ga0500595_009741 | |||
| 3091 | Ga0500595_022147 | |||
| 3092 | Ga0500608_024017 | |||
| 3093 | Ga0500608_108111 | |||
| 3094 | Ga0500614_002002 | |||
| 3095 | Ga0500618_015870 | |||
| 3096 | Ga0500642_0000046 | |||
| 3097 | Ga0500642_0000129 | |||
| 3098 | Ga0500642_0098851 | |||
| 3099 | Ga0500652_008962 | |||
| 3100 | Ga0500652_012313 | |||
| 3101 | Ga0500655_017301 | |||
| 3102 | Ga0500658_0061763 | |||
| 3103 | Ga0500658_0095634 | |||
| 3104 | Ga0500559_0000201 | |||
| 3105 | Ga0500559_0000287 | |||
| 3106 | Ga0500559_0000803 | |||
| 3107 | Ga0500559_0015771 | |||
| 3108 | Ga0500559_0029076 | |||
| 3109 | Ga0500568_0002999 | |||
| 3110 | Ga0500568_0025139 | |||
| 3111 | Ga0500568_0033886 | |||
| 3112 | Ga0500577_0039113 | |||
| 3113 | Ga0500577_0042885 | |||
| 3114 | Ga0500589_107840 | |||
| 3115 | Ga0500590_044248 | |||
| 3116 | Ga0500590_151712 | |||
| 3117 | Ga0500603_000119 | |||
| 3118 | Ga0500603_000839 | |||
| 3119 | Ga0500603_001632 | |||
| 3120 | Ga0500616_0000022 | |||
| 3121 | Ga0500616_0000283 | |||
| 3122 | Ga0500616_0002182 | |||
| 3123 | Ga0500622_0016789 | |||
| 3124 | Ga0500622_0017072 | |||
| 3125 | Ga0500622_0035115 | |||
| 3126 | Ga0500622_0049796 | |||
| 3127 | Ga0500627_0017230 | |||
| 3128 | Ga0500627_0089282 | |||
| 3129 | Ga0500630_003337 | |||
| 3130 | Ga0500639_004881 | |||
| 3131 | Ga0500636_0000291 | |||
| 3132 | Ga0500636_0000970 | |||
| 3133 | Ga0500636_0003204 | |||
| 3134 | Ga0500636_0010476 | |||
| 3135 | Ga0500636_0108023 | |||
| 3136 | Ga0500637_0000757 | |||
| 3137 | Ga0500637_0001082 | |||
| 3138 | Ga0500637_0042820 | |||
| 3139 | Ga0500567_104933 | |||
| 3140 | Ga0500576_058468 | |||
| 3141 | Ga0500576_092761 | |||
| 3142 | Ga0500576_124916 | |||
| 3143 | Ga0500645_000371 | |||
| 3144 | Ga0500645_019793 | |||
| 3145 | Ga0500609_001958 | |||
| 3146 | Ga0500552_000588 | |||
| 3147 | Ga0500596_000981 | |||
| 3148 | Ga0500596_008877 | |||
| 3149 | Ga0500601_000421 | |||
| 3150 | Ga0501084_0048521 | |||
| 3151 | Ga0501084_0068030 | |||
| 3152 | Ga0501084_0346291 | |||
| 3153 | Ga0500661_002205 | |||
| 3154 | Ga0501082_0248233 | |||
| 3155 | Ga0530510_0205009 | |||
| 3156 | 2507504817 | |||
| 3157 | 2508546169 | |||
| 3158 | 2508695103 | |||
| 3159 | 2511399022 | |||
| 3160 | 2513589571 | |||
| 3161 | 2513626159 | |||
| 3162 | 2513641884 | |||
| 3163 | 2513647990 | |||
| 3164 | 2513656475 | |||
| 3165 | 2513673007 | |||
| 3166 | 2513694892 | |||
| 3167 | 2513705995 | |||
| 3168 | 2513715683 | |||
| 3169 | 2513858951 | |||
| 3170 | 2513873939 | |||
| 3171 | 2513890431 | |||
| 3172 | 2513917346 | |||
| 3173 | 2514012913 | |||
| 3174 | 2515625893 | |||
| 3175 | 2517102415 | |||
| 3176 | 2517889569 | |||
| 3177 | 2524435718 | |||
| 3178 | 2524466481 | |||
| 3179 | 2524539555 | |||
| 3180 | 2528855164 | |||
| 3181 | 2603861859 | |||
| 3182 | 2617351675 | |||
| 3183 | 2617374157 | |||
| 3184 | 2671121241 | |||
| 3185 | 2723842055 | |||
| 3186 | 2738885832 | |||
| 3187 | 2739282594 | |||
| 3188 | 2745079014 | |||
| 3189 | 2793063127 | |||
| 3190 | 2793073656 | |||
| 3191 | 2793077395 | |||
| 3192 | 2805919474 | |||
| 3193 | 2818237252 | |||
| 3194 | 2819719442 | |||
| 3195 | 2824602548 | |||
| 3196 | 2824612672 | |||
| 3197 | 2824624779 | |||
| 3198 | 2824633651 | |||
| 3199 | 2824643259 | |||
| 3200 | 2824651470 | |||
| 3201 | 2824654486 | |||
| 3202 | 2824663637 | |||
| 3203 | 2824674880 | |||
| 3204 | 2824685488 | |||
| 3205 | 2824691948 | |||
| 3206 | 2824700438 | |||
| 3207 | 2824708482 | |||
| 3208 | 2824721584 | |||
| 3209 | 2824731518 | |||
| 3210 | 2824734841 | |||
| 3211 | 2824748153 | |||
| 3212 | 2824757142 | |||
| 3213 | 2824772081 | |||
| 3214 | 2824774969 | |||
| 3215 | 2838129531 | |||
| 3216 | 2841913941 | |||
| 3217 | 2841920506 | |||
| 3218 | 2841944432 | |||
| 3219 | 2841951573 | |||
| 3220 | 2841964641 | |||
| 3221 | 2841969209 | |||
| 3222 | 2841982874 | |||
| 3223 | 2841991044 | |||
| 3224 | 2842043909 | |||
| 3225 | 2842052101 | |||
| 3226 | 2842695329 | |||
| 3227 | 2844321796 | |||
| 3228 | 2847931495 | |||
| 3229 | 2847941727 | |||
| 3230 | 2849082645 | |||
| 3231 | 2857511542 | |||
| 3232 | 2857526029 | |||
| 3233 | 2874594224 | |||
| 3234 | 2874610327 | |||
| 3235 | 2874617946 | |||
| 3236 | 2874624395 | |||
| 3237 | 2874636679 | |||
| 3238 | 2874647650 | |||
| 3239 | 2876765015 | |||
| 3240 | 2876771872 | |||
| 3241 | 2876812804 | |||
| 3242 | 2876819178 | |||
| 3243 | 2879075723 | |||
| 3244 | 2879087467 | |||
| 3245 | 2879101273 | |||
| 3246 | 2879111648 | |||
| 3247 | 2879130746 | |||
| 3248 | 2879146094 | |||
| 3249 | 2881371029 | |||
| 3250 | 2881665668 | |||
| 3251 | 2885371423 | |||
| 3252 | 2885375075 | |||
| 3253 | 2885385388 | |||
| 3254 | 2885410823 | |||
| 3255 | 2888379994 | |||
| 3256 | 2888391070 | |||
| 3257 | 2888420799 | |||
| 3258 | 2889035039 | |||
| 3259 | 2893067698 | |||
| 3260 | 2899931519 | |||
| 3261 | 2903727654 | |||
| 3262 | 2903756146 | |||
| 3263 | 2903772294 | |||
| 3264 | 2904672266 | |||
| 3265 | 2904692128 | |||
| 3266 | 2904709394 | |||
| 3267 | 2904716155 | |||
| 3268 | 2906602856 | |||
| 3269 | 2906613048 | |||
| 3270 | 2906627040 | |||
| 3271 | 2906641156 | |||
| 3272 | 2906652363 | |||
| 3273 | 2906665712 | |||
| 3274 | 2908748069 | |||
| 3275 | 2908757410 | |||
| 3276 | 2908776631 | |||
| 3277 | 2922366926 | |||
| 3278 | 2922378377 | |||
| 3279 | 2922388582 | |||
| 3280 | 2922400338 | |||
| 3281 | 2922433518 | |||
| 3282 | 2928056517 | |||
| 3283 | 2928069014 | |||
| 3284 | 2929622523 | |||
| 3285 | 2929631259 | |||
| 3286 | 2932786320 | |||
| 3287 | 2932794712 | |||
| 3288 | 2932805477 | |||
| 3289 | 2932812605 | |||
| 3290 | 2932822967 | |||
| 3291 | 2932829558 | |||
| 3292 | 2933584398 | |||
| 3293 | 2935614985 | |||
| 3294 | 2935618076 | |||
| 3295 | 2935635061 | |||
| 3296 | 2935641526 | |||
| 3297 | 2935651667 | |||
| 3298 | 2935659566 | |||
| 3299 | 2935669416 | |||
| 3300 | 2935677986 | |||
| 3301 | 2935689563 | |||
| 3302 | 2935701775 | |||
| 3303 | 2935707240 | |||
| 3304 | 2935717082 | |||
| 3305 | 2935730084 | |||
| 3306 | 2935738497 | |||
| 3307 | 2935749255 | |||
| 3308 | 2935756916 | |||
| 3309 | 2935764470 | |||
| 3310 | 2935772802 | |||
| 3311 | 2935778062 | |||
| 3312 | 2935787289 | |||
| 3313 | 2935795923 | |||
| 3314 | 2935804380 | |||
| 3315 | 2935817241 | |||
| 3316 | 2935825976 | |||
| 3317 | 2935831257 | |||
| 3318 | 2935841866 | |||
| 3319 | 2935851595 | |||
| 3320 | 2935856425 | |||
| 3321 | 2935871052 | |||
| 3322 | 2935874549 | |||
| 3323 | 2935888926 | |||
| 3324 | 2935910382 | |||
| 3325 | 2935918332 | |||
| 3326 | 2935927707 | |||
| 3327 | 2935936421 | |||
| 3328 | 2935944026 | |||
| 3329 | 2935952463 | |||
| 3330 | 2935964171 | |||
| 3331 | 2935969303 | |||
| 3332 | 2935977935 | |||
| 3333 | 2935984764 | |||
| 3334 | 2935994010 | |||
| 3335 | 2936004979 | |||
| 3336 | 2936013981 | |||
| 3337 | 2936023109 | |||
| 3338 | 2936031246 | |||
| 3339 | 2936044037 | |||
| 3340 | 2936049368 | |||
| 3341 | 2936055934 | |||
| 3342 | 2940562830 | |||
| 3343 | 2941511660 | |||
| 3344 | 2941519357 | |||
| 3345 | 2941527519 | |||
| 3346 | 2941532327 | |||
| 3347 | 2941543939 | |||
| 3348 | 3005483200 | |||
| 3349 | 3005488940 | |||
| 3350 | 3005509571 | |||
| 3351 | 3005594167 | |||
| 3352 | 3005602145 | |||
| 3353 | 3005717901 | |||
| 3354 | 3005724934 | |||
| 3355 | 8006929263 | |||
| 3356 | 8006935570 | |||
| 3357 | 8006968346 | |||
| 3358 | 8006975496 | |||
| 3359 | 8006985899 | |||
| 3360 | 8007000279 | |||
| 3361 | 8016518670 | |||
| 3362 | 8016526631 | |||
| 3363 | 8016557159 | |||
| 3364 | 8016565509 | |||
| 3365 | 8016582562 | |||
| 3366 | 8016586842 | |||
| 3367 | 8016603136 | |||
| 3368 | 8016606050 | |||
| 3369 | 8016617933 | |||
| 3370 | 8016623638 | |||
| 3371 | 8016636114 | |||
| 3372 | 8017058003 | |||
| 3373 | 8019531539 | |||
| 3374 | 8019550659 | |||
| 3375 | 8019563237 | |||
| 3376 | 8019573317 | |||
| 3377 | 8019577716 | |||
| 3378 | 8019595818 | |||
| 3379 | 8019605942 | |||
| 3380 | 8019612590 | |||
| 3381 | 8019622526 | |||
| 3382 | 8019630591 | |||
| 3383 | 8019640025 | |||
| 3384 | 8019652054 | |||
| 3385 | 8019667418 | |||
| 3386 | 8019677187 | |||
| 3387 | 8019678795 | |||
| 3388 | 8019696730 | |||
| 3389 | 8055750974 | |||
| 3390 | 8056677760 | |||
| 3391 | 8056692775 | |||
| 3392 | 8056970887 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
PF00528
BPD_transp_1
Binding-protein-dependent transport system inner membrane component
148
333
0.99
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3tuz-assembly2.cif.gz_F | inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form | 0.65 | 100 | 286 |
| 3tui-assembly2.cif.gz_E | inward facing conformations of the metni methionine abc transporter: cy5 native crystal form | 0.6308 | 107 | 285 |
| 3rlf-assembly1.cif.gz_F | crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to mgamppnp | 0.596 | 97 | 280 |
| 3tuz-assembly2.cif.gz_F | inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form | 0.568 | 100 | 286 |
| 3tui-assembly2.cif.gz_E | inward facing conformations of the metni methionine abc transporter: cy5 native crystal form | 0.5302 | 107 | 285 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P77463_85_288_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.7997 | 98 | 284 | 1.10.3720.10 |
| af_P0AEG1_88_295_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.7982 | 95 | 287 | 1.10.3720.10 |
| af_P75799_92_298_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.7979 | 96 | 287 | 1.10.3720.10 |
| af_Q2FZQ8_74_286_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.7925 | 98 | 284 | 1.10.3720.10 |
| af_P9WFZ9_71_279_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.7854 | 95 | 285 | 1.10.3720.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A436LC10-F1-model_v4 | deleted | 0.9426 | 45 | 188 |
|
| AF-F3GLH3-F1-model_v4 | Binding-protein dependent transport system inner membrane protein | 0.9342 | 58 | 208 |
GO:0005886
GO:0055085 |
| AF-A0A7C7PRV1-F1-model_v4 | ABC transporter permease | 0.9321 | 48 | 198 |
GO:0005886
GO:0015833 GO:0055085 |
| AF-W1WJM0-F1-model_v4 | Putative D,D-dipeptide transport system permease protein ddpC | 0.9248 | 108 | 235 |
GO:0005886
GO:0071916 |
| AF-A0A382PNI5-F1-model_v4 | ABC transmembrane type-1 domain-containing protein | 0.9228 | 29 | 207 |
GO:0005886
GO:0055085 |