F495376

General Info

Members Datasets Scaffolds Average Seq Length
1696 744 3392 294

Family's Representative Sequence

Representative Sequence 3300021384|Ga0213876_10013947|Ga0213876_100139471
Length 333
Sequence MSSIATDRADPDAAIGAALVQAASVTADTVLPPEPATTFTPPPRPTAPRQSGLAATLSHIRYVLSENLVTGFAFALFLLIVLAAVFGPALVPYDPLASDTVAALKPPSAQHWFGTDQLGRDIFSRVVVATRLDFGIAVASVVLVFLMGGLAGVAAGFYGGWTDRIVGRLADTIMAFPLFVLAMGIVAALGNTVQNIVLATAIVNFPLYARVARAEANVRREAGFVEAARLSGNSEFRIVSFQVLPNVFPILVVQMSLTMGYAILNAAGLSFIGLGVRPPTAEWGIMVAEGAAFIVSGEWWIALFPGLALMIAVFCFNLLGDGVRDIVDPRRRT

Samples

Sample ID Description Type Environment
1 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
9 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
10 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
11 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
12 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
13 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
14 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
15 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
16 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
17 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
18 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
19 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
20 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
21 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
22 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
23 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
24 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
25 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
26 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
27 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
28 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
29 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
30 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
31 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
32 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
33 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
34 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
35 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
36 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
37 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
38 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
39 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
40 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
41 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
42 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
43 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
44 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
45 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
46 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
47 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
48 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
49 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
50 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
51 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
52 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
53 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
54 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
55 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
56 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
57 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
58 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
59 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
60 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
61 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
62 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
63 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
64 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
65 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
66 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
67 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
68 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
69 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
70 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
71 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
72 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
73 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
74 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
75 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
76 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
77 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
78 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
79 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
80 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
81 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
82 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
83 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
84 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
85 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
86 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
87 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
88 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
89 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
90 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
91 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
92 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
93 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
94 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
95 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
96 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
97 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
98 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
99 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
100 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
101 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
102 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
103 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
104 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
105 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
106 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
107 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
108 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
109 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
110 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
111 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
112 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
113 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
114 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
115 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
116 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
117 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
118 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
119 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
120 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
121 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
122 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
123 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
124 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
125 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
126 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
127 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
128 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
129 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
130 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
131 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
132 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
133 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
134 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
135 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
136 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
137 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
138 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
139 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
140 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
141 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
142 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
143 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
144 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
145 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
146 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
147 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
152 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
153 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
154 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
155 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
156 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
157 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
221 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
222 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
223 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
224 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
227 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
228 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
229 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
233 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
234 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
235 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
236 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
237 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
238 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
239 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
240 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
241 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
242 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
243 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
244 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
245 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
246 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
247 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
248 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
249 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
250 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
251 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
252 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
253 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
254 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
255 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
256 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
257 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
258 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
259 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
260 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
261 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
262 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
263 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
264 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
265 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
266 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
267 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
268 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
269 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
270 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
271 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
272 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
273 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
274 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
275 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
276 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
277 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
278 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
279 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
280 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
281 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
282 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
283 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
284 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
285 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
286 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
287 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
288 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
289 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
290 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
291 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
292 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
293 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
294 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
295 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
296 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
297 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
298 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
299 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
300 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
301 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
302 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
303 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
304 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
305 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
306 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
307 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
308 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
309 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
310 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
311 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
312 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
313 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
314 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
315 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
316 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
317 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
318 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
319 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
320 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
321 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
322 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
323 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
324 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
325 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
326 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
327 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
328 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
329 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
330 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
331 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
332 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
333 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
334 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
335 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
336 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
337 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
338 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
339 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
340 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
341 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
342 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
343 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
344 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
345 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
346 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
347 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
348 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
349 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
350 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
351 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
352 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
353 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
354 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
355 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
356 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
357 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
358 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
359 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
360 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
361 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
362 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
363 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
364 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
365 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
366 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
367 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
368 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
369 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
370 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
371 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
372 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
373 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
374 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
375 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
376 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
377 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
378 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
379 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
380 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
381 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
382 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
383 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
384 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
385 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
386 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
387 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
388 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
389 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
390 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
391 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
392 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
393 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
394 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
395 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
396 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
397 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
398 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
399 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
400 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
401 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
402 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
403 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
404 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
405 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
406 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
407 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
408 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
409 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
410 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
411 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
412 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
413 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
414 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
415 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
416 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
417 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
418 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
419 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
420 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
421 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
422 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
423 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
424 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
425 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
426 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
427 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
428 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
429 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
430 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
431 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
432 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
433 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
434 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
435 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
436 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
437 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
438 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
439 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
440 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
441 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
442 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
443 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
444 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
445 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
446 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
447 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
448 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
449 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
450 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
451 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
452 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
453 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
454 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
455 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
456 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
457 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
458 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
459 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
460 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
461 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
462 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
463 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
464 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
465 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
466 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
467 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
468 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
469 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
470 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
471 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
472 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
473 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
474 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
475 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
476 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
477 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
478 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
479 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
480 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
481 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
482 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
483 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
484 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
485 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
486 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
487 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
488 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
489 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
490 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
491 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
492 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
493 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
494 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
495 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
496 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
497 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
498 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
499 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
500 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
501 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
502 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
503 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
504 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
505 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
506 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
507 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
508 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
509 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
510 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
511 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
512 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
513 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
514 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
515 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
516 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
517 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
518 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
519 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
520 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
521 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
522 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
523 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
524 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
525 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
526 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
527 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
528 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
529 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
530 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
531 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
532 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
533 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
534 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
535 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
536 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
537 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
538 2738541307 Variovorax sp. GV008 Isolate Unclassified
539 2738543019 Variovorax sp. GV040 Isolate Unclassified
540 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
541 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
542 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
543 2791355199
544 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
545 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
546 2818991467 Bosea vestrisii 3192 Isolate Unclassified
547 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
548 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
549 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
550 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
551 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
552 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
553 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
554 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
555 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
556 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
557 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
558 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
559 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
560 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
561 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
562 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
563 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
564 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
565 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
566 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
567 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
568 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
569 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
570 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
571 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
572 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
573 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
574 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
575 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
576 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
577 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
578 2842694124 Methylopila sp. R-72369 Isolate Unclassified
579 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
580 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
581 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
582 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
583 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
584 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
585 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
586 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
587 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
588 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
589 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
590 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
591 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
592 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
593 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
594 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
595 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
596 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
597 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
598 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
599 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
600 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
601 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
602 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
603 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
604 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
605 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
606 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
607 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
608 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
609 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
610 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
611 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
612 2899924645 Variovorax sp. 369 Isolate Unclassified
613 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
614 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
615 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
616 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
617 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
618 2904699407
619 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
620 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
621 2906610324
622 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
623 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
624 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
625 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
626 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
627 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
628 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
629 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
630 2922368715
631 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
632 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
633 2922425934
634 2928051484 Variovorax sp. 1133 Isolate Unclassified
635 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
636 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
637 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
638 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
639 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
640 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
641 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
642 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
643 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
644 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
645 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
646 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
647 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
648 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
649 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
650 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
651 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
652 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
653 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
654 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
655 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
656 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
657 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
658 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
659 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
660 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
661 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
662 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
663 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
664 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
665 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
666 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
667 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
668 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
669 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
670 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
671 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
672 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
673 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
674 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
675 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
676 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
677 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
678 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
679 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
680 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
681 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
682 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
683 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
684 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
685 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
686 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
687 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
688 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
689 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
690 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
691 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
692 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
693 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
694 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
695 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
696 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
697 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
698 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
699 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
700 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
701 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
702 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
703 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
704 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
705 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
706 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
707 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
708 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
709 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
710 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
711 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
712 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
713 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
714 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
715 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
716 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
717 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
718 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
719 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
720 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
721 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
722 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
723 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
724 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
725 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
726 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
727 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
728 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
729 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
730 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
731 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
732 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
733 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
734 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
735 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
736 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
737 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
738 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
739 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
740 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
741 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
742 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
743 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
744 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 86.22
Metatranscriptomes 0.06
Isolates 13.72

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.09
Nodule 10.55
Rhizoplane 7.9
Rhizosphere 57.67
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0213876_10013947 3300021384 Bacteria 4259
2 JGI24752J21851_1010227 3300001976 Bacteria 1225
3 JGI24746J21847_1008694 3300001977 Bacteria 1529
4 JGI24740J21852_10005522 3300001979 Bacteria 5334
5 JGI24739J22299_10013653 3300001989 Bacteria 2961
6 JGI24739J22299_10039948 3300001989 Bacteria 1568
7 JGI24737J22298_10000407 3300001990 Bacteria 14732
8 JGI24737J22298_10046503 3300001990 Bacteria 1324
9 JGI24735J21928_10020499 3300002067 Bacteria 2024
10 JGI24750J21931_1001542 3300002070 Bacteria 2837
11 JGI24745J21846_1004626 3300002073 Bacteria 1479
12 JGI24749J21850_1013662 3300002076 Bacteria 1140
13 JGI24034J26672_10012021 3300002239 Bacteria 1301
14 JGI24742J22300_10006282 3300002244 Bacteria 1962
15 JGI25151J46595_10000021 3300003187 Bacteria 227826
16 JGI25406J46586_10000471 3300003203 Bacteria 18790
17 JGI25406J46586_10012262 3300003203 Bacteria 3727
18 JGI25406J46586_10032321 3300003203 Bacteria 1945
19 JGI25153J46596_10002109 3300003215 Bacteria 11645
20 JGI25153J46596_10004526 3300003215 Bacteria 7477
21 JGI25153J46596_10006239 3300003215 Bacteria 6098
22 rootH2_10041169 3300003320 Bacteria 13340
23 rootH2_10310578 3300003320 Bacteria 1763
24 rootH1_10181803 3300003323 Bacteria 2859
25 JGI25160J50197_1007366 3300003354 Bacteria 4316
26 JGI25160J50197_1009546 3300003354 Bacteria 3587
27 JGI25160J50197_1020686 3300003354 Bacteria 1977
28 JGI25404J52841_10006128 3300003659 Bacteria 2505
29 JGI25404J52841_10007547 3300003659 Bacteria 2302
30 JGI25404J52841_10008577 3300003659 Bacteria 2179
31 Ga0055542_1003668 3300003762 Bacteria 4036
32 Ga0055526_1004359 3300003771 Bacteria 8546
33 Ga0055524_1000035 3300003775 Bacteria 174636
34 Ga0055531_10003847 3300003794 Bacteria 9398
35 Ga0055543_1005535 3300004625 Bacteria 3205
36 Ga0065165_1001304 3300005262 Bacteria 27869
37 Ga0065165_1001405 3300005262 Bacteria 26282
38 Ga0065165_1002635 3300005262 Bacteria 14588
39 Ga0065165_1026191 3300005262 Bacteria 1922
40 Ga0065165_1057318 3300005262 Bacteria 1080
41 Ga0065712_10011010 3300005290 Bacteria 2159
42 Ga0070658_10128348 3300005327 Bacteria 2112
43 Ga0070676_10029115 3300005328 Bacteria 3139
44 Ga0070676_10069728 3300005328 Bacteria 2108
45 Ga0070676_10142015 3300005328 Bacteria 1530
46 Ga0070683_100155493 3300005329 Bacteria 2168
47 Ga0070690_100001480 3300005330 Bacteria 12289
48 Ga0070690_100044230 3300005330 Bacteria 2826
49 Ga0070670_100038656 3300005331 Bacteria 4103
50 Ga0070670_100075323 3300005331 Bacteria 2899
51 Ga0070670_100495953 3300005331 Bacteria 1085
52 Ga0070677_10023030 3300005333 Bacteria 2302
53 Ga0068869_100021007 3300005334 Bacteria 4487
54 Ga0070666_10033290 3300005335 Bacteria 3409
55 Ga0070660_100271379 3300005339 Bacteria 1386
56 Ga0070691_10150544 3300005341 Bacteria 1193
57 Ga0070687_100003576 3300005343 Bacteria 6056
58 Ga0070661_100058235 3300005344 Bacteria 2831
59 Ga0070661_100178791 3300005344 Bacteria 1613
60 Ga0070668_100087567 3300005347 Bacteria 2450
61 Ga0070668_100088760 3300005347 Bacteria 2434
62 Ga0070668_100439538 3300005347 Bacteria 1120
63 Ga0070669_100048090 3300005353 Bacteria 3113
64 Ga0070669_100197949 3300005353 Bacteria 1580
65 Ga0070671_100018157 3300005355 Bacteria 5711
66 Ga0070671_100114268 3300005355 Bacteria 2269
67 Ga0070674_100009734 3300005356 Bacteria 5772
68 Ga0070674_100030919 3300005356 Bacteria 3543
69 Ga0070674_100047259 3300005356 Bacteria 2947
70 Ga0070674_100125974 3300005356 Bacteria 1902
71 Ga0070674_100240279 3300005356 Bacteria 1418
72 Ga0070673_100232842 3300005364 Bacteria 1598
73 Ga0070673_100247850 3300005364 Bacteria 1551
74 Ga0070688_100426597 3300005365 Bacteria 987
75 Ga0070659_100057085 3300005366 Bacteria 3078
76 Ga0070659_100073622 3300005366 Bacteria 2719
77 Ga0070667_100163219 3300005367 Bacteria 1963
78 Ga0070667_100431209 3300005367 Bacteria 1203
79 Ga0070667_100486156 3300005367 Bacteria 1131
80 Ga0070709_10001435 3300005434 Bacteria 12865
81 Ga0070709_10018623 3300005434 Bacteria 4002
82 Ga0070709_10028519 3300005434 Bacteria 3330
83 Ga0070709_10031766 3300005434 Bacteria 3179
84 Ga0070714_100028593 3300005435 Bacteria 4628
85 Ga0070714_100037350 3300005435 Bacteria 4081
86 Ga0070714_100064833 3300005435 Bacteria 3146
87 Ga0070714_100066789 3300005435 Bacteria 3099
88 Ga0070714_100143642 3300005435 Bacteria 2144
89 Ga0070713_100010045 3300005436 Bacteria 6822
90 Ga0070713_100020133 3300005436 Bacteria 5109
91 Ga0070713_100023379 3300005436 Bacteria 4796
92 Ga0070713_100026553 3300005436 Bacteria 4549
93 Ga0070713_100029310 3300005436 Bacteria 4357
94 Ga0070713_100139238 3300005436 Bacteria 2148
95 Ga0070713_100156058 3300005436 Bacteria 2034
96 Ga0070713_100251525 3300005436 Bacteria 1612
97 Ga0070713_100419325 3300005436 Bacteria 1253
98 Ga0070710_10003070 3300005437 Bacteria 7934
99 Ga0070710_10007821 3300005437 Bacteria 5188
100 Ga0070710_10025405 3300005437 Bacteria 3137
101 Ga0070710_10049485 3300005437 Bacteria 2351
102 Ga0070710_10333289 3300005437 Bacteria 1000
103 Ga0070711_100007255 3300005439 Bacteria 6734
104 Ga0070711_100010158 3300005439 Bacteria 5816
105 Ga0070705_100137607 3300005440 Bacteria 1603
106 Ga0070700_100051096 3300005441 Bacteria 2572
107 Ga0070694_100320059 3300005444 Bacteria 1193
108 Ga0070708_100069725 3300005445 Bacteria 3162
109 Ga0070663_100022794 3300005455 Bacteria 4190
110 Ga0070663_100071811 3300005455 Bacteria 2520
111 Ga0070663_100094017 3300005455 Bacteria 2225
112 Ga0070663_100421720 3300005455 Bacteria 1094
113 Ga0070678_100007756 3300005456 Bacteria 6383
114 Ga0070678_100058009 3300005456 Bacteria 2839
115 Ga0070678_100103787 3300005456 Bacteria 2209
116 Ga0070678_100122156 3300005456 Bacteria 2056
117 Ga0070678_100205342 3300005456 Bacteria 1629
118 Ga0070678_100247360 3300005456 Bacteria 1494
119 Ga0070662_100020979 3300005457 Bacteria 4456
120 Ga0070662_100123072 3300005457 Bacteria 1990
121 Ga0070662_100353274 3300005457 Bacteria 1205
122 Ga0068867_100074089 3300005459 Bacteria 2551
123 Ga0068867_100128336 3300005459 Bacteria 1967
124 Ga0070685_10013574 3300005466 Bacteria 4300
125 Ga0070685_10094745 3300005466 Bacteria 1814
126 Ga0070706_100038324 3300005467 Bacteria 4424
127 Ga0070707_100061272 3300005468 Bacteria 3608
128 Ga0070707_100182951 3300005468 Bacteria 2043
129 Ga0070698_100001256 3300005471 Bacteria 28317
130 Ga0070698_100056924 3300005471 Bacteria 3958
131 Ga0070698_100077624 3300005471 Bacteria 3320
132 Ga0070699_100101414 3300005518 Bacteria 2523
133 Ga0070699_100201380 3300005518 Bacteria 1770
134 Ga0070697_100088394 3300005536 Bacteria 2559
135 Ga0068853_100002466 3300005539 Bacteria 13857
136 Ga0070686_100058643 3300005544 Bacteria 2477
137 Ga0070686_100151107 3300005544 Bacteria 1626
138 Ga0070686_100171722 3300005544 Bacteria 1534
139 Ga0070665_100100771 3300005548 Bacteria 2892
140 Ga0070665_100197862 3300005548 Bacteria 2010
141 Ga0070665_100375703 3300005548 Bacteria 1428
142 Ga0070665_100712718 3300005548 Bacteria 1016
143 Ga0070704_100112829 3300005549 Bacteria 2072
144 Ga0070704_100507766 3300005549 Bacteria 1047
145 Ga0068855_100019962 3300005563 Bacteria 8049
146 Ga0068855_100090841 3300005563 Bacteria 3523
147 Ga0068855_100187886 3300005563 Bacteria 2332
148 Ga0068855_100781952 3300005563 Bacteria 1016
149 Ga0070664_100114591 3300005564 Bacteria 2355
150 Ga0068857_100001764 3300005577 Bacteria 17398
151 Ga0068857_100066536 3300005577 Bacteria 3206
152 Ga0068857_100131046 3300005577 Bacteria 2261
153 Ga0068854_100003702 3300005578 Bacteria 9566
154 Ga0068854_100009437 3300005578 Bacteria 6301
155 Ga0068856_100002751 3300005614 Bacteria 18008
156 Ga0068856_100003801 3300005614 Bacteria 15121
157 Ga0068856_100014815 3300005614 Bacteria 7527
158 Ga0068856_100175841 3300005614 Bacteria 2153
159 Ga0068856_100381878 3300005614 Bacteria 1428
160 Ga0068856_100471965 3300005614 Bacteria 1275
161 Ga0070702_100007182 3300005615 Bacteria 5320
162 Ga0070702_100024775 3300005615 Bacteria 3205
163 Ga0068852_100010588 3300005616 Bacteria 6900
164 Ga0068852_100018932 3300005616 Bacteria 5438
165 Ga0068852_100190570 3300005616 Bacteria 1934
166 Ga0068859_100005143 3300005617 Bacteria 13279
167 Ga0068859_100161666 3300005617 Bacteria 2318
168 Ga0068859_100424083 3300005617 Bacteria 1426
169 Ga0068864_100066351 3300005618 Bacteria 3132
170 Ga0068864_100367086 3300005618 Bacteria 1361
171 Ga0068861_100020081 3300005719 Bacteria 4779
172 Ga0068861_100026916 3300005719 Bacteria 4184
173 Ga0068861_100030834 3300005719 Bacteria 3933
174 Ga0068861_100066886 3300005719 Bacteria 2771
175 Ga0068861_100090784 3300005719 Bacteria 2410
176 Ga0068861_100117093 3300005719 Bacteria 2143
177 Ga0068851_10000998 3300005834 Bacteria 12268
178 Ga0068870_10012535 3300005840 Bacteria 3965
179 Ga0068870_10144352 3300005840 Bacteria 1396
180 Ga0068870_10214031 3300005840 Bacteria 1176
181 Ga0068863_100038224 3300005841 Bacteria 4567
182 Ga0068858_100009054 3300005842 Bacteria 9519
183 Ga0068858_100105049 3300005842 Bacteria 2635
184 Ga0068860_100002058 3300005843 Bacteria 21189
185 Ga0068860_100089568 3300005843 Bacteria 2929
186 Ga0068860_100171857 3300005843 Bacteria 2093
187 Ga0068862_100018243 3300005844 Bacteria 5842
188 Ga0068862_100108764 3300005844 Bacteria 2431
189 Ga0068862_100164815 3300005844 Bacteria 1980
190 Ga0068862_100252521 3300005844 Bacteria 1608
191 Ga0068862_100613990 3300005844 Bacteria 1045
192 Ga0081455_10000015 3300005937 Bacteria 189655
193 Ga0081455_10006198 3300005937 Bacteria 12894
194 Ga0081455_10021542 3300005937 Bacteria 6043
195 Ga0081455_10033433 3300005937 Bacteria 4621
196 Ga0081455_10121889 3300005937 Bacteria 2053
197 Ga0081455_10138084 3300005937 Bacteria 1897
198 Ga0081455_10178983 3300005937 Bacteria 1608
199 Ga0081538_10010377 3300005981 Bacteria 7637
200 Ga0081538_10085548 3300005981 Bacteria 1656
201 Ga0081540_1000459 3300005983 Bacteria 40435
202 Ga0081540_1002269 3300005983 Bacteria 15807
203 Ga0081540_1002282 3300005983 Bacteria 15746
204 Ga0081540_1004494 3300005983 Bacteria 10596
205 Ga0081540_1004784 3300005983 Bacteria 10207
206 Ga0081540_1006449 3300005983 Bacteria 8541
207 Ga0081540_1006666 3300005983 Bacteria 8358
208 Ga0081540_1007254 3300005983 Bacteria 7943
209 Ga0081540_1007646 3300005983 Bacteria 7669
210 Ga0081540_1009916 3300005983 Bacteria 6498
211 Ga0081540_1017080 3300005983 Bacteria 4509
212 Ga0081539_10000048 3300005985 Bacteria 272906
213 Ga0081539_10000466 3300005985 Bacteria 85716
214 Ga0081539_10004314 3300005985 Bacteria 15887
215 Ga0081539_10021149 3300005985 Bacteria 4358
216 Ga0081539_10062699 3300005985 Bacteria 2031
217 Ga0081539_10074323 3300005985 Bacteria 1810
218 Ga0070717_10002608 3300006028 Bacteria 12713
219 Ga0070717_10042632 3300006028 Bacteria 3701
220 Ga0070717_10093928 3300006028 Bacteria 2536
221 Ga0070717_10153827 3300006028 Bacteria 1991
222 Ga0070717_10201699 3300006028 Bacteria 1743
223 Ga0070717_10258003 3300006028 Bacteria 1542
224 Ga0070717_10420841 3300006028 Bacteria 1202
225 Ga0075365_10022006 3300006038 Bacteria 3986
226 Ga0075365_10038669 3300006038 Bacteria 3103
227 Ga0075365_10052107 3300006038 Bacteria 2705
228 Ga0075365_10066663 3300006038 Bacteria 2416
229 Ga0075365_10068611 3300006038 Bacteria 2382
230 Ga0075365_10080643 3300006038 Bacteria 2203
231 Ga0075368_10017075 3300006042 Bacteria 2712
232 Ga0075368_10034166 3300006042 Bacteria 1980
233 Ga0075363_100002145 3300006048 Bacteria 7931
234 Ga0075363_100021620 3300006048 Bacteria 3244
235 Ga0075363_100036579 3300006048 Bacteria 2576
236 Ga0075363_100040437 3300006048 Bacteria 2458
237 Ga0075363_100099922 3300006048 Bacteria 1605
238 Ga0075363_100135741 3300006048 Bacteria 1382
239 Ga0075364_10029682 3300006051 Bacteria 3508
240 Ga0075364_10089660 3300006051 Bacteria 2039
241 Ga0075364_10103781 3300006051 Bacteria 1894
242 Ga0075364_10119495 3300006051 Bacteria 1763
243 Ga0075364_10151415 3300006051 Bacteria 1563
244 Ga0075364_10186549 3300006051 Bacteria 1404
245 Ga0075364_10217615 3300006051 Bacteria 1296
246 Ga0075364_10352855 3300006051 Bacteria 1003
247 Ga0070715_10002100 3300006163 Bacteria 6022
248 Ga0070715_10077355 3300006163 Bacteria 1502
249 Ga0070716_100010030 3300006173 Bacteria 4737
250 Ga0070716_100039116 3300006173 Bacteria 2630
251 Ga0070716_100066067 3300006173 Bacteria 2108
252 Ga0070712_100007483 3300006175 Bacteria 6819
253 Ga0070712_100009194 3300006175 Bacteria 6225
254 Ga0070712_100085241 3300006175 Bacteria 2299
255 Ga0075362_10008683 3300006177 Bacteria 3901
256 Ga0075362_10053901 3300006177 Bacteria 1806
257 Ga0075362_10099250 3300006177 Bacteria 1360
258 Ga0075367_10010679 3300006178 Bacteria 4833
259 Ga0075367_10012056 3300006178 Bacteria 4594
260 Ga0075367_10032962 3300006178 Bacteria 2983
261 Ga0075367_10093726 3300006178 Bacteria 1829
262 Ga0075367_10106413 3300006178 Bacteria 1719
263 Ga0075367_10265601 3300006178 Bacteria 1077
264 Ga0075367_10271415 3300006178 Bacteria 1065
265 Ga0075369_10012200 3300006186 Bacteria 3393
266 Ga0075369_10028615 3300006186 Bacteria 2336
267 Ga0075369_10058463 3300006186 Bacteria 1679
268 Ga0075369_10063893 3300006186 Bacteria 1611
269 Ga0075369_10068667 3300006186 Bacteria 1558
270 Ga0075369_10082234 3300006186 Bacteria 1429
271 Ga0075366_10050584 3300006195 Bacteria 2468
272 Ga0075366_10087531 3300006195 Bacteria 1864
273 Ga0075366_10129353 3300006195 Bacteria 1523
274 Ga0075366_10129511 3300006195 Bacteria 1522
275 Ga0097621_100043350 3300006237 Bacteria 3626
276 Ga0097621_100063124 3300006237 Bacteria 3043
277 Ga0097621_100303904 3300006237 Bacteria 1410
278 Ga0075370_10023979 3300006353 Bacteria 3366
279 Ga0075370_10034636 3300006353 Bacteria 2830
280 Ga0075370_10035109 3300006353 Bacteria 2813
281 Ga0075370_10056900 3300006353 Bacteria 2222
282 Ga0075370_10097115 3300006353 Bacteria 1703
283 Ga0068871_100069401 3300006358 Bacteria 2894
284 Ga0068871_100389103 3300006358 Bacteria 1240
285 Ga0075428_100126914 3300006844 Bacteria 2776
286 Ga0075428_100219808 3300006844 Bacteria 2052
287 Ga0075428_100454510 3300006844 Bacteria 1372
288 Ga0075430_100003805 3300006846 Bacteria 12703
289 Ga0075430_100061792 3300006846 Bacteria 3147
290 Ga0075430_100148719 3300006846 Bacteria 1950
291 Ga0075431_100008501 3300006847 Bacteria 10278
292 Ga0075431_100127583 3300006847 Bacteria 2625
293 Ga0075431_100465316 3300006847 Bacteria 1259
294 Ga0075434_100108893 3300006871 Bacteria 2780
295 Ga0075434_100243277 3300006871 Bacteria 1819
296 Ga0075434_100452194 3300006871 Bacteria 1306
297 Ga0075434_100659338 3300006871 Bacteria 1065
298 Ga0068865_100017612 3300006881 Bacteria 4597
299 Ga0068865_100137402 3300006881 Bacteria 1839
300 Ga0075436_100153078 3300006914 Bacteria 1623
301 Ga0097620_100005143 3300006931 Bacteria 13279
302 Ga0097620_100161662 3300006931 Bacteria 2318
303 Ga0097620_100424100 3300006931 Bacteria 1426
304 Ga0099824_1004372 3300006942 Bacteria 20372
305 Ga0099823_1053765 3300006944 Bacteria 2347
306 Ga0075435_100280507 3300007076 Bacteria 1422
307 Ga0099795_10025142 3300007788 Bacteria 1994
308 Ga0099795_10060531 3300007788 Bacteria 1403
309 Ga0099795_10064618 3300007788 Bacteria 1367
310 Ga0105240_10009595 3300009093 Bacteria 13695
311 Ga0105240_10055652 3300009093 Bacteria 4953
312 Ga0105240_10806247 3300009093 Bacteria 1017
313 Ga0111539_10132770 3300009094 Bacteria 2915
314 Ga0105245_10018387 3300009098 Bacteria 6110
315 Ga0105245_10077260 3300009098 Bacteria 3035
316 Ga0105247_10074757 3300009101 Bacteria 2126
317 Ga0114129_10028215 3300009147 Bacteria 7952
318 Ga0114129_10050504 3300009147 Bacteria 5841
319 Ga0114129_10236575 3300009147 Bacteria 2457
320 Ga0114129_10237884 3300009147 Bacteria 2449
321 Ga0114129_10329886 3300009147 Bacteria 2026
322 Ga0105241_10002508 3300009174 Bacteria 13787
323 Ga0105241_10055998 3300009174 Bacteria 3022
324 Ga0105241_10091913 3300009174 Bacteria 2395
325 Ga0105241_10099417 3300009174 Bacteria 2310
326 Ga0105242_10048183 3300009176 Bacteria 3463
327 Ga0105248_10026102 3300009177 Bacteria 6499
328 Ga0105248_10235666 3300009177 Bacteria 2060
329 Ga0105248_10274419 3300009177 Bacteria 1898
330 Ga0105237_10023360 3300009545 Bacteria 6337
331 Ga0105237_10045757 3300009545 Bacteria 4403
332 Ga0105237_10077993 3300009545 Bacteria 3302
333 Ga0105237_10136081 3300009545 Bacteria 2451
334 Ga0105237_10436933 3300009545 Bacteria 1314
335 Ga0105238_10013064 3300009551 Bacteria 8379
336 Ga0105238_10032374 3300009551 Bacteria 5320
337 Ga0105238_10058953 3300009551 Bacteria 3847
338 Ga0105238_10220379 3300009551 Bacteria 1873
339 Ga0105249_10104567 3300009553 Bacteria 2668
340 Ga0105249_10325248 3300009553 Bacteria 1550
341 Ga0099796_10002833 3300010159 Bacteria 3902
342 Ga0099796_10011208 3300010159 Bacteria 2493
343 Ga0099796_10013605 3300010159 Bacteria 2328
344 Ga0099796_10055234 3300010159 Bacteria 1390
345 Ga0099796_10057378 3300010159 Bacteria 1369
346 Ga0105239_10023710 3300010375 Bacteria 6756
347 Ga0105239_10041130 3300010375 Bacteria 5065
348 Ga0105239_10125755 3300010375 Bacteria 2849
349 Ga0105239_10287272 3300010375 Bacteria 1852
350 Ga0105246_10193446 3300011119 Bacteria 1576
351 Ga0105246_10328939 3300011119 Bacteria 1245
352 Ga0105246_10364412 3300011119 Bacteria 1189
353 Ga0157374_10065407 3300013296 Bacteria 3414
354 Ga0157374_10439508 3300013296 Bacteria 1305
355 Ga0157378_10052575 3300013297 Bacteria 3624
356 Ga0157378_10107994 3300013297 Bacteria 2547
357 Ga0157378_10734915 3300013297 Bacteria 1009
358 Ga0163162_10080918 3300013306 Bacteria 3318
359 Ga0163162_10463199 3300013306 Bacteria 1399
360 Ga0157375_10022892 3300013308 Bacteria 5757
361 Ga0157375_10153214 3300013308 Bacteria 2442
362 Ga0157375_10274654 3300013308 Bacteria 1847
363 Ga0163163_10062889 3300014325 Bacteria 3679
364 Ga0163163_10166955 3300014325 Bacteria 2247
365 Ga0157379_10371260 3300014968 Bacteria 1312
366 Ga0157379_10671791 3300014968 Bacteria 971
367 Ga0157376_10175081 3300014969 Bacteria 1957
368 Ga0157376_10189499 3300014969 Bacteria 1885
369 Ga0157376_10226961 3300014969 Bacteria 1733
370 Ga0157376_10314533 3300014969 Bacteria 1487
371 Ga0182007_10043534 3300015262 Bacteria 1492
372 Ga0163161_10114351 3300017792 Bacteria 2021
373 Ga0163161_10328618 3300017792 Bacteria 1210
374 Ga0214544_1000003 3300021320 Bacteria 643752
375 Ga0214542_1000003 3300021321 Bacteria 435700
376 Ga0214545_1000004 3300021324 Bacteria 453352
377 Ga0214545_1020700 3300021324 Bacteria 5173
378 Ga0214543_1000007 3300021327 Bacteria 414744
379 Ga0213872_10013101 3300021361 Bacteria 3887
380 Ga0213872_10105557 3300021361 Bacteria 1254
381 Ga0213876_10014535 3300021384 Bacteria 4172
382 Ga0213876_10027233 3300021384 Bacteria 3017
383 Ga0213876_10038656 3300021384 Bacteria 2519
384 Ga0213876_10046054 3300021384 Bacteria 2306
385 Ga0213876_10213934 3300021384 Bacteria 1025
386 Ga0213875_10000138 3300021388 Bacteria 79866
387 Ga0213871_10000343 3300021441 Bacteria 5979
388 Ga0224572_1001925 3300024225 Bacteria 3228
389 Ga0209563_105273 3300025230 Bacteria 2365
390 Ga0209677_102298 3300025253 Bacteria 7359
391 Ga0209677_104782 3300025253 Bacteria 3761
392 Ga0209677_105656 3300025253 Bacteria 3199
393 Ga0209148_1000351 3300025254 Bacteria 59739
394 Ga0209455_1001952 3300025272 Bacteria 8497
395 Ga0209455_1007569 3300025272 Bacteria 3050
396 Ga0209675_1000347 3300025291 Bacteria 40287
397 Ga0209675_1001333 3300025291 Bacteria 14605
398 Ga0209025_1000010 3300025294 Bacteria 986612
399 Ga0209025_1092622 3300025294 Bacteria 983
400 Ga0209564_1000049 3300025295 Bacteria 362075
401 Ga0209564_1003721 3300025295 Bacteria 9997
402 Ga0209564_1010578 3300025295 Bacteria 4232
403 Ga0209758_1000015 3300025297 Bacteria 851943
404 Ga0209758_1000224 3300025297 Bacteria 121530
405 Ga0209758_1001252 3300025297 Bacteria 31479
406 Ga0209758_1001877 3300025297 Bacteria 23026
407 Ga0209758_1007694 3300025297 Bacteria 7239
408 Ga0209758_1019413 3300025297 Bacteria 3277
409 Ga0209758_1030260 3300025297 Bacteria 2246
410 Ga0209758_1068127 3300025297 Bacteria 1135
411 Ga0209256_1000014 3300025299 Bacteria 687409
412 Ga0209256_1009667 3300025299 Bacteria 4181
413 Ga0207426_1000552 3300025302 Bacteria 51852
414 Ga0207426_1000585 3300025302 Bacteria 48529
415 Ga0207426_1000940 3300025302 Bacteria 28937
416 Ga0207426_1013654 3300025302 Bacteria 3000
417 Ga0207426_1023802 3300025302 Bacteria 2086
418 Ga0209257_1000440 3300025304 Bacteria 79182
419 Ga0207696_1065859 3300025711 Bacteria 1013
420 Ga0207682_10025490 3300025893 Bacteria 2345
421 Ga0207692_10000547 3300025898 Bacteria 13349
422 Ga0207692_10043898 3300025898 Bacteria 2227
423 Ga0207642_10182465 3300025899 Bacteria 1145
424 Ga0207710_10035650 3300025900 Bacteria 2190
425 Ga0207710_10052378 3300025900 Bacteria 1835
426 Ga0207688_10001018 3300025901 Bacteria 14321
427 Ga0207688_10139847 3300025901 Bacteria 1424
428 Ga0207647_10047034 3300025904 Bacteria 2685
429 Ga0207685_10062853 3300025905 Bacteria 1477
430 Ga0207685_10108855 3300025905 Bacteria 1198
431 Ga0207699_10000386 3300025906 Bacteria 23177
432 Ga0207699_10001899 3300025906 Bacteria 9840
433 Ga0207699_10003779 3300025906 Bacteria 7226
434 Ga0207645_10030013 3300025907 Bacteria 3503
435 Ga0207645_10035040 3300025907 Bacteria 3223
436 Ga0207645_10041151 3300025907 Bacteria 2959
437 Ga0207645_10271358 3300025907 Bacteria 1125
438 Ga0207643_10143592 3300025908 Bacteria 1427
439 Ga0207705_10124768 3300025909 Bacteria 1913
440 Ga0207705_10200854 3300025909 Bacteria 1510
441 Ga0207684_10003003 3300025910 Bacteria 16721
442 Ga0207684_10194294 3300025910 Bacteria 1750
443 Ga0207654_10003583 3300025911 Bacteria 7852
444 Ga0207654_10010023 3300025911 Bacteria 4818
445 Ga0207654_10058758 3300025911 Bacteria 2240
446 Ga0207654_10157307 3300025911 Bacteria 1465
447 Ga0207707_10000816 3300025912 Bacteria 30547
448 Ga0207707_10462289 3300025912 Bacteria 1085
449 Ga0207695_10000065 3300025913 Bacteria 336949
450 Ga0207695_10000968 3300025913 Bacteria 51180
451 Ga0207695_10246090 3300025913 Bacteria 1688
452 Ga0207671_10007223 3300025914 Bacteria 9676
453 Ga0207671_10011255 3300025914 Bacteria 7300
454 Ga0207671_10135319 3300025914 Bacteria 1894
455 Ga0207693_10000774 3300025915 Bacteria 28742
456 Ga0207693_10003450 3300025915 Bacteria 13491
457 Ga0207693_10011795 3300025915 Bacteria 7063
458 Ga0207693_10018699 3300025915 Bacteria 5516
459 Ga0207693_10025504 3300025915 Bacteria 4687
460 Ga0207693_10189713 3300025915 Bacteria 1618
461 Ga0207663_10001349 3300025916 Bacteria 11352
462 Ga0207663_10044415 3300025916 Bacteria 2727
463 Ga0207662_10002530 3300025918 Bacteria 9207
464 Ga0207657_10080554 3300025919 Bacteria 2737
465 Ga0207657_10157830 3300025919 Bacteria 1844
466 Ga0207649_10054012 3300025920 Bacteria 2499
467 Ga0207649_10120391 3300025920 Bacteria 1769
468 Ga0207652_10005821 3300025921 Bacteria 9997
469 Ga0207646_10108874 3300025922 Bacteria 2486
470 Ga0207681_10017858 3300025923 Bacteria 4460
471 Ga0207694_10000213 3300025924 Bacteria 56487
472 Ga0207694_10036548 3300025924 Bacteria 3770
473 Ga0207650_10020260 3300025925 Bacteria 4689
474 Ga0207659_10064515 3300025926 Bacteria 2650
475 Ga0207659_10534690 3300025926 Bacteria 995
476 Ga0207687_10029730 3300025927 Bacteria 3677
477 Ga0207687_10043769 3300025927 Bacteria 3086
478 Ga0207687_10219441 3300025927 Bacteria 1496
479 Ga0207700_10002201 3300025928 Bacteria 11181
480 Ga0207700_10011224 3300025928 Bacteria 5704
481 Ga0207700_10022359 3300025928 Bacteria 4339
482 Ga0207700_10036944 3300025928 Bacteria 3533
483 Ga0207700_10046045 3300025928 Bacteria 3223
484 Ga0207700_10063057 3300025928 Bacteria 2817
485 Ga0207664_10050317 3300025929 Bacteria 3285
486 Ga0207664_10161846 3300025929 Bacteria 1909
487 Ga0207664_10345364 3300025929 Bacteria 1316
488 Ga0207644_10043351 3300025931 Bacteria 3192
489 Ga0207644_10068452 3300025931 Bacteria 2590
490 Ga0207644_10272542 3300025931 Bacteria 1356
491 Ga0207690_10072098 3300025932 Bacteria 2385
492 Ga0207706_10007301 3300025933 Bacteria 10216
493 Ga0207706_10081510 3300025933 Bacteria 2843
494 Ga0207706_10141867 3300025933 Bacteria 2114
495 Ga0207706_10255463 3300025933 Bacteria 1530
496 Ga0207686_10017480 3300025934 Bacteria 4042
497 Ga0207709_10111415 3300025935 Bacteria 1830
498 Ga0207709_10126258 3300025935 Bacteria 1736
499 Ga0207709_10145800 3300025935 Bacteria 1633
500 Ga0207709_10372132 3300025935 Bacteria 1085
501 Ga0207670_10021668 3300025936 Bacteria 3969
502 Ga0207669_10003709 3300025937 Bacteria 6646
503 Ga0207669_10012917 3300025937 Bacteria 4126
504 Ga0207669_10079031 3300025937 Bacteria 2098
505 Ga0207669_10116285 3300025937 Bacteria 1804
506 Ga0207669_10156636 3300025937 Bacteria 1603
507 Ga0207669_10257152 3300025937 Bacteria 1304
508 Ga0207704_10046324 3300025938 Bacteria 2591
509 Ga0207665_10000289 3300025939 Bacteria 34924
510 Ga0207665_10001425 3300025939 Bacteria 16086
511 Ga0207665_10001510 3300025939 Bacteria 15663
512 Ga0207665_10003729 3300025939 Bacteria 10182
513 Ga0207665_10097212 3300025939 Bacteria 2050
514 Ga0207665_10175217 3300025939 Bacteria 1551
515 Ga0207665_10238951 3300025939 Bacteria 1338
516 Ga0207691_10013884 3300025940 Bacteria 7686
517 Ga0207691_10143212 3300025940 Bacteria 2105
518 Ga0207691_10536001 3300025940 Bacteria 993
519 Ga0207711_10038123 3300025941 Bacteria 4086
520 Ga0207711_10048181 3300025941 Bacteria 3646
521 Ga0207711_10124403 3300025941 Bacteria 2305
522 Ga0207711_10183618 3300025941 Bacteria 1903
523 Ga0207711_10257495 3300025941 Bacteria 1603
524 Ga0207689_10036089 3300025942 Bacteria 4104
525 Ga0207689_10054040 3300025942 Bacteria 3308
526 Ga0207689_10217966 3300025942 Bacteria 1577
527 Ga0207661_10082840 3300025944 Bacteria 2653
528 Ga0207661_10587079 3300025944 Bacteria 1022
529 Ga0207679_10027684 3300025945 Bacteria 3923
530 Ga0207679_10080457 3300025945 Bacteria 2488
531 Ga0207667_10079331 3300025949 Bacteria 3403
532 Ga0207667_10219652 3300025949 Bacteria 1947
533 Ga0207667_10224943 3300025949 Bacteria 1922
534 Ga0207667_10384194 3300025949 Bacteria 1430
535 Ga0207651_10179218 3300025960 Bacteria 1679
536 Ga0207651_10213983 3300025960 Bacteria 1553
537 Ga0207712_10027778 3300025961 Bacteria 3781
538 Ga0207712_10030143 3300025961 Bacteria 3645
539 Ga0207668_10051796 3300025972 Bacteria 2837
540 Ga0207668_10136239 3300025972 Bacteria 1882
541 Ga0207668_10140121 3300025972 Bacteria 1858
542 Ga0207668_10198817 3300025972 Bacteria 1594
543 Ga0207668_10355903 3300025972 Bacteria 1225
544 Ga0207677_10015799 3300026023 Bacteria 4452
545 Ga0207677_10104825 3300026023 Bacteria 2091
546 Ga0207703_10285436 3300026035 Bacteria 1500
547 Ga0207703_10503468 3300026035 Bacteria 1137
548 Ga0207639_10019353 3300026041 Bacteria 4854
549 Ga0207639_10069817 3300026041 Bacteria 2742
550 Ga0207678_10037422 3300026067 Bacteria 4220
551 Ga0207678_10063278 3300026067 Bacteria 3179
552 Ga0207678_10071220 3300026067 Bacteria 2981
553 Ga0207678_10092481 3300026067 Bacteria 2585
554 Ga0207678_10207334 3300026067 Bacteria 1677
555 Ga0207708_10003151 3300026075 Bacteria 12142
556 Ga0207708_10302960 3300026075 Bacteria 1300
557 Ga0207708_10337924 3300026075 Bacteria 1233
558 Ga0207702_10000094 3300026078 Bacteria 103202
559 Ga0207702_10000095 3300026078 Bacteria 102704
560 Ga0207702_10000539 3300026078 Bacteria 42329
561 Ga0207702_10009972 3300026078 Bacteria 7965
562 Ga0207702_10116279 3300026078 Bacteria 2386
563 Ga0207702_10201888 3300026078 Bacteria 1843
564 Ga0207641_10019053 3300026088 Bacteria 5628
565 Ga0207648_10009796 3300026089 Bacteria 9155
566 Ga0207648_10065982 3300026089 Bacteria 3156
567 Ga0207648_10073497 3300026089 Bacteria 2979
568 Ga0207676_10032685 3300026095 Bacteria 3923
569 Ga0207676_10194012 3300026095 Bacteria 1789
570 Ga0207674_10000578 3300026116 Bacteria 48259
571 Ga0207674_10004408 3300026116 Bacteria 16958
572 Ga0207674_10035720 3300026116 Bacteria 5186
573 Ga0207674_10232416 3300026116 Bacteria 1792
574 Ga0207674_10349879 3300026116 Bacteria 1429
575 Ga0207675_100007420 3300026118 Bacteria 10361
576 Ga0207675_100030164 3300026118 Bacteria 5050
577 Ga0207675_100065878 3300026118 Bacteria 3385
578 Ga0207675_100097179 3300026118 Bacteria 2773
579 Ga0207683_10039973 3300026121 Bacteria 4092
580 Ga0207683_10074617 3300026121 Bacteria 3001
581 Ga0207683_10080049 3300026121 Bacteria 2898
582 Ga0207683_10102921 3300026121 Bacteria 2550
583 Ga0207683_10141110 3300026121 Bacteria 2171
584 Ga0207683_10325126 3300026121 Bacteria 1409
585 Ga0207698_10171001 3300026142 Bacteria 1913
586 Ga0207698_10394753 3300026142 Bacteria 1320
587 Ga0207698_10399432 3300026142 Bacteria 1313
588 Ga0209389_1000029 3300027296 Bacteria 140337
589 Ga0209389_1000076 3300027296 Bacteria 92447
590 Ga0209589_1000012 3300027357 Bacteria 229451
591 Ga0209589_1000013 3300027357 Bacteria 229273
592 Ga0209489_100013 3300027361 Bacteria 229831
593 Ga0209489_100416 3300027361 Bacteria 77981
594 Ga0209700_100014 3300027363 Bacteria 299349
595 Ga0209179_1001813 3300027512 Bacteria 2728
596 Ga0209588_1012833 3300027671 Bacteria 2549
597 Ga0209813_10000669 3300027866 Bacteria 7833
598 Ga0209813_10031992 3300027866 Bacteria 1556
599 Ga0207428_10238879 3300027907 Bacteria 1358
600 Ga0207428_10244724 3300027907 Bacteria 1339
601 Ga0265356_1006070 3300028017 Bacteria 1422
602 Ga0268266_10001689 3300028379 Bacteria 25367
603 Ga0268266_10026887 3300028379 Bacteria 4895
604 Ga0268266_10107655 3300028379 Bacteria 2465
605 Ga0268266_10118594 3300028379 Bacteria 2352
606 Ga0268266_10200622 3300028379 Bacteria 1825
607 Ga0268266_10499369 3300028379 Bacteria 1161
608 Ga0268265_10040614 3300028380 Bacteria 3437
609 Ga0268265_10116158 3300028380 Bacteria 2195
610 Ga0268265_10511088 3300028380 Bacteria 1134
611 Ga0268265_10695953 3300028380 Bacteria 981
612 Ga0268264_10000049 3300028381 Bacteria 329992
613 Ga0268264_10364191 3300028381 Bacteria 1380
614 Ga0265337_1012592 3300028556 Bacteria 2868
615 Ga0265319_1007105 3300028563 Bacteria 5078
616 Ga0265334_10001581 3300028573 Bacteria 10962
617 Ga0265318_10009274 3300028577 Bacteria 4338
618 Ga0265323_10003611 3300028653 Bacteria 6791
619 Ga0265322_10011291 3300028654 Bacteria 2591
620 Ga0265336_10001012 3300028666 Bacteria 13808
621 Ga0307517_10000766 3300028786 Bacteria 55210
622 Ga0307515_10015099 3300028794 Bacteria 14254
623 Ga0307515_10324519 3300028794 Bacteria 1203
624 Ga0265338_10000024 3300028800 Bacteria 297778
625 Ga0265324_10011216 3300029957 Bacteria 3423
626 Ga0265770_1005620 3300030878 Bacteria 1734
627 Ga0265330_10030730 3300031235 Bacteria 2410
628 Ga0265332_10001539 3300031238 Bacteria 12742
629 Ga0265332_10013992 3300031238 Bacteria 3550
630 Ga0265320_10015232 3300031240 Bacteria 4351
631 Ga0265325_10002052 3300031241 Bacteria 13828
632 Ga0265325_10005467 3300031241 Bacteria 7836
633 Ga0265325_10037542 3300031241 Bacteria 2561
634 Ga0265329_10042012 3300031242 Bacteria 1465
635 Ga0265340_10000694 3300031247 Bacteria 18937
636 Ga0265340_10005839 3300031247 Bacteria 6812
637 Ga0265340_10037432 3300031247 Bacteria 2403
638 Ga0265340_10046022 3300031247 Bacteria 2129
639 Ga0265339_10001969 3300031249 Bacteria 15094
640 Ga0265339_10004309 3300031249 Bacteria 9731
641 Ga0265339_10170567 3300031249 Bacteria 1089
642 Ga0265331_10054802 3300031250 Bacteria 1898
643 Ga0265331_10063819 3300031250 Bacteria 1735
644 Ga0307513_10207965 3300031456 Bacteria 1791
645 Ga0307509_10011299 3300031507 Bacteria 10828
646 Ga0307509_10261457 3300031507 Bacteria 1506
647 Ga0307408_100208005 3300031548 Bacteria 1588
648 Ga0265313_10004767 3300031595 Bacteria 10226
649 Ga0265313_10146705 3300031595 Bacteria 1011
650 Ga0307508_10000046 3300031616 Bacteria 139709
651 Ga0307508_10063610 3300031616 Bacteria 3255
652 Ga0265314_10002061 3300031711 Bacteria 21230
653 Ga0265314_10006588 3300031711 Bacteria 10231
654 Ga0265314_10043659 3300031711 Bacteria 3185
655 Ga0265314_10189388 3300031711 Bacteria 1226
656 Ga0265342_10000178 3300031712 Bacteria 70648
657 Ga0265342_10028149 3300031712 Bacteria 3504
658 Ga0265342_10056469 3300031712 Bacteria 2327
659 Ga0265342_10100660 3300031712 Bacteria 1646
660 Ga0265342_10123090 3300031712 Bacteria 1459
661 Ga0265342_10124229 3300031712 Bacteria 1451
662 Ga0265342_10170509 3300031712 Bacteria 1197
663 Ga0316578_10016976 3300031728 Bacteria 3952
664 Ga0307516_10016335 3300031730 Bacteria 7767
665 Ga0307516_10022356 3300031730 Bacteria 6496
666 Ga0307516_10056447 3300031730 Bacteria 3829
667 Ga0307516_10272985 3300031730 Bacteria 1376
668 Ga0307412_10332525 3300031911 Bacteria 1213
669 Ga0307409_100758087 3300031995 Bacteria 975
670 Ga0307507_10129822 3300033179 Bacteria 1977
671 Ga0307510_10007534 3300033180 Bacteria 12965
672 Ga0307510_10011049 3300033180 Bacteria 10732
673 Ga0307510_10030284 3300033180 Bacteria 6136
674 Ga0307510_10094994 3300033180 Bacteria 2804
675 Ga0307510_10245668 3300033180 Bacteria 1281
676 Ga0307510_10263591 3300033180 Bacteria 1203
677 Ga0315911_1000024 3300033442 Bacteria 97712
678 Ga0373938_0010308 3300034957 Bacteria 1715
679 Ga0373926_0029845 3300035083 Bacteria 1918
680 Ga0373926_0047541 3300035083 Bacteria 1541
681 Ga0373926_0082365 3300035083 Bacteria 1191
682 Ga0373934_0101394 3300035086 Bacteria 1164
683 Ga0373944_0000833 3300035089 Bacteria 7570
684 Ga0373944_0084537 3300035089 Bacteria 1053
685 Ga0373923_0000022 3300035111 Bacteria 23262
686 Ga0373923_0006016 3300035111 Bacteria 4161
687 Ga0373923_0162102 3300035111 Bacteria 1021
688 Ga0373936_0023248 3300035113 Bacteria 2414
689 Ga0373936_0039715 3300035113 Bacteria 1884
690 Ga0373936_0066598 3300035113 Bacteria 1479
691 Ga0373936_0111610 3300035113 Bacteria 1161
692 Ga0373945_0006815 3300035116 Bacteria 3691
693 Ga0373945_0023683 3300035116 Bacteria 2123
694 Ga0373945_0051997 3300035116 Bacteria 1508
695 Ga0373953_0000468 3300035117 Bacteria 11120
696 Ga0373953_0023144 3300035117 Bacteria 2350
697 Ga0373954_0000519 3300035118 Bacteria 14460
698 Ga0373954_0016654 3300035118 Bacteria 3293
699 Ga0373954_0043971 3300035118 Bacteria 2083
700 Ga0373954_0069110 3300035118 Bacteria 1676
701 Ga0373954_0071910 3300035118 Bacteria 1644
702 Ga0373954_0102158 3300035118 Bacteria 1384
703 Ga0373956_0113378 3300035119 Bacteria 1263
704 Ga0373956_0120863 3300035119 Bacteria 1223
705 Ga0373957_0010201 3300035120 Bacteria 3098
706 Ga0373957_0024318 3300035120 Bacteria 2175
707 Ga0373957_0103363 3300035120 Bacteria 1142
708 Ga0373943_0001832 3300035170 Bacteria 9614
709 Ga0373943_0007592 3300035170 Bacteria 4869
710 Ga0373943_0041582 3300035170 Bacteria 2223
711 Ga0373943_0192818 3300035170 Bacteria 1124
712 Ga0373946_0016673 3300035171 Bacteria 2801
713 Ga0373946_0020193 3300035171 Bacteria 2573
714 Ga0373955_0000402 3300035172 Bacteria 18349
715 Ga0373955_0003617 3300035172 Bacteria 6803
716 Ga0373955_0019856 3300035172 Bacteria 3367
717 Ga0373955_0038256 3300035172 Bacteria 2555
718 Ga0373962_0018109 3300035242 Bacteria 1830
719 Ga0316574_0002046 3300035398 Bacteria 9958
720 Ga0373924_0002920 3300035410 Bacteria 5796
721 Ga0373924_0004843 3300035410 Bacteria 4732
722 Ga0373924_0107398 3300035410 Bacteria 1204
723 Ga0373931_0058705 3300035691 Bacteria 2067
724 Ga0373931_0186049 3300035691 Bacteria 1233
725 Ga0373935_0000244 3300035692 Bacteria 26819
726 Ga0373935_0020883 3300035692 Bacteria 4005
727 Ga0373935_0021933 3300035692 Bacteria 3910
728 Ga0373935_0060125 3300035692 Bacteria 2430
729 Ga0373927_0001820 3300035695 Bacteria 15839
730 Ga0373927_0003221 3300035695 Bacteria 11752
731 Ga0373927_0007112 3300035695 Bacteria 7592
732 Ga0373927_0081034 3300035695 Bacteria 2103
733 Ga0373927_0280831 3300035695 Bacteria 1095
734 Ga0373933_0000114 3300035724 Bacteria 52016
735 Ga0373933_0000374 3300035724 Bacteria 28691
736 Ga0373933_0006739 3300035724 Bacteria 6261
737 Ga0373933_0024593 3300035724 Bacteria 3448
738 Ga0373933_0185468 3300035724 Bacteria 1328
739 Ga0373947_0004892 3300035725 Bacteria 7840
740 Ga0373947_0008108 3300035725 Bacteria 6055
741 Ga0373947_0011337 3300035725 Bacteria 5117
742 Ga0373947_0043417 3300035725 Bacteria 2685
743 Ga0373947_0069836 3300035725 Bacteria 2151
744 Ga0373947_0187371 3300035725 Bacteria 1349
745 Ga0373937_0001469 3300036401 Bacteria 19735
746 Ga0373937_0003416 3300036401 Bacteria 13330
747 Ga0373937_0004831 3300036401 Bacteria 11454
748 Ga0373937_0022308 3300036401 Bacteria 5692
749 Ga0373937_0043053 3300036401 Bacteria 4121
750 Ga0373937_0048738 3300036401 Bacteria 3878
751 Ga0373937_0106793 3300036401 Bacteria 2602
752 Ga0373937_0165064 3300036401 Bacteria 2076
753 Ga0373937_0204572 3300036401 Bacteria 1856
754 Ga0373937_0395092 3300036401 Bacteria 1312
755 Ga0316584_0002434 3300036712 Bacteria 11775
756 Ga0373925_0014715 3300037068 Bacteria 5652
757 Ga0373925_0085545 3300037068 Bacteria 2404
758 Ga0373925_0123338 3300037068 Bacteria 2013
759 Ga0395898_0295430 3300037466 Bacteria 1546
760 Ga0395898_0340814 3300037466 Bacteria 1430
761 Ga0395905_0033085 3300037471 Bacteria 4860
762 Ga0395905_0068527 3300037471 Bacteria 3323
763 Ga0395905_0410962 3300037471 Bacteria 1249
764 Ga0436364_0048041 3300037853 Bacteria 30704
765 Ga0436364_1046390 3300037853 Bacteria 2036
766 Ga0395901_0172375 3300038443 Bacteria 2270
767 Ga0395901_0205715 3300038443 Bacteria 2062
768 Ga0395901_0676645 3300038443 Bacteria 1032
769 Ga0436365_0191440 3300039437 Bacteria 2528
770 Ga0436365_0241841 3300039437 Bacteria 5746
771 Ga0436365_0285454 3300039437 Bacteria 5399
772 Ga0436365_0725015 3300039437 Bacteria 1548
773 Ga0436365_0989879 3300039437 Bacteria 21862
774 Ga0436365_1338721 3300039437 Bacteria 1631
775 Ga0436365_1708547 3300039437 Bacteria 5402
776 Ga0436360_0310216 3300039438 Bacteria 6523
777 Ga0436360_0458549 3300039438 Bacteria 992
778 Ga0436360_0872213 3300039438 Bacteria 1696
779 Ga0436360_0875496 3300039438 Bacteria 2383
780 Ga0436361_0240915 3300039447 Bacteria 2026
781 Ga0436361_0863829 3300039447 Bacteria 1754
782 Ga0436361_1092466 3300039447 Bacteria 5526
783 Ga0436363_0151139 3300039450 Bacteria 1177
784 Ga0436363_1043486 3300039450 Bacteria 2271
785 Ga0436363_1360117 3300039450 Bacteria 1344
786 Ga0439465_0076397 3300041413 Bacteria 1129
787 Ga0451833_0242002 3300041491 Bacteria 1017
788 Ga0439443_005520 3300042003 Bacteria 1694
789 Ga0439435_0032036 3300042436 Bacteria 1433
790 Ga0439460_0003551 3300042461 Bacteria 3768
791 Ga0466969_0049520 3300044656 Bacteria 2073
792 Ga0466972_0000048 3300044658 Bacteria 119165
793 Ga0466965_0098425 3300044683 Bacteria 1494
794 Ga0466966_0000238 3300044684 Bacteria 36401
795 Ga0466966_0144923 3300044684 Bacteria 1450
796 Ga0466961_0000044 3300044693 Bacteria 76071
797 Ga0466963_0054300 3300044694 Bacteria 2662
798 Ga0466964_0098777 3300044706 Bacteria 1283
799 Ga0466968_0028990 3300044735 Bacteria 2286
800 Ga0466970_0076533 3300044765 Bacteria 1803
801 Ga0466957_0067374 3300044842 Bacteria 2208
802 Ga0466960_0081361 3300044901 Bacteria 1633
803 Ga0466959_0000963 3300045049 Bacteria 17121
804 Ga0466959_0017608 3300045049 Bacteria 5239
805 Ga0451576_0001156 3300045051 Bacteria 47552
806 Ga0451576_0496630 3300045051 Bacteria 1282
807 Ga0466958_0328904 3300045836 Bacteria 983
808 Ga0466967_0142993 3300045976 Bacteria 2229
809 Ga0466967_0271045 3300045976 Bacteria 1627
810 Ga0495617_020921 3300046452 Bacteria 2211
811 Ga0495627_049161 3300046453 Bacteria 1274
812 Ga0495592_0002074 3300046454 Bacteria 14129
813 Ga0495592_0032704 3300046454 Bacteria 3922
814 Ga0495592_0040311 3300046454 Bacteria 3505
815 Ga0495603_0000370 3300046455 Bacteria 24383
816 Ga0495603_0006854 3300046455 Bacteria 6834
817 Ga0495603_0025017 3300046455 Bacteria 3611
818 Ga0495603_0032180 3300046455 Bacteria 3156
819 Ga0495590_0029439 3300046457 Bacteria 1925
820 Ga0495590_0046024 3300046457 Bacteria 1522
821 Ga0495629_0000081 3300046459 Bacteria 85305
822 Ga0495629_0000380 3300046459 Bacteria 37205
823 Ga0495629_0001124 3300046459 Bacteria 21212
824 Ga0495629_0170162 3300046459 Bacteria 1512
825 Ga0495629_0218504 3300046459 Bacteria 1315
826 Ga0495638_0031456 3300046460 Bacteria 3411
827 Ga0495641_0007097 3300046461 Bacteria 7091
828 Ga0495641_0124184 3300046461 Bacteria 1152
829 Ga0495651_0001523 3300046462 Bacteria 17910
830 Ga0495651_0009321 3300046462 Bacteria 7534
831 Ga0495651_0017237 3300046462 Bacteria 5597
832 Ga0495651_0033842 3300046462 Bacteria 3985
833 Ga0495651_0035032 3300046462 Bacteria 3911
834 Ga0495651_0036906 3300046462 Bacteria 3805
835 Ga0495651_0098692 3300046462 Bacteria 2179
836 Ga0495651_0147119 3300046462 Bacteria 1702
837 Ga0495651_0161790 3300046462 Bacteria 1603
838 Ga0495651_0203471 3300046462 Bacteria 1384
839 Ga0495653_0000807 3300046463 Bacteria 24078
840 Ga0495653_0004588 3300046463 Bacteria 11168
841 Ga0495653_0008281 3300046463 Bacteria 8525
842 Ga0495653_0080323 3300046463 Bacteria 2413
843 Ga0495650_0030451 3300046471 Bacteria 2445
844 Ga0495580_0040123 3300046472 Bacteria 3347
845 Ga0495580_0254571 3300046472 Bacteria 1201
846 Ga0495582_0000051 3300046473 Bacteria 59010
847 Ga0495582_0011691 3300046473 Bacteria 4837
848 Ga0495582_0060346 3300046473 Bacteria 2093
849 Ga0495605_0044972 3300046474 Bacteria 2179
850 Ga0495639_0000010 3300046475 Bacteria 93685
851 Ga0495639_0003638 3300046475 Bacteria 6641
852 Ga0495639_0006195 3300046475 Bacteria 5137
853 Ga0495639_0047817 3300046475 Bacteria 1939
854 Ga0495639_0080272 3300046475 Bacteria 1518
855 Ga0495662_0007880 3300046476 Bacteria 5243
856 Ga0495662_0023141 3300046476 Bacteria 3000
857 Ga0495662_0049960 3300046476 Bacteria 2018
858 Ga0495662_0107253 3300046476 Bacteria 1368
859 Ga0495664_0003734 3300046477 Bacteria 8306
860 Ga0495664_0010817 3300046477 Bacteria 5131
861 Ga0495664_0020718 3300046477 Bacteria 3794
862 Ga0495664_0021685 3300046477 Bacteria 3711
863 Ga0495664_0030030 3300046477 Bacteria 3183
864 Ga0495584_0109513 3300046491 Bacteria 1397
865 Ga0495585_0004363 3300046492 Bacteria 9196
866 Ga0495585_0022427 3300046492 Bacteria 3624
867 Ga0495585_0052914 3300046492 Bacteria 2247
868 Ga0495585_0075849 3300046492 Bacteria 1827
869 Ga0495594_0001074 3300046499 Bacteria 14256
870 Ga0495594_0012226 3300046499 Bacteria 4470
871 Ga0495594_0102654 3300046499 Bacteria 1609
872 Ga0495607_0044870 3300046501 Bacteria 2603
873 Ga0495607_0092938 3300046501 Bacteria 1631
874 Ga0495607_0105301 3300046501 Bacteria 1504
875 Ga0495606_0000265 3300046507 Bacteria 92526
876 Ga0495606_0051543 3300046507 Bacteria 2683
877 Ga0495606_0194748 3300046507 Bacteria 1159
878 Ga0495608_0008172 3300046511 Bacteria 7348
879 Ga0495608_0008410 3300046511 Bacteria 7230
880 Ga0495608_0047354 3300046511 Bacteria 2858
881 Ga0495610_0014371 3300046512 Bacteria 4652
882 Ga0495616_0042659 3300046513 Bacteria 2308
883 Ga0495618_0046111 3300046514 Bacteria 2750
884 Ga0495618_0066259 3300046514 Bacteria 2296
885 Ga0495618_0157063 3300046514 Bacteria 1451
886 Ga0495628_0000115 3300046516 Bacteria 65159
887 Ga0495628_0026354 3300046516 Bacteria 4741
888 Ga0495628_0054423 3300046516 Bacteria 3155
889 Ga0495628_0061993 3300046516 Bacteria 2932
890 Ga0495628_0095564 3300046516 Bacteria 2296
891 Ga0495628_0121237 3300046516 Bacteria 2005
892 Ga0495628_0430908 3300046516 Bacteria 960
893 Ga0495630_0011435 3300046517 Bacteria 6429
894 Ga0495630_0017568 3300046517 Bacteria 5241
895 Ga0495630_0177953 3300046517 Bacteria 1621
896 Ga0495632_0085709 3300046519 Bacteria 1498
897 Ga0495643_0030597 3300046522 Bacteria 3004
898 Ga0495643_0034671 3300046522 Bacteria 2784
899 Ga0495644_0039229 3300046523 Bacteria 1785
900 Ga0495648_0000271 3300046524 Bacteria 58164
901 Ga0495648_0007795 3300046524 Bacteria 8519
902 Ga0495648_0059977 3300046524 Bacteria 2266
903 Ga0495648_0198579 3300046524 Bacteria 1006
904 Ga0495663_0041401 3300046525 Bacteria 1401
905 Ga0495663_0046639 3300046525 Bacteria 1332
906 Ga0495666_0015984 3300046526 Bacteria 3737
907 Ga0495666_0056425 3300046526 Bacteria 1881
908 Ga0495666_0201053 3300046526 Bacteria 916
909 Ga0495642_0040013 3300046528 Bacteria 1903
910 Ga0495652_0007397 3300046529 Bacteria 10125
911 Ga0495652_0020559 3300046529 Bacteria 5867
912 Ga0495652_0068933 3300046529 Bacteria 2962
913 Ga0495652_0084882 3300046529 Bacteria 2603
914 Ga0495652_0130893 3300046529 Bacteria 1986
915 Ga0495654_0024723 3300046530 Bacteria 3100
916 Ga0495665_0000005 3300046531 Bacteria 86491
917 Ga0495665_0023984 3300046531 Bacteria 3277
918 Ga0495665_0026680 3300046531 Bacteria 3102
919 Ga0495640_0000301 3300046533 Bacteria 33996
920 Ga0495640_0009451 3300046533 Bacteria 7596
921 Ga0495640_0012766 3300046533 Bacteria 6412
922 Ga0495640_0019216 3300046533 Bacteria 5047
923 Ga0495587_0002764 3300046536 Bacteria 11712
924 Ga0495587_0037268 3300046536 Bacteria 2920
925 Ga0495587_0042194 3300046536 Bacteria 2721
926 Ga0495587_0072019 3300046536 Bacteria 2009
927 Ga0495598_0004502 3300046537 Bacteria 3022
928 Ga0495598_0025576 3300046537 Bacteria 1611
929 Ga0495598_0050375 3300046537 Bacteria 1251
930 Ga0495621_0030961 3300046539 Bacteria 1832
931 Ga0495597_0142002 3300046542 Bacteria 990
932 Ga0495645_0000994 3300046543 Bacteria 19292
933 Ga0495645_0010387 3300046543 Bacteria 6525
934 Ga0495645_0014229 3300046543 Bacteria 5643
935 Ga0495645_0039260 3300046543 Bacteria 3454
936 Ga0495645_0067971 3300046543 Bacteria 2573
937 Ga0495622_0036869 3300046557 Bacteria 2278
938 Ga0495622_0057834 3300046557 Bacteria 1796
939 Ga0495633_0009170 3300046558 Bacteria 5491
940 Ga0495633_0127635 3300046558 Bacteria 1177
941 Ga0495633_0137651 3300046558 Bacteria 1129
942 Ga0495667_0002081 3300046559 Bacteria 13300
943 Ga0495667_0002874 3300046559 Bacteria 11538
944 Ga0495667_0002956 3300046559 Bacteria 11399
945 Ga0495667_0004975 3300046559 Bacteria 8988
946 Ga0495667_0013842 3300046559 Bacteria 5448
947 Ga0495667_0055145 3300046559 Bacteria 2614
948 Ga0495667_0090933 3300046559 Bacteria 1977
949 Ga0495656_0000981 3300046615 Bacteria 9245
950 Ga0495656_0001491 3300046615 Bacteria 7662
951 Ga0495656_0011915 3300046615 Bacteria 3199
952 Ga0495668_0111830 3300046616 Bacteria 1494
953 Ga0495634_0000764 3300046642 Bacteria 31101
954 Ga0495634_0008147 3300046642 Bacteria 7807
955 Ga0495634_0016602 3300046642 Bacteria 5262
956 Ga0495634_0127514 3300046642 Bacteria 1625
957 Ga0495634_0129531 3300046642 Bacteria 1609
958 Ga0495625_0028874 3300046660 Bacteria 4153
959 Ga0495635_0000213 3300046663 Bacteria 36809
960 Ga0495635_0000259 3300046663 Bacteria 33960
961 Ga0495635_0016975 3300046663 Bacteria 5084
962 Ga0495635_0030094 3300046663 Bacteria 3774
963 Ga0495635_0049090 3300046663 Bacteria 2909
964 Ga0495635_0065423 3300046663 Bacteria 2494
965 Ga0495635_0249981 3300046663 Bacteria 1195
966 Ga0495659_0001624 3300046664 Bacteria 7546
967 Ga0495659_0007589 3300046664 Bacteria 3440
968 Ga0495659_0032403 3300046664 Bacteria 1829
969 Ga0495661_0009639 3300046665 Bacteria 6617
970 Ga0495661_0065688 3300046665 Bacteria 2137
971 Ga0495661_0196732 3300046665 Bacteria 1058
972 Ga0495588_0024498 3300046674 Bacteria 2998
973 Ga0495588_0024537 3300046674 Bacteria 2996
974 Ga0495657_0002844 3300046675 Bacteria 14362
975 Ga0495657_0016391 3300046675 Bacteria 5399
976 Ga0495657_0016908 3300046675 Bacteria 5303
977 Ga0495657_0025579 3300046675 Bacteria 4190
978 Ga0495657_0082646 3300046675 Bacteria 2075
979 Ga0495599_0007346 3300046678 Bacteria 6680
980 Ga0495599_0014241 3300046678 Bacteria 4923
981 Ga0495599_0014708 3300046678 Bacteria 4846
982 Ga0495599_0014832 3300046678 Bacteria 4826
983 Ga0495623_0005373 3300046679 Bacteria 8381
984 Ga0495646_0004387 3300046680 Bacteria 8886
985 Ga0495646_0029664 3300046680 Bacteria 3419
986 Ga0495646_0067197 3300046680 Bacteria 2119
987 Ga0495647_0000671 3300046681 Bacteria 10182
988 Ga0495647_0009031 3300046681 Bacteria 3363
989 Ga0495647_0018362 3300046681 Bacteria 2489
990 Ga0495658_0001217 3300046683 Bacteria 13511
991 Ga0495658_0003377 3300046683 Bacteria 7909
992 Ga0495658_0015731 3300046683 Bacteria 3885
993 Ga0495658_0039662 3300046683 Bacteria 2614
994 Ga0495658_0044760 3300046683 Bacteria 2481
995 Ga0495658_0055581 3300046683 Bacteria 2255
996 Ga0495658_0150455 3300046683 Bacteria 1429
997 Ga0495669_0017236 3300046684 Bacteria 3098
998 Ga0495613_0001985 3300046689 Bacteria 15542
999 Ga0495613_0008073 3300046689 Bacteria 7825
1000 Ga0495613_0029070 3300046689 Bacteria 4109
1001 Ga0495613_0039681 3300046689 Bacteria 3490
1002 Ga0495613_0040397 3300046689 Bacteria 3457
1003 Ga0495624_0000094 3300046690 Bacteria 59911
1004 Ga0495624_0005832 3300046690 Bacteria 8812
1005 Ga0495624_0039916 3300046690 Bacteria 3008
1006 Ga0495624_0105692 3300046690 Bacteria 1732
1007 Ga0495624_0221826 3300046690 Bacteria 1146
1008 Ga0495670_0006395 3300046691 Bacteria 5787
1009 Ga0495670_0020245 3300046691 Bacteria 3279
1010 Ga0495670_0035981 3300046691 Bacteria 2466
1011 Ga0495670_0079467 3300046691 Bacteria 1669
1012 Ga0495649_0045404 3300046694 Bacteria 2395
1013 Ga0495649_0150303 3300046694 Bacteria 1224
1014 Ga0495589_0082575 3300046794 Bacteria 1562
1015 Ga0495600_0001029 3300046809 Bacteria 15081
1016 Ga0495600_0001162 3300046809 Bacteria 14346
1017 Ga0495600_0002671 3300046809 Bacteria 10307
1018 Ga0495600_0010441 3300046809 Bacteria 5764
1019 Ga0495600_0077585 3300046809 Bacteria 2169
1020 Ga0495600_0197916 3300046809 Bacteria 1291
1021 Ga0495600_0244756 3300046809 Bacteria 1142
1022 Ga0495581_0001146 3300047315 Bacteria 14489
1023 Ga0495581_0039890 3300047315 Bacteria 2718
1024 Ga0495581_0054963 3300047315 Bacteria 2298
1025 Ga0495581_0059405 3300047315 Bacteria 2210
1026 Ga0495581_0062688 3300047315 Bacteria 2148
1027 Ga0495581_0120994 3300047315 Bacteria 1523
1028 Ga0495581_0233294 3300047315 Bacteria 1076
1029 Ga0495604_0002338 3300047317 Bacteria 15198
1030 Ga0495604_0002686 3300047317 Bacteria 14260
1031 Ga0495604_0005951 3300047317 Bacteria 9677
1032 Ga0495604_0015525 3300047317 Bacteria 6078
1033 Ga0495604_0061087 3300047317 Bacteria 2883
1034 Ga0495604_0150464 3300047317 Bacteria 1654
1035 Ga0495636_0044370 3300047318 Bacteria 1851
1036 Ga0495674_0000955 3300047319 Bacteria 27621
1037 Ga0495674_0015736 3300047319 Bacteria 7061
1038 Ga0495674_0033074 3300047319 Bacteria 4686
1039 Ga0495674_0093291 3300047319 Bacteria 2569
1040 Ga0495672_0016111 3300047320 Bacteria 5050
1041 Ga0495672_0085617 3300047320 Bacteria 1746
1042 Ga0495676_0067157 3300047321 Bacteria 2775
1043 Ga0495680_0002637 3300047322 Bacteria 18206
1044 Ga0495680_0013217 3300047322 Bacteria 7212
1045 Ga0495680_0014747 3300047322 Bacteria 6755
1046 Ga0495680_0077921 3300047322 Bacteria 2509
1047 Ga0495680_0095688 3300047322 Bacteria 2219
1048 Ga0495680_0135662 3300047322 Bacteria 1804
1049 Ga0495675_0000756 3300047444 Bacteria 20233
1050 Ga0495675_0009113 3300047444 Bacteria 6169
1051 Ga0495675_0020522 3300047444 Bacteria 4204
1052 Ga0495675_0042090 3300047444 Bacteria 2909
1053 Ga0495679_023599 3300047446 Bacteria 2084
1054 Ga0495679_057589 3300047446 Bacteria 1149
1055 Ga0495673_0046413 3300047469 Bacteria 1925
1056 Ga0495684_0000052 3300047471 Bacteria 85125
1057 Ga0495684_0005982 3300047471 Bacteria 9452
1058 Ga0495684_0021687 3300047471 Bacteria 4946
1059 Ga0495684_0034401 3300047471 Bacteria 3887
1060 Ga0495684_0039927 3300047471 Bacteria 3598
1061 Ga0495593_0000084 3300047673 Bacteria 41155
1062 Ga0495593_0000518 3300047673 Bacteria 21864
1063 Ga0495593_0030920 3300047673 Bacteria 2927
1064 Ga0495593_0044493 3300047673 Bacteria 2374
1065 Ga0495602_0005240 3300048088 Bacteria 13587
1066 Ga0495602_0017645 3300048088 Bacteria 7150
1067 Ga0495602_0067122 3300048088 Bacteria 3087
1068 Ga0495602_0172220 3300048088 Bacteria 1679
1069 Ga0496100_0002070 3300048903 Bacteria 10081
1070 Ga0496100_0003202 3300048903 Bacteria 8501
1071 Ga0496100_0007436 3300048903 Bacteria 6043
1072 Ga0496100_0011757 3300048903 Bacteria 4992
1073 Ga0496100_0074702 3300048903 Bacteria 2272
1074 Ga0496101_0010499 3300048904 Bacteria 6116
1075 Ga0496101_0013727 3300048904 Bacteria 5433
1076 Ga0496101_0086452 3300048904 Bacteria 2325
1077 Ga0496101_0112749 3300048904 Bacteria 2048
1078 Ga0496101_0190511 3300048904 Bacteria 1582
1079 Ga0496101_0190527 3300048904 Bacteria 1582
1080 Ga0496102_0002260 3300048905 Bacteria 16503
1081 Ga0496102_0008445 3300048905 Bacteria 8828
1082 Ga0496102_0012347 3300048905 Bacteria 7391
1083 Ga0496102_0028962 3300048905 Bacteria 4950
1084 Ga0496102_0085393 3300048905 Bacteria 2914
1085 Ga0496102_0133391 3300048905 Bacteria 2326
1086 Ga0496102_0213438 3300048905 Bacteria 1819
1087 Ga0496102_0264513 3300048905 Bacteria 1621
1088 Ga0496102_0287089 3300048905 Bacteria 1551
1089 Ga0496103_0010418 3300048906 Bacteria 5501
1090 Ga0496103_0190253 3300048906 Bacteria 1319
1091 Ga0496103_0232674 3300048906 Bacteria 1185
1092 Ga0496104_0000355 3300048907 Bacteria 40904
1093 Ga0496104_0002092 3300048907 Bacteria 17331
1094 Ga0496104_0002505 3300048907 Bacteria 15804
1095 Ga0496104_0005097 3300048907 Bacteria 11465
1096 Ga0496104_0013196 3300048907 Bacteria 7447
1097 Ga0496104_0013207 3300048907 Bacteria 7444
1098 Ga0496104_0031130 3300048907 Bacteria 4960
1099 Ga0496104_0100268 3300048907 Bacteria 2772
1100 Ga0496104_0111701 3300048907 Bacteria 2620
1101 Ga0496104_0115091 3300048907 Bacteria 2580
1102 Ga0496104_0154112 3300048907 Bacteria 2205
1103 Ga0496104_0169359 3300048907 Bacteria 2094
1104 Ga0496104_0196077 3300048907 Bacteria 1931
1105 Ga0496104_0252609 3300048907 Bacteria 1676
1106 Ga0496104_0280421 3300048907 Bacteria 1579
1107 Ga0496105_0007792 3300048908 Bacteria 8312
1108 Ga0496105_0009967 3300048908 Bacteria 7454
1109 Ga0496105_0036325 3300048908 Bacteria 4058
1110 Ga0496105_0043466 3300048908 Bacteria 3705
1111 Ga0496105_0047162 3300048908 Bacteria 3555
1112 Ga0496105_0103471 3300048908 Bacteria 2351
1113 Ga0496105_0107881 3300048908 Bacteria 2299
1114 Ga0496106_0000262 3300048909 Bacteria 36919
1115 Ga0496106_0005300 3300048909 Bacteria 9553
1116 Ga0496106_0007107 3300048909 Bacteria 8273
1117 Ga0496106_0009020 3300048909 Bacteria 7369
1118 Ga0496106_0031238 3300048909 Bacteria 3968
1119 Ga0496106_0130848 3300048909 Bacteria 1968
1120 Ga0496106_0141426 3300048909 Bacteria 1893
1121 Ga0496106_0283172 3300048909 Bacteria 1328
1122 Ga0496106_0286362 3300048909 Bacteria 1320
1123 Ga0496107_0006402 3300048910 Bacteria 8092
1124 Ga0496107_0008145 3300048910 Bacteria 7249
1125 Ga0496107_0026340 3300048910 Bacteria 4121
1126 Ga0496107_0095745 3300048910 Bacteria 2172
1127 Ga0496107_0180235 3300048910 Bacteria 1568
1128 Ga0496107_0189534 3300048910 Bacteria 1527
1129 Ga0496108_0000357 3300048911 Bacteria 38614
1130 Ga0496108_0002206 3300048911 Bacteria 15586
1131 Ga0496108_0019692 3300048911 Bacteria 5542
1132 Ga0496108_0036720 3300048911 Bacteria 4077
1133 Ga0496108_0128267 3300048911 Bacteria 2179
1134 Ga0496108_0152555 3300048911 Bacteria 1994
1135 Ga0496108_0255222 3300048911 Bacteria 1525
1136 Ga0496108_0334821 3300048911 Bacteria 1320
1137 Ga0496108_0381278 3300048911 Bacteria 1231
1138 Ga0496109_0001120 3300048912 Bacteria 22267
1139 Ga0496109_0002394 3300048912 Bacteria 15685
1140 Ga0496109_0003393 3300048912 Bacteria 13328
1141 Ga0496109_0019820 3300048912 Bacteria 5934
1142 Ga0496109_0033231 3300048912 Bacteria 4640
1143 Ga0496109_0068095 3300048912 Bacteria 3262
1144 Ga0496109_0073170 3300048912 Bacteria 3149
1145 Ga0496109_0115139 3300048912 Bacteria 2501
1146 Ga0496109_0171529 3300048912 Bacteria 2035
1147 Ga0496109_0200548 3300048912 Bacteria 1875
1148 Ga0496109_0303959 3300048912 Bacteria 1504
1149 Ga0496109_0311271 3300048912 Bacteria 1486
1150 Ga0496109_0450813 3300048912 Bacteria 1215
1151 Ga0496110_0000205 3300048913 Bacteria 37706
1152 Ga0496110_0000214 3300048913 Bacteria 37211
1153 Ga0496110_0003778 3300048913 Bacteria 11663
1154 Ga0496110_0011003 3300048913 Bacteria 7383
1155 Ga0496110_0033779 3300048913 Bacteria 4427
1156 Ga0496110_0059615 3300048913 Bacteria 3365
1157 Ga0496110_0234627 3300048913 Bacteria 1669
1158 Ga0496111_0009382 3300048914 Bacteria 6526
1159 Ga0496111_0017446 3300048914 Bacteria 4963
1160 Ga0496111_0021207 3300048914 Bacteria 4533
1161 Ga0496111_0029313 3300048914 Bacteria 3908
1162 Ga0496111_0074574 3300048914 Bacteria 2471
1163 Ga0496111_0118345 3300048914 Bacteria 1955
1164 Ga0496112_0000019 3300048915 Bacteria 185531
1165 Ga0496112_0006469 3300048915 Bacteria 10288
1166 Ga0496112_0008306 3300048915 Bacteria 9290
1167 Ga0496112_0014600 3300048915 Bacteria 7297
1168 Ga0496112_0018368 3300048915 Bacteria 6583
1169 Ga0496112_0049850 3300048915 Bacteria 4104
1170 Ga0496112_0051135 3300048915 Bacteria 4053
1171 Ga0496112_0060871 3300048915 Bacteria 3720
1172 Ga0496112_0081318 3300048915 Bacteria 3204
1173 Ga0496112_0115121 3300048915 Bacteria 2659
1174 Ga0496112_0161353 3300048915 Bacteria 2208
1175 Ga0496113_0006975 3300048916 Bacteria 7223
1176 Ga0496113_0010586 3300048916 Bacteria 6104
1177 Ga0496113_0012822 3300048916 Bacteria 5649
1178 Ga0496113_0014335 3300048916 Bacteria 5405
1179 Ga0496113_0100574 3300048916 Bacteria 2240
1180 Ga0496113_0121802 3300048916 Bacteria 2040
1181 Ga0496113_0182381 3300048916 Bacteria 1664
1182 Ga0496113_0247459 3300048916 Bacteria 1423
1183 Ga0496114_0001228 3300048917 Bacteria 19391
1184 Ga0496114_0029582 3300048917 Bacteria 4505
1185 Ga0496114_0033066 3300048917 Bacteria 4260
1186 Ga0496114_0089379 3300048917 Bacteria 2614
1187 Ga0496114_0210258 3300048917 Bacteria 1706
1188 Ga0496114_0275296 3300048917 Bacteria 1483
1189 Ga0496114_0352468 3300048917 Bacteria 1302
1190 Ga0496114_0455267 3300048917 Bacteria 1133
1191 Ga0496114_0656683 3300048917 Bacteria 922
1192 Ga0496115_0004229 3300048918 Bacteria 10380
1193 Ga0496115_0008048 3300048918 Bacteria 7783
1194 Ga0496115_0021524 3300048918 Bacteria 4983
1195 Ga0496115_0029321 3300048918 Bacteria 4321
1196 Ga0496115_0080259 3300048918 Bacteria 2656
1197 Ga0496115_0084242 3300048918 Bacteria 2592
1198 Ga0496115_0152003 3300048918 Bacteria 1912
1199 Ga0496115_0287002 3300048918 Bacteria 1350
1200 Ga0496115_0316617 3300048918 Bacteria 1277
1201 Ga0496116_0002417 3300048919 Bacteria 19673
1202 Ga0496116_0050987 3300048919 Bacteria 2752
1203 Ga0496117_0018002 3300048920 Bacteria 5878
1204 Ga0496117_0023389 3300048920 Bacteria 4927
1205 Ga0496117_0087055 3300048920 Bacteria 2026
1206 Ga0496117_0088117 3300048920 Bacteria 2009
1207 Ga0496118_0012386 3300048921 Bacteria 8194
1208 Ga0496118_0049433 3300048921 Bacteria 3238
1209 Ga0496118_0053446 3300048921 Bacteria 3070
1210 Ga0496118_0103252 3300048921 Bacteria 1918
1211 Ga0496118_0108023 3300048921 Bacteria 1856
1212 Ga0496118_0202765 3300048921 Bacteria 1173
1213 Ga0496119_0054246 3300048922 Bacteria 2442
1214 Ga0496119_0054585 3300048922 Bacteria 2432
1215 Ga0496120_0075070 3300048923 Bacteria 1846
1216 Ga0496121_0001792 3300048924 Bacteria 34718
1217 Ga0496121_0002340 3300048924 Bacteria 29257
1218 Ga0496121_0009331 3300048924 Bacteria 11311
1219 Ga0496121_0010594 3300048924 Bacteria 10360
1220 Ga0496121_0021376 3300048924 Bacteria 6340
1221 Ga0496121_0023069 3300048924 Bacteria 6011
1222 Ga0496121_0038228 3300048924 Bacteria 4254
1223 Ga0496121_0069240 3300048924 Bacteria 2849
1224 Ga0496121_0078424 3300048924 Bacteria 2626
1225 Ga0496121_0128909 3300048924 Bacteria 1897
1226 Ga0496121_0139294 3300048924 Bacteria 1802
1227 Ga0496121_0170352 3300048924 Bacteria 1582
1228 Ga0496121_0182789 3300048924 Bacteria 1511
1229 Ga0496122_0043715 3300048925 Bacteria 3506
1230 Ga0496122_0061496 3300048925 Bacteria 2756
1231 Ga0496122_0062910 3300048925 Bacteria 2713
1232 Ga0496123_0044422 3300048926 Bacteria 3038
1233 Ga0496123_0059825 3300048926 Bacteria 2460
1234 Ga0496124_0002998 3300048927 Bacteria 21122
1235 Ga0496124_0116329 3300048927 Bacteria 2144
1236 Ga0496124_0117952 3300048927 Bacteria 2125
1237 Ga0496124_0141815 3300048927 Bacteria 1895
1238 Ga0496124_0311228 3300048927 Bacteria 1132
1239 Ga0496125_0000048 3300048928 Bacteria 290651
1240 Ga0496125_0003042 3300048928 Bacteria 20965
1241 Ga0496125_0020421 3300048928 Bacteria 6217
1242 Ga0496125_0020601 3300048928 Bacteria 6186
1243 Ga0496125_0033975 3300048928 Bacteria 4503
1244 Ga0496125_0045631 3300048928 Bacteria 3685
1245 Ga0496125_0048395 3300048928 Bacteria 3546
1246 Ga0496125_0125076 3300048928 Bacteria 1824
1247 Ga0496126_0001531 3300048929 Bacteria 35598
1248 Ga0496126_0007269 3300048929 Bacteria 12174
1249 Ga0496126_0022191 3300048929 Bacteria 6182
1250 Ga0496126_0053197 3300048929 Bacteria 3675
1251 Ga0496126_0063890 3300048929 Bacteria 3298
1252 Ga0496126_0084610 3300048929 Bacteria 2797
1253 Ga0496126_0085677 3300048929 Bacteria 2777
1254 Ga0496126_0201529 3300048929 Bacteria 1680
1255 Ga0496126_0386822 3300048929 Bacteria 1137
1256 Ga0495682_0106530 3300049460 Bacteria 1005
1257 Ga0501040_0205804 3300049576 Bacteria 1398
1258 Ga0501040_0232929 3300049576 Bacteria 1312
1259 Ga0501072_0012253 3300049588 Bacteria 6553
1260 Ga0501072_0178888 3300049588 Bacteria 1692
1261 Ga0501076_0360227 3300049592 Bacteria 1195
1262 Ga0501079_0158269 3300049741 Bacteria 1766
1263 Ga0501080_0189941 3300049742 Bacteria 1888
1264 Ga0501081_0023726 3300049743 Bacteria 4113
1265 nmdc:mga03683_115613_c1 3300050489 Bacteria 1190
1266 nmdc:mga03683_12165_c1 3300050489 Bacteria 3136
1267 nmdc:mga03683_5238_c1 3300050489 Bacteria 4367
1268 nmdc:mga03683_61544_c1 3300050489 Bacteria 1588
1269 nmdc:mga03n38_110650_c1 3300050490 Bacteria 1337
1270 nmdc:mga03n38_1386_c1 3300050490 Bacteria 6887
1271 nmdc:mga03n38_152415_c1 3300050490 Bacteria 1164
1272 nmdc:mga03n38_38856_c1 3300050490 Bacteria 2061
1273 nmdc:mga03n38_93275_c1 3300050490 Bacteria 1438
1274 nmdc:mga00v17_161423_c1 3300050491 Bacteria 1443
1275 nmdc:mga00v17_193505_c1 3300050491 Bacteria 1314
1276 nmdc:mga00v17_235422_c1 3300050491 Bacteria 1187
1277 nmdc:mga00v17_318133_c1 3300050491 Bacteria 1011
1278 nmdc:mga00v17_358939_c1 3300050491 Bacteria 947
1279 nmdc:mga00v17_82162_c1 3300050491 Bacteria 2013
1280 nmdc:mga0yw44_127834_c1 3300050492 Bacteria 1642
1281 nmdc:mga0yw44_330496_c1 3300050492 Bacteria 1024
1282 nmdc:mga0yw44_403898_c1 3300050492 Bacteria 924
1283 nmdc:mga0yw44_59246_c1 3300050492 Bacteria 2342
1284 nmdc:mga0yw44_92609_c1 3300050492 Bacteria 1913
1285 nmdc:mga0k408_18266_c1 3300050493 Bacteria 3913
1286 nmdc:mga0k408_27566_c1 3300050493 Bacteria 3227
1287 nmdc:mga0k408_29533_c1 3300050493 Bacteria 3121
1288 nmdc:mga0k408_77148_c1 3300050493 Bacteria 1948
1289 nmdc:mga06z11_207236_c1 3300050494 Bacteria 1141
1290 nmdc:mga06z11_46885_c1 3300050494 Bacteria 2192
1291 nmdc:mga06z11_60561_c1 3300050494 Bacteria 1971
1292 nmdc:mga06z11_672_c1 3300050494 Bacteria 12432
1293 nmdc:mga04h51_38042_c1 3300050495 Bacteria 1556
1294 nmdc:mga04h51_42884_c1 3300050495 Bacteria 1486
1295 nmdc:mga04h51_671_c1 3300050495 Bacteria 7931
1296 nmdc:mga07m45_103435_c1 3300050496 Bacteria 1637
1297 nmdc:mga07m45_8956_c1 3300050496 Bacteria 5168
1298 nmdc:mga05p37_277222_c1 3300050507 Bacteria 2001
1299 nmdc:mga05p37_289475_c1 3300050507 Bacteria 1950
1300 nmdc:mga05p37_337234_c1 3300050507 Bacteria 1779
1301 nmdc:mga05p37_33971_c1 3300050507 Bacteria 6247
1302 nmdc:mga05p37_63416_c1 3300050507 Bacteria 4547
1303 nmdc:mga0qj67_20_c1 3300050509 Bacteria 109238
1304 nmdc:mga0qj67_93234_c1 3300050509 Bacteria 2421
1305 nmdc:mga06r32_102633_c1 3300050510 Bacteria 2808
1306 nmdc:mga06r32_113971_c1 3300050510 Bacteria 2661
1307 nmdc:mga06r32_415863_c1 3300050510 Bacteria 1326
1308 nmdc:mga06r32_86776_c1 3300050510 Bacteria 3052
1309 nmdc:mga08y16_125408_c1 3300050511 Bacteria 2671
1310 nmdc:mga08y16_159658_c1 3300050511 Bacteria 2342
1311 nmdc:mga0n895_170663_c1 3300050512 Bacteria 2207
1312 nmdc:mga0n895_216861_c1 3300050512 Bacteria 1943
1313 nmdc:mga0n895_244620_c1 3300050512 Bacteria 1821
1314 nmdc:mga0rr50_88932_c1 3300050513 Bacteria 2400
1315 nmdc:mga0a205_123013_c1 3300050515 Bacteria 2494
1316 nmdc:mga0a205_170388_c1 3300050515 Bacteria 2073
1317 nmdc:mga0sz30_1011_c1 3300050516 Bacteria 3247
1318 nmdc:mga0sz30_13780_c1 3300050516 Bacteria 3171
1319 nmdc:mga0sz30_63010_c1 3300050516 Bacteria 1587
1320 nmdc:mga0sz30_66381_c1 3300050516 Bacteria 1548
1321 nmdc:mga0sz30_72291_c1 3300050516 Bacteria 1486
1322 nmdc:mga0sz30_88011_c1 3300050516 Bacteria 1349
1323 Ga0495601_0000305 3300053077 Bacteria 26104
1324 Ga0495601_0011287 3300053077 Bacteria 5340
1325 Ga0495601_0018567 3300053077 Bacteria 4234
1326 Ga0495601_0029678 3300053077 Bacteria 3394
1327 Ga0495601_0046252 3300053077 Bacteria 2739
1328 Ga0495601_0049541 3300053077 Bacteria 2648
1329 Ga0495601_0097121 3300053077 Bacteria 1900
1330 Ga0495601_0134956 3300053077 Bacteria 1608
1331 Ga0495612_0001062 3300053078 Bacteria 11245
1332 Ga0495612_0010200 3300053078 Bacteria 3800
1333 Ga0495612_0137247 3300053078 Bacteria 1059
1334 Ga0500635_0002948 3300053080 Bacteria 4241
1335 Ga0495595_0000258 3300053084 Bacteria 21114
1336 Ga0495595_0000279 3300053084 Bacteria 20119
1337 Ga0495595_0005878 3300053084 Bacteria 4974
1338 Ga0495595_0007822 3300053084 Bacteria 4378
1339 Ga0495595_0034009 3300053084 Bacteria 2303
1340 Ga0495619_0000159 3300053085 Bacteria 49689
1341 Ga0495619_0000377 3300053085 Bacteria 30766
1342 Ga0495619_0000870 3300053085 Bacteria 19823
1343 Ga0495619_0000913 3300053085 Bacteria 19380
1344 Ga0495619_0018863 3300053085 Bacteria 4380
1345 Ga0495619_0025691 3300053085 Bacteria 3784
1346 Ga0495619_0032296 3300053085 Bacteria 3396
1347 Ga0495619_0041017 3300053085 Bacteria 3027
1348 Ga0495619_0080962 3300053085 Bacteria 2186
1349 Ga0495619_0151021 3300053085 Bacteria 1602
1350 Ga0495619_0160939 3300053085 Bacteria 1550
1351 Ga0495619_0242024 3300053085 Bacteria 1250
1352 Ga0500578_0154231 3300053086 Bacteria 1429
1353 Ga0500578_0191848 3300053086 Bacteria 1254
1354 Ga0500643_000091 3300053087 Bacteria 93825
1355 Ga0500644_0014191 3300053088 Bacteria 2243
1356 Ga0500581_003120 3300053089 Bacteria 7361
1357 Ga0500646_0007849 3300053090 Bacteria 2728
1358 Ga0500646_0085887 3300053090 Bacteria 967
1359 Ga0500647_0019458 3300053091 Bacteria 3153
1360 Ga0500647_0035940 3300053091 Bacteria 2368
1361 Ga0500583_0061791 3300053092 Bacteria 1770
1362 Ga0500583_0075530 3300053092 Bacteria 1619
1363 Ga0500651_0003570 3300053093 Bacteria 8523
1364 Ga0500651_0021493 3300053093 Bacteria 4023
1365 Ga0500651_0041703 3300053093 Bacteria 2893
1366 Ga0500651_0044167 3300053093 Bacteria 2807
1367 Ga0500566_0000199 3300053094 Bacteria 31473
1368 Ga0500566_0001862 3300053094 Bacteria 12407
1369 Ga0500566_0005554 3300053094 Bacteria 7494
1370 Ga0500566_0011591 3300053094 Bacteria 5190
1371 Ga0500566_0147602 3300053094 Bacteria 1241
1372 Ga0500640_000362 3300053095 Bacteria 10622
1373 Ga0500641_0009296 3300053096 Bacteria 3533
1374 Ga0500650_0019978 3300053098 Bacteria 2932
1375 Ga0500554_052233 3300053102 Bacteria 1289
1376 Ga0500555_026618 3300053103 Bacteria 1652
1377 Ga0500555_034857 3300053103 Bacteria 1416
1378 Ga0500556_0000091 3300053104 Bacteria 83564
1379 Ga0500556_0032128 3300053104 Bacteria 1791
1380 Ga0500556_0036442 3300053104 Bacteria 1706
1381 Ga0500557_000043 3300053105 Bacteria 63389
1382 Ga0500562_041040 3300053108 Bacteria 1230
1383 Ga0500569_000764 3300053109 Bacteria 5632
1384 Ga0500572_000254 3300053111 Bacteria 19130
1385 Ga0500572_001685 3300053111 Bacteria 5771
1386 Ga0500572_002479 3300053111 Bacteria 4425
1387 Ga0500593_015527 3300053117 Bacteria 3284
1388 Ga0500594_0023858 3300053118 Bacteria 1554
1389 Ga0500594_0024902 3300053118 Bacteria 1529
1390 Ga0500595_000001 3300053119 Bacteria 1088438
1391 Ga0500595_001153 3300053119 Bacteria 14657
1392 Ga0500595_001894 3300053119 Bacteria 10778
1393 Ga0500595_006741 3300053119 Bacteria 4841
1394 Ga0500595_009741 3300053119 Bacteria 3862
1395 Ga0500595_022147 3300053119 Bacteria 2255
1396 Ga0500608_024017 3300053122 Bacteria 2842
1397 Ga0500608_108111 3300053122 Bacteria 1278
1398 Ga0500614_002002 3300053123 Bacteria 4660
1399 Ga0500618_015870 3300053125 Bacteria 1894
1400 Ga0500642_0000046 3300053130 Bacteria 82391
1401 Ga0500642_0000129 3300053130 Bacteria 34204
1402 Ga0500642_0098851 3300053130 Bacteria 1355
1403 Ga0500652_008962 3300053131 Bacteria 3362
1404 Ga0500652_012313 3300053131 Bacteria 2997
1405 Ga0500655_017301 3300053133 Bacteria 1333
1406 Ga0500658_0061763 3300053134 Bacteria 1559
1407 Ga0500658_0095634 3300053134 Bacteria 1290
1408 Ga0500559_0000201 3300053136 Bacteria 47715
1409 Ga0500559_0000287 3300053136 Bacteria 38965
1410 Ga0500559_0000803 3300053136 Bacteria 20545
1411 Ga0500559_0015771 3300053136 Bacteria 3191
1412 Ga0500559_0029076 3300053136 Bacteria 2364
1413 Ga0500568_0002999 3300053139 Bacteria 9656
1414 Ga0500568_0025139 3300053139 Bacteria 2516
1415 Ga0500568_0033886 3300053139 Bacteria 2092
1416 Ga0500577_0039113 3300053142 Bacteria 1717
1417 Ga0500577_0042885 3300053142 Bacteria 1659
1418 Ga0500589_107840 3300053147 Bacteria 1199
1419 Ga0500590_044248 3300053148 Bacteria 2281
1420 Ga0500590_151712 3300053148 Bacteria 1044
1421 Ga0500603_000119 3300053150 Bacteria 18463
1422 Ga0500603_000839 3300053150 Bacteria 7338
1423 Ga0500603_001632 3300053150 Bacteria 5060
1424 Ga0500616_0000022 3300053153 Bacteria 460463
1425 Ga0500616_0000283 3300053153 Bacteria 74456
1426 Ga0500616_0002182 3300053153 Bacteria 16877
1427 Ga0500622_0016789 3300053156 Bacteria 3907
1428 Ga0500622_0017072 3300053156 Bacteria 3869
1429 Ga0500622_0035115 3300053156 Bacteria 2625
1430 Ga0500622_0049796 3300053156 Bacteria 2159
1431 Ga0500627_0017230 3300053158 Bacteria 2834
1432 Ga0500627_0089282 3300053158 Bacteria 1379
1433 Ga0500630_003337 3300053159 Bacteria 7777
1434 Ga0500639_004881 3300053163 Bacteria 6826
1435 Ga0500636_0000291 3300053177 Bacteria 27724
1436 Ga0500636_0000970 3300053177 Bacteria 15430
1437 Ga0500636_0003204 3300053177 Bacteria 9163
1438 Ga0500636_0010476 3300053177 Bacteria 5410
1439 Ga0500636_0108023 3300053177 Bacteria 1575
1440 Ga0500637_0000757 3300053178 Bacteria 12952
1441 Ga0500637_0001082 3300053178 Bacteria 11204
1442 Ga0500637_0042820 3300053178 Bacteria 2560
1443 Ga0500567_104933 3300053723 Bacteria 1165
1444 Ga0500576_058468 3300053725 Bacteria 1693
1445 Ga0500576_092761 3300053725 Bacteria 1250
1446 Ga0500576_124916 3300053725 Bacteria 1007
1447 Ga0500645_000371 3300053730 Bacteria 31603
1448 Ga0500645_019793 3300053730 Bacteria 2091
1449 Ga0500609_001958 3300053731 Bacteria 2972
1450 Ga0500552_000588 3300053733 Bacteria 3408
1451 Ga0500596_000981 3300053735 Bacteria 5698
1452 Ga0500596_008877 3300053735 Bacteria 1589
1453 Ga0500601_000421 3300053737 Bacteria 7093
1454 Ga0501084_0048521 3300054114 Bacteria 3554
1455 Ga0501084_0068030 3300054114 Bacteria 2982
1456 Ga0501084_0346291 3300054114 Bacteria 1255
1457 Ga0500661_002205 3300055283 Bacteria 3680
1458 Ga0501082_0248233 3300060353 Bacteria 1549
1459 Ga0530510_0205009 3300061734 Bacteria 1465
1460 2507504817 2507262055 Bacteria 8048963
1461 2508546169 2508501009 Bacteria 7784016
1462 2508695103 2508501042 Bacteria 8719808
1463 2511399022 2511231028 Bacteria 8046582
1464 2513589571 2513237087 Bacteria 5817514
1465 2513626159 2513237092 Bacteria 8341956
1466 2513641884 2513237094 Bacteria 8789602
1467 2513647990 2513237095 Bacteria 8976980
1468 2513656475 2513237096 Bacteria 8722461
1469 2513673007 2513237098 Bacteria 9902361
1470 2513694892 2513237101 Bacteria 7952346
1471 2513705995 2513237102 Bacteria 7703324
1472 2513715683 2513237104 Bacteria 10034502
1473 2513858951 2513237137 Bacteria 9558895
1474 2513873939 2513237139 Bacteria 8737671
1475 2513890431 2513237141 Bacteria 8496279
1476 2513917346 2513237145 Bacteria 8979722
1477 2514012913 2513237161 Bacteria 8871253
1478 2515625893 2515154112 Bacteria 8294334
1479 2517102415 2517093001 Bacteria 9002274
1480 2517889569 2517572143 Bacteria 9484767
1481 2524435718 2524023205 Bacteria 8918781
1482 2524466481 2524023210 Bacteria 9029266
1483 2524539555 2524023228 Bacteria 10118060
1484 2528855164 2528768022 Bacteria 10457665
1485 2603861859 2602042107 Bacteria 6226103
1486 2617351675 2617270735 Bacteria 9163226
1487 2617374157 2617270741 Bacteria 8201522
1488 2671121241 2667528175 Bacteria 7532676
1489 2723842055 2721755755 Bacteria 8322773
1490 2738885832 2738541307 Bacteria 8606193
1491 2739282594 2738543019 Bacteria 7459457
1492 2745079014 2744054633 Bacteria 8678936
1493 2793063127 2791355196 Bacteria 7323613
1494 2793073656 2791355197 Bacteria 8420563
1495 2793077395
1496 2805919474 2802429603 Bacteria 8777136
1497 2818237252 2816332527 Bacteria 8933356
1498 2819719442 2818991467 Bacteria 5893227
1499 2824602548 2824600985 Bacteria 8488197
1500 2824612672 2824609381 Bacteria 8672835
1501 2824624779 2824617872 Bacteria 8814715
1502 2824633651 2824626560 Bacteria 8813858
1503 2824643259 2824635225 Bacteria 8785348
1504 2824651470 2824644064 Bacteria 8743947
1505 2824654486 2824653114 Bacteria 8493680
1506 2824663637 2824661429 Bacteria 9877870
1507 2824674880 2824671348 Bacteria 8369588
1508 2824685488 2824679649 Bacteria 8248951
1509 2824691948 2824687955 Bacteria 8360029
1510 2824700438 2824696289 Bacteria 8335049
1511 2824708482 2824704595 Bacteria 9667483
1512 2824721584 2824714736 Bacteria 8717648
1513 2824731518 2824723954 Bacteria 8758240
1514 2824734841 2824732956 Bacteria 7810675
1515 2824748153 2824746037 Bacteria 7911610
1516 2824757142 2824753945 Bacteria 9787441
1517 2824772081 2824763712 Bacteria 9792355
1518 2824774969 2824773399 Bacteria 8360218
1519 2838129531 2838122688 Bacteria 8803140
1520 2841913941 2841911363 Bacteria 6173697
1521 2841920506 2841917233 Bacteria 6173500
1522 2841944432 2841941048 Bacteria 8688029
1523 2841951573 2841949485 Bacteria 8680857
1524 2841964641 2841957949 Bacteria 8652217
1525 2841969209 2841966195 Bacteria 8673214
1526 2841982874 2841974524 Bacteria 8931498
1527 2841991044 2841983080 Bacteria 8395090
1528 2842043909 2842038055 Bacteria 8002051
1529 2842052101 2842045827 Bacteria 8006841
1530 2842695329 2842694124 Bacteria 4063419
1531 2844321796 2844315083 Bacteria 8138177
1532 2847931495 2847930680 Bacteria 9342022
1533 2847941727 2847939898 Bacteria 8606328
1534 2849082645 2849076700 Bacteria 7039503
1535 2857511542 2857509624 Bacteria 7472071
1536 2857526029 2857524615 Bacteria 6615449
1537 2874594224 2874590934 Bacteria 8299676
1538 2874610327 2874604998 Bacteria 7834745
1539 2874617946 2874612657 Bacteria 8252029
1540 2874624395 2874620515 Bacteria 8290088
1541 2874636679 2874628541 Bacteria 8630250
1542 2874647650 2874645413 Bacteria 8214782
1543 2876765015 2876761206 Bacteria 10111113
1544 2876771872 2876771140 Bacteria 8287509
1545 2876812804 2876808645 Bacteria 8824342
1546 2876819178 2876818435 Bacteria 8274608
1547 2879075723 2879074833 Bacteria 8279565
1548 2879087467 2879083081 Bacteria 8587928
1549 2879101273 2879099564 Bacteria 10442239
1550 2879111648 2879110137 Bacteria 8907982
1551 2879130746 2879127579 Bacteria 8294491
1552 2879146094 2879142872 Bacteria 8267021
1553 2881371029 2881364244 Bacteria 7710352
1554 2881665668 2881665667 Bacteria 8175609
1555 2885371423 2885366525 Bacteria 8326213
1556 2885375075 2885374607 Bacteria 8927485
1557 2885385388 2885383462 Bacteria 9473874
1558 2885410823 2885409591 Bacteria 9235467
1559 2888379994 2888378607 Bacteria 9652610
1560 2888391070 2888388044 Bacteria 7304136
1561 2888420799 2888419890 Bacteria 7857137
1562 2889035039 2889033259 Bacteria 9099371
1563 2893067698 2893066018 Bacteria 6158120
1564 2899931519 2899924645 Bacteria 7487985
1565 2903727654 2903727486 Bacteria 8281579
1566 2903756146 2903748898 Bacteria 9972761
1567 2903772294 2903768456 Bacteria 9749579
1568 2904672266 2904666416 Bacteria 8226587
1569 2904692128 2904690495 Bacteria 9412302
1570 2904709394
1571 2904716155 2904711408 Bacteria 9771557
1572 2906602856 2906602504 Bacteria 8295279
1573 2906613048
1574 2906627040 2906626472 Bacteria 8826946
1575 2906641156 2906635258 Bacteria 8601019
1576 2906652363 2906643746 Bacteria 8722424
1577 2906665712 2906660503 Bacteria 8595048
1578 2908748069 2908739725 Bacteria 8628932
1579 2908757410 2908756301 Bacteria 8864324
1580 2908776631 2908775508 Bacteria 8092255
1581 2922366926 2922361189 Bacteria 7436256
1582 2922378377
1583 2922388582 2922386360 Bacteria 7017218
1584 2922400338 2922393267 Bacteria 8285685
1585 2922433518
1586 2928056517 2928051484 Bacteria 7773759
1587 2928069014 2928064002 Bacteria 7419480
1588 2929622523 2929615660 Bacteria 9193770
1589 2929631259 2929624759 Bacteria 9339455
1590 2932786320 2932784394 Bacteria 9704911
1591 2932794712 2932794094 Bacteria 7915132
1592 2932805477 2932801729 Bacteria 7987968
1593 2932812605 2932809354 Bacteria 9135765
1594 2932822967 2932818245 Bacteria 9955613
1595 2932829558 2932828146 Bacteria 9745859
1596 2933584398 2933577622 Bacteria 9116884
1597 2935614985 2935608549 Bacteria 8203142
1598 2935618076 2935616580 Bacteria 9032984
1599 2935635061 2935630451 Bacteria 8169952
1600 2935641526 2935638405 Bacteria 10015038
1601 2935651667 2935648319 Bacteria 8801166
1602 2935659566 2935656913 Bacteria 8965014
1603 2935669416 2935665750 Bacteria 9571747
1604 2935677986 2935675223 Bacteria 9928132
1605 2935689563 2935684952 Bacteria 9590419
1606 2935701775 2935694250 Bacteria 9291695
1607 2935707240 2935703347 Bacteria 10242284
1608 2935717082 2935713505 Bacteria 9608509
1609 2935730084 2935722832 Bacteria 9608746
1610 2935738497 2935732158 Bacteria 9706831
1611 2935749255 2935741537 Bacteria 9707219
1612 2935756916 2935750917 Bacteria 9590372
1613 2935764470 2935760218 Bacteria 9817913
1614 2935772802 2935769743 Bacteria 7878163
1615 2935778062 2935777560 Bacteria 8077691
1616 2935787289 2935785616 Bacteria 7962367
1617 2935795923 2935793552 Bacteria 8012592
1618 2935804380 2935801545 Bacteria 9301974
1619 2935817241 2935810662 Bacteria 9401221
1620 2935825976 2935819856 Bacteria 8261050
1621 2935831257 2935827899 Bacteria 10038562
1622 2935841866 2935837841 Bacteria 9454360
1623 2935851595 2935847175 Bacteria 8228321
1624 2935856425 2935855204 Bacteria 9035059
1625 2935871052 2935864058 Bacteria 9784707
1626 2935874549 2935873716 Bacteria 9632195
1627 2935888926 2935883170 Bacteria 7964738
1628 2935910382 2935908558 Bacteria 8568796
1629 2935918332 2935916978 Bacteria 9113783
1630 2935927707 2935926038 Bacteria 8601059
1631 2935936421 2935934488 Bacteria 8602579
1632 2935944026 2935942939 Bacteria 8599779
1633 2935952463 2935951376 Bacteria 8602333
1634 2935964171 2935959822 Bacteria 7869783
1635 2935969303 2935967501 Bacteria 8603075
1636 2935977935 2935975950 Bacteria 8347125
1637 2935984764 2935984226 Bacteria 8302647
1638 2935994010 2935992306 Bacteria 9802711
1639 2936004979 2936002035 Bacteria 9362176
1640 2936013981 2936011229 Bacteria 8801034
1641 2936023109 2936019824 Bacteria 8804134
1642 2936031246 2936028420 Bacteria 8965941
1643 2936044037 2936037263 Bacteria 9446081
1644 2936049368 2936046547 Bacteria 8903709
1645 2936055934 2936055302 Bacteria 8785755
1646 2940562830 2940556831 Bacteria 9590747
1647 2941511660 2941507105 Bacteria 8166816
1648 2941519357 2941515067 Bacteria 8166720
1649 2941527519 2941523033 Bacteria 8169134
1650 2941532327 2941531003 Bacteria 7653939
1651 2941543939 2941538514 Bacteria 9402094
1652 3005483200 3005474847 Bacteria 9259049
1653 3005488940 3005483717 Bacteria 7877331
1654 3005509571 3005506211 Bacteria 6943378
1655 3005594167 3005587118 Bacteria 7794411
1656 3005602145 3005594810 Bacteria 8716512
1657 3005717901 3005710791 Bacteria 7622528
1658 3005724934 3005718088 Bacteria 8283608
1659 8006929263 8006926726 Bacteria 6749210
1660 8006935570 8006933436 Bacteria 10410654
1661 8006968346 8006964411 Bacteria 8966052
1662 8006975496 8006973647 Bacteria 10679141
1663 8006985899 8006984368 Bacteria 9651211
1664 8007000279 8006994254 Bacteria 8309700
1665 8016518670 8016511872 Bacteria 9921665
1666 8016526631 8016522445 Bacteria 8156687
1667 8016557159 8016548790 Bacteria 8155074
1668 8016565509 8016557553 Bacteria 8154380
1669 8016582562 8016575299 Bacteria 8154085
1670 8016586842 8016583857 Bacteria 10421953
1671 8016603136 8016595262 Bacteria 8149947
1672 8016606050 8016603502 Bacteria 8731218
1673 8016617933 8016613128 Bacteria 8794220
1674 8016623638 8016622563 Bacteria 7999408
1675 8016636114 8016630954 Bacteria 9217207
1676 8017058003 8017057580 Bacteria 10023680
1677 8019531539 8019530166 Bacteria 8155624
1678 8019550659 8019547302 Bacteria 7996444
1679 8019563237 8019555841 Bacteria 9642137
1680 8019573317 8019565922 Bacteria 9639779
1681 8019577716 8019576017 Bacteria 10049540
1682 8019595818 8019586578 Bacteria 10212056
1683 8019605942 8019597564 Bacteria 10041141
1684 8019612590 8019608314 Bacteria 10042931
1685 8019622526 8019619141 Bacteria 9218857
1686 8019630591 8019629233 Bacteria 8687553
1687 8019640025 8019638758 Bacteria 9062356
1688 8019652054 8019648815 Bacteria 10014479
1689 8019667418 8019659431 Bacteria 8577854
1690 8019677187 8019668869 Bacteria 8791617
1691 8019678795 8019678201 Bacteria 8863603
1692 8019696730 8019687851 Bacteria 8712826
1693 8055750974 8055742211 Bacteria 9226248
1694 8056677760 8056673599 Bacteria 7871253
1695 8056692775 8056689827 Bacteria 6712655
1696 8056970887 8056967851 Bacteria 9038162
1697 Ga0213876_10013947
1698 JGI24752J21851_1010227
1699 JGI24746J21847_1008694
1700 JGI24740J21852_10005522
1701 JGI24739J22299_10013653
1702 JGI24739J22299_10039948
1703 JGI24737J22298_10000407
1704 JGI24737J22298_10046503
1705 JGI24735J21928_10020499
1706 JGI24750J21931_1001542
1707 JGI24745J21846_1004626
1708 JGI24749J21850_1013662
1709 JGI24034J26672_10012021
1710 JGI24742J22300_10006282
1711 JGI25151J46595_10000021
1712 JGI25406J46586_10000471
1713 JGI25406J46586_10012262
1714 JGI25406J46586_10032321
1715 JGI25153J46596_10002109
1716 JGI25153J46596_10004526
1717 JGI25153J46596_10006239
1718 rootH2_10041169
1719 rootH2_10310578
1720 rootH1_10181803
1721 JGI25160J50197_1007366
1722 JGI25160J50197_1009546
1723 JGI25160J50197_1020686
1724 JGI25404J52841_10006128
1725 JGI25404J52841_10007547
1726 JGI25404J52841_10008577
1727 Ga0055542_1003668
1728 Ga0055526_1004359
1729 Ga0055524_1000035
1730 Ga0055531_10003847
1731 Ga0055543_1005535
1732 Ga0065165_1001304
1733 Ga0065165_1001405
1734 Ga0065165_1002635
1735 Ga0065165_1026191
1736 Ga0065165_1057318
1737 Ga0065712_10011010
1738 Ga0070658_10128348
1739 Ga0070676_10029115
1740 Ga0070676_10069728
1741 Ga0070676_10142015
1742 Ga0070683_100155493
1743 Ga0070690_100001480
1744 Ga0070690_100044230
1745 Ga0070670_100038656
1746 Ga0070670_100075323
1747 Ga0070670_100495953
1748 Ga0070677_10023030
1749 Ga0068869_100021007
1750 Ga0070666_10033290
1751 Ga0070660_100271379
1752 Ga0070691_10150544
1753 Ga0070687_100003576
1754 Ga0070661_100058235
1755 Ga0070661_100178791
1756 Ga0070668_100087567
1757 Ga0070668_100088760
1758 Ga0070668_100439538
1759 Ga0070669_100048090
1760 Ga0070669_100197949
1761 Ga0070671_100018157
1762 Ga0070671_100114268
1763 Ga0070674_100009734
1764 Ga0070674_100030919
1765 Ga0070674_100047259
1766 Ga0070674_100125974
1767 Ga0070674_100240279
1768 Ga0070673_100232842
1769 Ga0070673_100247850
1770 Ga0070688_100426597
1771 Ga0070659_100057085
1772 Ga0070659_100073622
1773 Ga0070667_100163219
1774 Ga0070667_100431209
1775 Ga0070667_100486156
1776 Ga0070709_10001435
1777 Ga0070709_10018623
1778 Ga0070709_10028519
1779 Ga0070709_10031766
1780 Ga0070714_100028593
1781 Ga0070714_100037350
1782 Ga0070714_100064833
1783 Ga0070714_100066789
1784 Ga0070714_100143642
1785 Ga0070713_100010045
1786 Ga0070713_100020133
1787 Ga0070713_100023379
1788 Ga0070713_100026553
1789 Ga0070713_100029310
1790 Ga0070713_100139238
1791 Ga0070713_100156058
1792 Ga0070713_100251525
1793 Ga0070713_100419325
1794 Ga0070710_10003070
1795 Ga0070710_10007821
1796 Ga0070710_10025405
1797 Ga0070710_10049485
1798 Ga0070710_10333289
1799 Ga0070711_100007255
1800 Ga0070711_100010158
1801 Ga0070705_100137607
1802 Ga0070700_100051096
1803 Ga0070694_100320059
1804 Ga0070708_100069725
1805 Ga0070663_100022794
1806 Ga0070663_100071811
1807 Ga0070663_100094017
1808 Ga0070663_100421720
1809 Ga0070678_100007756
1810 Ga0070678_100058009
1811 Ga0070678_100103787
1812 Ga0070678_100122156
1813 Ga0070678_100205342
1814 Ga0070678_100247360
1815 Ga0070662_100020979
1816 Ga0070662_100123072
1817 Ga0070662_100353274
1818 Ga0068867_100074089
1819 Ga0068867_100128336
1820 Ga0070685_10013574
1821 Ga0070685_10094745
1822 Ga0070706_100038324
1823 Ga0070707_100061272
1824 Ga0070707_100182951
1825 Ga0070698_100001256
1826 Ga0070698_100056924
1827 Ga0070698_100077624
1828 Ga0070699_100101414
1829 Ga0070699_100201380
1830 Ga0070697_100088394
1831 Ga0068853_100002466
1832 Ga0070686_100058643
1833 Ga0070686_100151107
1834 Ga0070686_100171722
1835 Ga0070665_100100771
1836 Ga0070665_100197862
1837 Ga0070665_100375703
1838 Ga0070665_100712718
1839 Ga0070704_100112829
1840 Ga0070704_100507766
1841 Ga0068855_100019962
1842 Ga0068855_100090841
1843 Ga0068855_100187886
1844 Ga0068855_100781952
1845 Ga0070664_100114591
1846 Ga0068857_100001764
1847 Ga0068857_100066536
1848 Ga0068857_100131046
1849 Ga0068854_100003702
1850 Ga0068854_100009437
1851 Ga0068856_100002751
1852 Ga0068856_100003801
1853 Ga0068856_100014815
1854 Ga0068856_100175841
1855 Ga0068856_100381878
1856 Ga0068856_100471965
1857 Ga0070702_100007182
1858 Ga0070702_100024775
1859 Ga0068852_100010588
1860 Ga0068852_100018932
1861 Ga0068852_100190570
1862 Ga0068859_100005143
1863 Ga0068859_100161666
1864 Ga0068859_100424083
1865 Ga0068864_100066351
1866 Ga0068864_100367086
1867 Ga0068861_100020081
1868 Ga0068861_100026916
1869 Ga0068861_100030834
1870 Ga0068861_100066886
1871 Ga0068861_100090784
1872 Ga0068861_100117093
1873 Ga0068851_10000998
1874 Ga0068870_10012535
1875 Ga0068870_10144352
1876 Ga0068870_10214031
1877 Ga0068863_100038224
1878 Ga0068858_100009054
1879 Ga0068858_100105049
1880 Ga0068860_100002058
1881 Ga0068860_100089568
1882 Ga0068860_100171857
1883 Ga0068862_100018243
1884 Ga0068862_100108764
1885 Ga0068862_100164815
1886 Ga0068862_100252521
1887 Ga0068862_100613990
1888 Ga0081455_10000015
1889 Ga0081455_10006198
1890 Ga0081455_10021542
1891 Ga0081455_10033433
1892 Ga0081455_10121889
1893 Ga0081455_10138084
1894 Ga0081455_10178983
1895 Ga0081538_10010377
1896 Ga0081538_10085548
1897 Ga0081540_1000459
1898 Ga0081540_1002269
1899 Ga0081540_1002282
1900 Ga0081540_1004494
1901 Ga0081540_1004784
1902 Ga0081540_1006449
1903 Ga0081540_1006666
1904 Ga0081540_1007254
1905 Ga0081540_1007646
1906 Ga0081540_1009916
1907 Ga0081540_1017080
1908 Ga0081539_10000048
1909 Ga0081539_10000466
1910 Ga0081539_10004314
1911 Ga0081539_10021149
1912 Ga0081539_10062699
1913 Ga0081539_10074323
1914 Ga0070717_10002608
1915 Ga0070717_10042632
1916 Ga0070717_10093928
1917 Ga0070717_10153827
1918 Ga0070717_10201699
1919 Ga0070717_10258003
1920 Ga0070717_10420841
1921 Ga0075365_10022006
1922 Ga0075365_10038669
1923 Ga0075365_10052107
1924 Ga0075365_10066663
1925 Ga0075365_10068611
1926 Ga0075365_10080643
1927 Ga0075368_10017075
1928 Ga0075368_10034166
1929 Ga0075363_100002145
1930 Ga0075363_100021620
1931 Ga0075363_100036579
1932 Ga0075363_100040437
1933 Ga0075363_100099922
1934 Ga0075363_100135741
1935 Ga0075364_10029682
1936 Ga0075364_10089660
1937 Ga0075364_10103781
1938 Ga0075364_10119495
1939 Ga0075364_10151415
1940 Ga0075364_10186549
1941 Ga0075364_10217615
1942 Ga0075364_10352855
1943 Ga0070715_10002100
1944 Ga0070715_10077355
1945 Ga0070716_100010030
1946 Ga0070716_100039116
1947 Ga0070716_100066067
1948 Ga0070712_100007483
1949 Ga0070712_100009194
1950 Ga0070712_100085241
1951 Ga0075362_10008683
1952 Ga0075362_10053901
1953 Ga0075362_10099250
1954 Ga0075367_10010679
1955 Ga0075367_10012056
1956 Ga0075367_10032962
1957 Ga0075367_10093726
1958 Ga0075367_10106413
1959 Ga0075367_10265601
1960 Ga0075367_10271415
1961 Ga0075369_10012200
1962 Ga0075369_10028615
1963 Ga0075369_10058463
1964 Ga0075369_10063893
1965 Ga0075369_10068667
1966 Ga0075369_10082234
1967 Ga0075366_10050584
1968 Ga0075366_10087531
1969 Ga0075366_10129353
1970 Ga0075366_10129511
1971 Ga0097621_100043350
1972 Ga0097621_100063124
1973 Ga0097621_100303904
1974 Ga0075370_10023979
1975 Ga0075370_10034636
1976 Ga0075370_10035109
1977 Ga0075370_10056900
1978 Ga0075370_10097115
1979 Ga0068871_100069401
1980 Ga0068871_100389103
1981 Ga0075428_100126914
1982 Ga0075428_100219808
1983 Ga0075428_100454510
1984 Ga0075430_100003805
1985 Ga0075430_100061792
1986 Ga0075430_100148719
1987 Ga0075431_100008501
1988 Ga0075431_100127583
1989 Ga0075431_100465316
1990 Ga0075434_100108893
1991 Ga0075434_100243277
1992 Ga0075434_100452194
1993 Ga0075434_100659338
1994 Ga0068865_100017612
1995 Ga0068865_100137402
1996 Ga0075436_100153078
1997 Ga0097620_100005143
1998 Ga0097620_100161662
1999 Ga0097620_100424100
2000 Ga0099824_1004372
2001 Ga0099823_1053765
2002 Ga0075435_100280507
2003 Ga0099795_10025142
2004 Ga0099795_10060531
2005 Ga0099795_10064618
2006 Ga0105240_10009595
2007 Ga0105240_10055652
2008 Ga0105240_10806247
2009 Ga0111539_10132770
2010 Ga0105245_10018387
2011 Ga0105245_10077260
2012 Ga0105247_10074757
2013 Ga0114129_10028215
2014 Ga0114129_10050504
2015 Ga0114129_10236575
2016 Ga0114129_10237884
2017 Ga0114129_10329886
2018 Ga0105241_10002508
2019 Ga0105241_10055998
2020 Ga0105241_10091913
2021 Ga0105241_10099417
2022 Ga0105242_10048183
2023 Ga0105248_10026102
2024 Ga0105248_10235666
2025 Ga0105248_10274419
2026 Ga0105237_10023360
2027 Ga0105237_10045757
2028 Ga0105237_10077993
2029 Ga0105237_10136081
2030 Ga0105237_10436933
2031 Ga0105238_10013064
2032 Ga0105238_10032374
2033 Ga0105238_10058953
2034 Ga0105238_10220379
2035 Ga0105249_10104567
2036 Ga0105249_10325248
2037 Ga0099796_10002833
2038 Ga0099796_10011208
2039 Ga0099796_10013605
2040 Ga0099796_10055234
2041 Ga0099796_10057378
2042 Ga0105239_10023710
2043 Ga0105239_10041130
2044 Ga0105239_10125755
2045 Ga0105239_10287272
2046 Ga0105246_10193446
2047 Ga0105246_10328939
2048 Ga0105246_10364412
2049 Ga0157374_10065407
2050 Ga0157374_10439508
2051 Ga0157378_10052575
2052 Ga0157378_10107994
2053 Ga0157378_10734915
2054 Ga0163162_10080918
2055 Ga0163162_10463199
2056 Ga0157375_10022892
2057 Ga0157375_10153214
2058 Ga0157375_10274654
2059 Ga0163163_10062889
2060 Ga0163163_10166955
2061 Ga0157379_10371260
2062 Ga0157379_10671791
2063 Ga0157376_10175081
2064 Ga0157376_10189499
2065 Ga0157376_10226961
2066 Ga0157376_10314533
2067 Ga0182007_10043534
2068 Ga0163161_10114351
2069 Ga0163161_10328618
2070 Ga0214544_1000003
2071 Ga0214542_1000003
2072 Ga0214545_1000004
2073 Ga0214545_1020700
2074 Ga0214543_1000007
2075 Ga0213872_10013101
2076 Ga0213872_10105557
2077 Ga0213876_10014535
2078 Ga0213876_10027233
2079 Ga0213876_10038656
2080 Ga0213876_10046054
2081 Ga0213876_10213934
2082 Ga0213875_10000138
2083 Ga0213871_10000343
2084 Ga0224572_1001925
2085 Ga0209563_105273
2086 Ga0209677_102298
2087 Ga0209677_104782
2088 Ga0209677_105656
2089 Ga0209148_1000351
2090 Ga0209455_1001952
2091 Ga0209455_1007569
2092 Ga0209675_1000347
2093 Ga0209675_1001333
2094 Ga0209025_1000010
2095 Ga0209025_1092622
2096 Ga0209564_1000049
2097 Ga0209564_1003721
2098 Ga0209564_1010578
2099 Ga0209758_1000015
2100 Ga0209758_1000224
2101 Ga0209758_1001252
2102 Ga0209758_1001877
2103 Ga0209758_1007694
2104 Ga0209758_1019413
2105 Ga0209758_1030260
2106 Ga0209758_1068127
2107 Ga0209256_1000014
2108 Ga0209256_1009667
2109 Ga0207426_1000552
2110 Ga0207426_1000585
2111 Ga0207426_1000940
2112 Ga0207426_1013654
2113 Ga0207426_1023802
2114 Ga0209257_1000440
2115 Ga0207696_1065859
2116 Ga0207682_10025490
2117 Ga0207692_10000547
2118 Ga0207692_10043898
2119 Ga0207642_10182465
2120 Ga0207710_10035650
2121 Ga0207710_10052378
2122 Ga0207688_10001018
2123 Ga0207688_10139847
2124 Ga0207647_10047034
2125 Ga0207685_10062853
2126 Ga0207685_10108855
2127 Ga0207699_10000386
2128 Ga0207699_10001899
2129 Ga0207699_10003779
2130 Ga0207645_10030013
2131 Ga0207645_10035040
2132 Ga0207645_10041151
2133 Ga0207645_10271358
2134 Ga0207643_10143592
2135 Ga0207705_10124768
2136 Ga0207705_10200854
2137 Ga0207684_10003003
2138 Ga0207684_10194294
2139 Ga0207654_10003583
2140 Ga0207654_10010023
2141 Ga0207654_10058758
2142 Ga0207654_10157307
2143 Ga0207707_10000816
2144 Ga0207707_10462289
2145 Ga0207695_10000065
2146 Ga0207695_10000968
2147 Ga0207695_10246090
2148 Ga0207671_10007223
2149 Ga0207671_10011255
2150 Ga0207671_10135319
2151 Ga0207693_10000774
2152 Ga0207693_10003450
2153 Ga0207693_10011795
2154 Ga0207693_10018699
2155 Ga0207693_10025504
2156 Ga0207693_10189713
2157 Ga0207663_10001349
2158 Ga0207663_10044415
2159 Ga0207662_10002530
2160 Ga0207657_10080554
2161 Ga0207657_10157830
2162 Ga0207649_10054012
2163 Ga0207649_10120391
2164 Ga0207652_10005821
2165 Ga0207646_10108874
2166 Ga0207681_10017858
2167 Ga0207694_10000213
2168 Ga0207694_10036548
2169 Ga0207650_10020260
2170 Ga0207659_10064515
2171 Ga0207659_10534690
2172 Ga0207687_10029730
2173 Ga0207687_10043769
2174 Ga0207687_10219441
2175 Ga0207700_10002201
2176 Ga0207700_10011224
2177 Ga0207700_10022359
2178 Ga0207700_10036944
2179 Ga0207700_10046045
2180 Ga0207700_10063057
2181 Ga0207664_10050317
2182 Ga0207664_10161846
2183 Ga0207664_10345364
2184 Ga0207644_10043351
2185 Ga0207644_10068452
2186 Ga0207644_10272542
2187 Ga0207690_10072098
2188 Ga0207706_10007301
2189 Ga0207706_10081510
2190 Ga0207706_10141867
2191 Ga0207706_10255463
2192 Ga0207686_10017480
2193 Ga0207709_10111415
2194 Ga0207709_10126258
2195 Ga0207709_10145800
2196 Ga0207709_10372132
2197 Ga0207670_10021668
2198 Ga0207669_10003709
2199 Ga0207669_10012917
2200 Ga0207669_10079031
2201 Ga0207669_10116285
2202 Ga0207669_10156636
2203 Ga0207669_10257152
2204 Ga0207704_10046324
2205 Ga0207665_10000289
2206 Ga0207665_10001425
2207 Ga0207665_10001510
2208 Ga0207665_10003729
2209 Ga0207665_10097212
2210 Ga0207665_10175217
2211 Ga0207665_10238951
2212 Ga0207691_10013884
2213 Ga0207691_10143212
2214 Ga0207691_10536001
2215 Ga0207711_10038123
2216 Ga0207711_10048181
2217 Ga0207711_10124403
2218 Ga0207711_10183618
2219 Ga0207711_10257495
2220 Ga0207689_10036089
2221 Ga0207689_10054040
2222 Ga0207689_10217966
2223 Ga0207661_10082840
2224 Ga0207661_10587079
2225 Ga0207679_10027684
2226 Ga0207679_10080457
2227 Ga0207667_10079331
2228 Ga0207667_10219652
2229 Ga0207667_10224943
2230 Ga0207667_10384194
2231 Ga0207651_10179218
2232 Ga0207651_10213983
2233 Ga0207712_10027778
2234 Ga0207712_10030143
2235 Ga0207668_10051796
2236 Ga0207668_10136239
2237 Ga0207668_10140121
2238 Ga0207668_10198817
2239 Ga0207668_10355903
2240 Ga0207677_10015799
2241 Ga0207677_10104825
2242 Ga0207703_10285436
2243 Ga0207703_10503468
2244 Ga0207639_10019353
2245 Ga0207639_10069817
2246 Ga0207678_10037422
2247 Ga0207678_10063278
2248 Ga0207678_10071220
2249 Ga0207678_10092481
2250 Ga0207678_10207334
2251 Ga0207708_10003151
2252 Ga0207708_10302960
2253 Ga0207708_10337924
2254 Ga0207702_10000094
2255 Ga0207702_10000095
2256 Ga0207702_10000539
2257 Ga0207702_10009972
2258 Ga0207702_10116279
2259 Ga0207702_10201888
2260 Ga0207641_10019053
2261 Ga0207648_10009796
2262 Ga0207648_10065982
2263 Ga0207648_10073497
2264 Ga0207676_10032685
2265 Ga0207676_10194012
2266 Ga0207674_10000578
2267 Ga0207674_10004408
2268 Ga0207674_10035720
2269 Ga0207674_10232416
2270 Ga0207674_10349879
2271 Ga0207675_100007420
2272 Ga0207675_100030164
2273 Ga0207675_100065878
2274 Ga0207675_100097179
2275 Ga0207683_10039973
2276 Ga0207683_10074617
2277 Ga0207683_10080049
2278 Ga0207683_10102921
2279 Ga0207683_10141110
2280 Ga0207683_10325126
2281 Ga0207698_10171001
2282 Ga0207698_10394753
2283 Ga0207698_10399432
2284 Ga0209389_1000029
2285 Ga0209389_1000076
2286 Ga0209589_1000012
2287 Ga0209589_1000013
2288 Ga0209489_100013
2289 Ga0209489_100416
2290 Ga0209700_100014
2291 Ga0209179_1001813
2292 Ga0209588_1012833
2293 Ga0209813_10000669
2294 Ga0209813_10031992
2295 Ga0207428_10238879
2296 Ga0207428_10244724
2297 Ga0265356_1006070
2298 Ga0268266_10001689
2299 Ga0268266_10026887
2300 Ga0268266_10107655
2301 Ga0268266_10118594
2302 Ga0268266_10200622
2303 Ga0268266_10499369
2304 Ga0268265_10040614
2305 Ga0268265_10116158
2306 Ga0268265_10511088
2307 Ga0268265_10695953
2308 Ga0268264_10000049
2309 Ga0268264_10364191
2310 Ga0265337_1012592
2311 Ga0265319_1007105
2312 Ga0265334_10001581
2313 Ga0265318_10009274
2314 Ga0265323_10003611
2315 Ga0265322_10011291
2316 Ga0265336_10001012
2317 Ga0307517_10000766
2318 Ga0307515_10015099
2319 Ga0307515_10324519
2320 Ga0265338_10000024
2321 Ga0265324_10011216
2322 Ga0265770_1005620
2323 Ga0265330_10030730
2324 Ga0265332_10001539
2325 Ga0265332_10013992
2326 Ga0265320_10015232
2327 Ga0265325_10002052
2328 Ga0265325_10005467
2329 Ga0265325_10037542
2330 Ga0265329_10042012
2331 Ga0265340_10000694
2332 Ga0265340_10005839
2333 Ga0265340_10037432
2334 Ga0265340_10046022
2335 Ga0265339_10001969
2336 Ga0265339_10004309
2337 Ga0265339_10170567
2338 Ga0265331_10054802
2339 Ga0265331_10063819
2340 Ga0307513_10207965
2341 Ga0307509_10011299
2342 Ga0307509_10261457
2343 Ga0307408_100208005
2344 Ga0265313_10004767
2345 Ga0265313_10146705
2346 Ga0307508_10000046
2347 Ga0307508_10063610
2348 Ga0265314_10002061
2349 Ga0265314_10006588
2350 Ga0265314_10043659
2351 Ga0265314_10189388
2352 Ga0265342_10000178
2353 Ga0265342_10028149
2354 Ga0265342_10056469
2355 Ga0265342_10100660
2356 Ga0265342_10123090
2357 Ga0265342_10124229
2358 Ga0265342_10170509
2359 Ga0316578_10016976
2360 Ga0307516_10016335
2361 Ga0307516_10022356
2362 Ga0307516_10056447
2363 Ga0307516_10272985
2364 Ga0307412_10332525
2365 Ga0307409_100758087
2366 Ga0307507_10129822
2367 Ga0307510_10007534
2368 Ga0307510_10011049
2369 Ga0307510_10030284
2370 Ga0307510_10094994
2371 Ga0307510_10245668
2372 Ga0307510_10263591
2373 Ga0315911_1000024
2374 Ga0373938_0010308
2375 Ga0373926_0029845
2376 Ga0373926_0047541
2377 Ga0373926_0082365
2378 Ga0373934_0101394
2379 Ga0373944_0000833
2380 Ga0373944_0084537
2381 Ga0373923_0000022
2382 Ga0373923_0006016
2383 Ga0373923_0162102
2384 Ga0373936_0023248
2385 Ga0373936_0039715
2386 Ga0373936_0066598
2387 Ga0373936_0111610
2388 Ga0373945_0006815
2389 Ga0373945_0023683
2390 Ga0373945_0051997
2391 Ga0373953_0000468
2392 Ga0373953_0023144
2393 Ga0373954_0000519
2394 Ga0373954_0016654
2395 Ga0373954_0043971
2396 Ga0373954_0069110
2397 Ga0373954_0071910
2398 Ga0373954_0102158
2399 Ga0373956_0113378
2400 Ga0373956_0120863
2401 Ga0373957_0010201
2402 Ga0373957_0024318
2403 Ga0373957_0103363
2404 Ga0373943_0001832
2405 Ga0373943_0007592
2406 Ga0373943_0041582
2407 Ga0373943_0192818
2408 Ga0373946_0016673
2409 Ga0373946_0020193
2410 Ga0373955_0000402
2411 Ga0373955_0003617
2412 Ga0373955_0019856
2413 Ga0373955_0038256
2414 Ga0373962_0018109
2415 Ga0316574_0002046
2416 Ga0373924_0002920
2417 Ga0373924_0004843
2418 Ga0373924_0107398
2419 Ga0373931_0058705
2420 Ga0373931_0186049
2421 Ga0373935_0000244
2422 Ga0373935_0020883
2423 Ga0373935_0021933
2424 Ga0373935_0060125
2425 Ga0373927_0001820
2426 Ga0373927_0003221
2427 Ga0373927_0007112
2428 Ga0373927_0081034
2429 Ga0373927_0280831
2430 Ga0373933_0000114
2431 Ga0373933_0000374
2432 Ga0373933_0006739
2433 Ga0373933_0024593
2434 Ga0373933_0185468
2435 Ga0373947_0004892
2436 Ga0373947_0008108
2437 Ga0373947_0011337
2438 Ga0373947_0043417
2439 Ga0373947_0069836
2440 Ga0373947_0187371
2441 Ga0373937_0001469
2442 Ga0373937_0003416
2443 Ga0373937_0004831
2444 Ga0373937_0022308
2445 Ga0373937_0043053
2446 Ga0373937_0048738
2447 Ga0373937_0106793
2448 Ga0373937_0165064
2449 Ga0373937_0204572
2450 Ga0373937_0395092
2451 Ga0316584_0002434
2452 Ga0373925_0014715
2453 Ga0373925_0085545
2454 Ga0373925_0123338
2455 Ga0395898_0295430
2456 Ga0395898_0340814
2457 Ga0395905_0033085
2458 Ga0395905_0068527
2459 Ga0395905_0410962
2460 Ga0436364_0048041
2461 Ga0436364_1046390
2462 Ga0395901_0172375
2463 Ga0395901_0205715
2464 Ga0395901_0676645
2465 Ga0436365_0191440
2466 Ga0436365_0241841
2467 Ga0436365_0285454
2468 Ga0436365_0725015
2469 Ga0436365_0989879
2470 Ga0436365_1338721
2471 Ga0436365_1708547
2472 Ga0436360_0310216
2473 Ga0436360_0458549
2474 Ga0436360_0872213
2475 Ga0436360_0875496
2476 Ga0436361_0240915
2477 Ga0436361_0863829
2478 Ga0436361_1092466
2479 Ga0436363_0151139
2480 Ga0436363_1043486
2481 Ga0436363_1360117
2482 Ga0439465_0076397
2483 Ga0451833_0242002
2484 Ga0439443_005520
2485 Ga0439435_0032036
2486 Ga0439460_0003551
2487 Ga0466969_0049520
2488 Ga0466972_0000048
2489 Ga0466965_0098425
2490 Ga0466966_0000238
2491 Ga0466966_0144923
2492 Ga0466961_0000044
2493 Ga0466963_0054300
2494 Ga0466964_0098777
2495 Ga0466968_0028990
2496 Ga0466970_0076533
2497 Ga0466957_0067374
2498 Ga0466960_0081361
2499 Ga0466959_0000963
2500 Ga0466959_0017608
2501 Ga0451576_0001156
2502 Ga0451576_0496630
2503 Ga0466958_0328904
2504 Ga0466967_0142993
2505 Ga0466967_0271045
2506 Ga0495617_020921
2507 Ga0495627_049161
2508 Ga0495592_0002074
2509 Ga0495592_0032704
2510 Ga0495592_0040311
2511 Ga0495603_0000370
2512 Ga0495603_0006854
2513 Ga0495603_0025017
2514 Ga0495603_0032180
2515 Ga0495590_0029439
2516 Ga0495590_0046024
2517 Ga0495629_0000081
2518 Ga0495629_0000380
2519 Ga0495629_0001124
2520 Ga0495629_0170162
2521 Ga0495629_0218504
2522 Ga0495638_0031456
2523 Ga0495641_0007097
2524 Ga0495641_0124184
2525 Ga0495651_0001523
2526 Ga0495651_0009321
2527 Ga0495651_0017237
2528 Ga0495651_0033842
2529 Ga0495651_0035032
2530 Ga0495651_0036906
2531 Ga0495651_0098692
2532 Ga0495651_0147119
2533 Ga0495651_0161790
2534 Ga0495651_0203471
2535 Ga0495653_0000807
2536 Ga0495653_0004588
2537 Ga0495653_0008281
2538 Ga0495653_0080323
2539 Ga0495650_0030451
2540 Ga0495580_0040123
2541 Ga0495580_0254571
2542 Ga0495582_0000051
2543 Ga0495582_0011691
2544 Ga0495582_0060346
2545 Ga0495605_0044972
2546 Ga0495639_0000010
2547 Ga0495639_0003638
2548 Ga0495639_0006195
2549 Ga0495639_0047817
2550 Ga0495639_0080272
2551 Ga0495662_0007880
2552 Ga0495662_0023141
2553 Ga0495662_0049960
2554 Ga0495662_0107253
2555 Ga0495664_0003734
2556 Ga0495664_0010817
2557 Ga0495664_0020718
2558 Ga0495664_0021685
2559 Ga0495664_0030030
2560 Ga0495584_0109513
2561 Ga0495585_0004363
2562 Ga0495585_0022427
2563 Ga0495585_0052914
2564 Ga0495585_0075849
2565 Ga0495594_0001074
2566 Ga0495594_0012226
2567 Ga0495594_0102654
2568 Ga0495607_0044870
2569 Ga0495607_0092938
2570 Ga0495607_0105301
2571 Ga0495606_0000265
2572 Ga0495606_0051543
2573 Ga0495606_0194748
2574 Ga0495608_0008172
2575 Ga0495608_0008410
2576 Ga0495608_0047354
2577 Ga0495610_0014371
2578 Ga0495616_0042659
2579 Ga0495618_0046111
2580 Ga0495618_0066259
2581 Ga0495618_0157063
2582 Ga0495628_0000115
2583 Ga0495628_0026354
2584 Ga0495628_0054423
2585 Ga0495628_0061993
2586 Ga0495628_0095564
2587 Ga0495628_0121237
2588 Ga0495628_0430908
2589 Ga0495630_0011435
2590 Ga0495630_0017568
2591 Ga0495630_0177953
2592 Ga0495632_0085709
2593 Ga0495643_0030597
2594 Ga0495643_0034671
2595 Ga0495644_0039229
2596 Ga0495648_0000271
2597 Ga0495648_0007795
2598 Ga0495648_0059977
2599 Ga0495648_0198579
2600 Ga0495663_0041401
2601 Ga0495663_0046639
2602 Ga0495666_0015984
2603 Ga0495666_0056425
2604 Ga0495666_0201053
2605 Ga0495642_0040013
2606 Ga0495652_0007397
2607 Ga0495652_0020559
2608 Ga0495652_0068933
2609 Ga0495652_0084882
2610 Ga0495652_0130893
2611 Ga0495654_0024723
2612 Ga0495665_0000005
2613 Ga0495665_0023984
2614 Ga0495665_0026680
2615 Ga0495640_0000301
2616 Ga0495640_0009451
2617 Ga0495640_0012766
2618 Ga0495640_0019216
2619 Ga0495587_0002764
2620 Ga0495587_0037268
2621 Ga0495587_0042194
2622 Ga0495587_0072019
2623 Ga0495598_0004502
2624 Ga0495598_0025576
2625 Ga0495598_0050375
2626 Ga0495621_0030961
2627 Ga0495597_0142002
2628 Ga0495645_0000994
2629 Ga0495645_0010387
2630 Ga0495645_0014229
2631 Ga0495645_0039260
2632 Ga0495645_0067971
2633 Ga0495622_0036869
2634 Ga0495622_0057834
2635 Ga0495633_0009170
2636 Ga0495633_0127635
2637 Ga0495633_0137651
2638 Ga0495667_0002081
2639 Ga0495667_0002874
2640 Ga0495667_0002956
2641 Ga0495667_0004975
2642 Ga0495667_0013842
2643 Ga0495667_0055145
2644 Ga0495667_0090933
2645 Ga0495656_0000981
2646 Ga0495656_0001491
2647 Ga0495656_0011915
2648 Ga0495668_0111830
2649 Ga0495634_0000764
2650 Ga0495634_0008147
2651 Ga0495634_0016602
2652 Ga0495634_0127514
2653 Ga0495634_0129531
2654 Ga0495625_0028874
2655 Ga0495635_0000213
2656 Ga0495635_0000259
2657 Ga0495635_0016975
2658 Ga0495635_0030094
2659 Ga0495635_0049090
2660 Ga0495635_0065423
2661 Ga0495635_0249981
2662 Ga0495659_0001624
2663 Ga0495659_0007589
2664 Ga0495659_0032403
2665 Ga0495661_0009639
2666 Ga0495661_0065688
2667 Ga0495661_0196732
2668 Ga0495588_0024498
2669 Ga0495588_0024537
2670 Ga0495657_0002844
2671 Ga0495657_0016391
2672 Ga0495657_0016908
2673 Ga0495657_0025579
2674 Ga0495657_0082646
2675 Ga0495599_0007346
2676 Ga0495599_0014241
2677 Ga0495599_0014708
2678 Ga0495599_0014832
2679 Ga0495623_0005373
2680 Ga0495646_0004387
2681 Ga0495646_0029664
2682 Ga0495646_0067197
2683 Ga0495647_0000671
2684 Ga0495647_0009031
2685 Ga0495647_0018362
2686 Ga0495658_0001217
2687 Ga0495658_0003377
2688 Ga0495658_0015731
2689 Ga0495658_0039662
2690 Ga0495658_0044760
2691 Ga0495658_0055581
2692 Ga0495658_0150455
2693 Ga0495669_0017236
2694 Ga0495613_0001985
2695 Ga0495613_0008073
2696 Ga0495613_0029070
2697 Ga0495613_0039681
2698 Ga0495613_0040397
2699 Ga0495624_0000094
2700 Ga0495624_0005832
2701 Ga0495624_0039916
2702 Ga0495624_0105692
2703 Ga0495624_0221826
2704 Ga0495670_0006395
2705 Ga0495670_0020245
2706 Ga0495670_0035981
2707 Ga0495670_0079467
2708 Ga0495649_0045404
2709 Ga0495649_0150303
2710 Ga0495589_0082575
2711 Ga0495600_0001029
2712 Ga0495600_0001162
2713 Ga0495600_0002671
2714 Ga0495600_0010441
2715 Ga0495600_0077585
2716 Ga0495600_0197916
2717 Ga0495600_0244756
2718 Ga0495581_0001146
2719 Ga0495581_0039890
2720 Ga0495581_0054963
2721 Ga0495581_0059405
2722 Ga0495581_0062688
2723 Ga0495581_0120994
2724 Ga0495581_0233294
2725 Ga0495604_0002338
2726 Ga0495604_0002686
2727 Ga0495604_0005951
2728 Ga0495604_0015525
2729 Ga0495604_0061087
2730 Ga0495604_0150464
2731 Ga0495636_0044370
2732 Ga0495674_0000955
2733 Ga0495674_0015736
2734 Ga0495674_0033074
2735 Ga0495674_0093291
2736 Ga0495672_0016111
2737 Ga0495672_0085617
2738 Ga0495676_0067157
2739 Ga0495680_0002637
2740 Ga0495680_0013217
2741 Ga0495680_0014747
2742 Ga0495680_0077921
2743 Ga0495680_0095688
2744 Ga0495680_0135662
2745 Ga0495675_0000756
2746 Ga0495675_0009113
2747 Ga0495675_0020522
2748 Ga0495675_0042090
2749 Ga0495679_023599
2750 Ga0495679_057589
2751 Ga0495673_0046413
2752 Ga0495684_0000052
2753 Ga0495684_0005982
2754 Ga0495684_0021687
2755 Ga0495684_0034401
2756 Ga0495684_0039927
2757 Ga0495593_0000084
2758 Ga0495593_0000518
2759 Ga0495593_0030920
2760 Ga0495593_0044493
2761 Ga0495602_0005240
2762 Ga0495602_0017645
2763 Ga0495602_0067122
2764 Ga0495602_0172220
2765 Ga0496100_0002070
2766 Ga0496100_0003202
2767 Ga0496100_0007436
2768 Ga0496100_0011757
2769 Ga0496100_0074702
2770 Ga0496101_0010499
2771 Ga0496101_0013727
2772 Ga0496101_0086452
2773 Ga0496101_0112749
2774 Ga0496101_0190511
2775 Ga0496101_0190527
2776 Ga0496102_0002260
2777 Ga0496102_0008445
2778 Ga0496102_0012347
2779 Ga0496102_0028962
2780 Ga0496102_0085393
2781 Ga0496102_0133391
2782 Ga0496102_0213438
2783 Ga0496102_0264513
2784 Ga0496102_0287089
2785 Ga0496103_0010418
2786 Ga0496103_0190253
2787 Ga0496103_0232674
2788 Ga0496104_0000355
2789 Ga0496104_0002092
2790 Ga0496104_0002505
2791 Ga0496104_0005097
2792 Ga0496104_0013196
2793 Ga0496104_0013207
2794 Ga0496104_0031130
2795 Ga0496104_0100268
2796 Ga0496104_0111701
2797 Ga0496104_0115091
2798 Ga0496104_0154112
2799 Ga0496104_0169359
2800 Ga0496104_0196077
2801 Ga0496104_0252609
2802 Ga0496104_0280421
2803 Ga0496105_0007792
2804 Ga0496105_0009967
2805 Ga0496105_0036325
2806 Ga0496105_0043466
2807 Ga0496105_0047162
2808 Ga0496105_0103471
2809 Ga0496105_0107881
2810 Ga0496106_0000262
2811 Ga0496106_0005300
2812 Ga0496106_0007107
2813 Ga0496106_0009020
2814 Ga0496106_0031238
2815 Ga0496106_0130848
2816 Ga0496106_0141426
2817 Ga0496106_0283172
2818 Ga0496106_0286362
2819 Ga0496107_0006402
2820 Ga0496107_0008145
2821 Ga0496107_0026340
2822 Ga0496107_0095745
2823 Ga0496107_0180235
2824 Ga0496107_0189534
2825 Ga0496108_0000357
2826 Ga0496108_0002206
2827 Ga0496108_0019692
2828 Ga0496108_0036720
2829 Ga0496108_0128267
2830 Ga0496108_0152555
2831 Ga0496108_0255222
2832 Ga0496108_0334821
2833 Ga0496108_0381278
2834 Ga0496109_0001120
2835 Ga0496109_0002394
2836 Ga0496109_0003393
2837 Ga0496109_0019820
2838 Ga0496109_0033231
2839 Ga0496109_0068095
2840 Ga0496109_0073170
2841 Ga0496109_0115139
2842 Ga0496109_0171529
2843 Ga0496109_0200548
2844 Ga0496109_0303959
2845 Ga0496109_0311271
2846 Ga0496109_0450813
2847 Ga0496110_0000205
2848 Ga0496110_0000214
2849 Ga0496110_0003778
2850 Ga0496110_0011003
2851 Ga0496110_0033779
2852 Ga0496110_0059615
2853 Ga0496110_0234627
2854 Ga0496111_0009382
2855 Ga0496111_0017446
2856 Ga0496111_0021207
2857 Ga0496111_0029313
2858 Ga0496111_0074574
2859 Ga0496111_0118345
2860 Ga0496112_0000019
2861 Ga0496112_0006469
2862 Ga0496112_0008306
2863 Ga0496112_0014600
2864 Ga0496112_0018368
2865 Ga0496112_0049850
2866 Ga0496112_0051135
2867 Ga0496112_0060871
2868 Ga0496112_0081318
2869 Ga0496112_0115121
2870 Ga0496112_0161353
2871 Ga0496113_0006975
2872 Ga0496113_0010586
2873 Ga0496113_0012822
2874 Ga0496113_0014335
2875 Ga0496113_0100574
2876 Ga0496113_0121802
2877 Ga0496113_0182381
2878 Ga0496113_0247459
2879 Ga0496114_0001228
2880 Ga0496114_0029582
2881 Ga0496114_0033066
2882 Ga0496114_0089379
2883 Ga0496114_0210258
2884 Ga0496114_0275296
2885 Ga0496114_0352468
2886 Ga0496114_0455267
2887 Ga0496114_0656683
2888 Ga0496115_0004229
2889 Ga0496115_0008048
2890 Ga0496115_0021524
2891 Ga0496115_0029321
2892 Ga0496115_0080259
2893 Ga0496115_0084242
2894 Ga0496115_0152003
2895 Ga0496115_0287002
2896 Ga0496115_0316617
2897 Ga0496116_0002417
2898 Ga0496116_0050987
2899 Ga0496117_0018002
2900 Ga0496117_0023389
2901 Ga0496117_0087055
2902 Ga0496117_0088117
2903 Ga0496118_0012386
2904 Ga0496118_0049433
2905 Ga0496118_0053446
2906 Ga0496118_0103252
2907 Ga0496118_0108023
2908 Ga0496118_0202765
2909 Ga0496119_0054246
2910 Ga0496119_0054585
2911 Ga0496120_0075070
2912 Ga0496121_0001792
2913 Ga0496121_0002340
2914 Ga0496121_0009331
2915 Ga0496121_0010594
2916 Ga0496121_0021376
2917 Ga0496121_0023069
2918 Ga0496121_0038228
2919 Ga0496121_0069240
2920 Ga0496121_0078424
2921 Ga0496121_0128909
2922 Ga0496121_0139294
2923 Ga0496121_0170352
2924 Ga0496121_0182789
2925 Ga0496122_0043715
2926 Ga0496122_0061496
2927 Ga0496122_0062910
2928 Ga0496123_0044422
2929 Ga0496123_0059825
2930 Ga0496124_0002998
2931 Ga0496124_0116329
2932 Ga0496124_0117952
2933 Ga0496124_0141815
2934 Ga0496124_0311228
2935 Ga0496125_0000048
2936 Ga0496125_0003042
2937 Ga0496125_0020421
2938 Ga0496125_0020601
2939 Ga0496125_0033975
2940 Ga0496125_0045631
2941 Ga0496125_0048395
2942 Ga0496125_0125076
2943 Ga0496126_0001531
2944 Ga0496126_0007269
2945 Ga0496126_0022191
2946 Ga0496126_0053197
2947 Ga0496126_0063890
2948 Ga0496126_0084610
2949 Ga0496126_0085677
2950 Ga0496126_0201529
2951 Ga0496126_0386822
2952 Ga0495682_0106530
2953 Ga0501040_0205804
2954 Ga0501040_0232929
2955 Ga0501072_0012253
2956 Ga0501072_0178888
2957 Ga0501076_0360227
2958 Ga0501079_0158269
2959 Ga0501080_0189941
2960 Ga0501081_0023726
2961 nmdc:mga03683_115613_c1
2962 nmdc:mga03683_12165_c1
2963 nmdc:mga03683_5238_c1
2964 nmdc:mga03683_61544_c1
2965 nmdc:mga03n38_110650_c1
2966 nmdc:mga03n38_1386_c1
2967 nmdc:mga03n38_152415_c1
2968 nmdc:mga03n38_38856_c1
2969 nmdc:mga03n38_93275_c1
2970 nmdc:mga00v17_161423_c1
2971 nmdc:mga00v17_193505_c1
2972 nmdc:mga00v17_235422_c1
2973 nmdc:mga00v17_318133_c1
2974 nmdc:mga00v17_358939_c1
2975 nmdc:mga00v17_82162_c1
2976 nmdc:mga0yw44_127834_c1
2977 nmdc:mga0yw44_330496_c1
2978 nmdc:mga0yw44_403898_c1
2979 nmdc:mga0yw44_59246_c1
2980 nmdc:mga0yw44_92609_c1
2981 nmdc:mga0k408_18266_c1
2982 nmdc:mga0k408_27566_c1
2983 nmdc:mga0k408_29533_c1
2984 nmdc:mga0k408_77148_c1
2985 nmdc:mga06z11_207236_c1
2986 nmdc:mga06z11_46885_c1
2987 nmdc:mga06z11_60561_c1
2988 nmdc:mga06z11_672_c1
2989 nmdc:mga04h51_38042_c1
2990 nmdc:mga04h51_42884_c1
2991 nmdc:mga04h51_671_c1
2992 nmdc:mga07m45_103435_c1
2993 nmdc:mga07m45_8956_c1
2994 nmdc:mga05p37_277222_c1
2995 nmdc:mga05p37_289475_c1
2996 nmdc:mga05p37_337234_c1
2997 nmdc:mga05p37_33971_c1
2998 nmdc:mga05p37_63416_c1
2999 nmdc:mga0qj67_20_c1
3000 nmdc:mga0qj67_93234_c1
3001 nmdc:mga06r32_102633_c1
3002 nmdc:mga06r32_113971_c1
3003 nmdc:mga06r32_415863_c1
3004 nmdc:mga06r32_86776_c1
3005 nmdc:mga08y16_125408_c1
3006 nmdc:mga08y16_159658_c1
3007 nmdc:mga0n895_170663_c1
3008 nmdc:mga0n895_216861_c1
3009 nmdc:mga0n895_244620_c1
3010 nmdc:mga0rr50_88932_c1
3011 nmdc:mga0a205_123013_c1
3012 nmdc:mga0a205_170388_c1
3013 nmdc:mga0sz30_1011_c1
3014 nmdc:mga0sz30_13780_c1
3015 nmdc:mga0sz30_63010_c1
3016 nmdc:mga0sz30_66381_c1
3017 nmdc:mga0sz30_72291_c1
3018 nmdc:mga0sz30_88011_c1
3019 Ga0495601_0000305
3020 Ga0495601_0011287
3021 Ga0495601_0018567
3022 Ga0495601_0029678
3023 Ga0495601_0046252
3024 Ga0495601_0049541
3025 Ga0495601_0097121
3026 Ga0495601_0134956
3027 Ga0495612_0001062
3028 Ga0495612_0010200
3029 Ga0495612_0137247
3030 Ga0500635_0002948
3031 Ga0495595_0000258
3032 Ga0495595_0000279
3033 Ga0495595_0005878
3034 Ga0495595_0007822
3035 Ga0495595_0034009
3036 Ga0495619_0000159
3037 Ga0495619_0000377
3038 Ga0495619_0000870
3039 Ga0495619_0000913
3040 Ga0495619_0018863
3041 Ga0495619_0025691
3042 Ga0495619_0032296
3043 Ga0495619_0041017
3044 Ga0495619_0080962
3045 Ga0495619_0151021
3046 Ga0495619_0160939
3047 Ga0495619_0242024
3048 Ga0500578_0154231
3049 Ga0500578_0191848
3050 Ga0500643_000091
3051 Ga0500644_0014191
3052 Ga0500581_003120
3053 Ga0500646_0007849
3054 Ga0500646_0085887
3055 Ga0500647_0019458
3056 Ga0500647_0035940
3057 Ga0500583_0061791
3058 Ga0500583_0075530
3059 Ga0500651_0003570
3060 Ga0500651_0021493
3061 Ga0500651_0041703
3062 Ga0500651_0044167
3063 Ga0500566_0000199
3064 Ga0500566_0001862
3065 Ga0500566_0005554
3066 Ga0500566_0011591
3067 Ga0500566_0147602
3068 Ga0500640_000362
3069 Ga0500641_0009296
3070 Ga0500650_0019978
3071 Ga0500554_052233
3072 Ga0500555_026618
3073 Ga0500555_034857
3074 Ga0500556_0000091
3075 Ga0500556_0032128
3076 Ga0500556_0036442
3077 Ga0500557_000043
3078 Ga0500562_041040
3079 Ga0500569_000764
3080 Ga0500572_000254
3081 Ga0500572_001685
3082 Ga0500572_002479
3083 Ga0500593_015527
3084 Ga0500594_0023858
3085 Ga0500594_0024902
3086 Ga0500595_000001
3087 Ga0500595_001153
3088 Ga0500595_001894
3089 Ga0500595_006741
3090 Ga0500595_009741
3091 Ga0500595_022147
3092 Ga0500608_024017
3093 Ga0500608_108111
3094 Ga0500614_002002
3095 Ga0500618_015870
3096 Ga0500642_0000046
3097 Ga0500642_0000129
3098 Ga0500642_0098851
3099 Ga0500652_008962
3100 Ga0500652_012313
3101 Ga0500655_017301
3102 Ga0500658_0061763
3103 Ga0500658_0095634
3104 Ga0500559_0000201
3105 Ga0500559_0000287
3106 Ga0500559_0000803
3107 Ga0500559_0015771
3108 Ga0500559_0029076
3109 Ga0500568_0002999
3110 Ga0500568_0025139
3111 Ga0500568_0033886
3112 Ga0500577_0039113
3113 Ga0500577_0042885
3114 Ga0500589_107840
3115 Ga0500590_044248
3116 Ga0500590_151712
3117 Ga0500603_000119
3118 Ga0500603_000839
3119 Ga0500603_001632
3120 Ga0500616_0000022
3121 Ga0500616_0000283
3122 Ga0500616_0002182
3123 Ga0500622_0016789
3124 Ga0500622_0017072
3125 Ga0500622_0035115
3126 Ga0500622_0049796
3127 Ga0500627_0017230
3128 Ga0500627_0089282
3129 Ga0500630_003337
3130 Ga0500639_004881
3131 Ga0500636_0000291
3132 Ga0500636_0000970
3133 Ga0500636_0003204
3134 Ga0500636_0010476
3135 Ga0500636_0108023
3136 Ga0500637_0000757
3137 Ga0500637_0001082
3138 Ga0500637_0042820
3139 Ga0500567_104933
3140 Ga0500576_058468
3141 Ga0500576_092761
3142 Ga0500576_124916
3143 Ga0500645_000371
3144 Ga0500645_019793
3145 Ga0500609_001958
3146 Ga0500552_000588
3147 Ga0500596_000981
3148 Ga0500596_008877
3149 Ga0500601_000421
3150 Ga0501084_0048521
3151 Ga0501084_0068030
3152 Ga0501084_0346291
3153 Ga0500661_002205
3154 Ga0501082_0248233
3155 Ga0530510_0205009
3156 2507504817
3157 2508546169
3158 2508695103
3159 2511399022
3160 2513589571
3161 2513626159
3162 2513641884
3163 2513647990
3164 2513656475
3165 2513673007
3166 2513694892
3167 2513705995
3168 2513715683
3169 2513858951
3170 2513873939
3171 2513890431
3172 2513917346
3173 2514012913
3174 2515625893
3175 2517102415
3176 2517889569
3177 2524435718
3178 2524466481
3179 2524539555
3180 2528855164
3181 2603861859
3182 2617351675
3183 2617374157
3184 2671121241
3185 2723842055
3186 2738885832
3187 2739282594
3188 2745079014
3189 2793063127
3190 2793073656
3191 2793077395
3192 2805919474
3193 2818237252
3194 2819719442
3195 2824602548
3196 2824612672
3197 2824624779
3198 2824633651
3199 2824643259
3200 2824651470
3201 2824654486
3202 2824663637
3203 2824674880
3204 2824685488
3205 2824691948
3206 2824700438
3207 2824708482
3208 2824721584
3209 2824731518
3210 2824734841
3211 2824748153
3212 2824757142
3213 2824772081
3214 2824774969
3215 2838129531
3216 2841913941
3217 2841920506
3218 2841944432
3219 2841951573
3220 2841964641
3221 2841969209
3222 2841982874
3223 2841991044
3224 2842043909
3225 2842052101
3226 2842695329
3227 2844321796
3228 2847931495
3229 2847941727
3230 2849082645
3231 2857511542
3232 2857526029
3233 2874594224
3234 2874610327
3235 2874617946
3236 2874624395
3237 2874636679
3238 2874647650
3239 2876765015
3240 2876771872
3241 2876812804
3242 2876819178
3243 2879075723
3244 2879087467
3245 2879101273
3246 2879111648
3247 2879130746
3248 2879146094
3249 2881371029
3250 2881665668
3251 2885371423
3252 2885375075
3253 2885385388
3254 2885410823
3255 2888379994
3256 2888391070
3257 2888420799
3258 2889035039
3259 2893067698
3260 2899931519
3261 2903727654
3262 2903756146
3263 2903772294
3264 2904672266
3265 2904692128
3266 2904709394
3267 2904716155
3268 2906602856
3269 2906613048
3270 2906627040
3271 2906641156
3272 2906652363
3273 2906665712
3274 2908748069
3275 2908757410
3276 2908776631
3277 2922366926
3278 2922378377
3279 2922388582
3280 2922400338
3281 2922433518
3282 2928056517
3283 2928069014
3284 2929622523
3285 2929631259
3286 2932786320
3287 2932794712
3288 2932805477
3289 2932812605
3290 2932822967
3291 2932829558
3292 2933584398
3293 2935614985
3294 2935618076
3295 2935635061
3296 2935641526
3297 2935651667
3298 2935659566
3299 2935669416
3300 2935677986
3301 2935689563
3302 2935701775
3303 2935707240
3304 2935717082
3305 2935730084
3306 2935738497
3307 2935749255
3308 2935756916
3309 2935764470
3310 2935772802
3311 2935778062
3312 2935787289
3313 2935795923
3314 2935804380
3315 2935817241
3316 2935825976
3317 2935831257
3318 2935841866
3319 2935851595
3320 2935856425
3321 2935871052
3322 2935874549
3323 2935888926
3324 2935910382
3325 2935918332
3326 2935927707
3327 2935936421
3328 2935944026
3329 2935952463
3330 2935964171
3331 2935969303
3332 2935977935
3333 2935984764
3334 2935994010
3335 2936004979
3336 2936013981
3337 2936023109
3338 2936031246
3339 2936044037
3340 2936049368
3341 2936055934
3342 2940562830
3343 2941511660
3344 2941519357
3345 2941527519
3346 2941532327
3347 2941543939
3348 3005483200
3349 3005488940
3350 3005509571
3351 3005594167
3352 3005602145
3353 3005717901
3354 3005724934
3355 8006929263
3356 8006935570
3357 8006968346
3358 8006975496
3359 8006985899
3360 8007000279
3361 8016518670
3362 8016526631
3363 8016557159
3364 8016565509
3365 8016582562
3366 8016586842
3367 8016603136
3368 8016606050
3369 8016617933
3370 8016623638
3371 8016636114
3372 8017058003
3373 8019531539
3374 8019550659
3375 8019563237
3376 8019573317
3377 8019577716
3378 8019595818
3379 8019605942
3380 8019612590
3381 8019622526
3382 8019630591
3383 8019640025
3384 8019652054
3385 8019667418
3386 8019677187
3387 8019678795
3388 8019696730
3389 8055750974
3390 8056677760
3391 8056692775
3392 8056970887

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

148

333

0.99

PF12911

OppC_N

N-terminal TM domain of oligopeptide transport permease C

61

107

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tuz-assembly2.cif.gz_F inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form 0.65 100 286
3tui-assembly2.cif.gz_E inward facing conformations of the metni methionine abc transporter: cy5 native crystal form 0.6308 107 285
3rlf-assembly1.cif.gz_F crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to mgamppnp 0.596 97 280
3tuz-assembly2.cif.gz_F inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form 0.568 100 286
3tui-assembly2.cif.gz_E inward facing conformations of the metni methionine abc transporter: cy5 native crystal form 0.5302 107 285
ID Description Score Start End Superfamily
af_P77463_85_288_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7997 98 284 1.10.3720.10
af_P0AEG1_88_295_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7982 95 287 1.10.3720.10
af_P75799_92_298_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7979 96 287 1.10.3720.10
af_Q2FZQ8_74_286_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7925 98 284 1.10.3720.10
af_P9WFZ9_71_279_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7854 95 285 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A436LC10-F1-model_v4 deleted 0.9426 45 188
AF-F3GLH3-F1-model_v4 Binding-protein dependent transport system inner membrane protein 0.9342 58 208 GO:0005886
GO:0055085
AF-A0A7C7PRV1-F1-model_v4 ABC transporter permease 0.9321 48 198 GO:0005886
GO:0015833
GO:0055085
AF-W1WJM0-F1-model_v4 Putative D,D-dipeptide transport system permease protein ddpC 0.9248 108 235 GO:0005886
GO:0071916
AF-A0A382PNI5-F1-model_v4 ABC transmembrane type-1 domain-containing protein 0.9228 29 207 GO:0005886
GO:0055085

Map