F495385
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1698 | 470 | 3396 | 359 |
Family's Representative Sequence
| Representative Sequence | 3300025944|Ga0207661_10172082|Ga0207661_101720822 |
| Length | 433 |
| Sequence | MRILLSYSGPTALHRPGASLRPPSPHLQLALALKFTKNRHARRDISERKRLRRLELPFVREQLAAKGDELMATQVADQTSILGLDNPMGTDGFEFVEYTAPDIELLRSLFTRMGFPEVARHKSKNVTLHKQGDCNFIINAEPGSYAEEYAKAHGPSACAMAFRVKDAKAAHQRALELGAANVEVKKGTGELDIPAIEGIGGSRLFFVDRYGDNGSIYEVDFDFHPDWQQRMADADSKLTYIDHLTHNVNRGRMSVWADFYERLFNFREIRYFDIEGKQTGLFSKAMTSPCGKIRIPLNESQDDKSQIEEFLREYKGEGIQHIALGTSDIYTAVDIIRARGIEFQDTPETYYELLPERIKGHGESIPELHKRGILMDGAPTEGQGLLLQIFTRNVIGPIFFEIIQRKGNEGFGEGNFKALFESIELDQVRRGVI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 2 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 3 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 4 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 5 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 6 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 7 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 8 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 9 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 10 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 11 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 12 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 13 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 15 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 22 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 26 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 50 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 56 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 59 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 65 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 67 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 68 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 69 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 70 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 71 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 72 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 73 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 74 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 75 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 76 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 77 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 78 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 79 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 80 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 81 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 82 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 83 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 85 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 86 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 87 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 88 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 89 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 90 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 91 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 93 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 94 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 95 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 96 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 97 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 98 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 99 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 100 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 101 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 103 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 104 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 119 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 135 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 136 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 210 | 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Metagenome | Rhizosphere |
| 211 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 212 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 216 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 217 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 218 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 219 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 220 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 221 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 222 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 223 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 224 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 225 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 226 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 227 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 228 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 229 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 230 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 231 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 232 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 233 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 234 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 235 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 236 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 237 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 238 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 239 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 240 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 241 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 242 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 243 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 244 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 245 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 246 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 247 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 248 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 249 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 250 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 251 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 252 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 253 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 254 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 255 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 256 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 257 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 258 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 259 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 260 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 261 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 262 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 263 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 264 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 265 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 266 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 267 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 268 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 269 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 270 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 271 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 272 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 273 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 274 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 275 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 276 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 277 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 278 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 279 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 280 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 281 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 282 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 283 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 284 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 285 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 286 | 3300042132 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 | Metagenome | Rhizosphere |
| 287 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 288 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 289 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 290 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 291 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 292 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 293 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 294 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 295 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 296 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 297 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 298 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 299 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 300 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 301 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 302 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 303 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 304 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 305 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 306 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 307 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 308 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 309 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 310 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 311 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 312 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 313 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 314 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 315 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 316 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 356 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 357 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 358 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 359 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 360 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 361 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 362 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 363 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 364 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 365 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 366 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 367 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 368 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 369 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 370 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 371 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 372 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 373 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 374 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 375 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 377 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 378 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 379 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 380 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 381 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 382 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 383 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 384 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 385 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 386 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 387 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 388 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 389 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 390 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 391 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 392 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 393 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 394 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 395 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 396 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 397 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 398 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 399 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 400 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 401 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 402 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 403 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 404 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 405 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 406 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 407 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 408 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 409 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 410 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 411 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 412 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 413 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 414 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 415 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 416 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 417 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 418 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 419 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 420 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 421 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 422 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 423 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 424 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 425 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 426 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 427 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 428 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 429 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 430 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 431 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 432 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 433 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 434 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 435 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 436 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 437 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 438 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 439 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 440 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 441 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 442 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 443 | 2524023250 | Niveispirillum irakense DSM 11586 | Isolate | Unclassified |
| 444 | 2547132103 | Chromobacterium sp. C-61 | Isolate | Rhizosphere |
| 445 | 2554235132 | Pseudomonas aeruginosa PGPR2 | Isolate | Unclassified |
| 446 | 2600254954 | Pseudomonas sp. NFACC19-2 | Isolate | Rhizoplane |
| 447 | 2600255389 | Pseudomonas sp. NFPP33 | Isolate | Rhizoplane |
| 448 | 2606217733 | Pseudomonas aeruginosa NFHH01 | Isolate | Rhizoplane |
| 449 | 2728369097 | Stutzerimonas balearica st101 | Isolate | Unclassified |
| 450 | 2738543020 | Pseudomonas sp. GV054 | Isolate | Unclassified |
| 451 | 2738543021 | Pseudomonas sp. GV071 | Isolate | Unclassified |
| 452 | 2808606373 | Pseudomonas sp. SLBN-2 | Isolate | Unclassified |
| 453 | 2808606379 | Pseudomonas sp. SJZ079 | Isolate | Rhizosphere |
| 454 | 2823421272 | Pseudomonas mendocina S5.2 | Isolate | Rhizoplane |
| 455 | 2842805378 | Pseudomonas sp. R-72599 | Isolate | Unclassified |
| 456 | 2843690924 | Chromobacterium rhizoryzae JP2-74 | Isolate | Rhizosphere |
| 457 | 2846033681 | Chromobacterium sinusclupearum MWU13-2610 | Isolate | Rhizosphere |
| 458 | 2846037992 | Chromobacterium alticapitis MWU14-2602 | Isolate | Rhizosphere |
| 459 | 2885427238 | Sphingomonas mesophila SYSUP0001 | Isolate | Stem Tuber |
| 460 | 2919501602 | Pseudomonas alcaliphila 3512 | Isolate | Unclassified |
| 461 | 2926063275 | Pseudomonas sp. 3400 | Isolate | Unclassified |
| 462 | 2990265787 | Sphingomonas sp. SORGH_AS802 | Isolate | Aerial Root |
| 463 | 2993693658 | Sphingomonas sp. SORGH_AS438 | Isolate | Aerial Root |
| 464 | 2998344455 | Vogesella urethralis SLBN-145 | Isolate | Rhizosphere |
| 465 | 3007252601 | Pseudomonas punonensis D1-6 | Isolate | Unclassified |
| 466 | 3007315729 | Pseudomonas argentinensis SA190 | Isolate | Unclassified |
| 467 | 640427133 | Stutzerimonas stutzeri A1501 | Isolate | Rhizosphere |
| 468 | 651053060 | Stutzerimonas stutzeri CMT.A.9 | Isolate | Rhizosphere |
| 469 | 8011350971 | Pseudomonas sp. 30_B | Isolate | Rhizosphere |
| 470 | 8034962539 | Pseudomonas sediminis PI11 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.35 |
| Metatranscriptomes | 0 |
| Isolates | 1.65 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.12 |
| Bulb | 0 |
| Endosphere | 1.83 |
| Nodule | 0.06 |
| Rhizoplane | 5.01 |
| Rhizosphere | 90.46 |
| Stem | 0 |
| Stem Tuber | 0.06 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0207661_10172082 | 3300025944 | Bacteria | 1885 |
| 2 | JGI24736J21556_1007099 | 3300001904 | Bacteria | 1887 |
| 3 | JGI24736J21556_1009758 | 3300001904 | Bacteria | 1577 |
| 4 | JGI24741J21665_1004028 | 3300001915 | Bacteria | 3346 |
| 5 | JGI24741J21665_1004851 | 3300001915 | Bacteria | 2909 |
| 6 | JGI24741J21665_1012167 | 3300001915 | Bacteria | 1485 |
| 7 | JGI24752J21851_1002288 | 3300001976 | Bacteria | 2555 |
| 8 | JGI24746J21847_1008484 | 3300001977 | Bacteria | 1548 |
| 9 | JGI24740J21852_10012406 | 3300001979 | Bacteria | 3212 |
| 10 | JGI24739J22299_10000129 | 3300001989 | Bacteria | 23885 |
| 11 | JGI24737J22298_10001260 | 3300001990 | Bacteria | 8957 |
| 12 | JGI24737J22298_10003247 | 3300001990 | Bacteria | 5767 |
| 13 | JGI24737J22298_10009782 | 3300001990 | Bacteria | 3177 |
| 14 | JGI24735J21928_10003273 | 3300002067 | Bacteria | 5534 |
| 15 | JGI24735J21928_10006116 | 3300002067 | Bacteria | 3975 |
| 16 | JGI24738J21930_10000498 | 3300002075 | Bacteria | 11174 |
| 17 | JGI25153J46596_10002720 | 3300003215 | Bacteria | 10084 |
| 18 | Ga0055536_1002563 | 3300003781 | Bacteria | 10140 |
| 19 | Ga0065714_10017464 | 3300005288 | Bacteria | 1558 |
| 20 | Ga0065712_10074254 | 3300005290 | Bacteria | 4144 |
| 21 | Ga0065712_10095303 | 3300005290 | Bacteria | 2223 |
| 22 | Ga0065715_10092501 | 3300005293 | Bacteria | 5088 |
| 23 | Ga0065715_10097978 | 3300005293 | Bacteria | 3617 |
| 24 | Ga0065715_10126836 | 3300005293 | Bacteria | 2100 |
| 25 | Ga0065715_10217694 | 3300005293 | Bacteria | 1285 |
| 26 | Ga0070658_10000782 | 3300005327 | Bacteria | 27329 |
| 27 | Ga0070658_10016126 | 3300005327 | Bacteria | 5976 |
| 28 | Ga0070658_10020167 | 3300005327 | Bacteria | 5340 |
| 29 | Ga0070658_10032109 | 3300005327 | Bacteria | 4221 |
| 30 | Ga0070658_10036407 | 3300005327 | Bacteria | 3967 |
| 31 | Ga0070658_10045362 | 3300005327 | Bacteria | 3554 |
| 32 | Ga0070658_10062402 | 3300005327 | Bacteria | 3037 |
| 33 | Ga0070658_10083328 | 3300005327 | Bacteria | 2628 |
| 34 | Ga0070658_10188590 | 3300005327 | Bacteria | 1737 |
| 35 | Ga0070676_10001960 | 3300005328 | Bacteria | 10470 |
| 36 | Ga0070676_10013444 | 3300005328 | Bacteria | 4485 |
| 37 | Ga0070676_10021151 | 3300005328 | Bacteria | 3640 |
| 38 | Ga0070676_10024500 | 3300005328 | Bacteria | 3400 |
| 39 | Ga0070676_10088878 | 3300005328 | Bacteria | 1889 |
| 40 | Ga0070676_10110328 | 3300005328 | Bacteria | 1712 |
| 41 | Ga0070683_100000209 | 3300005329 | Bacteria | 39666 |
| 42 | Ga0070683_100021851 | 3300005329 | Bacteria | 5712 |
| 43 | Ga0070683_100067719 | 3300005329 | Bacteria | 3325 |
| 44 | Ga0070683_100255932 | 3300005329 | Bacteria | 1665 |
| 45 | Ga0070683_100404237 | 3300005329 | Bacteria | 1302 |
| 46 | Ga0070670_100000035 | 3300005331 | Bacteria | 157570 |
| 47 | Ga0070670_100000265 | 3300005331 | Bacteria | 46560 |
| 48 | Ga0070670_100001878 | 3300005331 | Bacteria | 17143 |
| 49 | Ga0070670_100016626 | 3300005331 | Bacteria | 6313 |
| 50 | Ga0070670_100063582 | 3300005331 | Bacteria | 3167 |
| 51 | Ga0070670_100088826 | 3300005331 | Bacteria | 2657 |
| 52 | Ga0070670_100096526 | 3300005331 | Bacteria | 2543 |
| 53 | Ga0070670_100131204 | 3300005331 | Bacteria | 2164 |
| 54 | Ga0070677_10000332 | 3300005333 | Bacteria | 16570 |
| 55 | Ga0068869_100000331 | 3300005334 | Bacteria | 25170 |
| 56 | Ga0070666_10000822 | 3300005335 | Bacteria | 18838 |
| 57 | Ga0070666_10000924 | 3300005335 | Bacteria | 17819 |
| 58 | Ga0070666_10010937 | 3300005335 | Bacteria | 5686 |
| 59 | Ga0070666_10018159 | 3300005335 | Bacteria | 4519 |
| 60 | Ga0070666_10027338 | 3300005335 | Bacteria | 3735 |
| 61 | Ga0070666_10178467 | 3300005335 | Bacteria | 1489 |
| 62 | Ga0070680_100011718 | 3300005336 | Bacteria | 6796 |
| 63 | Ga0070680_100026458 | 3300005336 | Bacteria | 4640 |
| 64 | Ga0070680_100055922 | 3300005336 | Bacteria | 3225 |
| 65 | Ga0070680_100076972 | 3300005336 | Bacteria | 2747 |
| 66 | Ga0070682_100050330 | 3300005337 | Bacteria | 2601 |
| 67 | Ga0068868_100000156 | 3300005338 | Bacteria | 44526 |
| 68 | Ga0068868_100002559 | 3300005338 | Bacteria | 12640 |
| 69 | Ga0068868_100023466 | 3300005338 | Bacteria | 4669 |
| 70 | Ga0068868_100033029 | 3300005338 | Bacteria | 3986 |
| 71 | Ga0068868_100111310 | 3300005338 | Bacteria | 2225 |
| 72 | Ga0070660_100000534 | 3300005339 | Bacteria | 25407 |
| 73 | Ga0070660_100010855 | 3300005339 | Bacteria | 6448 |
| 74 | Ga0070660_100014517 | 3300005339 | Bacteria | 5677 |
| 75 | Ga0070660_100028930 | 3300005339 | Bacteria | 4149 |
| 76 | Ga0070660_100050134 | 3300005339 | Bacteria | 3211 |
| 77 | Ga0070660_100076959 | 3300005339 | Bacteria | 2614 |
| 78 | Ga0070660_100116913 | 3300005339 | Bacteria | 2126 |
| 79 | Ga0070660_100138592 | 3300005339 | Bacteria | 1950 |
| 80 | Ga0070689_100064072 | 3300005340 | Bacteria | 2860 |
| 81 | Ga0070689_100069289 | 3300005340 | Bacteria | 2752 |
| 82 | Ga0070691_10003441 | 3300005341 | Bacteria | 7116 |
| 83 | Ga0070691_10010751 | 3300005341 | Bacteria | 4178 |
| 84 | Ga0070691_10014911 | 3300005341 | Bacteria | 3568 |
| 85 | Ga0070661_100000452 | 3300005344 | Bacteria | 31380 |
| 86 | Ga0070661_100000694 | 3300005344 | Bacteria | 24691 |
| 87 | Ga0070661_100005269 | 3300005344 | Bacteria | 8906 |
| 88 | Ga0070661_100007519 | 3300005344 | Bacteria | 7515 |
| 89 | Ga0070661_100028664 | 3300005344 | Bacteria | 4017 |
| 90 | Ga0070661_100042947 | 3300005344 | Bacteria | 3301 |
| 91 | Ga0070661_100047268 | 3300005344 | Bacteria | 3149 |
| 92 | Ga0070661_100161246 | 3300005344 | Bacteria | 1698 |
| 93 | Ga0070661_100186272 | 3300005344 | Bacteria | 1581 |
| 94 | Ga0070668_100003642 | 3300005347 | Bacteria | 11366 |
| 95 | Ga0070668_100007660 | 3300005347 | Bacteria | 8014 |
| 96 | Ga0070668_100008418 | 3300005347 | Bacteria | 7661 |
| 97 | Ga0070668_100017704 | 3300005347 | Bacteria | 5343 |
| 98 | Ga0070668_100025836 | 3300005347 | Bacteria | 4454 |
| 99 | Ga0070668_100090493 | 3300005347 | Bacteria | 2411 |
| 100 | Ga0070669_100000383 | 3300005353 | Bacteria | 33931 |
| 101 | Ga0070669_100025265 | 3300005353 | Bacteria | 4266 |
| 102 | Ga0070669_100036006 | 3300005353 | Bacteria | 3586 |
| 103 | Ga0070669_100044111 | 3300005353 | Bacteria | 3249 |
| 104 | Ga0070669_100052547 | 3300005353 | Bacteria | 2982 |
| 105 | Ga0070669_100062219 | 3300005353 | Bacteria | 2744 |
| 106 | Ga0070675_100000992 | 3300005354 | Bacteria | 20329 |
| 107 | Ga0070675_100005969 | 3300005354 | Bacteria | 9330 |
| 108 | Ga0070675_100065716 | 3300005354 | Bacteria | 2999 |
| 109 | Ga0070675_100129959 | 3300005354 | Bacteria | 2145 |
| 110 | Ga0070675_100149565 | 3300005354 | Bacteria | 2001 |
| 111 | Ga0070671_100000722 | 3300005355 | Bacteria | 23671 |
| 112 | Ga0070671_100004160 | 3300005355 | Bacteria | 11432 |
| 113 | Ga0070671_100004541 | 3300005355 | Bacteria | 10994 |
| 114 | Ga0070671_100011174 | 3300005355 | Bacteria | 7211 |
| 115 | Ga0070671_100012253 | 3300005355 | Bacteria | 6898 |
| 116 | Ga0070671_100025495 | 3300005355 | Bacteria | 4852 |
| 117 | Ga0070671_100025830 | 3300005355 | Bacteria | 4822 |
| 118 | Ga0070671_100029411 | 3300005355 | Bacteria | 4530 |
| 119 | Ga0070671_100043894 | 3300005355 | Bacteria | 3715 |
| 120 | Ga0070671_100044621 | 3300005355 | Bacteria | 3684 |
| 121 | Ga0070671_100087864 | 3300005355 | Bacteria | 2601 |
| 122 | Ga0070671_100276361 | 3300005355 | Bacteria | 1428 |
| 123 | Ga0070674_100004878 | 3300005356 | Bacteria | 7688 |
| 124 | Ga0070674_100006097 | 3300005356 | Bacteria | 7011 |
| 125 | Ga0070674_100103281 | 3300005356 | Bacteria | 2080 |
| 126 | Ga0070674_100118619 | 3300005356 | Bacteria | 1955 |
| 127 | Ga0070673_100000249 | 3300005364 | Bacteria | 27281 |
| 128 | Ga0070673_100002351 | 3300005364 | Bacteria | 11486 |
| 129 | Ga0070673_100003351 | 3300005364 | Bacteria | 9957 |
| 130 | Ga0070673_100004608 | 3300005364 | Bacteria | 8741 |
| 131 | Ga0070673_100006422 | 3300005364 | Bacteria | 7641 |
| 132 | Ga0070673_100011852 | 3300005364 | Bacteria | 5967 |
| 133 | Ga0070673_100023653 | 3300005364 | Bacteria | 4492 |
| 134 | Ga0070673_100086124 | 3300005364 | Bacteria | 2559 |
| 135 | Ga0070673_100106527 | 3300005364 | Bacteria | 2318 |
| 136 | Ga0070673_100121150 | 3300005364 | Bacteria | 2182 |
| 137 | Ga0070659_100000138 | 3300005366 | Bacteria | 56073 |
| 138 | Ga0070659_100000814 | 3300005366 | Bacteria | 22773 |
| 139 | Ga0070659_100001624 | 3300005366 | Bacteria | 16179 |
| 140 | Ga0070659_100002821 | 3300005366 | Bacteria | 12369 |
| 141 | Ga0070659_100031998 | 3300005366 | Bacteria | 4077 |
| 142 | Ga0070659_100045351 | 3300005366 | Bacteria | 3443 |
| 143 | Ga0070659_100046182 | 3300005366 | Bacteria | 3414 |
| 144 | Ga0070659_100071360 | 3300005366 | Bacteria | 2761 |
| 145 | Ga0070659_100089041 | 3300005366 | Bacteria | 2472 |
| 146 | Ga0070659_100101139 | 3300005366 | Bacteria | 2320 |
| 147 | Ga0070659_100152099 | 3300005366 | Bacteria | 1888 |
| 148 | Ga0070659_100168024 | 3300005366 | Bacteria | 1795 |
| 149 | Ga0070659_100321586 | 3300005366 | Bacteria | 1293 |
| 150 | Ga0070667_100001410 | 3300005367 | Bacteria | 21500 |
| 151 | Ga0070667_100001484 | 3300005367 | Bacteria | 21034 |
| 152 | Ga0070667_100003528 | 3300005367 | Bacteria | 13330 |
| 153 | Ga0070667_100017734 | 3300005367 | Bacteria | 5901 |
| 154 | Ga0070667_100047025 | 3300005367 | Bacteria | 3630 |
| 155 | Ga0070667_100048037 | 3300005367 | Bacteria | 3592 |
| 156 | Ga0070667_100056280 | 3300005367 | Bacteria | 3322 |
| 157 | Ga0070667_100165629 | 3300005367 | Bacteria | 1949 |
| 158 | Ga0070709_10000789 | 3300005434 | Bacteria | 17695 |
| 159 | Ga0070714_100037783 | 3300005435 | Bacteria | 4059 |
| 160 | Ga0070714_100042701 | 3300005435 | Bacteria | 3832 |
| 161 | Ga0070714_100048894 | 3300005435 | Bacteria | 3599 |
| 162 | Ga0070714_100059795 | 3300005435 | Bacteria | 3268 |
| 163 | Ga0070714_100118950 | 3300005435 | Bacteria | 2348 |
| 164 | Ga0070714_100142418 | 3300005435 | Bacteria | 2153 |
| 165 | Ga0070713_100000001 | 3300005436 | Bacteria | 257984 |
| 166 | Ga0070713_100007288 | 3300005436 | Bacteria | 7747 |
| 167 | Ga0070713_100030084 | 3300005436 | Bacteria | 4308 |
| 168 | Ga0070713_100100338 | 3300005436 | Bacteria | 2506 |
| 169 | Ga0070713_100102562 | 3300005436 | Bacteria | 2481 |
| 170 | Ga0070710_10027180 | 3300005437 | Bacteria | 3049 |
| 171 | Ga0070711_100125905 | 3300005439 | Bacteria | 1902 |
| 172 | Ga0070700_100169748 | 3300005441 | Bacteria | 1510 |
| 173 | Ga0070694_100003977 | 3300005444 | Bacteria | 8844 |
| 174 | Ga0070663_100001943 | 3300005455 | Bacteria | 11539 |
| 175 | Ga0070678_100006645 | 3300005456 | Bacteria | 6804 |
| 176 | Ga0070678_100057492 | 3300005456 | Bacteria | 2850 |
| 177 | Ga0070662_100000410 | 3300005457 | Bacteria | 25434 |
| 178 | Ga0070662_100001575 | 3300005457 | Bacteria | 14101 |
| 179 | Ga0070662_100003923 | 3300005457 | Bacteria | 9329 |
| 180 | Ga0070662_100014525 | 3300005457 | Bacteria | 5265 |
| 181 | Ga0070662_100184060 | 3300005457 | Bacteria | 1648 |
| 182 | Ga0070681_10003186 | 3300005458 | Bacteria | 15274 |
| 183 | Ga0070681_10010375 | 3300005458 | Bacteria | 9199 |
| 184 | Ga0070681_10088204 | 3300005458 | Bacteria | 3054 |
| 185 | Ga0070681_10220261 | 3300005458 | Bacteria | 1813 |
| 186 | Ga0068867_100000388 | 3300005459 | Bacteria | 29345 |
| 187 | Ga0068867_100009701 | 3300005459 | Bacteria | 6788 |
| 188 | Ga0070685_10007272 | 3300005466 | Bacteria | 5662 |
| 189 | Ga0070706_100015818 | 3300005467 | Bacteria | 6966 |
| 190 | Ga0070707_100029636 | 3300005468 | Bacteria | 5210 |
| 191 | Ga0070698_100039510 | 3300005471 | Bacteria | 4856 |
| 192 | Ga0070699_100117657 | 3300005518 | Bacteria | 2336 |
| 193 | Ga0070699_100146256 | 3300005518 | Bacteria | 2088 |
| 194 | Ga0070679_100002478 | 3300005530 | Bacteria | 16719 |
| 195 | Ga0070679_100003827 | 3300005530 | Bacteria | 13814 |
| 196 | Ga0070679_100124070 | 3300005530 | Bacteria | 2566 |
| 197 | Ga0070679_100168049 | 3300005530 | Bacteria | 2166 |
| 198 | Ga0070679_100194439 | 3300005530 | Bacteria | 1996 |
| 199 | Ga0070679_100197449 | 3300005530 | Bacteria | 1979 |
| 200 | Ga0070679_100431192 | 3300005530 | Bacteria | 1263 |
| 201 | Ga0070684_100004466 | 3300005535 | Bacteria | 10652 |
| 202 | Ga0070684_100153624 | 3300005535 | Bacteria | 2086 |
| 203 | Ga0070684_100169862 | 3300005535 | Bacteria | 1980 |
| 204 | Ga0070697_100076280 | 3300005536 | Bacteria | 2757 |
| 205 | Ga0068853_100000479 | 3300005539 | Bacteria | 27267 |
| 206 | Ga0068853_100001793 | 3300005539 | Bacteria | 15788 |
| 207 | Ga0068853_100022483 | 3300005539 | Bacteria | 5267 |
| 208 | Ga0068853_100025293 | 3300005539 | Bacteria | 4981 |
| 209 | Ga0068853_100051542 | 3300005539 | Bacteria | 3542 |
| 210 | Ga0068853_100061709 | 3300005539 | Bacteria | 3242 |
| 211 | Ga0068853_100088570 | 3300005539 | Bacteria | 2717 |
| 212 | Ga0068853_100119979 | 3300005539 | Bacteria | 2344 |
| 213 | Ga0068853_100132713 | 3300005539 | Bacteria | 2230 |
| 214 | Ga0068853_100234293 | 3300005539 | Bacteria | 1680 |
| 215 | Ga0070672_100006526 | 3300005543 | Bacteria | 7843 |
| 216 | Ga0070672_100083124 | 3300005543 | Bacteria | 2569 |
| 217 | Ga0070672_100136073 | 3300005543 | Bacteria | 2024 |
| 218 | Ga0070672_100213238 | 3300005543 | Bacteria | 1618 |
| 219 | Ga0070686_100073568 | 3300005544 | Bacteria | 2244 |
| 220 | Ga0070696_100003105 | 3300005546 | Bacteria | 11047 |
| 221 | Ga0070693_100015865 | 3300005547 | Bacteria | 3887 |
| 222 | Ga0070693_100082019 | 3300005547 | Bacteria | 1925 |
| 223 | Ga0070665_100000657 | 3300005548 | Bacteria | 46640 |
| 224 | Ga0070665_100005611 | 3300005548 | Bacteria | 12905 |
| 225 | Ga0070665_100011777 | 3300005548 | Bacteria | 8833 |
| 226 | Ga0070665_100014723 | 3300005548 | Bacteria | 7847 |
| 227 | Ga0070665_100016244 | 3300005548 | Bacteria | 7468 |
| 228 | Ga0070665_100032541 | 3300005548 | Bacteria | 5248 |
| 229 | Ga0070665_100053106 | 3300005548 | Bacteria | 4064 |
| 230 | Ga0070665_100053577 | 3300005548 | Bacteria | 4046 |
| 231 | Ga0070665_100086327 | 3300005548 | Bacteria | 3143 |
| 232 | Ga0070665_100086545 | 3300005548 | Bacteria | 3139 |
| 233 | Ga0070665_100130213 | 3300005548 | Bacteria | 2518 |
| 234 | Ga0070665_100144360 | 3300005548 | Bacteria | 2383 |
| 235 | Ga0068855_100000080 | 3300005563 | Bacteria | 115920 |
| 236 | Ga0068855_100000163 | 3300005563 | Bacteria | 85587 |
| 237 | Ga0068855_100003338 | 3300005563 | Bacteria | 19637 |
| 238 | Ga0068855_100017460 | 3300005563 | Bacteria | 8631 |
| 239 | Ga0068855_100040253 | 3300005563 | Bacteria | 5547 |
| 240 | Ga0068855_100042316 | 3300005563 | Bacteria | 5397 |
| 241 | Ga0068855_100093945 | 3300005563 | Bacteria | 3458 |
| 242 | Ga0068855_100342694 | 3300005563 | Bacteria | 1647 |
| 243 | Ga0070664_100000717 | 3300005564 | Bacteria | 25407 |
| 244 | Ga0070664_100014158 | 3300005564 | Bacteria | 6505 |
| 245 | Ga0070664_100021741 | 3300005564 | Bacteria | 5291 |
| 246 | Ga0070664_100109262 | 3300005564 | Bacteria | 2412 |
| 247 | Ga0070664_100117107 | 3300005564 | Bacteria | 2330 |
| 248 | Ga0068857_100000126 | 3300005577 | Bacteria | 46128 |
| 249 | Ga0068857_100000282 | 3300005577 | Bacteria | 34844 |
| 250 | Ga0068857_100002754 | 3300005577 | Bacteria | 14445 |
| 251 | Ga0068857_100010471 | 3300005577 | Bacteria | 8060 |
| 252 | Ga0068857_100015555 | 3300005577 | Bacteria | 6646 |
| 253 | Ga0068857_100120054 | 3300005577 | Bacteria | 2366 |
| 254 | Ga0068857_100152264 | 3300005577 | Bacteria | 2096 |
| 255 | Ga0068857_100185985 | 3300005577 | Bacteria | 1891 |
| 256 | Ga0068854_100001188 | 3300005578 | Bacteria | 15628 |
| 257 | Ga0068854_100004579 | 3300005578 | Bacteria | 8720 |
| 258 | Ga0068854_100049588 | 3300005578 | Bacteria | 2999 |
| 259 | Ga0068854_100114310 | 3300005578 | Bacteria | 2040 |
| 260 | Ga0068854_100197224 | 3300005578 | Bacteria | 1580 |
| 261 | Ga0068856_100000829 | 3300005614 | Bacteria | 33313 |
| 262 | Ga0068856_100001618 | 3300005614 | Bacteria | 23572 |
| 263 | Ga0068856_100008781 | 3300005614 | Bacteria | 9830 |
| 264 | Ga0068856_100015666 | 3300005614 | Bacteria | 7329 |
| 265 | Ga0068856_100017271 | 3300005614 | Bacteria | 6993 |
| 266 | Ga0068856_100020012 | 3300005614 | Bacteria | 6496 |
| 267 | Ga0068856_100025549 | 3300005614 | Bacteria | 5759 |
| 268 | Ga0068856_100142030 | 3300005614 | Bacteria | 2408 |
| 269 | Ga0068856_100552669 | 3300005614 | Bacteria | 1172 |
| 270 | Ga0068852_100001212 | 3300005616 | Bacteria | 17137 |
| 271 | Ga0068852_100001802 | 3300005616 | Bacteria | 14542 |
| 272 | Ga0068852_100011615 | 3300005616 | Bacteria | 6642 |
| 273 | Ga0068852_100014847 | 3300005616 | Bacteria | 6018 |
| 274 | Ga0068852_100027877 | 3300005616 | Bacteria | 4611 |
| 275 | Ga0068852_100042816 | 3300005616 | Bacteria | 3835 |
| 276 | Ga0068852_100060278 | 3300005616 | Bacteria | 3294 |
| 277 | Ga0068852_100125832 | 3300005616 | Bacteria | 2353 |
| 278 | Ga0068852_100146568 | 3300005616 | Bacteria | 2190 |
| 279 | Ga0068852_100149977 | 3300005616 | Bacteria | 2167 |
| 280 | Ga0068859_100000362 | 3300005617 | Bacteria | 45197 |
| 281 | Ga0068859_100001327 | 3300005617 | Bacteria | 25257 |
| 282 | Ga0068859_100007893 | 3300005617 | Bacteria | 10798 |
| 283 | Ga0068859_100021629 | 3300005617 | Bacteria | 6454 |
| 284 | Ga0068859_100033933 | 3300005617 | Bacteria | 5123 |
| 285 | Ga0068859_100036132 | 3300005617 | Bacteria | 4959 |
| 286 | Ga0068859_100048838 | 3300005617 | Bacteria | 4251 |
| 287 | Ga0068859_100078513 | 3300005617 | Bacteria | 3341 |
| 288 | Ga0068859_100182707 | 3300005617 | Bacteria | 2180 |
| 289 | Ga0068859_100212187 | 3300005617 | Bacteria | 2022 |
| 290 | Ga0068864_100000060 | 3300005618 | Bacteria | 124506 |
| 291 | Ga0068864_100001144 | 3300005618 | Bacteria | 22133 |
| 292 | Ga0068864_100001235 | 3300005618 | Bacteria | 21256 |
| 293 | Ga0068864_100001458 | 3300005618 | Bacteria | 19498 |
| 294 | Ga0068864_100001720 | 3300005618 | Bacteria | 17993 |
| 295 | Ga0068864_100006305 | 3300005618 | Bacteria | 9731 |
| 296 | Ga0068864_100006905 | 3300005618 | Bacteria | 9309 |
| 297 | Ga0068864_100012818 | 3300005618 | Bacteria | 6932 |
| 298 | Ga0068864_100014170 | 3300005618 | Bacteria | 6617 |
| 299 | Ga0068864_100031578 | 3300005618 | Bacteria | 4495 |
| 300 | Ga0068864_100045792 | 3300005618 | Bacteria | 3752 |
| 301 | Ga0068864_100209715 | 3300005618 | Bacteria | 1793 |
| 302 | Ga0068864_100373558 | 3300005618 | Bacteria | 1350 |
| 303 | Ga0068866_10012950 | 3300005718 | Bacteria | 3646 |
| 304 | Ga0068866_10017834 | 3300005718 | Bacteria | 3199 |
| 305 | Ga0068861_100153505 | 3300005719 | Bacteria | 1892 |
| 306 | Ga0068861_100161740 | 3300005719 | Bacteria | 1847 |
| 307 | Ga0068851_10009143 | 3300005834 | Bacteria | 4603 |
| 308 | Ga0068851_10015035 | 3300005834 | Bacteria | 3682 |
| 309 | Ga0068851_10018843 | 3300005834 | Bacteria | 3330 |
| 310 | Ga0068870_10038534 | 3300005840 | Bacteria | 2468 |
| 311 | Ga0068863_100000023 | 3300005841 | Bacteria | 186490 |
| 312 | Ga0068863_100000816 | 3300005841 | Bacteria | 31200 |
| 313 | Ga0068863_100000921 | 3300005841 | Bacteria | 29492 |
| 314 | Ga0068863_100002037 | 3300005841 | Bacteria | 20029 |
| 315 | Ga0068863_100002790 | 3300005841 | Bacteria | 17302 |
| 316 | Ga0068863_100011421 | 3300005841 | Bacteria | 8590 |
| 317 | Ga0068863_100027758 | 3300005841 | Bacteria | 5402 |
| 318 | Ga0068863_100046008 | 3300005841 | Bacteria | 4142 |
| 319 | Ga0068863_100051205 | 3300005841 | Bacteria | 3914 |
| 320 | Ga0068863_100064532 | 3300005841 | Bacteria | 3463 |
| 321 | Ga0068863_100075590 | 3300005841 | Bacteria | 3187 |
| 322 | Ga0068863_100094097 | 3300005841 | Bacteria | 2844 |
| 323 | Ga0068863_100139703 | 3300005841 | Bacteria | 2315 |
| 324 | Ga0068858_100000184 | 3300005842 | Bacteria | 66104 |
| 325 | Ga0068858_100002655 | 3300005842 | Bacteria | 18004 |
| 326 | Ga0068858_100003884 | 3300005842 | Bacteria | 14758 |
| 327 | Ga0068858_100005521 | 3300005842 | Bacteria | 12381 |
| 328 | Ga0068858_100008834 | 3300005842 | Bacteria | 9663 |
| 329 | Ga0068858_100010815 | 3300005842 | Bacteria | 8627 |
| 330 | Ga0068858_100017181 | 3300005842 | Bacteria | 6789 |
| 331 | Ga0068858_100017613 | 3300005842 | Bacteria | 6696 |
| 332 | Ga0068858_100024599 | 3300005842 | Bacteria | 5611 |
| 333 | Ga0068858_100183823 | 3300005842 | Bacteria | 1974 |
| 334 | Ga0068860_100000037 | 3300005843 | Bacteria | 234524 |
| 335 | Ga0068860_100001374 | 3300005843 | Bacteria | 26435 |
| 336 | Ga0068860_100001926 | 3300005843 | Bacteria | 21977 |
| 337 | Ga0068860_100005298 | 3300005843 | Bacteria | 13094 |
| 338 | Ga0068860_100006472 | 3300005843 | Bacteria | 11762 |
| 339 | Ga0068860_100009999 | 3300005843 | Bacteria | 9403 |
| 340 | Ga0068860_100012899 | 3300005843 | Bacteria | 8213 |
| 341 | Ga0068860_100055109 | 3300005843 | Bacteria | 3779 |
| 342 | Ga0068860_100099994 | 3300005843 | Bacteria | 2766 |
| 343 | Ga0068862_100000368 | 3300005844 | Bacteria | 48907 |
| 344 | Ga0068862_100001850 | 3300005844 | Bacteria | 19179 |
| 345 | Ga0068862_100001992 | 3300005844 | Bacteria | 18521 |
| 346 | Ga0068862_100005412 | 3300005844 | Bacteria | 10664 |
| 347 | Ga0068862_100021712 | 3300005844 | Bacteria | 5370 |
| 348 | Ga0068862_100065009 | 3300005844 | Bacteria | 3141 |
| 349 | Ga0068862_100074074 | 3300005844 | Bacteria | 2943 |
| 350 | Ga0068862_100121722 | 3300005844 | Bacteria | 2300 |
| 351 | Ga0068862_100159121 | 3300005844 | Bacteria | 2015 |
| 352 | Ga0068862_100166159 | 3300005844 | Bacteria | 1973 |
| 353 | Ga0068862_100270917 | 3300005844 | Bacteria | 1553 |
| 354 | Ga0081455_10000188 | 3300005937 | Bacteria | 78570 |
| 355 | Ga0081455_10000446 | 3300005937 | Bacteria | 54371 |
| 356 | Ga0081455_10003238 | 3300005937 | Bacteria | 18862 |
| 357 | Ga0081455_10054505 | 3300005937 | Bacteria | 3407 |
| 358 | Ga0081538_10038343 | 3300005981 | Bacteria | 3093 |
| 359 | Ga0081539_10011316 | 3300005985 | Bacteria | 7081 |
| 360 | Ga0070717_10000431 | 3300006028 | Bacteria | 26731 |
| 361 | Ga0070717_10028219 | 3300006028 | Bacteria | 4490 |
| 362 | Ga0070717_10034440 | 3300006028 | Bacteria | 4094 |
| 363 | Ga0075365_10095347 | 3300006038 | Bacteria | 2032 |
| 364 | Ga0075368_10012410 | 3300006042 | Bacteria | 3114 |
| 365 | Ga0070715_10000864 | 3300006163 | Bacteria | 8362 |
| 366 | Ga0070712_100000198 | 3300006175 | Bacteria | 33726 |
| 367 | Ga0070712_100000207 | 3300006175 | Bacteria | 33201 |
| 368 | Ga0070712_100015655 | 3300006175 | Bacteria | 4889 |
| 369 | Ga0075362_10038968 | 3300006177 | Bacteria | 2088 |
| 370 | Ga0075367_10004458 | 3300006178 | Bacteria | 6840 |
| 371 | Ga0075366_10110660 | 3300006195 | Bacteria | 1652 |
| 372 | Ga0097621_100002177 | 3300006237 | Bacteria | 13408 |
| 373 | Ga0097621_100006196 | 3300006237 | Bacteria | 8480 |
| 374 | Ga0097621_100028359 | 3300006237 | Bacteria | 4412 |
| 375 | Ga0097621_100035885 | 3300006237 | Bacteria | 3963 |
| 376 | Ga0097621_100076903 | 3300006237 | Bacteria | 2769 |
| 377 | Ga0097621_100166525 | 3300006237 | Bacteria | 1898 |
| 378 | Ga0097621_100348526 | 3300006237 | Bacteria | 1316 |
| 379 | Ga0068871_100006155 | 3300006358 | Bacteria | 8456 |
| 380 | Ga0068871_100012935 | 3300006358 | Bacteria | 6180 |
| 381 | Ga0068871_100073910 | 3300006358 | Bacteria | 2811 |
| 382 | Ga0068871_100091013 | 3300006358 | Bacteria | 2542 |
| 383 | Ga0068871_100113143 | 3300006358 | Bacteria | 2285 |
| 384 | Ga0068871_100122014 | 3300006358 | Bacteria | 2202 |
| 385 | Ga0068871_100154726 | 3300006358 | Bacteria | 1957 |
| 386 | Ga0068871_100336819 | 3300006358 | Bacteria | 1331 |
| 387 | Ga0075428_100007695 | 3300006844 | Bacteria | 11939 |
| 388 | Ga0075428_100291367 | 3300006844 | Bacteria | 1755 |
| 389 | Ga0075430_100028740 | 3300006846 | Bacteria | 4722 |
| 390 | Ga0075430_100132952 | 3300006846 | Bacteria | 2073 |
| 391 | Ga0075431_100000030 | 3300006847 | Bacteria | 72683 |
| 392 | Ga0075431_100183844 | 3300006847 | Bacteria | 2144 |
| 393 | Ga0075433_10020998 | 3300006852 | Bacteria | 5470 |
| 394 | Ga0075434_100000615 | 3300006871 | Bacteria | 27538 |
| 395 | Ga0075429_100002466 | 3300006880 | Bacteria | 15563 |
| 396 | Ga0068865_100014298 | 3300006881 | Bacteria | 5041 |
| 397 | Ga0068865_100018962 | 3300006881 | Bacteria | 4447 |
| 398 | Ga0068865_100060126 | 3300006881 | Bacteria | 2659 |
| 399 | Ga0068865_100093689 | 3300006881 | Bacteria | 2184 |
| 400 | Ga0068865_100118688 | 3300006881 | Bacteria | 1963 |
| 401 | Ga0068865_100131508 | 3300006881 | Bacteria | 1876 |
| 402 | Ga0075436_100000629 | 3300006914 | Bacteria | 23192 |
| 403 | Ga0097620_100000362 | 3300006931 | Bacteria | 45197 |
| 404 | Ga0097620_100001327 | 3300006931 | Bacteria | 25257 |
| 405 | Ga0097620_100007893 | 3300006931 | Bacteria | 10798 |
| 406 | Ga0097620_100021628 | 3300006931 | Bacteria | 6454 |
| 407 | Ga0097620_100033936 | 3300006931 | Bacteria | 5123 |
| 408 | Ga0097620_100036130 | 3300006931 | Bacteria | 4959 |
| 409 | Ga0097620_100048838 | 3300006931 | Bacteria | 4251 |
| 410 | Ga0097620_100182713 | 3300006931 | Bacteria | 2180 |
| 411 | Ga0097620_100212187 | 3300006931 | Bacteria | 2022 |
| 412 | Ga0079104_1017749 | 3300006946 | Bacteria | 2037 |
| 413 | Ga0075435_100014156 | 3300007076 | Bacteria | 5953 |
| 414 | Ga0075435_100024559 | 3300007076 | Bacteria | 4680 |
| 415 | Ga0075435_100148397 | 3300007076 | Bacteria | 1970 |
| 416 | Ga0105250_10025153 | 3300009092 | Bacteria | 2399 |
| 417 | Ga0105240_10000575 | 3300009093 | Bacteria | 68057 |
| 418 | Ga0105240_10006449 | 3300009093 | Bacteria | 17248 |
| 419 | Ga0105240_10009561 | 3300009093 | Bacteria | 13726 |
| 420 | Ga0105240_10012472 | 3300009093 | Bacteria | 11727 |
| 421 | Ga0105240_10029016 | 3300009093 | Bacteria | 7216 |
| 422 | Ga0105240_10033483 | 3300009093 | Bacteria | 6638 |
| 423 | Ga0105240_10035946 | 3300009093 | Bacteria | 6378 |
| 424 | Ga0105240_10051295 | 3300009093 | Bacteria | 5193 |
| 425 | Ga0105240_10072531 | 3300009093 | Bacteria | 4255 |
| 426 | Ga0105240_10110459 | 3300009093 | Bacteria | 3328 |
| 427 | Ga0105240_10132195 | 3300009093 | Bacteria | 2992 |
| 428 | Ga0105240_10155951 | 3300009093 | Bacteria | 2715 |
| 429 | Ga0105240_10172106 | 3300009093 | Bacteria | 2563 |
| 430 | Ga0105240_10209542 | 3300009093 | Bacteria | 2278 |
| 431 | Ga0105240_10309677 | 3300009093 | Bacteria | 1804 |
| 432 | Ga0105240_10310348 | 3300009093 | Bacteria | 1801 |
| 433 | Ga0105240_10603449 | 3300009093 | Bacteria | 1208 |
| 434 | Ga0111539_10000699 | 3300009094 | Bacteria | 43468 |
| 435 | Ga0111539_10090632 | 3300009094 | Bacteria | 3593 |
| 436 | Ga0111539_10234643 | 3300009094 | Bacteria | 2136 |
| 437 | Ga0111539_10315446 | 3300009094 | Bacteria | 1819 |
| 438 | Ga0111539_10415906 | 3300009094 | Bacteria | 1566 |
| 439 | Ga0105245_10000326 | 3300009098 | Bacteria | 44899 |
| 440 | Ga0105245_10003113 | 3300009098 | Bacteria | 14841 |
| 441 | Ga0105245_10006170 | 3300009098 | Bacteria | 10548 |
| 442 | Ga0105245_10062960 | 3300009098 | Bacteria | 3348 |
| 443 | Ga0105247_10000668 | 3300009101 | Bacteria | 27068 |
| 444 | Ga0105247_10006488 | 3300009101 | Bacteria | 7239 |
| 445 | Ga0105247_10016387 | 3300009101 | Bacteria | 4439 |
| 446 | Ga0105247_10108498 | 3300009101 | Bacteria | 1783 |
| 447 | Ga0114129_10044265 | 3300009147 | Bacteria | 6262 |
| 448 | Ga0114129_10144129 | 3300009147 | Bacteria | 3264 |
| 449 | Ga0114129_10590189 | 3300009147 | Bacteria | 1441 |
| 450 | Ga0105243_10024838 | 3300009148 | Bacteria | 4574 |
| 451 | Ga0105241_10013600 | 3300009174 | Bacteria | 5964 |
| 452 | Ga0105241_10031106 | 3300009174 | Bacteria | 3994 |
| 453 | Ga0105241_10101356 | 3300009174 | Bacteria | 2289 |
| 454 | Ga0105241_10351517 | 3300009174 | Bacteria | 1280 |
| 455 | Ga0105242_10000991 | 3300009176 | Bacteria | 22219 |
| 456 | Ga0105242_10004538 | 3300009176 | Bacteria | 10775 |
| 457 | Ga0105242_10013402 | 3300009176 | Bacteria | 6335 |
| 458 | Ga0105248_10000001 | 3300009177 | Bacteria | 1881304 |
| 459 | Ga0105248_10000123 | 3300009177 | Bacteria | 89301 |
| 460 | Ga0105248_10000159 | 3300009177 | Bacteria | 78504 |
| 461 | Ga0105248_10000516 | 3300009177 | Bacteria | 43895 |
| 462 | Ga0105248_10001489 | 3300009177 | Bacteria | 26067 |
| 463 | Ga0105248_10001737 | 3300009177 | Bacteria | 24220 |
| 464 | Ga0105248_10008337 | 3300009177 | Bacteria | 11388 |
| 465 | Ga0105248_10023976 | 3300009177 | Bacteria | 6783 |
| 466 | Ga0105248_10024334 | 3300009177 | Bacteria | 6733 |
| 467 | Ga0105248_10026848 | 3300009177 | Bacteria | 6404 |
| 468 | Ga0105248_10058452 | 3300009177 | Bacteria | 4331 |
| 469 | Ga0105248_10113116 | 3300009177 | Bacteria | 3061 |
| 470 | Ga0105248_10182660 | 3300009177 | Bacteria | 2363 |
| 471 | Ga0105248_10186208 | 3300009177 | Bacteria | 2339 |
| 472 | Ga0105248_10279034 | 3300009177 | Bacteria | 1881 |
| 473 | Ga0105237_10016895 | 3300009545 | Bacteria | 7572 |
| 474 | Ga0105237_10018114 | 3300009545 | Bacteria | 7291 |
| 475 | Ga0105237_10160027 | 3300009545 | Bacteria | 2250 |
| 476 | Ga0105237_10388158 | 3300009545 | Bacteria | 1401 |
| 477 | Ga0105238_10006259 | 3300009551 | Bacteria | 11826 |
| 478 | Ga0105238_10013529 | 3300009551 | Bacteria | 8239 |
| 479 | Ga0105238_10014921 | 3300009551 | Bacteria | 7864 |
| 480 | Ga0105238_10022470 | 3300009551 | Bacteria | 6428 |
| 481 | Ga0105238_10029292 | 3300009551 | Bacteria | 5609 |
| 482 | Ga0105238_10089598 | 3300009551 | Bacteria | 3063 |
| 483 | Ga0105238_10280028 | 3300009551 | Bacteria | 1649 |
| 484 | Ga0105249_10005221 | 3300009553 | Bacteria | 11206 |
| 485 | Ga0105249_10008214 | 3300009553 | Bacteria | 9094 |
| 486 | Ga0105249_10020199 | 3300009553 | Bacteria | 5953 |
| 487 | Ga0105249_10054338 | 3300009553 | Bacteria | 3662 |
| 488 | Ga0105249_10087387 | 3300009553 | Bacteria | 2909 |
| 489 | Ga0105249_10107216 | 3300009553 | Bacteria | 2637 |
| 490 | Ga0105249_10180266 | 3300009553 | Bacteria | 2055 |
| 491 | Ga0105249_10472483 | 3300009553 | Bacteria | 1295 |
| 492 | Ga0105239_10000221 | 3300010375 | Bacteria | 83919 |
| 493 | Ga0105239_10018893 | 3300010375 | Bacteria | 7615 |
| 494 | Ga0105239_10044346 | 3300010375 | Bacteria | 4876 |
| 495 | Ga0105239_10082240 | 3300010375 | Bacteria | 3545 |
| 496 | Ga0105239_10100766 | 3300010375 | Bacteria | 3195 |
| 497 | Ga0105239_10110588 | 3300010375 | Bacteria | 3046 |
| 498 | Ga0157327_1001018 | 3300012512 | Bacteria | 1663 |
| 499 | Ga0157373_10001328 | 3300013100 | Bacteria | 18939 |
| 500 | Ga0157373_10005545 | 3300013100 | Bacteria | 9463 |
| 501 | Ga0157373_10010426 | 3300013100 | Bacteria | 6836 |
| 502 | Ga0157373_10010771 | 3300013100 | Bacteria | 6729 |
| 503 | Ga0157373_10042515 | 3300013100 | Bacteria | 3247 |
| 504 | Ga0157373_10101482 | 3300013100 | Bacteria | 2024 |
| 505 | Ga0157373_10131181 | 3300013100 | Bacteria | 1762 |
| 506 | Ga0157373_10140085 | 3300013100 | Bacteria | 1701 |
| 507 | Ga0157373_10165370 | 3300013100 | Bacteria | 1557 |
| 508 | Ga0157371_10000784 | 3300013102 | Bacteria | 36573 |
| 509 | Ga0157371_10041345 | 3300013102 | Bacteria | 3290 |
| 510 | Ga0157371_10117260 | 3300013102 | Bacteria | 1892 |
| 511 | Ga0157371_10226202 | 3300013102 | Bacteria | 1344 |
| 512 | Ga0157370_10033453 | 3300013104 | Bacteria | 5013 |
| 513 | Ga0157370_10060396 | 3300013104 | Bacteria | 3599 |
| 514 | Ga0157370_10224077 | 3300013104 | Bacteria | 1741 |
| 515 | Ga0157369_10000385 | 3300013105 | Bacteria | 58590 |
| 516 | Ga0157369_10015115 | 3300013105 | Bacteria | 8712 |
| 517 | Ga0157369_10016270 | 3300013105 | Bacteria | 8373 |
| 518 | Ga0157369_10028551 | 3300013105 | Bacteria | 6174 |
| 519 | Ga0157369_10098254 | 3300013105 | Bacteria | 3122 |
| 520 | Ga0157369_10101663 | 3300013105 | Bacteria | 3063 |
| 521 | Ga0157369_10144238 | 3300013105 | Bacteria | 2518 |
| 522 | Ga0157369_10531001 | 3300013105 | Bacteria | 1217 |
| 523 | Ga0157374_10016363 | 3300013296 | Bacteria | 6514 |
| 524 | Ga0157374_10038823 | 3300013296 | Bacteria | 4379 |
| 525 | Ga0157374_10047960 | 3300013296 | Bacteria | 3962 |
| 526 | Ga0157378_10048179 | 3300013297 | Bacteria | 3789 |
| 527 | Ga0157378_10061412 | 3300013297 | Bacteria | 3353 |
| 528 | Ga0157378_10104811 | 3300013297 | Bacteria | 2585 |
| 529 | Ga0163162_10044909 | 3300013306 | Bacteria | 4427 |
| 530 | Ga0163162_10117588 | 3300013306 | Bacteria | 2760 |
| 531 | Ga0163162_10198346 | 3300013306 | Bacteria | 2136 |
| 532 | Ga0163162_10387446 | 3300013306 | Bacteria | 1531 |
| 533 | Ga0163162_10545758 | 3300013306 | Bacteria | 1288 |
| 534 | Ga0157372_10008989 | 3300013307 | Bacteria | 10620 |
| 535 | Ga0157372_10155586 | 3300013307 | Bacteria | 2640 |
| 536 | Ga0157375_10002431 | 3300013308 | Bacteria | 16131 |
| 537 | Ga0157375_10003764 | 3300013308 | Bacteria | 13151 |
| 538 | Ga0157375_10039336 | 3300013308 | Bacteria | 4552 |
| 539 | Ga0163163_10000338 | 3300014325 | Bacteria | 45226 |
| 540 | Ga0163163_10001060 | 3300014325 | Bacteria | 23333 |
| 541 | Ga0163163_10006099 | 3300014325 | Bacteria | 10496 |
| 542 | Ga0163163_10013742 | 3300014325 | Bacteria | 7419 |
| 543 | Ga0163163_10103120 | 3300014325 | Bacteria | 2877 |
| 544 | Ga0163163_10137440 | 3300014325 | Bacteria | 2485 |
| 545 | Ga0163163_10210444 | 3300014325 | Bacteria | 1994 |
| 546 | Ga0163163_10261292 | 3300014325 | Bacteria | 1782 |
| 547 | Ga0163163_10262561 | 3300014325 | Bacteria | 1778 |
| 548 | Ga0163163_10321634 | 3300014325 | Bacteria | 1601 |
| 549 | Ga0157380_10002546 | 3300014326 | Bacteria | 12305 |
| 550 | Ga0157380_10008597 | 3300014326 | Bacteria | 7297 |
| 551 | Ga0157380_10009442 | 3300014326 | Bacteria | 6988 |
| 552 | Ga0157380_10014739 | 3300014326 | Bacteria | 5723 |
| 553 | Ga0157380_10080210 | 3300014326 | Bacteria | 2667 |
| 554 | Ga0157380_10093079 | 3300014326 | Bacteria | 2492 |
| 555 | Ga0157377_10023595 | 3300014745 | Bacteria | 3262 |
| 556 | Ga0157377_10099818 | 3300014745 | Bacteria | 1727 |
| 557 | Ga0157379_10001118 | 3300014968 | Bacteria | 21939 |
| 558 | Ga0157379_10001552 | 3300014968 | Bacteria | 18894 |
| 559 | Ga0157379_10002249 | 3300014968 | Bacteria | 16076 |
| 560 | Ga0157379_10002695 | 3300014968 | Bacteria | 14972 |
| 561 | Ga0157379_10010858 | 3300014968 | Bacteria | 7940 |
| 562 | Ga0157379_10012631 | 3300014968 | Bacteria | 7378 |
| 563 | Ga0157379_10046072 | 3300014968 | Bacteria | 3892 |
| 564 | Ga0157379_10054531 | 3300014968 | Bacteria | 3572 |
| 565 | Ga0157379_10087356 | 3300014968 | Bacteria | 2796 |
| 566 | Ga0157379_10092777 | 3300014968 | Bacteria | 2709 |
| 567 | Ga0157379_10149029 | 3300014968 | Bacteria | 2110 |
| 568 | Ga0157379_10364823 | 3300014968 | Bacteria | 1324 |
| 569 | Ga0157376_10015671 | 3300014969 | Bacteria | 5733 |
| 570 | Ga0163161_10010609 | 3300017792 | Bacteria | 6378 |
| 571 | Ga0213872_10000095 | 3300021361 | Bacteria | 81971 |
| 572 | Ga0213872_10015461 | 3300021361 | Bacteria | 3546 |
| 573 | Ga0213872_10033658 | 3300021361 | Bacteria | 2348 |
| 574 | Ga0213876_10012133 | 3300021384 | Bacteria | 4591 |
| 575 | Ga0209148_1012167 | 3300025254 | Bacteria | 1580 |
| 576 | Ga0209676_1000019 | 3300025292 | Bacteria | 620012 |
| 577 | Ga0209758_1000036 | 3300025297 | Bacteria | 441671 |
| 578 | Ga0209050_1011605 | 3300025298 | Bacteria | 4151 |
| 579 | Ga0207697_10000584 | 3300025315 | Bacteria | 20797 |
| 580 | Ga0207696_1018269 | 3300025711 | Bacteria | 2305 |
| 581 | Ga0207682_10000453 | 3300025893 | Bacteria | 18893 |
| 582 | Ga0207682_10001897 | 3300025893 | Bacteria | 9495 |
| 583 | Ga0207642_10016122 | 3300025899 | Bacteria | 2806 |
| 584 | Ga0207710_10000722 | 3300025900 | Bacteria | 18297 |
| 585 | Ga0207710_10013135 | 3300025900 | Bacteria | 3488 |
| 586 | Ga0207688_10001613 | 3300025901 | Bacteria | 11897 |
| 587 | Ga0207688_10010810 | 3300025901 | Bacteria | 4967 |
| 588 | Ga0207680_10001404 | 3300025903 | Bacteria | 11397 |
| 589 | Ga0207680_10003774 | 3300025903 | Bacteria | 7133 |
| 590 | Ga0207680_10007639 | 3300025903 | Bacteria | 5281 |
| 591 | Ga0207680_10013386 | 3300025903 | Bacteria | 4212 |
| 592 | Ga0207680_10150050 | 3300025903 | Bacteria | 1553 |
| 593 | Ga0207680_10154525 | 3300025903 | Bacteria | 1533 |
| 594 | Ga0207647_10000575 | 3300025904 | Bacteria | 28658 |
| 595 | Ga0207647_10033358 | 3300025904 | Bacteria | 3297 |
| 596 | Ga0207647_10050223 | 3300025904 | Bacteria | 2583 |
| 597 | Ga0207647_10094731 | 3300025904 | Bacteria | 1778 |
| 598 | Ga0207685_10062992 | 3300025905 | Bacteria | 1476 |
| 599 | Ga0207699_10000598 | 3300025906 | Bacteria | 17752 |
| 600 | Ga0207645_10017137 | 3300025907 | Bacteria | 4785 |
| 601 | Ga0207645_10035085 | 3300025907 | Bacteria | 3221 |
| 602 | Ga0207643_10012861 | 3300025908 | Bacteria | 4524 |
| 603 | Ga0207643_10099665 | 3300025908 | Bacteria | 1703 |
| 604 | Ga0207705_10000059 | 3300025909 | Bacteria | 155683 |
| 605 | Ga0207705_10000260 | 3300025909 | Bacteria | 51366 |
| 606 | Ga0207705_10001692 | 3300025909 | Bacteria | 17538 |
| 607 | Ga0207705_10003911 | 3300025909 | Bacteria | 11328 |
| 608 | Ga0207705_10004275 | 3300025909 | Bacteria | 10816 |
| 609 | Ga0207705_10007630 | 3300025909 | Bacteria | 7956 |
| 610 | Ga0207705_10011851 | 3300025909 | Bacteria | 6300 |
| 611 | Ga0207705_10012858 | 3300025909 | Bacteria | 6043 |
| 612 | Ga0207705_10015880 | 3300025909 | Bacteria | 5407 |
| 613 | Ga0207705_10031663 | 3300025909 | Bacteria | 3776 |
| 614 | Ga0207705_10048019 | 3300025909 | Bacteria | 3070 |
| 615 | Ga0207705_10053153 | 3300025909 | Bacteria | 2917 |
| 616 | Ga0207705_10065689 | 3300025909 | Bacteria | 2623 |
| 617 | Ga0207705_10080162 | 3300025909 | Bacteria | 2378 |
| 618 | Ga0207705_10099364 | 3300025909 | Bacteria | 2139 |
| 619 | Ga0207705_10123701 | 3300025909 | Bacteria | 1921 |
| 620 | Ga0207684_10029412 | 3300025910 | Bacteria | 4679 |
| 621 | Ga0207654_10112503 | 3300025911 | Bacteria | 1696 |
| 622 | Ga0207707_10033485 | 3300025912 | Bacteria | 4496 |
| 623 | Ga0207695_10000012 | 3300025913 | Bacteria | 840961 |
| 624 | Ga0207695_10006706 | 3300025913 | Bacteria | 14858 |
| 625 | Ga0207695_10010547 | 3300025913 | Bacteria | 11299 |
| 626 | Ga0207695_10022543 | 3300025913 | Bacteria | 7145 |
| 627 | Ga0207695_10053694 | 3300025913 | Bacteria | 4212 |
| 628 | Ga0207695_10057609 | 3300025913 | Bacteria | 4036 |
| 629 | Ga0207695_10099801 | 3300025913 | Bacteria | 2900 |
| 630 | Ga0207695_10149758 | 3300025913 | Bacteria | 2273 |
| 631 | Ga0207695_10166656 | 3300025913 | Bacteria | 2131 |
| 632 | Ga0207695_10174746 | 3300025913 | Bacteria | 2071 |
| 633 | Ga0207695_10385441 | 3300025913 | Bacteria | 1287 |
| 634 | Ga0207671_10050560 | 3300025914 | Bacteria | 3078 |
| 635 | Ga0207671_10067584 | 3300025914 | Bacteria | 2662 |
| 636 | Ga0207693_10000007 | 3300025915 | Bacteria | 173735 |
| 637 | Ga0207693_10000052 | 3300025915 | Bacteria | 98125 |
| 638 | Ga0207693_10071651 | 3300025915 | Bacteria | 2713 |
| 639 | Ga0207663_10144738 | 3300025916 | Bacteria | 1660 |
| 640 | Ga0207660_10001180 | 3300025917 | Bacteria | 17506 |
| 641 | Ga0207660_10006502 | 3300025917 | Bacteria | 7584 |
| 642 | Ga0207660_10023204 | 3300025917 | Bacteria | 4189 |
| 643 | Ga0207660_10040427 | 3300025917 | Bacteria | 3265 |
| 644 | Ga0207660_10122121 | 3300025917 | Bacteria | 1974 |
| 645 | Ga0207660_10172271 | 3300025917 | Bacteria | 1676 |
| 646 | Ga0207657_10000031 | 3300025919 | Bacteria | 132167 |
| 647 | Ga0207657_10006220 | 3300025919 | Bacteria | 12407 |
| 648 | Ga0207657_10006383 | 3300025919 | Bacteria | 12243 |
| 649 | Ga0207657_10011019 | 3300025919 | Bacteria | 8987 |
| 650 | Ga0207657_10015222 | 3300025919 | Bacteria | 7460 |
| 651 | Ga0207657_10019527 | 3300025919 | Bacteria | 6433 |
| 652 | Ga0207657_10059926 | 3300025919 | Bacteria | 3268 |
| 653 | Ga0207649_10000112 | 3300025920 | Bacteria | 68472 |
| 654 | Ga0207649_10000394 | 3300025920 | Bacteria | 32788 |
| 655 | Ga0207649_10010690 | 3300025920 | Bacteria | 5046 |
| 656 | Ga0207649_10012162 | 3300025920 | Bacteria | 4766 |
| 657 | Ga0207649_10012291 | 3300025920 | Bacteria | 4745 |
| 658 | Ga0207649_10014810 | 3300025920 | Bacteria | 4374 |
| 659 | Ga0207649_10292555 | 3300025920 | Bacteria | 1188 |
| 660 | Ga0207652_10021635 | 3300025921 | Bacteria | 5308 |
| 661 | Ga0207652_10030193 | 3300025921 | Bacteria | 4536 |
| 662 | Ga0207652_10072121 | 3300025921 | Bacteria | 3002 |
| 663 | Ga0207652_10083464 | 3300025921 | Bacteria | 2798 |
| 664 | Ga0207652_10118948 | 3300025921 | Bacteria | 2349 |
| 665 | Ga0207652_10174123 | 3300025921 | Bacteria | 1932 |
| 666 | Ga0207652_10178769 | 3300025921 | Bacteria | 1906 |
| 667 | Ga0207652_10232298 | 3300025921 | Bacteria | 1662 |
| 668 | Ga0207652_10238570 | 3300025921 | Bacteria | 1639 |
| 669 | Ga0207646_10024779 | 3300025922 | Bacteria | 5492 |
| 670 | Ga0207681_10001333 | 3300025923 | Bacteria | 15917 |
| 671 | Ga0207681_10003060 | 3300025923 | Bacteria | 10510 |
| 672 | Ga0207681_10004527 | 3300025923 | Bacteria | 8560 |
| 673 | Ga0207681_10042703 | 3300025923 | Bacteria | 3030 |
| 674 | Ga0207681_10127386 | 3300025923 | Bacteria | 1877 |
| 675 | Ga0207694_10000055 | 3300025924 | Bacteria | 151308 |
| 676 | Ga0207694_10000526 | 3300025924 | Bacteria | 34586 |
| 677 | Ga0207694_10003458 | 3300025924 | Bacteria | 12548 |
| 678 | Ga0207694_10016498 | 3300025924 | Bacteria | 5577 |
| 679 | Ga0207694_10070641 | 3300025924 | Bacteria | 2728 |
| 680 | Ga0207694_10075804 | 3300025924 | Bacteria | 2633 |
| 681 | Ga0207694_10153788 | 3300025924 | Bacteria | 1854 |
| 682 | Ga0207694_10248405 | 3300025924 | Bacteria | 1455 |
| 683 | Ga0207694_10380643 | 3300025924 | Bacteria | 1171 |
| 684 | Ga0207650_10000350 | 3300025925 | Bacteria | 44409 |
| 685 | Ga0207650_10001366 | 3300025925 | Bacteria | 17614 |
| 686 | Ga0207650_10001451 | 3300025925 | Bacteria | 17072 |
| 687 | Ga0207650_10002939 | 3300025925 | Bacteria | 11756 |
| 688 | Ga0207650_10004442 | 3300025925 | Bacteria | 9580 |
| 689 | Ga0207650_10007278 | 3300025925 | Bacteria | 7536 |
| 690 | Ga0207650_10017000 | 3300025925 | Bacteria | 5089 |
| 691 | Ga0207650_10031318 | 3300025925 | Bacteria | 3840 |
| 692 | Ga0207650_10033598 | 3300025925 | Bacteria | 3716 |
| 693 | Ga0207650_10040601 | 3300025925 | Bacteria | 3405 |
| 694 | Ga0207650_10192941 | 3300025925 | Bacteria | 1628 |
| 695 | Ga0207650_10230402 | 3300025925 | Bacteria | 1494 |
| 696 | Ga0207659_10001907 | 3300025926 | Bacteria | 12372 |
| 697 | Ga0207659_10058251 | 3300025926 | Bacteria | 2773 |
| 698 | Ga0207687_10002526 | 3300025927 | Bacteria | 12416 |
| 699 | Ga0207687_10042578 | 3300025927 | Bacteria | 3125 |
| 700 | Ga0207687_10160106 | 3300025927 | Bacteria | 1727 |
| 701 | Ga0207700_10000015 | 3300025928 | Bacteria | 224772 |
| 702 | Ga0207700_10008151 | 3300025928 | Bacteria | 6470 |
| 703 | Ga0207700_10040061 | 3300025928 | Bacteria | 3416 |
| 704 | Ga0207700_10057060 | 3300025928 | Bacteria | 2943 |
| 705 | Ga0207664_10025456 | 3300025929 | Bacteria | 4459 |
| 706 | Ga0207664_10143186 | 3300025929 | Bacteria | 2025 |
| 707 | Ga0207644_10000153 | 3300025931 | Bacteria | 49585 |
| 708 | Ga0207644_10000954 | 3300025931 | Bacteria | 18456 |
| 709 | Ga0207644_10002867 | 3300025931 | Bacteria | 11114 |
| 710 | Ga0207644_10004200 | 3300025931 | Bacteria | 9349 |
| 711 | Ga0207644_10005195 | 3300025931 | Bacteria | 8508 |
| 712 | Ga0207644_10012164 | 3300025931 | Bacteria | 5711 |
| 713 | Ga0207644_10020767 | 3300025931 | Bacteria | 4467 |
| 714 | Ga0207644_10021850 | 3300025931 | Bacteria | 4363 |
| 715 | Ga0207644_10042575 | 3300025931 | Bacteria | 3219 |
| 716 | Ga0207644_10045488 | 3300025931 | Bacteria | 3123 |
| 717 | Ga0207644_10113914 | 3300025931 | Bacteria | 2048 |
| 718 | Ga0207644_10147139 | 3300025931 | Bacteria | 1819 |
| 719 | Ga0207644_10229199 | 3300025931 | Bacteria | 1475 |
| 720 | Ga0207644_10258551 | 3300025931 | Bacteria | 1391 |
| 721 | Ga0207690_10000132 | 3300025932 | Bacteria | 60604 |
| 722 | Ga0207690_10000382 | 3300025932 | Bacteria | 29300 |
| 723 | Ga0207690_10002417 | 3300025932 | Bacteria | 11291 |
| 724 | Ga0207690_10002543 | 3300025932 | Bacteria | 11026 |
| 725 | Ga0207690_10003206 | 3300025932 | Bacteria | 9816 |
| 726 | Ga0207690_10029122 | 3300025932 | Bacteria | 3508 |
| 727 | Ga0207690_10038583 | 3300025932 | Bacteria | 3110 |
| 728 | Ga0207690_10082426 | 3300025932 | Bacteria | 2250 |
| 729 | Ga0207690_10130552 | 3300025932 | Bacteria | 1838 |
| 730 | Ga0207706_10000028 | 3300025933 | Bacteria | 149092 |
| 731 | Ga0207706_10002096 | 3300025933 | Bacteria | 19514 |
| 732 | Ga0207706_10008999 | 3300025933 | Bacteria | 9191 |
| 733 | Ga0207706_10019364 | 3300025933 | Bacteria | 6122 |
| 734 | Ga0207706_10024040 | 3300025933 | Bacteria | 5467 |
| 735 | Ga0207706_10062316 | 3300025933 | Bacteria | 3284 |
| 736 | Ga0207706_10142626 | 3300025933 | Bacteria | 2107 |
| 737 | Ga0207686_10057220 | 3300025934 | Bacteria | 2454 |
| 738 | Ga0207709_10062657 | 3300025935 | Bacteria | 2328 |
| 739 | Ga0207670_10040007 | 3300025936 | Bacteria | 3075 |
| 740 | Ga0207669_10004855 | 3300025937 | Bacteria | 5968 |
| 741 | Ga0207669_10068479 | 3300025937 | Bacteria | 2217 |
| 742 | Ga0207704_10087298 | 3300025938 | Bacteria | 2037 |
| 743 | Ga0207704_10203047 | 3300025938 | Bacteria | 1452 |
| 744 | Ga0207665_10004501 | 3300025939 | Bacteria | 9248 |
| 745 | Ga0207665_10007716 | 3300025939 | Bacteria | 7103 |
| 746 | Ga0207691_10000143 | 3300025940 | Bacteria | 65645 |
| 747 | Ga0207691_10013013 | 3300025940 | Bacteria | 7967 |
| 748 | Ga0207691_10054524 | 3300025940 | Bacteria | 3646 |
| 749 | Ga0207691_10157892 | 3300025940 | Bacteria | 1991 |
| 750 | Ga0207691_10264950 | 3300025940 | Bacteria | 1481 |
| 751 | Ga0207711_10000001 | 3300025941 | Bacteria | 1325674 |
| 752 | Ga0207711_10000100 | 3300025941 | Bacteria | 91024 |
| 753 | Ga0207711_10000500 | 3300025941 | Bacteria | 40435 |
| 754 | Ga0207711_10001375 | 3300025941 | Bacteria | 22908 |
| 755 | Ga0207711_10001810 | 3300025941 | Bacteria | 19532 |
| 756 | Ga0207711_10002836 | 3300025941 | Bacteria | 15230 |
| 757 | Ga0207711_10005132 | 3300025941 | Bacteria | 11104 |
| 758 | Ga0207711_10005966 | 3300025941 | Bacteria | 10298 |
| 759 | Ga0207711_10006042 | 3300025941 | Bacteria | 10232 |
| 760 | Ga0207711_10009820 | 3300025941 | Bacteria | 7960 |
| 761 | Ga0207711_10016947 | 3300025941 | Bacteria | 6051 |
| 762 | Ga0207711_10030815 | 3300025941 | Bacteria | 4525 |
| 763 | Ga0207711_10114514 | 3300025941 | Bacteria | 2401 |
| 764 | Ga0207711_10204995 | 3300025941 | Bacteria | 1800 |
| 765 | Ga0207689_10000092 | 3300025942 | Bacteria | 73254 |
| 766 | Ga0207689_10006575 | 3300025942 | Bacteria | 10249 |
| 767 | Ga0207689_10168800 | 3300025942 | Bacteria | 1803 |
| 768 | Ga0207689_10245723 | 3300025942 | Bacteria | 1480 |
| 769 | Ga0207661_10003597 | 3300025944 | Bacteria | 10780 |
| 770 | Ga0207661_10004356 | 3300025944 | Bacteria | 9920 |
| 771 | Ga0207661_10051724 | 3300025944 | Bacteria | 3278 |
| 772 | Ga0207661_10072094 | 3300025944 | Bacteria | 2825 |
| 773 | Ga0207661_10312576 | 3300025944 | Bacteria | 1411 |
| 774 | Ga0207679_10000488 | 3300025945 | Bacteria | 27329 |
| 775 | Ga0207679_10004617 | 3300025945 | Bacteria | 8575 |
| 776 | Ga0207679_10007146 | 3300025945 | Bacteria | 7071 |
| 777 | Ga0207679_10061457 | 3300025945 | Bacteria | 2796 |
| 778 | Ga0207679_10072064 | 3300025945 | Bacteria | 2608 |
| 779 | Ga0207679_10088583 | 3300025945 | Bacteria | 2387 |
| 780 | Ga0207679_10124462 | 3300025945 | Bacteria | 2058 |
| 781 | Ga0207679_10291479 | 3300025945 | Bacteria | 1403 |
| 782 | Ga0207667_10000068 | 3300025949 | Bacteria | 180716 |
| 783 | Ga0207667_10003386 | 3300025949 | Bacteria | 19669 |
| 784 | Ga0207667_10006235 | 3300025949 | Bacteria | 14473 |
| 785 | Ga0207667_10014559 | 3300025949 | Bacteria | 8959 |
| 786 | Ga0207667_10019487 | 3300025949 | Bacteria | 7571 |
| 787 | Ga0207667_10023984 | 3300025949 | Bacteria | 6710 |
| 788 | Ga0207667_10041974 | 3300025949 | Bacteria | 4864 |
| 789 | Ga0207667_10043597 | 3300025949 | Bacteria | 4760 |
| 790 | Ga0207667_10068586 | 3300025949 | Bacteria | 3692 |
| 791 | Ga0207667_10070757 | 3300025949 | Bacteria | 3630 |
| 792 | Ga0207667_10113280 | 3300025949 | Bacteria | 2797 |
| 793 | Ga0207667_10115913 | 3300025949 | Bacteria | 2761 |
| 794 | Ga0207667_10127380 | 3300025949 | Bacteria | 2623 |
| 795 | Ga0207651_10000176 | 3300025960 | Bacteria | 27858 |
| 796 | Ga0207651_10004585 | 3300025960 | Bacteria | 6997 |
| 797 | Ga0207651_10006875 | 3300025960 | Bacteria | 6006 |
| 798 | Ga0207651_10007344 | 3300025960 | Bacteria | 5863 |
| 799 | Ga0207651_10008312 | 3300025960 | Bacteria | 5599 |
| 800 | Ga0207651_10014015 | 3300025960 | Bacteria | 4613 |
| 801 | Ga0207651_10072242 | 3300025960 | Bacteria | 2449 |
| 802 | Ga0207651_10119160 | 3300025960 | Bacteria | 1998 |
| 803 | Ga0207712_10000269 | 3300025961 | Bacteria | 50416 |
| 804 | Ga0207712_10001855 | 3300025961 | Bacteria | 13931 |
| 805 | Ga0207712_10003847 | 3300025961 | Bacteria | 9479 |
| 806 | Ga0207712_10032706 | 3300025961 | Bacteria | 3511 |
| 807 | Ga0207668_10000035 | 3300025972 | Bacteria | 119182 |
| 808 | Ga0207668_10000080 | 3300025972 | Bacteria | 72198 |
| 809 | Ga0207668_10024477 | 3300025972 | Bacteria | 3897 |
| 810 | Ga0207668_10046120 | 3300025972 | Bacteria | 2976 |
| 811 | Ga0207668_10071989 | 3300025972 | Bacteria | 2471 |
| 812 | Ga0207640_10000423 | 3300025981 | Bacteria | 26221 |
| 813 | Ga0207640_10000922 | 3300025981 | Bacteria | 16485 |
| 814 | Ga0207640_10001385 | 3300025981 | Bacteria | 13123 |
| 815 | Ga0207640_10191918 | 3300025981 | Bacteria | 1540 |
| 816 | Ga0207658_10000300 | 3300025986 | Bacteria | 51413 |
| 817 | Ga0207658_10000966 | 3300025986 | Bacteria | 23710 |
| 818 | Ga0207658_10010339 | 3300025986 | Bacteria | 6340 |
| 819 | Ga0207658_10014800 | 3300025986 | Bacteria | 5345 |
| 820 | Ga0207658_10016561 | 3300025986 | Bacteria | 5073 |
| 821 | Ga0207658_10033830 | 3300025986 | Bacteria | 3648 |
| 822 | Ga0207658_10045204 | 3300025986 | Bacteria | 3209 |
| 823 | Ga0207658_10058268 | 3300025986 | Bacteria | 2873 |
| 824 | Ga0207658_10183459 | 3300025986 | Bacteria | 1734 |
| 825 | Ga0207677_10051313 | 3300026023 | Bacteria | 2796 |
| 826 | Ga0207677_10057162 | 3300026023 | Bacteria | 2677 |
| 827 | Ga0207703_10000273 | 3300026035 | Bacteria | 57186 |
| 828 | Ga0207703_10000515 | 3300026035 | Bacteria | 39972 |
| 829 | Ga0207703_10001587 | 3300026035 | Bacteria | 20578 |
| 830 | Ga0207703_10003524 | 3300026035 | Bacteria | 13094 |
| 831 | Ga0207703_10004802 | 3300026035 | Bacteria | 11007 |
| 832 | Ga0207703_10007602 | 3300026035 | Bacteria | 8593 |
| 833 | Ga0207703_10014105 | 3300026035 | Bacteria | 6229 |
| 834 | Ga0207703_10016679 | 3300026035 | Bacteria | 5730 |
| 835 | Ga0207703_10022556 | 3300026035 | Bacteria | 4939 |
| 836 | Ga0207703_10032227 | 3300026035 | Bacteria | 4147 |
| 837 | Ga0207703_10099612 | 3300026035 | Bacteria | 2460 |
| 838 | Ga0207703_10156353 | 3300026035 | Bacteria | 1993 |
| 839 | Ga0207703_10163377 | 3300026035 | Bacteria | 1952 |
| 840 | Ga0207639_10000131 | 3300026041 | Bacteria | 54681 |
| 841 | Ga0207639_10000608 | 3300026041 | Bacteria | 24669 |
| 842 | Ga0207639_10005686 | 3300026041 | Bacteria | 8438 |
| 843 | Ga0207639_10018014 | 3300026041 | Bacteria | 5011 |
| 844 | Ga0207639_10022568 | 3300026041 | Bacteria | 4534 |
| 845 | Ga0207639_10036872 | 3300026041 | Bacteria | 3627 |
| 846 | Ga0207639_10041904 | 3300026041 | Bacteria | 3429 |
| 847 | Ga0207678_10005050 | 3300026067 | Bacteria | 11841 |
| 848 | Ga0207678_10036093 | 3300026067 | Bacteria | 4303 |
| 849 | Ga0207678_10067806 | 3300026067 | Bacteria | 3062 |
| 850 | Ga0207678_10077304 | 3300026067 | Bacteria | 2851 |
| 851 | Ga0207678_10231032 | 3300026067 | Bacteria | 1584 |
| 852 | Ga0207678_10234459 | 3300026067 | Bacteria | 1571 |
| 853 | Ga0207702_10000011 | 3300026078 | Bacteria | 284514 |
| 854 | Ga0207702_10000247 | 3300026078 | Bacteria | 62873 |
| 855 | Ga0207702_10000465 | 3300026078 | Bacteria | 45960 |
| 856 | Ga0207702_10004072 | 3300026078 | Bacteria | 13122 |
| 857 | Ga0207702_10011347 | 3300026078 | Bacteria | 7429 |
| 858 | Ga0207702_10015773 | 3300026078 | Bacteria | 6255 |
| 859 | Ga0207702_10027235 | 3300026078 | Bacteria | 4747 |
| 860 | Ga0207702_10042865 | 3300026078 | Bacteria | 3798 |
| 861 | Ga0207702_10066763 | 3300026078 | Bacteria | 3085 |
| 862 | Ga0207702_10082576 | 3300026078 | Bacteria | 2794 |
| 863 | Ga0207702_10108242 | 3300026078 | Bacteria | 2466 |
| 864 | Ga0207702_10138457 | 3300026078 | Bacteria | 2199 |
| 865 | Ga0207702_10153119 | 3300026078 | Bacteria | 2099 |
| 866 | Ga0207641_10000067 | 3300026088 | Bacteria | 155379 |
| 867 | Ga0207641_10000221 | 3300026088 | Bacteria | 74390 |
| 868 | Ga0207641_10003540 | 3300026088 | Bacteria | 13816 |
| 869 | Ga0207641_10005042 | 3300026088 | Bacteria | 11314 |
| 870 | Ga0207641_10005367 | 3300026088 | Bacteria | 10945 |
| 871 | Ga0207641_10011553 | 3300026088 | Bacteria | 7247 |
| 872 | Ga0207641_10013846 | 3300026088 | Bacteria | 6616 |
| 873 | Ga0207641_10031905 | 3300026088 | Bacteria | 4371 |
| 874 | Ga0207641_10036437 | 3300026088 | Bacteria | 4106 |
| 875 | Ga0207641_10051295 | 3300026088 | Bacteria | 3493 |
| 876 | Ga0207641_10051908 | 3300026088 | Bacteria | 3472 |
| 877 | Ga0207641_10064790 | 3300026088 | Bacteria | 3124 |
| 878 | Ga0207641_10344348 | 3300026088 | Bacteria | 1419 |
| 879 | Ga0207648_10010642 | 3300026089 | Bacteria | 8698 |
| 880 | Ga0207648_10011747 | 3300026089 | Bacteria | 8235 |
| 881 | Ga0207648_10027465 | 3300026089 | Bacteria | 5051 |
| 882 | Ga0207676_10000501 | 3300026095 | Bacteria | 33019 |
| 883 | Ga0207676_10000970 | 3300026095 | Bacteria | 22157 |
| 884 | Ga0207676_10002026 | 3300026095 | Bacteria | 14724 |
| 885 | Ga0207676_10003162 | 3300026095 | Bacteria | 11751 |
| 886 | Ga0207676_10004385 | 3300026095 | Bacteria | 9979 |
| 887 | Ga0207676_10019165 | 3300026095 | Bacteria | 4986 |
| 888 | Ga0207676_10135140 | 3300026095 | Bacteria | 2103 |
| 889 | Ga0207676_10232763 | 3300026095 | Bacteria | 1648 |
| 890 | Ga0207676_10444329 | 3300026095 | Bacteria | 1221 |
| 891 | Ga0207674_10000002 | 3300026116 | Bacteria | 279738 |
| 892 | Ga0207674_10000289 | 3300026116 | Bacteria | 63604 |
| 893 | Ga0207674_10002652 | 3300026116 | Bacteria | 22343 |
| 894 | Ga0207674_10006972 | 3300026116 | Bacteria | 13225 |
| 895 | Ga0207674_10020324 | 3300026116 | Bacteria | 7175 |
| 896 | Ga0207674_10045599 | 3300026116 | Bacteria | 4508 |
| 897 | Ga0207674_10052612 | 3300026116 | Bacteria | 4153 |
| 898 | Ga0207674_10289773 | 3300026116 | Bacteria | 1586 |
| 899 | Ga0207675_100001358 | 3300026118 | Bacteria | 24514 |
| 900 | Ga0207675_100010615 | 3300026118 | Bacteria | 8626 |
| 901 | Ga0207675_100070549 | 3300026118 | Bacteria | 3266 |
| 902 | Ga0207675_100100232 | 3300026118 | Bacteria | 2728 |
| 903 | Ga0207675_100215026 | 3300026118 | Bacteria | 1850 |
| 904 | Ga0207675_100341589 | 3300026118 | Bacteria | 1466 |
| 905 | Ga0207683_10005080 | 3300026121 | Bacteria | 11290 |
| 906 | Ga0207683_10007284 | 3300026121 | Bacteria | 9482 |
| 907 | Ga0207683_10091340 | 3300026121 | Bacteria | 2712 |
| 908 | Ga0207698_10000944 | 3300026142 | Bacteria | 16887 |
| 909 | Ga0207698_10001888 | 3300026142 | Bacteria | 12271 |
| 910 | Ga0207698_10001974 | 3300026142 | Bacteria | 12073 |
| 911 | Ga0207698_10025187 | 3300026142 | Bacteria | 4186 |
| 912 | Ga0207698_10028417 | 3300026142 | Bacteria | 3987 |
| 913 | Ga0207698_10065494 | 3300026142 | Bacteria | 2854 |
| 914 | Ga0207698_10138293 | 3300026142 | Bacteria | 2093 |
| 915 | Ga0207698_10221799 | 3300026142 | Bacteria | 1709 |
| 916 | Ga0209371_1001305 | 3300027312 | Bacteria | 17451 |
| 917 | Ga0209999_1001545 | 3300027543 | Bacteria | 3954 |
| 918 | Ga0210002_1001847 | 3300027617 | Bacteria | 3020 |
| 919 | Ga0209983_1002070 | 3300027665 | Bacteria | 4423 |
| 920 | Ga0209983_1005542 | 3300027665 | Bacteria | 2609 |
| 921 | Ga0209971_1020083 | 3300027682 | Bacteria | 1587 |
| 922 | Ga0209974_10005564 | 3300027876 | Bacteria | 4426 |
| 923 | Ga0207428_10003010 | 3300027907 | Bacteria | 16626 |
| 924 | Ga0207428_10018693 | 3300027907 | Bacteria | 5915 |
| 925 | Ga0265354_1002230 | 3300028016 | Bacteria | 2462 |
| 926 | Ga0265356_1002140 | 3300028017 | Bacteria | 2706 |
| 927 | Ga0268266_10000003 | 3300028379 | Bacteria | 1701703 |
| 928 | Ga0268266_10000433 | 3300028379 | Bacteria | 62887 |
| 929 | Ga0268266_10012368 | 3300028379 | Bacteria | 7378 |
| 930 | Ga0268266_10022881 | 3300028379 | Bacteria | 5318 |
| 931 | Ga0268266_10126578 | 3300028379 | Bacteria | 2281 |
| 932 | Ga0268266_10154045 | 3300028379 | Bacteria | 2074 |
| 933 | Ga0268266_10156822 | 3300028379 | Bacteria | 2057 |
| 934 | Ga0268265_10001127 | 3300028380 | Bacteria | 23603 |
| 935 | Ga0268265_10004921 | 3300028380 | Bacteria | 9185 |
| 936 | Ga0268265_10017295 | 3300028380 | Bacteria | 4972 |
| 937 | Ga0268265_10020623 | 3300028380 | Bacteria | 4603 |
| 938 | Ga0268265_10023115 | 3300028380 | Bacteria | 4378 |
| 939 | Ga0268265_10024930 | 3300028380 | Bacteria | 4239 |
| 940 | Ga0268265_10073794 | 3300028380 | Bacteria | 2666 |
| 941 | Ga0268265_10134573 | 3300028380 | Bacteria | 2060 |
| 942 | Ga0268265_10178525 | 3300028380 | Bacteria | 1822 |
| 943 | Ga0268265_10253489 | 3300028380 | Bacteria | 1560 |
| 944 | Ga0268264_10000002 | 3300028381 | Bacteria | 1153045 |
| 945 | Ga0268264_10000211 | 3300028381 | Bacteria | 117108 |
| 946 | Ga0268264_10001360 | 3300028381 | Bacteria | 22913 |
| 947 | Ga0268264_10001461 | 3300028381 | Bacteria | 22084 |
| 948 | Ga0268264_10005259 | 3300028381 | Bacteria | 10956 |
| 949 | Ga0268264_10006022 | 3300028381 | Bacteria | 10262 |
| 950 | Ga0268264_10016792 | 3300028381 | Bacteria | 5990 |
| 951 | Ga0268264_10022226 | 3300028381 | Bacteria | 5178 |
| 952 | Ga0268264_10022679 | 3300028381 | Bacteria | 5123 |
| 953 | Ga0268264_10139291 | 3300028381 | Bacteria | 2161 |
| 954 | Ga0265334_10027542 | 3300028573 | Bacteria | 2289 |
| 955 | Ga0265338_10027623 | 3300028800 | Bacteria | 5688 |
| 956 | Ga0265338_10045428 | 3300028800 | Bacteria | 4039 |
| 957 | Ga0265338_10092279 | 3300028800 | Bacteria | 2498 |
| 958 | Ga0265338_10202534 | 3300028800 | Bacteria | 1496 |
| 959 | Ga0307511_10000702 | 3300030521 | Bacteria | 35747 |
| 960 | Ga0307511_10019143 | 3300030521 | Bacteria | 6521 |
| 961 | Ga0307511_10041367 | 3300030521 | Bacteria | 3893 |
| 962 | Ga0265330_10051134 | 3300031235 | Bacteria | 1812 |
| 963 | Ga0265325_10012767 | 3300031241 | Bacteria | 4794 |
| 964 | Ga0265325_10024044 | 3300031241 | Bacteria | 3317 |
| 965 | Ga0265340_10000057 | 3300031247 | Bacteria | 51264 |
| 966 | Ga0265340_10004434 | 3300031247 | Bacteria | 7842 |
| 967 | Ga0265339_10056129 | 3300031249 | Bacteria | 2133 |
| 968 | Ga0265331_10000003 | 3300031250 | Bacteria | 499358 |
| 969 | Ga0265331_10000699 | 3300031250 | Bacteria | 28634 |
| 970 | Ga0265331_10005579 | 3300031250 | Bacteria | 7578 |
| 971 | Ga0265331_10047123 | 3300031250 | Bacteria | 2075 |
| 972 | Ga0265327_10000150 | 3300031251 | Bacteria | 150039 |
| 973 | Ga0265327_10004373 | 3300031251 | Bacteria | 12554 |
| 974 | Ga0265316_10001355 | 3300031344 | Bacteria | 26360 |
| 975 | Ga0265316_10053447 | 3300031344 | Bacteria | 3165 |
| 976 | Ga0265316_10070827 | 3300031344 | Bacteria | 2689 |
| 977 | Ga0265316_10089788 | 3300031344 | Bacteria | 2344 |
| 978 | Ga0265316_10188160 | 3300031344 | Bacteria | 1535 |
| 979 | Ga0307513_10000053 | 3300031456 | Bacteria | 149356 |
| 980 | Ga0307513_10007003 | 3300031456 | Bacteria | 14668 |
| 981 | Ga0307513_10016636 | 3300031456 | Bacteria | 8858 |
| 982 | Ga0307513_10021089 | 3300031456 | Bacteria | 7698 |
| 983 | Ga0307513_10023455 | 3300031456 | Bacteria | 7207 |
| 984 | Ga0307513_10030889 | 3300031456 | Bacteria | 6077 |
| 985 | Ga0307513_10036720 | 3300031456 | Bacteria | 5461 |
| 986 | Ga0307513_10243362 | 3300031456 | Bacteria | 1602 |
| 987 | Ga0307509_10000080 | 3300031507 | Bacteria | 134551 |
| 988 | Ga0307509_10005263 | 3300031507 | Bacteria | 18116 |
| 989 | Ga0307408_100000027 | 3300031548 | Bacteria | 261506 |
| 990 | Ga0307408_100025262 | 3300031548 | Bacteria | 4067 |
| 991 | Ga0307408_100028628 | 3300031548 | Bacteria | 3852 |
| 992 | Ga0307408_100053473 | 3300031548 | Bacteria | 2916 |
| 993 | Ga0307408_100056503 | 3300031548 | Bacteria | 2846 |
| 994 | Ga0307408_100156577 | 3300031548 | Bacteria | 1805 |
| 995 | Ga0307408_100191565 | 3300031548 | Bacteria | 1648 |
| 996 | Ga0307408_100341720 | 3300031548 | Bacteria | 1267 |
| 997 | Ga0265313_10008061 | 3300031595 | Bacteria | 7056 |
| 998 | Ga0265313_10091213 | 3300031595 | Bacteria | 1368 |
| 999 | Ga0307508_10100667 | 3300031616 | Bacteria | 2485 |
| 1000 | Ga0307514_10177556 | 3300031649 | Bacteria | 1379 |
| 1001 | Ga0316579_10043800 | 3300031691 | Bacteria | 2083 |
| 1002 | Ga0265314_10000144 | 3300031711 | Bacteria | 107465 |
| 1003 | Ga0265314_10013734 | 3300031711 | Bacteria | 6527 |
| 1004 | Ga0265342_10003874 | 3300031712 | Bacteria | 12037 |
| 1005 | Ga0265342_10079805 | 3300031712 | Bacteria | 1892 |
| 1006 | Ga0316576_10001484 | 3300031727 | Bacteria | 12634 |
| 1007 | Ga0316576_10114326 | 3300031727 | Bacteria | 2024 |
| 1008 | Ga0316578_10081503 | 3300031728 | Bacteria | 1925 |
| 1009 | Ga0307516_10000373 | 3300031730 | Bacteria | 58684 |
| 1010 | Ga0307405_10004908 | 3300031731 | Bacteria | 6386 |
| 1011 | Ga0307405_10006394 | 3300031731 | Bacteria | 5793 |
| 1012 | Ga0307405_10007913 | 3300031731 | Bacteria | 5356 |
| 1013 | Ga0307405_10017942 | 3300031731 | Bacteria | 3894 |
| 1014 | Ga0307405_10019010 | 3300031731 | Bacteria | 3805 |
| 1015 | Ga0307405_10024043 | 3300031731 | Bacteria | 3474 |
| 1016 | Ga0307405_10031889 | 3300031731 | Bacteria | 3107 |
| 1017 | Ga0307405_10092545 | 3300031731 | Bacteria | 2006 |
| 1018 | Ga0307405_10138807 | 3300031731 | Bacteria | 1691 |
| 1019 | Ga0307405_10155671 | 3300031731 | Bacteria | 1612 |
| 1020 | Ga0316577_10021927 | 3300031733 | Bacteria | 3544 |
| 1021 | Ga0307413_10002489 | 3300031824 | Bacteria | 7505 |
| 1022 | Ga0307413_10002573 | 3300031824 | Bacteria | 7414 |
| 1023 | Ga0307413_10005899 | 3300031824 | Bacteria | 5531 |
| 1024 | Ga0307413_10009767 | 3300031824 | Bacteria | 4610 |
| 1025 | Ga0307413_10010047 | 3300031824 | Bacteria | 4564 |
| 1026 | Ga0307413_10014725 | 3300031824 | Bacteria | 3983 |
| 1027 | Ga0307413_10039773 | 3300031824 | Bacteria | 2738 |
| 1028 | Ga0307413_10054577 | 3300031824 | Bacteria | 2425 |
| 1029 | Ga0307413_10060391 | 3300031824 | Bacteria | 2334 |
| 1030 | Ga0307413_10090775 | 3300031824 | Bacteria | 1988 |
| 1031 | Ga0307413_10099200 | 3300031824 | Bacteria | 1919 |
| 1032 | Ga0307413_10252446 | 3300031824 | Bacteria | 1309 |
| 1033 | Ga0307410_10000175 | 3300031852 | Bacteria | 23582 |
| 1034 | Ga0307410_10000545 | 3300031852 | Bacteria | 15485 |
| 1035 | Ga0307410_10001188 | 3300031852 | Bacteria | 11522 |
| 1036 | Ga0307410_10003532 | 3300031852 | Bacteria | 7862 |
| 1037 | Ga0307410_10006146 | 3300031852 | Bacteria | 6445 |
| 1038 | Ga0307410_10010793 | 3300031852 | Bacteria | 5197 |
| 1039 | Ga0307410_10012638 | 3300031852 | Bacteria | 4891 |
| 1040 | Ga0307410_10034934 | 3300031852 | Bacteria | 3261 |
| 1041 | Ga0307410_10051814 | 3300031852 | Bacteria | 2768 |
| 1042 | Ga0307410_10073487 | 3300031852 | Bacteria | 2378 |
| 1043 | Ga0307410_10088707 | 3300031852 | Bacteria | 2190 |
| 1044 | Ga0307410_10112788 | 3300031852 | Bacteria | 1969 |
| 1045 | Ga0307410_10152653 | 3300031852 | Bacteria | 1721 |
| 1046 | Ga0307410_10333818 | 3300031852 | Bacteria | 1206 |
| 1047 | Ga0307406_10015494 | 3300031901 | Bacteria | 4414 |
| 1048 | Ga0307406_10021032 | 3300031901 | Bacteria | 3853 |
| 1049 | Ga0307406_10028133 | 3300031901 | Bacteria | 3394 |
| 1050 | Ga0307406_10038973 | 3300031901 | Bacteria | 2944 |
| 1051 | Ga0307406_10143549 | 3300031901 | Bacteria | 1693 |
| 1052 | Ga0307407_10000303 | 3300031903 | Bacteria | 14559 |
| 1053 | Ga0307407_10003997 | 3300031903 | Bacteria | 6168 |
| 1054 | Ga0307407_10004468 | 3300031903 | Bacteria | 5943 |
| 1055 | Ga0307407_10006848 | 3300031903 | Bacteria | 5110 |
| 1056 | Ga0307407_10012812 | 3300031903 | Bacteria | 4047 |
| 1057 | Ga0307407_10049138 | 3300031903 | Bacteria | 2406 |
| 1058 | Ga0307407_10056095 | 3300031903 | Bacteria | 2279 |
| 1059 | Ga0307407_10136796 | 3300031903 | Bacteria | 1575 |
| 1060 | Ga0307412_10006021 | 3300031911 | Bacteria | 6833 |
| 1061 | Ga0307412_10009278 | 3300031911 | Bacteria | 5641 |
| 1062 | Ga0307412_10028265 | 3300031911 | Bacteria | 3506 |
| 1063 | Ga0307412_10032337 | 3300031911 | Bacteria | 3314 |
| 1064 | Ga0307412_10076487 | 3300031911 | Bacteria | 2299 |
| 1065 | Ga0307412_10081648 | 3300031911 | Bacteria | 2236 |
| 1066 | Ga0307412_10177723 | 3300031911 | Bacteria | 1597 |
| 1067 | Ga0307409_100001912 | 3300031995 | Bacteria | 10625 |
| 1068 | Ga0307409_100005400 | 3300031995 | Bacteria | 7346 |
| 1069 | Ga0307409_100007431 | 3300031995 | Bacteria | 6553 |
| 1070 | Ga0307409_100007713 | 3300031995 | Bacteria | 6467 |
| 1071 | Ga0307409_100008635 | 3300031995 | Bacteria | 6197 |
| 1072 | Ga0307409_100009145 | 3300031995 | Bacteria | 6071 |
| 1073 | Ga0307409_100014898 | 3300031995 | Bacteria | 5078 |
| 1074 | Ga0307409_100043833 | 3300031995 | Bacteria | 3364 |
| 1075 | Ga0307409_100045472 | 3300031995 | Bacteria | 3314 |
| 1076 | Ga0307409_100063632 | 3300031995 | Bacteria | 2893 |
| 1077 | Ga0307409_100084021 | 3300031995 | Bacteria | 2583 |
| 1078 | Ga0307409_100113299 | 3300031995 | Bacteria | 2279 |
| 1079 | Ga0307409_100147805 | 3300031995 | Bacteria | 2035 |
| 1080 | Ga0307409_100207302 | 3300031995 | Bacteria | 1759 |
| 1081 | Ga0307409_100209835 | 3300031995 | Bacteria | 1749 |
| 1082 | Ga0307416_100001201 | 3300032002 | Bacteria | 13940 |
| 1083 | Ga0307416_100006793 | 3300032002 | Bacteria | 7195 |
| 1084 | Ga0307416_100026619 | 3300032002 | Bacteria | 4264 |
| 1085 | Ga0307416_100037169 | 3300032002 | Bacteria | 3744 |
| 1086 | Ga0307416_100041564 | 3300032002 | Bacteria | 3582 |
| 1087 | Ga0307416_100117585 | 3300032002 | Bacteria | 2360 |
| 1088 | Ga0307416_100124866 | 3300032002 | Bacteria | 2303 |
| 1089 | Ga0307416_100148304 | 3300032002 | Bacteria | 2146 |
| 1090 | Ga0307416_100163898 | 3300032002 | Bacteria | 2059 |
| 1091 | Ga0307416_100249106 | 3300032002 | Bacteria | 1727 |
| 1092 | Ga0307416_100392345 | 3300032002 | Bacteria | 1422 |
| 1093 | Ga0307414_10000602 | 3300032004 | Bacteria | 18524 |
| 1094 | Ga0307414_10010053 | 3300032004 | Bacteria | 5466 |
| 1095 | Ga0307414_10013053 | 3300032004 | Bacteria | 4935 |
| 1096 | Ga0307414_10014003 | 3300032004 | Bacteria | 4792 |
| 1097 | Ga0307414_10014223 | 3300032004 | Bacteria | 4762 |
| 1098 | Ga0307414_10015455 | 3300032004 | Bacteria | 4608 |
| 1099 | Ga0307414_10022036 | 3300032004 | Bacteria | 4010 |
| 1100 | Ga0307414_10023693 | 3300032004 | Bacteria | 3898 |
| 1101 | Ga0307414_10099754 | 3300032004 | Bacteria | 2182 |
| 1102 | Ga0307414_10101626 | 3300032004 | Bacteria | 2165 |
| 1103 | Ga0307414_10102648 | 3300032004 | Bacteria | 2155 |
| 1104 | Ga0307414_10107239 | 3300032004 | Bacteria | 2116 |
| 1105 | Ga0307414_10152594 | 3300032004 | Bacteria | 1824 |
| 1106 | Ga0307414_10176785 | 3300032004 | Bacteria | 1712 |
| 1107 | Ga0307414_10312943 | 3300032004 | Bacteria | 1333 |
| 1108 | Ga0307411_10001321 | 3300032005 | Bacteria | 9978 |
| 1109 | Ga0307411_10001648 | 3300032005 | Bacteria | 9321 |
| 1110 | Ga0307411_10003440 | 3300032005 | Bacteria | 7343 |
| 1111 | Ga0307411_10004197 | 3300032005 | Bacteria | 6848 |
| 1112 | Ga0307411_10017429 | 3300032005 | Bacteria | 4092 |
| 1113 | Ga0307411_10020865 | 3300032005 | Bacteria | 3820 |
| 1114 | Ga0307411_10029260 | 3300032005 | Bacteria | 3360 |
| 1115 | Ga0307411_10029612 | 3300032005 | Bacteria | 3346 |
| 1116 | Ga0307411_10039979 | 3300032005 | Bacteria | 2971 |
| 1117 | Ga0307411_10047799 | 3300032005 | Bacteria | 2768 |
| 1118 | Ga0307411_10098570 | 3300032005 | Bacteria | 2060 |
| 1119 | Ga0307411_10127528 | 3300032005 | Bacteria | 1853 |
| 1120 | Ga0307411_10133798 | 3300032005 | Bacteria | 1816 |
| 1121 | Ga0307411_10204037 | 3300032005 | Bacteria | 1521 |
| 1122 | Ga0307411_10264840 | 3300032005 | Bacteria | 1359 |
| 1123 | Ga0307415_100000189 | 3300032126 | Bacteria | 27332 |
| 1124 | Ga0307415_100015269 | 3300032126 | Bacteria | 4541 |
| 1125 | Ga0307415_100020507 | 3300032126 | Bacteria | 4038 |
| 1126 | Ga0307415_100033778 | 3300032126 | Bacteria | 3322 |
| 1127 | Ga0307415_100087554 | 3300032126 | Bacteria | 2244 |
| 1128 | Ga0307415_100119412 | 3300032126 | Bacteria | 1973 |
| 1129 | Ga0307415_100121330 | 3300032126 | Bacteria | 1960 |
| 1130 | Ga0373934_0072203 | 3300035086 | Bacteria | 1382 |
| 1131 | Ga0373923_0001884 | 3300035111 | Bacteria | 6252 |
| 1132 | Ga0373936_0003587 | 3300035113 | Bacteria | 5836 |
| 1133 | Ga0373939_0034685 | 3300035114 | Bacteria | 1482 |
| 1134 | Ga0373939_0046249 | 3300035114 | Bacteria | 1332 |
| 1135 | Ga0373956_0089620 | 3300035119 | Bacteria | 1418 |
| 1136 | Ga0373943_0004047 | 3300035170 | Bacteria | 6659 |
| 1137 | Ga0373946_0026404 | 3300035171 | Bacteria | 2291 |
| 1138 | Ga0373946_0031247 | 3300035171 | Bacteria | 2131 |
| 1139 | Ga0373955_0004423 | 3300035172 | Bacteria | 6225 |
| 1140 | Ga0373955_0100628 | 3300035172 | Bacteria | 1659 |
| 1141 | Ga0316574_0000061 | 3300035398 | Bacteria | 28446 |
| 1142 | Ga0316574_0125439 | 3300035398 | Bacteria | 1650 |
| 1143 | Ga0373931_0031688 | 3300035691 | Bacteria | 2730 |
| 1144 | Ga0373935_0074051 | 3300035692 | Bacteria | 2201 |
| 1145 | Ga0373935_0131372 | 3300035692 | Bacteria | 1683 |
| 1146 | Ga0373927_0000579 | 3300035695 | Bacteria | 27881 |
| 1147 | Ga0373927_0023218 | 3300035695 | Bacteria | 4063 |
| 1148 | Ga0373927_0083674 | 3300035695 | Bacteria | 2069 |
| 1149 | Ga0373933_0006446 | 3300035724 | Bacteria | 6393 |
| 1150 | Ga0373933_0109626 | 3300035724 | Bacteria | 1721 |
| 1151 | Ga0373947_0003842 | 3300035725 | Bacteria | 8843 |
| 1152 | Ga0373947_0009709 | 3300035725 | Bacteria | 5522 |
| 1153 | Ga0373937_0068538 | 3300036401 | Bacteria | 3271 |
| 1154 | Ga0373937_0075907 | 3300036401 | Bacteria | 3103 |
| 1155 | Ga0373937_0163606 | 3300036401 | Bacteria | 2086 |
| 1156 | Ga0373937_0300529 | 3300036401 | Bacteria | 1517 |
| 1157 | Ga0316582_0182571 | 3300036647 | Bacteria | 1428 |
| 1158 | Ga0316584_0238252 | 3300036712 | Bacteria | 1332 |
| 1159 | Ga0373925_0000032 | 3300037068 | Bacteria | 145357 |
| 1160 | Ga0373925_0299766 | 3300037068 | Bacteria | 1297 |
| 1161 | Ga0395899_0000706 | 3300037312 | Bacteria | 33556 |
| 1162 | Ga0395899_0003405 | 3300037312 | Bacteria | 12616 |
| 1163 | Ga0395899_0009462 | 3300037312 | Bacteria | 7479 |
| 1164 | Ga0395899_0012861 | 3300037312 | Bacteria | 6410 |
| 1165 | Ga0395899_0025525 | 3300037312 | Bacteria | 4460 |
| 1166 | Ga0395899_0033002 | 3300037312 | Bacteria | 3890 |
| 1167 | Ga0395899_0033147 | 3300037312 | Bacteria | 3880 |
| 1168 | Ga0395899_0041887 | 3300037312 | Bacteria | 3420 |
| 1169 | Ga0395899_0067424 | 3300037312 | Bacteria | 2625 |
| 1170 | Ga0395899_0073673 | 3300037312 | Bacteria | 2496 |
| 1171 | Ga0395899_0078064 | 3300037312 | Bacteria | 2414 |
| 1172 | Ga0395899_0105689 | 3300037312 | Bacteria | 2027 |
| 1173 | Ga0395899_0158320 | 3300037312 | Bacteria | 1601 |
| 1174 | Ga0395899_0161518 | 3300037312 | Bacteria | 1582 |
| 1175 | Ga0395900_0000161 | 3300037418 | Bacteria | 110637 |
| 1176 | Ga0395900_0000564 | 3300037418 | Bacteria | 51387 |
| 1177 | Ga0395900_0001237 | 3300037418 | Bacteria | 31404 |
| 1178 | Ga0395900_0002796 | 3300037418 | Bacteria | 19064 |
| 1179 | Ga0395900_0003293 | 3300037418 | Bacteria | 17476 |
| 1180 | Ga0395900_0008912 | 3300037418 | Bacteria | 10293 |
| 1181 | Ga0395900_0009593 | 3300037418 | Bacteria | 9923 |
| 1182 | Ga0395900_0010430 | 3300037418 | Bacteria | 9503 |
| 1183 | Ga0395900_0012370 | 3300037418 | Bacteria | 8733 |
| 1184 | Ga0395900_0012720 | 3300037418 | Bacteria | 8600 |
| 1185 | Ga0395900_0013337 | 3300037418 | Bacteria | 8401 |
| 1186 | Ga0395900_0014134 | 3300037418 | Bacteria | 8151 |
| 1187 | Ga0395900_0017498 | 3300037418 | Bacteria | 7315 |
| 1188 | Ga0395900_0027408 | 3300037418 | Bacteria | 5835 |
| 1189 | Ga0395900_0029417 | 3300037418 | Bacteria | 5635 |
| 1190 | Ga0395900_0030364 | 3300037418 | Bacteria | 5549 |
| 1191 | Ga0395900_0031449 | 3300037418 | Bacteria | 5453 |
| 1192 | Ga0395900_0040892 | 3300037418 | Bacteria | 4779 |
| 1193 | Ga0395900_0046022 | 3300037418 | Bacteria | 4493 |
| 1194 | Ga0395900_0050105 | 3300037418 | Bacteria | 4301 |
| 1195 | Ga0395900_0053986 | 3300037418 | Bacteria | 4136 |
| 1196 | Ga0395900_0065795 | 3300037418 | Bacteria | 3724 |
| 1197 | Ga0395900_0067719 | 3300037418 | Bacteria | 3668 |
| 1198 | Ga0395900_0071173 | 3300037418 | Bacteria | 3574 |
| 1199 | Ga0395900_0071585 | 3300037418 | Bacteria | 3564 |
| 1200 | Ga0395900_0072834 | 3300037418 | Bacteria | 3531 |
| 1201 | Ga0395900_0083974 | 3300037418 | Bacteria | 3272 |
| 1202 | Ga0395900_0111582 | 3300037418 | Bacteria | 2808 |
| 1203 | Ga0395900_0170170 | 3300037418 | Bacteria | 2218 |
| 1204 | Ga0395900_0197808 | 3300037418 | Bacteria | 2035 |
| 1205 | Ga0395900_0277371 | 3300037418 | Bacteria | 1669 |
| 1206 | Ga0395900_0385620 | 3300037418 | Bacteria | 1368 |
| 1207 | Ga0395900_0396975 | 3300037418 | Bacteria | 1344 |
| 1208 | Ga0395900_0586281 | 3300037418 | Bacteria | 1056 |
| 1209 | Ga0395898_0000937 | 3300037466 | Bacteria | 46531 |
| 1210 | Ga0395898_0000941 | 3300037466 | Bacteria | 46344 |
| 1211 | Ga0395898_0003514 | 3300037466 | Bacteria | 17472 |
| 1212 | Ga0395898_0006784 | 3300037466 | Bacteria | 12187 |
| 1213 | Ga0395898_0011630 | 3300037466 | Bacteria | 9133 |
| 1214 | Ga0395898_0013212 | 3300037466 | Bacteria | 8506 |
| 1215 | Ga0395898_0016800 | 3300037466 | Bacteria | 7478 |
| 1216 | Ga0395898_0019019 | 3300037466 | Bacteria | 6995 |
| 1217 | Ga0395898_0026042 | 3300037466 | Bacteria | 5889 |
| 1218 | Ga0395898_0032814 | 3300037466 | Bacteria | 5184 |
| 1219 | Ga0395898_0037999 | 3300037466 | Bacteria | 4773 |
| 1220 | Ga0395898_0063664 | 3300037466 | Bacteria | 3578 |
| 1221 | Ga0395898_0073073 | 3300037466 | Bacteria | 3312 |
| 1222 | Ga0395898_0093168 | 3300037466 | Bacteria | 2896 |
| 1223 | Ga0395898_0137221 | 3300037466 | Bacteria | 2342 |
| 1224 | Ga0395898_0201413 | 3300037466 | Bacteria | 1900 |
| 1225 | Ga0395898_0334720 | 3300037466 | Bacteria | 1444 |
| 1226 | Ga0395905_0000083 | 3300037471 | Bacteria | 158407 |
| 1227 | Ga0395905_0000120 | 3300037471 | Bacteria | 130865 |
| 1228 | Ga0395905_0002555 | 3300037471 | Bacteria | 20064 |
| 1229 | Ga0395905_0004314 | 3300037471 | Bacteria | 14817 |
| 1230 | Ga0395905_0004476 | 3300037471 | Bacteria | 14494 |
| 1231 | Ga0395905_0008284 | 3300037471 | Bacteria | 10261 |
| 1232 | Ga0395905_0010588 | 3300037471 | Bacteria | 8957 |
| 1233 | Ga0395905_0011011 | 3300037471 | Bacteria | 8753 |
| 1234 | Ga0395905_0011304 | 3300037471 | Bacteria | 8632 |
| 1235 | Ga0395905_0012589 | 3300037471 | Bacteria | 8137 |
| 1236 | Ga0395905_0014055 | 3300037471 | Bacteria | 7655 |
| 1237 | Ga0395905_0016902 | 3300037471 | Bacteria | 6930 |
| 1238 | Ga0395905_0016967 | 3300037471 | Bacteria | 6913 |
| 1239 | Ga0395905_0020231 | 3300037471 | Bacteria | 6305 |
| 1240 | Ga0395905_0023856 | 3300037471 | Bacteria | 5775 |
| 1241 | Ga0395905_0035763 | 3300037471 | Bacteria | 4664 |
| 1242 | Ga0395905_0045411 | 3300037471 | Bacteria | 4120 |
| 1243 | Ga0395905_0053044 | 3300037471 | Bacteria | 3796 |
| 1244 | Ga0395905_0062426 | 3300037471 | Bacteria | 3485 |
| 1245 | Ga0395905_0107179 | 3300037471 | Bacteria | 2623 |
| 1246 | Ga0395905_0107343 | 3300037471 | Bacteria | 2621 |
| 1247 | Ga0395905_0122928 | 3300037471 | Bacteria | 2440 |
| 1248 | Ga0395905_0142387 | 3300037471 | Bacteria | 2255 |
| 1249 | Ga0395905_0145286 | 3300037471 | Bacteria | 2232 |
| 1250 | Ga0395905_0169065 | 3300037471 | Bacteria | 2053 |
| 1251 | Ga0395905_0194796 | 3300037471 | Bacteria | 1900 |
| 1252 | Ga0395905_0255386 | 3300037471 | Bacteria | 1637 |
| 1253 | Ga0395905_0282847 | 3300037471 | Bacteria | 1545 |
| 1254 | Ga0395905_0298394 | 3300037471 | Bacteria | 1498 |
| 1255 | Ga0395905_0357729 | 3300037471 | Bacteria | 1352 |
| 1256 | Ga0436364_0395728 | 3300037853 | Bacteria | 10333 |
| 1257 | Ga0436364_0501730 | 3300037853 | Bacteria | 2060 |
| 1258 | Ga0436364_1341123 | 3300037853 | Bacteria | 3085 |
| 1259 | Ga0395901_0000276 | 3300038443 | Bacteria | 63580 |
| 1260 | Ga0395901_0001229 | 3300038443 | Bacteria | 27314 |
| 1261 | Ga0395901_0001252 | 3300038443 | Bacteria | 27019 |
| 1262 | Ga0395901_0004800 | 3300038443 | Bacteria | 13639 |
| 1263 | Ga0395901_0006565 | 3300038443 | Bacteria | 11761 |
| 1264 | Ga0395901_0009498 | 3300038443 | Bacteria | 9868 |
| 1265 | Ga0395901_0010154 | 3300038443 | Bacteria | 9540 |
| 1266 | Ga0395901_0014604 | 3300038443 | Bacteria | 7982 |
| 1267 | Ga0395901_0018714 | 3300038443 | Bacteria | 7075 |
| 1268 | Ga0395901_0020870 | 3300038443 | Bacteria | 6709 |
| 1269 | Ga0395901_0024605 | 3300038443 | Bacteria | 6183 |
| 1270 | Ga0395901_0030423 | 3300038443 | Bacteria | 5562 |
| 1271 | Ga0395901_0034405 | 3300038443 | Bacteria | 5232 |
| 1272 | Ga0395901_0039030 | 3300038443 | Bacteria | 4912 |
| 1273 | Ga0395901_0040708 | 3300038443 | Bacteria | 4813 |
| 1274 | Ga0395901_0041173 | 3300038443 | Bacteria | 4786 |
| 1275 | Ga0395901_0042757 | 3300038443 | Bacteria | 4699 |
| 1276 | Ga0395901_0043629 | 3300038443 | Bacteria | 4651 |
| 1277 | Ga0395901_0044205 | 3300038443 | Bacteria | 4620 |
| 1278 | Ga0395901_0048700 | 3300038443 | Bacteria | 4401 |
| 1279 | Ga0395901_0048854 | 3300038443 | Bacteria | 4394 |
| 1280 | Ga0395901_0064107 | 3300038443 | Bacteria | 3824 |
| 1281 | Ga0395901_0065885 | 3300038443 | Bacteria | 3773 |
| 1282 | Ga0395901_0088904 | 3300038443 | Bacteria | 3232 |
| 1283 | Ga0395901_0106327 | 3300038443 | Bacteria | 2945 |
| 1284 | Ga0395901_0134696 | 3300038443 | Bacteria | 2596 |
| 1285 | Ga0395901_0147081 | 3300038443 | Bacteria | 2476 |
| 1286 | Ga0395901_0153857 | 3300038443 | Bacteria | 2415 |
| 1287 | Ga0395901_0181472 | 3300038443 | Bacteria | 2208 |
| 1288 | Ga0395901_0269503 | 3300038443 | Bacteria | 1771 |
| 1289 | Ga0395901_0308312 | 3300038443 | Bacteria | 1640 |
| 1290 | Ga0395901_0388821 | 3300038443 | Bacteria | 1434 |
| 1291 | Ga0436365_1773598 | 3300039437 | Bacteria | 2231 |
| 1292 | Ga0436361_0004926 | 3300039447 | Bacteria | 16512 |
| 1293 | Ga0436361_0065571 | 3300039447 | Bacteria | 16897 |
| 1294 | Ga0436361_0118183 | 3300039447 | Bacteria | 1217 |
| 1295 | Ga0436361_0205215 | 3300039447 | Bacteria | 60678 |
| 1296 | Ga0436361_0866516 | 3300039447 | Bacteria | 9211 |
| 1297 | Ga0436361_1168029 | 3300039447 | Bacteria | 1348 |
| 1298 | Ga0436363_0550910 | 3300039450 | Bacteria | 12229 |
| 1299 | Ga0436363_0571997 | 3300039450 | Bacteria | 7484 |
| 1300 | Ga0439453_0008562 | 3300041408 | Bacteria | 1645 |
| 1301 | Ga0439466_0006862 | 3300041411 | Bacteria | 4314 |
| 1302 | Ga0451800_0302824 | 3300041459 | Bacteria | 2247 |
| 1303 | Ga0451849_1565031 | 3300041505 | Bacteria | 1198 |
| 1304 | Ga0439445_0003832 | 3300042004 | Bacteria | 3383 |
| 1305 | Ga0439448_0004443 | 3300042005 | Bacteria | 3958 |
| 1306 | Ga0439456_006236 | 3300042013 | Bacteria | 2433 |
| 1307 | Ga0450911_000007 | 3300042115 | Bacteria | 212322 |
| 1308 | Ga0450920_000278 | 3300042122 | Bacteria | 7716 |
| 1309 | Ga0450923_002228 | 3300042125 | Bacteria | 2744 |
| 1310 | Ga0450895_003634 | 3300042132 | Bacteria | 1196 |
| 1311 | Ga0450896_002559 | 3300042133 | Bacteria | 2358 |
| 1312 | Ga0450904_000067 | 3300042139 | Bacteria | 23305 |
| 1313 | Ga0450905_000582 | 3300042142 | Bacteria | 4517 |
| 1314 | Ga0450889_000141 | 3300042144 | Bacteria | 7285 |
| 1315 | Ga0450910_005558 | 3300042147 | Bacteria | 1723 |
| 1316 | Ga0439446_0000383 | 3300042156 | Bacteria | 8499 |
| 1317 | Ga0439446_0001120 | 3300042156 | Bacteria | 5934 |
| 1318 | Ga0439458_0000032 | 3300042157 | Bacteria | 21961 |
| 1319 | Ga0439458_0002553 | 3300042157 | Bacteria | 4407 |
| 1320 | Ga0450908_000265 | 3300042184 | Bacteria | 10347 |
| 1321 | Ga0450908_003190 | 3300042184 | Bacteria | 3191 |
| 1322 | Ga0439434_0003438 | 3300042435 | Bacteria | 4626 |
| 1323 | Ga0439435_0001973 | 3300042436 | Bacteria | 3955 |
| 1324 | Ga0439444_0002224 | 3300042437 | Bacteria | 2628 |
| 1325 | Ga0439464_0000318 | 3300042439 | Bacteria | 9184 |
| 1326 | Ga0450916_000442 | 3300042530 | Bacteria | 3565 |
| 1327 | Ga0451577_0067545 | 3300042876 | Bacteria | 3188 |
| 1328 | Ga0466965_0101828 | 3300044683 | Bacteria | 1469 |
| 1329 | Ga0466966_0000052 | 3300044684 | Bacteria | 88472 |
| 1330 | Ga0466966_0034309 | 3300044684 | Bacteria | 3281 |
| 1331 | Ga0466966_0064283 | 3300044684 | Bacteria | 2310 |
| 1332 | Ga0466966_0081582 | 3300044684 | Bacteria | 2013 |
| 1333 | Ga0466966_0082546 | 3300044684 | Bacteria | 2000 |
| 1334 | Ga0466966_0125775 | 3300044684 | Bacteria | 1572 |
| 1335 | Ga0466961_0001787 | 3300044693 | Bacteria | 13319 |
| 1336 | Ga0466961_0011411 | 3300044693 | Bacteria | 5683 |
| 1337 | Ga0466963_0011115 | 3300044694 | Bacteria | 5474 |
| 1338 | Ga0466963_0012079 | 3300044694 | Bacteria | 5277 |
| 1339 | Ga0466963_0030107 | 3300044694 | Bacteria | 3499 |
| 1340 | Ga0466963_0086326 | 3300044694 | Bacteria | 2132 |
| 1341 | Ga0466963_0110357 | 3300044694 | Bacteria | 1888 |
| 1342 | Ga0466964_0031435 | 3300044706 | Bacteria | 2106 |
| 1343 | Ga0466964_0042256 | 3300044706 | Bacteria | 1846 |
| 1344 | Ga0453684_0000163 | 3300044712 | Bacteria | 296196 |
| 1345 | Ga0453684_0247613 | 3300044712 | Bacteria | 2048 |
| 1346 | Ga0466971_0004987 | 3300044719 | Bacteria | 5743 |
| 1347 | Ga0466971_0023710 | 3300044719 | Bacteria | 2736 |
| 1348 | Ga0466968_0002072 | 3300044735 | Bacteria | 7299 |
| 1349 | Ga0466970_0003695 | 3300044765 | Bacteria | 7476 |
| 1350 | Ga0466970_0008527 | 3300044765 | Bacteria | 5162 |
| 1351 | Ga0466957_0001514 | 3300044842 | Bacteria | 12203 |
| 1352 | Ga0466957_0006445 | 3300044842 | Bacteria | 6628 |
| 1353 | Ga0466957_0006813 | 3300044842 | Bacteria | 6454 |
| 1354 | Ga0466957_0117274 | 3300044842 | Bacteria | 1694 |
| 1355 | Ga0466960_0052762 | 3300044901 | Bacteria | 1968 |
| 1356 | Ga0466959_0047089 | 3300045049 | Bacteria | 3172 |
| 1357 | Ga0466959_0112168 | 3300045049 | Bacteria | 1945 |
| 1358 | Ga0466959_0116516 | 3300045049 | Bacteria | 1902 |
| 1359 | Ga0451576_0002793 | 3300045051 | Bacteria | 25197 |
| 1360 | Ga0451576_0014659 | 3300045051 | Bacteria | 8713 |
| 1361 | Ga0466958_0000611 | 3300045836 | Bacteria | 15263 |
| 1362 | Ga0466958_0001430 | 3300045836 | Bacteria | 11308 |
| 1363 | Ga0466958_0001793 | 3300045836 | Bacteria | 10414 |
| 1364 | Ga0466958_0004940 | 3300045836 | Bacteria | 7112 |
| 1365 | Ga0466958_0007406 | 3300045836 | Bacteria | 6036 |
| 1366 | Ga0466958_0037514 | 3300045836 | Bacteria | 2904 |
| 1367 | Ga0466958_0054753 | 3300045836 | Bacteria | 2419 |
| 1368 | Ga0466958_0092641 | 3300045836 | Bacteria | 1871 |
| 1369 | Ga0466967_0000483 | 3300045976 | Bacteria | 19324 |
| 1370 | Ga0466967_0004145 | 3300045976 | Bacteria | 9695 |
| 1371 | Ga0466967_0005217 | 3300045976 | Bacteria | 8947 |
| 1372 | Ga0466967_0030098 | 3300045976 | Bacteria | 4552 |
| 1373 | Ga0466967_0099604 | 3300045976 | Bacteria | 2655 |
| 1374 | Ga0466967_0136172 | 3300045976 | Bacteria | 2284 |
| 1375 | Ga0466967_0147006 | 3300045976 | Bacteria | 2199 |
| 1376 | Ga0466967_0159424 | 3300045976 | Bacteria | 2116 |
| 1377 | Ga0466967_0231576 | 3300045976 | Bacteria | 1759 |
| 1378 | Ga0466967_0307946 | 3300045976 | Bacteria | 1525 |
| 1379 | Ga0495592_0205628 | 3300046454 | Bacteria | 1326 |
| 1380 | Ga0495629_0058673 | 3300046459 | Bacteria | 2691 |
| 1381 | Ga0495638_0004727 | 3300046460 | Bacteria | 10290 |
| 1382 | Ga0495580_0002818 | 3300046472 | Bacteria | 14949 |
| 1383 | Ga0495580_0003423 | 3300046472 | Bacteria | 13523 |
| 1384 | Ga0495607_0073945 | 3300046501 | Bacteria | 1893 |
| 1385 | Ga0495583_0028723 | 3300046506 | Bacteria | 2731 |
| 1386 | Ga0495583_0072037 | 3300046506 | Bacteria | 1517 |
| 1387 | Ga0495606_0002415 | 3300046507 | Bacteria | 21778 |
| 1388 | Ga0495610_0035142 | 3300046512 | Bacteria | 2576 |
| 1389 | Ga0495628_0126028 | 3300046516 | Bacteria | 1962 |
| 1390 | Ga0495632_0082677 | 3300046519 | Bacteria | 1530 |
| 1391 | Ga0495643_0002441 | 3300046522 | Bacteria | 14750 |
| 1392 | Ga0495643_0009118 | 3300046522 | Bacteria | 6208 |
| 1393 | Ga0495644_0047002 | 3300046523 | Bacteria | 1622 |
| 1394 | Ga0495663_0000251 | 3300046525 | Bacteria | 20762 |
| 1395 | Ga0495663_0054613 | 3300046525 | Bacteria | 1244 |
| 1396 | Ga0495642_0016247 | 3300046528 | Bacteria | 2899 |
| 1397 | Ga0495598_0013733 | 3300046537 | Bacteria | 2014 |
| 1398 | Ga0495621_0000065 | 3300046539 | Bacteria | 20486 |
| 1399 | Ga0495621_0000335 | 3300046539 | Bacteria | 11449 |
| 1400 | Ga0495621_0006404 | 3300046539 | Bacteria | 3437 |
| 1401 | Ga0495621_0011646 | 3300046539 | Bacteria | 2727 |
| 1402 | Ga0495597_0003150 | 3300046542 | Bacteria | 9877 |
| 1403 | Ga0495622_0001712 | 3300046557 | Bacteria | 10843 |
| 1404 | Ga0495633_0048995 | 3300046558 | Bacteria | 1994 |
| 1405 | Ga0495633_0088885 | 3300046558 | Bacteria | 1436 |
| 1406 | Ga0495668_0021731 | 3300046616 | Bacteria | 3674 |
| 1407 | Ga0495668_0113705 | 3300046616 | Bacteria | 1480 |
| 1408 | Ga0495668_0139562 | 3300046616 | Bacteria | 1326 |
| 1409 | Ga0495611_0065882 | 3300046648 | Bacteria | 1651 |
| 1410 | Ga0495625_0019083 | 3300046660 | Bacteria | 5334 |
| 1411 | Ga0495625_0022933 | 3300046660 | Bacteria | 4776 |
| 1412 | Ga0495625_0033218 | 3300046660 | Bacteria | 3818 |
| 1413 | Ga0495659_0066328 | 3300046664 | Bacteria | 1344 |
| 1414 | Ga0495588_0089837 | 3300046674 | Bacteria | 1609 |
| 1415 | Ga0495623_0074196 | 3300046679 | Bacteria | 2114 |
| 1416 | Ga0495647_0037770 | 3300046681 | Bacteria | 1824 |
| 1417 | Ga0495647_0044901 | 3300046681 | Bacteria | 1696 |
| 1418 | Ga0495658_0005618 | 3300046683 | Bacteria | 6159 |
| 1419 | Ga0495669_0000885 | 3300046684 | Bacteria | 12613 |
| 1420 | Ga0495669_0002616 | 3300046684 | Bacteria | 7364 |
| 1421 | Ga0495669_0010555 | 3300046684 | Bacteria | 3905 |
| 1422 | Ga0495669_0017149 | 3300046684 | Bacteria | 3105 |
| 1423 | Ga0495669_0026244 | 3300046684 | Bacteria | 2545 |
| 1424 | Ga0495669_0032532 | 3300046684 | Bacteria | 2293 |
| 1425 | Ga0495669_0060341 | 3300046684 | Bacteria | 1714 |
| 1426 | Ga0495670_0000467 | 3300046691 | Bacteria | 19301 |
| 1427 | Ga0495671_0060155 | 3300046692 | Bacteria | 1875 |
| 1428 | Ga0495649_0001380 | 3300046694 | Bacteria | 18369 |
| 1429 | Ga0495649_0009555 | 3300046694 | Bacteria | 5751 |
| 1430 | Ga0495604_0110888 | 3300047317 | Bacteria | 2001 |
| 1431 | Ga0495636_0017966 | 3300047318 | Bacteria | 2835 |
| 1432 | Ga0495677_0007969 | 3300047445 | Bacteria | 3937 |
| 1433 | Ga0495685_037274 | 3300047447 | Bacteria | 1668 |
| 1434 | Ga0495681_0042831 | 3300047470 | Bacteria | 2188 |
| 1435 | Ga0495684_0113899 | 3300047471 | Bacteria | 2039 |
| 1436 | Ga0495686_0000007 | 3300047472 | Bacteria | 732622 |
| 1437 | Ga0495686_0145206 | 3300047472 | Bacteria | 1397 |
| 1438 | Ga0495602_0034792 | 3300048088 | Bacteria | 4706 |
| 1439 | Ga0495602_0273450 | 3300048088 | Bacteria | 1248 |
| 1440 | Ga0496100_0076279 | 3300048903 | Bacteria | 2250 |
| 1441 | Ga0496100_0214748 | 3300048903 | Bacteria | 1409 |
| 1442 | Ga0496101_0001530 | 3300048904 | Bacteria | 13854 |
| 1443 | Ga0496101_0004925 | 3300048904 | Bacteria | 8472 |
| 1444 | Ga0496101_0039685 | 3300048904 | Bacteria | 3350 |
| 1445 | Ga0496101_0303664 | 3300048904 | Bacteria | 1250 |
| 1446 | Ga0496102_0003565 | 3300048905 | Bacteria | 13190 |
| 1447 | Ga0496102_0008489 | 3300048905 | Bacteria | 8806 |
| 1448 | Ga0496102_0018960 | 3300048905 | Bacteria | 6053 |
| 1449 | Ga0496102_0132100 | 3300048905 | Bacteria | 2338 |
| 1450 | Ga0496104_0032386 | 3300048907 | Bacteria | 4864 |
| 1451 | Ga0496104_0055098 | 3300048907 | Bacteria | 3759 |
| 1452 | Ga0496104_0056808 | 3300048907 | Bacteria | 3702 |
| 1453 | Ga0496104_0336598 | 3300048907 | Bacteria | 1422 |
| 1454 | Ga0496104_0504597 | 3300048907 | Bacteria | 1121 |
| 1455 | Ga0496105_0023452 | 3300048908 | Bacteria | 5005 |
| 1456 | Ga0496105_0121608 | 3300048908 | Bacteria | 2152 |
| 1457 | Ga0496105_0206307 | 3300048908 | Bacteria | 1603 |
| 1458 | Ga0496106_0000881 | 3300048909 | Bacteria | 21864 |
| 1459 | Ga0496106_0020944 | 3300048909 | Bacteria | 4852 |
| 1460 | Ga0496106_0070256 | 3300048909 | Bacteria | 2674 |
| 1461 | Ga0496107_0002088 | 3300048910 | Bacteria | 12791 |
| 1462 | Ga0496107_0002535 | 3300048910 | Bacteria | 11898 |
| 1463 | Ga0496107_0034798 | 3300048910 | Bacteria | 3609 |
| 1464 | Ga0496107_0150026 | 3300048910 | Bacteria | 1724 |
| 1465 | Ga0496108_0006866 | 3300048911 | Bacteria | 9210 |
| 1466 | Ga0496108_0025773 | 3300048911 | Bacteria | 4848 |
| 1467 | Ga0496108_0027380 | 3300048911 | Bacteria | 4706 |
| 1468 | Ga0496108_0030881 | 3300048911 | Bacteria | 4440 |
| 1469 | Ga0496108_0031348 | 3300048911 | Bacteria | 4411 |
| 1470 | Ga0496108_0051897 | 3300048911 | Bacteria | 3435 |
| 1471 | Ga0496108_0070888 | 3300048911 | Bacteria | 2941 |
| 1472 | Ga0496109_0003841 | 3300048912 | Bacteria | 12548 |
| 1473 | Ga0496109_0007667 | 3300048912 | Bacteria | 9150 |
| 1474 | Ga0496109_0013067 | 3300048912 | Bacteria | 7182 |
| 1475 | Ga0496109_0031031 | 3300048912 | Bacteria | 4792 |
| 1476 | Ga0496109_0043330 | 3300048912 | Bacteria | 4079 |
| 1477 | Ga0496109_0043367 | 3300048912 | Bacteria | 4077 |
| 1478 | Ga0496109_0079959 | 3300048912 | Bacteria | 3012 |
| 1479 | Ga0496110_0000847 | 3300048913 | Bacteria | 21521 |
| 1480 | Ga0496110_0003016 | 3300048913 | Bacteria | 12775 |
| 1481 | Ga0496110_0009800 | 3300048913 | Bacteria | 7758 |
| 1482 | Ga0496110_0019847 | 3300048913 | Bacteria | 5665 |
| 1483 | Ga0496110_0029386 | 3300048913 | Bacteria | 4730 |
| 1484 | Ga0496110_0032481 | 3300048913 | Bacteria | 4508 |
| 1485 | Ga0496110_0096527 | 3300048913 | Bacteria | 2649 |
| 1486 | Ga0496110_0130783 | 3300048913 | Bacteria | 2266 |
| 1487 | Ga0496110_0292961 | 3300048913 | Bacteria | 1482 |
| 1488 | Ga0496111_0003138 | 3300048914 | Bacteria | 10164 |
| 1489 | Ga0496111_0005026 | 3300048914 | Bacteria | 8411 |
| 1490 | Ga0496111_0008249 | 3300048914 | Bacteria | 6887 |
| 1491 | Ga0496111_0012396 | 3300048914 | Bacteria | 5770 |
| 1492 | Ga0496111_0044338 | 3300048914 | Bacteria | 3197 |
| 1493 | Ga0496111_0047561 | 3300048914 | Bacteria | 3089 |
| 1494 | Ga0496111_0055331 | 3300048914 | Bacteria | 2869 |
| 1495 | Ga0496111_0143949 | 3300048914 | Bacteria | 1767 |
| 1496 | Ga0496112_0005760 | 3300048915 | Bacteria | 10774 |
| 1497 | Ga0496112_0008648 | 3300048915 | Bacteria | 9128 |
| 1498 | Ga0496112_0014514 | 3300048915 | Bacteria | 7315 |
| 1499 | Ga0496112_0041388 | 3300048915 | Bacteria | 4508 |
| 1500 | Ga0496112_0109951 | 3300048915 | Bacteria | 2726 |
| 1501 | Ga0496112_0185709 | 3300048915 | Bacteria | 2042 |
| 1502 | Ga0496112_0294548 | 3300048915 | Bacteria | 1568 |
| 1503 | Ga0496112_0344824 | 3300048915 | Bacteria | 1432 |
| 1504 | Ga0496113_0002271 | 3300048916 | Bacteria | 11088 |
| 1505 | Ga0496113_0007556 | 3300048916 | Bacteria | 7007 |
| 1506 | Ga0496113_0060370 | 3300048916 | Bacteria | 2858 |
| 1507 | Ga0496113_0100372 | 3300048916 | Bacteria | 2242 |
| 1508 | Ga0496113_0115289 | 3300048916 | Bacteria | 2096 |
| 1509 | Ga0496113_0252400 | 3300048916 | Bacteria | 1408 |
| 1510 | Ga0496114_0000109 | 3300048917 | Bacteria | 59733 |
| 1511 | Ga0496114_0001264 | 3300048917 | Bacteria | 19117 |
| 1512 | Ga0496114_0014914 | 3300048917 | Bacteria | 6246 |
| 1513 | Ga0496114_0016520 | 3300048917 | Bacteria | 5948 |
| 1514 | Ga0496114_0030935 | 3300048917 | Bacteria | 4404 |
| 1515 | Ga0496114_0146898 | 3300048917 | Bacteria | 2044 |
| 1516 | Ga0496115_0000447 | 3300048918 | Bacteria | 33288 |
| 1517 | Ga0496115_0000691 | 3300048918 | Bacteria | 25050 |
| 1518 | Ga0496115_0008083 | 3300048918 | Bacteria | 7770 |
| 1519 | Ga0496115_0008980 | 3300048918 | Bacteria | 7409 |
| 1520 | Ga0496117_0000706 | 3300048920 | Bacteria | 52898 |
| 1521 | Ga0496117_0006611 | 3300048920 | Bacteria | 11651 |
| 1522 | Ga0496118_0006086 | 3300048921 | Bacteria | 13418 |
| 1523 | Ga0496121_0000152 | 3300048924 | Bacteria | 150767 |
| 1524 | Ga0496121_0001030 | 3300048924 | Bacteria | 49689 |
| 1525 | Ga0496123_0090884 | 3300048926 | Bacteria | 1813 |
| 1526 | Ga0496124_0005367 | 3300048927 | Bacteria | 14474 |
| 1527 | Ga0495682_0001304 | 3300049460 | Bacteria | 13872 |
| 1528 | Ga0501032_0005037 | 3300049569 | Bacteria | 9877 |
| 1529 | Ga0501032_0052026 | 3300049569 | Bacteria | 2760 |
| 1530 | Ga0501032_0097713 | 3300049569 | Bacteria | 1946 |
| 1531 | Ga0501033_0090880 | 3300049570 | Bacteria | 2233 |
| 1532 | Ga0501034_0030391 | 3300049571 | Bacteria | 5491 |
| 1533 | Ga0501036_0007193 | 3300049572 | Bacteria | 9067 |
| 1534 | Ga0501036_0009386 | 3300049572 | Bacteria | 8049 |
| 1535 | Ga0501037_0035800 | 3300049573 | Bacteria | 3659 |
| 1536 | Ga0501038_0000135 | 3300049574 | Bacteria | 63554 |
| 1537 | Ga0501039_0008528 | 3300049575 | Bacteria | 7815 |
| 1538 | Ga0501039_0132316 | 3300049575 | Bacteria | 1957 |
| 1539 | Ga0501040_0003605 | 3300049576 | Bacteria | 10012 |
| 1540 | Ga0501040_0004637 | 3300049576 | Bacteria | 8919 |
| 1541 | Ga0501040_0035662 | 3300049576 | Bacteria | 3374 |
| 1542 | Ga0501041_0003908 | 3300049577 | Bacteria | 8589 |
| 1543 | Ga0501041_0011078 | 3300049577 | Bacteria | 5323 |
| 1544 | Ga0501041_0012729 | 3300049577 | Bacteria | 4984 |
| 1545 | Ga0501041_0036174 | 3300049577 | Bacteria | 2992 |
| 1546 | Ga0501042_0000799 | 3300049578 | Bacteria | 17298 |
| 1547 | Ga0501042_0006057 | 3300049578 | Bacteria | 7835 |
| 1548 | Ga0501042_0116361 | 3300049578 | Bacteria | 1925 |
| 1549 | Ga0501043_0036359 | 3300049579 | Bacteria | 3873 |
| 1550 | Ga0501046_0010488 | 3300049580 | Bacteria | 7951 |
| 1551 | Ga0501046_0022852 | 3300049580 | Bacteria | 5151 |
| 1552 | Ga0501046_0105494 | 3300049580 | Bacteria | 2158 |
| 1553 | Ga0501047_0032978 | 3300049581 | Bacteria | 5001 |
| 1554 | Ga0501047_0102099 | 3300049581 | Bacteria | 2747 |
| 1555 | Ga0501048_0001057 | 3300049582 | Bacteria | 20625 |
| 1556 | Ga0501048_0015262 | 3300049582 | Bacteria | 5675 |
| 1557 | Ga0501067_0000259 | 3300049583 | Bacteria | 28905 |
| 1558 | Ga0501067_0000544 | 3300049583 | Bacteria | 20482 |
| 1559 | Ga0501067_0021162 | 3300049583 | Bacteria | 3599 |
| 1560 | Ga0501068_0056910 | 3300049584 | Bacteria | 2370 |
| 1561 | Ga0501068_0057411 | 3300049584 | Bacteria | 2360 |
| 1562 | Ga0501068_0070020 | 3300049584 | Bacteria | 2139 |
| 1563 | Ga0501070_0031320 | 3300049586 | Bacteria | 4456 |
| 1564 | Ga0501070_0058976 | 3300049586 | Bacteria | 3181 |
| 1565 | Ga0501071_0029786 | 3300049587 | Bacteria | 3855 |
| 1566 | Ga0501071_0191676 | 3300049587 | Bacteria | 1533 |
| 1567 | Ga0501072_0001227 | 3300049588 | Bacteria | 19141 |
| 1568 | Ga0501072_0033612 | 3300049588 | Bacteria | 4019 |
| 1569 | Ga0501072_0143707 | 3300049588 | Bacteria | 1902 |
| 1570 | Ga0501073_0000031 | 3300049589 | Bacteria | 114348 |
| 1571 | Ga0501073_0001765 | 3300049589 | Bacteria | 16078 |
| 1572 | Ga0501073_0009721 | 3300049589 | Bacteria | 7083 |
| 1573 | Ga0501073_0049117 | 3300049589 | Bacteria | 2959 |
| 1574 | Ga0501073_0111547 | 3300049589 | Bacteria | 1897 |
| 1575 | Ga0501074_0107412 | 3300049590 | Bacteria | 1998 |
| 1576 | Ga0501075_0000698 | 3300049591 | Bacteria | 20803 |
| 1577 | Ga0501075_0113084 | 3300049591 | Bacteria | 2064 |
| 1578 | Ga0501075_0114087 | 3300049591 | Bacteria | 2054 |
| 1579 | Ga0501075_0114846 | 3300049591 | Bacteria | 2047 |
| 1580 | Ga0501076_0000465 | 3300049592 | Bacteria | 25590 |
| 1581 | Ga0501076_0001807 | 3300049592 | Bacteria | 14510 |
| 1582 | Ga0501076_0050393 | 3300049592 | Bacteria | 3294 |
| 1583 | Ga0501076_0056565 | 3300049592 | Bacteria | 3113 |
| 1584 | Ga0501076_0118784 | 3300049592 | Bacteria | 2141 |
| 1585 | Ga0501076_0146855 | 3300049592 | Bacteria | 1917 |
| 1586 | Ga0501077_0001769 | 3300049593 | Bacteria | 13042 |
| 1587 | Ga0501077_0002091 | 3300049593 | Bacteria | 12037 |
| 1588 | Ga0501077_0015802 | 3300049593 | Bacteria | 4754 |
| 1589 | Ga0501077_0197296 | 3300049593 | Bacteria | 1279 |
| 1590 | Ga0501221_007061 | 3300049704 | Bacteria | 1915 |
| 1591 | Ga0501079_0000409 | 3300049741 | Bacteria | 27753 |
| 1592 | Ga0501079_0001622 | 3300049741 | Bacteria | 16031 |
| 1593 | Ga0501079_0003562 | 3300049741 | Bacteria | 11449 |
| 1594 | Ga0501079_0017011 | 3300049741 | Bacteria | 5553 |
| 1595 | Ga0501079_0092447 | 3300049741 | Bacteria | 2344 |
| 1596 | Ga0501079_0097791 | 3300049741 | Bacteria | 2275 |
| 1597 | Ga0501080_0005598 | 3300049742 | Bacteria | 11228 |
| 1598 | Ga0501080_0006326 | 3300049742 | Bacteria | 10627 |
| 1599 | Ga0501080_0055388 | 3300049742 | Bacteria | 3693 |
| 1600 | Ga0501080_0109150 | 3300049742 | Bacteria | 2564 |
| 1601 | Ga0501080_0111106 | 3300049742 | Bacteria | 2540 |
| 1602 | Ga0501081_0000363 | 3300049743 | Bacteria | 24680 |
| 1603 | Ga0501081_0025740 | 3300049743 | Bacteria | 3961 |
| 1604 | Ga0501081_0070552 | 3300049743 | Bacteria | 2435 |
| 1605 | Ga0501081_0350417 | 3300049743 | Bacteria | 1088 |
| 1606 | Ga0501083_0013202 | 3300049744 | Bacteria | 5773 |
| 1607 | Ga0501083_0157945 | 3300049744 | Bacteria | 1484 |
| 1608 | Ga0501263_008775 | 3300049760 | Bacteria | 1213 |
| 1609 | Ga0501268_002091 | 3300049765 | Bacteria | 2586 |
| 1610 | Ga0501273_006899 | 3300049770 | Bacteria | 1327 |
| 1611 | Ga0501035_0000618 | 3300049822 | Bacteria | 39128 |
| 1612 | Ga0501035_0015401 | 3300049822 | Bacteria | 7055 |
| 1613 | Ga0501035_0030681 | 3300049822 | Bacteria | 4900 |
| 1614 | Ga0501035_0040551 | 3300049822 | Bacteria | 4206 |
| 1615 | Ga0501035_0100666 | 3300049822 | Bacteria | 2537 |
| 1616 | Ga0501035_0185967 | 3300049822 | Bacteria | 1788 |
| 1617 | Ga0501044_0001081 | 3300049823 | Bacteria | 32566 |
| 1618 | Ga0501044_0004523 | 3300049823 | Bacteria | 15552 |
| 1619 | Ga0501044_0127466 | 3300049823 | Bacteria | 2541 |
| 1620 | Ga0501045_0080094 | 3300049824 | Bacteria | 2408 |
| 1621 | Ga0501045_0088190 | 3300049824 | Bacteria | 2291 |
| 1622 | Ga0501226_000006 | 3300049853 | Bacteria | 259153 |
| 1623 | nmdc:mga03683_50937_c1 | 3300050489 | Bacteria | 1727 |
| 1624 | nmdc:mga00v17_175882_c1 | 3300050491 | Bacteria | 1380 |
| 1625 | nmdc:mga0k408_112009_c1 | 3300050493 | Bacteria | 1613 |
| 1626 | nmdc:mga06z11_17568_c1 | 3300050494 | Bacteria | 3250 |
| 1627 | nmdc:mga04h51_9183_c1 | 3300050495 | Bacteria | 2669 |
| 1628 | nmdc:mga05p37_33127_c1 | 3300050507 | Bacteria | 6327 |
| 1629 | nmdc:mga09592_1337_c1 | 3300050508 | Bacteria | 19755 |
| 1630 | nmdc:mga06r32_159_c1 | 3300050510 | Bacteria | 51926 |
| 1631 | nmdc:mga08y16_1034_c1 | 3300050511 | Bacteria | 27262 |
| 1632 | nmdc:mga08y16_114907_c1 | 3300050511 | Bacteria | 2802 |
| 1633 | nmdc:mga08y16_146877_c1 | 3300050511 | Bacteria | 2451 |
| 1634 | nmdc:mga08y16_2154_c1 | 3300050511 | Bacteria | 20201 |
| 1635 | nmdc:mga08y16_411063_c1 | 3300050511 | Bacteria | 1384 |
| 1636 | nmdc:mga08y16_472917_c1 | 3300050511 | Bacteria | 1276 |
| 1637 | nmdc:mga0n895_3766_c1 | 3300050512 | Bacteria | 12276 |
| 1638 | nmdc:mga0rr50_12004_c1 | 3300050513 | Bacteria | 5576 |
| 1639 | nmdc:mga0rr50_34091_c1 | 3300050513 | Bacteria | 3643 |
| 1640 | nmdc:mga08x19_268468_c1 | 3300050514 | Bacteria | 1180 |
| 1641 | nmdc:mga08x19_41_c1 | 3300050514 | Bacteria | 151756 |
| 1642 | nmdc:mga0a205_101691_c1 | 3300050515 | Bacteria | 2773 |
| 1643 | nmdc:mga0a205_6033_c1 | 3300050515 | Bacteria | 10929 |
| 1644 | Ga0500635_0000135 | 3300053080 | Bacteria | 42687 |
| 1645 | Ga0500578_0048163 | 3300053086 | Bacteria | 2735 |
| 1646 | Ga0500583_0011173 | 3300053092 | Bacteria | 3373 |
| 1647 | Ga0500651_0090474 | 3300053093 | Bacteria | 1884 |
| 1648 | Ga0500555_001450 | 3300053103 | Bacteria | 7247 |
| 1649 | Ga0500556_0000347 | 3300053104 | Bacteria | 34592 |
| 1650 | Ga0500595_006321 | 3300053119 | Bacteria | 5040 |
| 1651 | Ga0500595_015464 | 3300053119 | Bacteria | 2863 |
| 1652 | Ga0500614_000771 | 3300053123 | Bacteria | 8118 |
| 1653 | Ga0500658_0001563 | 3300053134 | Bacteria | 9136 |
| 1654 | Ga0500590_073402 | 3300053148 | Bacteria | 1696 |
| 1655 | Ga0500616_0000018 | 3300053153 | Bacteria | 610976 |
| 1656 | Ga0500622_0006629 | 3300053156 | Bacteria | 6670 |
| 1657 | Ga0500637_0029175 | 3300053178 | Bacteria | 3059 |
| 1658 | Ga0500596_002973 | 3300053735 | Bacteria | 3274 |
| 1659 | Ga0501084_0002732 | 3300054114 | Bacteria | 14230 |
| 1660 | Ga0501084_0003976 | 3300054114 | Bacteria | 12041 |
| 1661 | Ga0501084_0009092 | 3300054114 | Bacteria | 8221 |
| 1662 | Ga0501084_0009238 | 3300054114 | Bacteria | 8156 |
| 1663 | Ga0501082_0005061 | 3300060353 | Bacteria | 11490 |
| 1664 | Ga0501082_0032521 | 3300060353 | Bacteria | 4498 |
| 1665 | Ga0501082_0053997 | 3300060353 | Bacteria | 3464 |
| 1666 | Ga0501082_0105042 | 3300060353 | Bacteria | 2444 |
| 1667 | Ga0466962_0014551 | 3300061719 | Bacteria | 3791 |
| 1668 | Ga0530510_0000311 | 3300061734 | Bacteria | 31154 |
| 1669 | Ga0530510_0016297 | 3300061734 | Bacteria | 5257 |
| 1670 | Ga0530510_0049929 | 3300061734 | Bacteria | 3022 |
| 1671 | 2524609398 | 2524023250 | Bacteria | 5457705 |
| 1672 | 2547376338 | 2547132103 | Bacteria | 5115736 |
| 1673 | 2554816907 | 2554235132 | Bacteria | 6772433 |
| 1674 | 2600445433 | 2600254954 | Bacteria | 5100516 |
| 1675 | 2602009832 | 2600255389 | Bacteria | 5275336 |
| 1676 | 2608379805 | 2606217733 | Bacteria | 6360972 |
| 1677 | 2729145656 | 2728369097 | Bacteria | 4333476 |
| 1678 | 2739287941 | 2738543020 | Bacteria | 5718238 |
| 1679 | 2739293253 | 2738543021 | Bacteria | 5718241 |
| 1680 | 2808907470 | 2808606373 | Bacteria | 4423627 |
| 1681 | 2808941492 | 2808606379 | Bacteria | 5022697 |
| 1682 | 2823424316 | 2823421272 | Bacteria | 5372474 |
| 1683 | 2842808659 | 2842805378 | Bacteria | 5385175 |
| 1684 | 2843694595 | 2843690924 | Bacteria | 5169057 |
| 1685 | 2846035022 | 2846033681 | Bacteria | 4377894 |
| 1686 | 2846040699 | 2846037992 | Bacteria | 4526407 |
| 1687 | 2885429442 | 2885427238 | Bacteria | 2291351 |
| 1688 | 2919504045 | 2919501602 | Bacteria | 5286340 |
| 1689 | 2926065382 | 2926063275 | Bacteria | 5285848 |
| 1690 | 2990268689 | 2990265787 | Bacteria | 3943888 |
| 1691 | 2993694604 | 2993693658 | Bacteria | 4040749 |
| 1692 | 2998348405 | 2998344455 | Bacteria | 4222996 |
| 1693 | 3007253208 | 3007252601 | Bacteria | 4559114 |
| 1694 | 3007317999 | 3007315729 | Bacteria | 5076637 |
| 1695 | 640486827 | 640427133 | Bacteria | 4567418 |
| 1696 | 651174681 | 651053060 | Bacteria | 4689946 |
| 1697 | 8011356674 | 8011350971 | Bacteria | 6158957 |
| 1698 | 8034965657 | 8034962539 | Bacteria | 4884839 |
| 1699 | Ga0207661_10172082 | |||
| 1700 | JGI24736J21556_1007099 | |||
| 1701 | JGI24736J21556_1009758 | |||
| 1702 | JGI24741J21665_1004028 | |||
| 1703 | JGI24741J21665_1004851 | |||
| 1704 | JGI24741J21665_1012167 | |||
| 1705 | JGI24752J21851_1002288 | |||
| 1706 | JGI24746J21847_1008484 | |||
| 1707 | JGI24740J21852_10012406 | |||
| 1708 | JGI24739J22299_10000129 | |||
| 1709 | JGI24737J22298_10001260 | |||
| 1710 | JGI24737J22298_10003247 | |||
| 1711 | JGI24737J22298_10009782 | |||
| 1712 | JGI24735J21928_10003273 | |||
| 1713 | JGI24735J21928_10006116 | |||
| 1714 | JGI24738J21930_10000498 | |||
| 1715 | JGI25153J46596_10002720 | |||
| 1716 | Ga0055536_1002563 | |||
| 1717 | Ga0065714_10017464 | |||
| 1718 | Ga0065712_10074254 | |||
| 1719 | Ga0065712_10095303 | |||
| 1720 | Ga0065715_10092501 | |||
| 1721 | Ga0065715_10097978 | |||
| 1722 | Ga0065715_10126836 | |||
| 1723 | Ga0065715_10217694 | |||
| 1724 | Ga0070658_10000782 | |||
| 1725 | Ga0070658_10016126 | |||
| 1726 | Ga0070658_10020167 | |||
| 1727 | Ga0070658_10032109 | |||
| 1728 | Ga0070658_10036407 | |||
| 1729 | Ga0070658_10045362 | |||
| 1730 | Ga0070658_10062402 | |||
| 1731 | Ga0070658_10083328 | |||
| 1732 | Ga0070658_10188590 | |||
| 1733 | Ga0070676_10001960 | |||
| 1734 | Ga0070676_10013444 | |||
| 1735 | Ga0070676_10021151 | |||
| 1736 | Ga0070676_10024500 | |||
| 1737 | Ga0070676_10088878 | |||
| 1738 | Ga0070676_10110328 | |||
| 1739 | Ga0070683_100000209 | |||
| 1740 | Ga0070683_100021851 | |||
| 1741 | Ga0070683_100067719 | |||
| 1742 | Ga0070683_100255932 | |||
| 1743 | Ga0070683_100404237 | |||
| 1744 | Ga0070670_100000035 | |||
| 1745 | Ga0070670_100000265 | |||
| 1746 | Ga0070670_100001878 | |||
| 1747 | Ga0070670_100016626 | |||
| 1748 | Ga0070670_100063582 | |||
| 1749 | Ga0070670_100088826 | |||
| 1750 | Ga0070670_100096526 | |||
| 1751 | Ga0070670_100131204 | |||
| 1752 | Ga0070677_10000332 | |||
| 1753 | Ga0068869_100000331 | |||
| 1754 | Ga0070666_10000822 | |||
| 1755 | Ga0070666_10000924 | |||
| 1756 | Ga0070666_10010937 | |||
| 1757 | Ga0070666_10018159 | |||
| 1758 | Ga0070666_10027338 | |||
| 1759 | Ga0070666_10178467 | |||
| 1760 | Ga0070680_100011718 | |||
| 1761 | Ga0070680_100026458 | |||
| 1762 | Ga0070680_100055922 | |||
| 1763 | Ga0070680_100076972 | |||
| 1764 | Ga0070682_100050330 | |||
| 1765 | Ga0068868_100000156 | |||
| 1766 | Ga0068868_100002559 | |||
| 1767 | Ga0068868_100023466 | |||
| 1768 | Ga0068868_100033029 | |||
| 1769 | Ga0068868_100111310 | |||
| 1770 | Ga0070660_100000534 | |||
| 1771 | Ga0070660_100010855 | |||
| 1772 | Ga0070660_100014517 | |||
| 1773 | Ga0070660_100028930 | |||
| 1774 | Ga0070660_100050134 | |||
| 1775 | Ga0070660_100076959 | |||
| 1776 | Ga0070660_100116913 | |||
| 1777 | Ga0070660_100138592 | |||
| 1778 | Ga0070689_100064072 | |||
| 1779 | Ga0070689_100069289 | |||
| 1780 | Ga0070691_10003441 | |||
| 1781 | Ga0070691_10010751 | |||
| 1782 | Ga0070691_10014911 | |||
| 1783 | Ga0070661_100000452 | |||
| 1784 | Ga0070661_100000694 | |||
| 1785 | Ga0070661_100005269 | |||
| 1786 | Ga0070661_100007519 | |||
| 1787 | Ga0070661_100028664 | |||
| 1788 | Ga0070661_100042947 | |||
| 1789 | Ga0070661_100047268 | |||
| 1790 | Ga0070661_100161246 | |||
| 1791 | Ga0070661_100186272 | |||
| 1792 | Ga0070668_100003642 | |||
| 1793 | Ga0070668_100007660 | |||
| 1794 | Ga0070668_100008418 | |||
| 1795 | Ga0070668_100017704 | |||
| 1796 | Ga0070668_100025836 | |||
| 1797 | Ga0070668_100090493 | |||
| 1798 | Ga0070669_100000383 | |||
| 1799 | Ga0070669_100025265 | |||
| 1800 | Ga0070669_100036006 | |||
| 1801 | Ga0070669_100044111 | |||
| 1802 | Ga0070669_100052547 | |||
| 1803 | Ga0070669_100062219 | |||
| 1804 | Ga0070675_100000992 | |||
| 1805 | Ga0070675_100005969 | |||
| 1806 | Ga0070675_100065716 | |||
| 1807 | Ga0070675_100129959 | |||
| 1808 | Ga0070675_100149565 | |||
| 1809 | Ga0070671_100000722 | |||
| 1810 | Ga0070671_100004160 | |||
| 1811 | Ga0070671_100004541 | |||
| 1812 | Ga0070671_100011174 | |||
| 1813 | Ga0070671_100012253 | |||
| 1814 | Ga0070671_100025495 | |||
| 1815 | Ga0070671_100025830 | |||
| 1816 | Ga0070671_100029411 | |||
| 1817 | Ga0070671_100043894 | |||
| 1818 | Ga0070671_100044621 | |||
| 1819 | Ga0070671_100087864 | |||
| 1820 | Ga0070671_100276361 | |||
| 1821 | Ga0070674_100004878 | |||
| 1822 | Ga0070674_100006097 | |||
| 1823 | Ga0070674_100103281 | |||
| 1824 | Ga0070674_100118619 | |||
| 1825 | Ga0070673_100000249 | |||
| 1826 | Ga0070673_100002351 | |||
| 1827 | Ga0070673_100003351 | |||
| 1828 | Ga0070673_100004608 | |||
| 1829 | Ga0070673_100006422 | |||
| 1830 | Ga0070673_100011852 | |||
| 1831 | Ga0070673_100023653 | |||
| 1832 | Ga0070673_100086124 | |||
| 1833 | Ga0070673_100106527 | |||
| 1834 | Ga0070673_100121150 | |||
| 1835 | Ga0070659_100000138 | |||
| 1836 | Ga0070659_100000814 | |||
| 1837 | Ga0070659_100001624 | |||
| 1838 | Ga0070659_100002821 | |||
| 1839 | Ga0070659_100031998 | |||
| 1840 | Ga0070659_100045351 | |||
| 1841 | Ga0070659_100046182 | |||
| 1842 | Ga0070659_100071360 | |||
| 1843 | Ga0070659_100089041 | |||
| 1844 | Ga0070659_100101139 | |||
| 1845 | Ga0070659_100152099 | |||
| 1846 | Ga0070659_100168024 | |||
| 1847 | Ga0070659_100321586 | |||
| 1848 | Ga0070667_100001410 | |||
| 1849 | Ga0070667_100001484 | |||
| 1850 | Ga0070667_100003528 | |||
| 1851 | Ga0070667_100017734 | |||
| 1852 | Ga0070667_100047025 | |||
| 1853 | Ga0070667_100048037 | |||
| 1854 | Ga0070667_100056280 | |||
| 1855 | Ga0070667_100165629 | |||
| 1856 | Ga0070709_10000789 | |||
| 1857 | Ga0070714_100037783 | |||
| 1858 | Ga0070714_100042701 | |||
| 1859 | Ga0070714_100048894 | |||
| 1860 | Ga0070714_100059795 | |||
| 1861 | Ga0070714_100118950 | |||
| 1862 | Ga0070714_100142418 | |||
| 1863 | Ga0070713_100000001 | |||
| 1864 | Ga0070713_100007288 | |||
| 1865 | Ga0070713_100030084 | |||
| 1866 | Ga0070713_100100338 | |||
| 1867 | Ga0070713_100102562 | |||
| 1868 | Ga0070710_10027180 | |||
| 1869 | Ga0070711_100125905 | |||
| 1870 | Ga0070700_100169748 | |||
| 1871 | Ga0070694_100003977 | |||
| 1872 | Ga0070663_100001943 | |||
| 1873 | Ga0070678_100006645 | |||
| 1874 | Ga0070678_100057492 | |||
| 1875 | Ga0070662_100000410 | |||
| 1876 | Ga0070662_100001575 | |||
| 1877 | Ga0070662_100003923 | |||
| 1878 | Ga0070662_100014525 | |||
| 1879 | Ga0070662_100184060 | |||
| 1880 | Ga0070681_10003186 | |||
| 1881 | Ga0070681_10010375 | |||
| 1882 | Ga0070681_10088204 | |||
| 1883 | Ga0070681_10220261 | |||
| 1884 | Ga0068867_100000388 | |||
| 1885 | Ga0068867_100009701 | |||
| 1886 | Ga0070685_10007272 | |||
| 1887 | Ga0070706_100015818 | |||
| 1888 | Ga0070707_100029636 | |||
| 1889 | Ga0070698_100039510 | |||
| 1890 | Ga0070699_100117657 | |||
| 1891 | Ga0070699_100146256 | |||
| 1892 | Ga0070679_100002478 | |||
| 1893 | Ga0070679_100003827 | |||
| 1894 | Ga0070679_100124070 | |||
| 1895 | Ga0070679_100168049 | |||
| 1896 | Ga0070679_100194439 | |||
| 1897 | Ga0070679_100197449 | |||
| 1898 | Ga0070679_100431192 | |||
| 1899 | Ga0070684_100004466 | |||
| 1900 | Ga0070684_100153624 | |||
| 1901 | Ga0070684_100169862 | |||
| 1902 | Ga0070697_100076280 | |||
| 1903 | Ga0068853_100000479 | |||
| 1904 | Ga0068853_100001793 | |||
| 1905 | Ga0068853_100022483 | |||
| 1906 | Ga0068853_100025293 | |||
| 1907 | Ga0068853_100051542 | |||
| 1908 | Ga0068853_100061709 | |||
| 1909 | Ga0068853_100088570 | |||
| 1910 | Ga0068853_100119979 | |||
| 1911 | Ga0068853_100132713 | |||
| 1912 | Ga0068853_100234293 | |||
| 1913 | Ga0070672_100006526 | |||
| 1914 | Ga0070672_100083124 | |||
| 1915 | Ga0070672_100136073 | |||
| 1916 | Ga0070672_100213238 | |||
| 1917 | Ga0070686_100073568 | |||
| 1918 | Ga0070696_100003105 | |||
| 1919 | Ga0070693_100015865 | |||
| 1920 | Ga0070693_100082019 | |||
| 1921 | Ga0070665_100000657 | |||
| 1922 | Ga0070665_100005611 | |||
| 1923 | Ga0070665_100011777 | |||
| 1924 | Ga0070665_100014723 | |||
| 1925 | Ga0070665_100016244 | |||
| 1926 | Ga0070665_100032541 | |||
| 1927 | Ga0070665_100053106 | |||
| 1928 | Ga0070665_100053577 | |||
| 1929 | Ga0070665_100086327 | |||
| 1930 | Ga0070665_100086545 | |||
| 1931 | Ga0070665_100130213 | |||
| 1932 | Ga0070665_100144360 | |||
| 1933 | Ga0068855_100000080 | |||
| 1934 | Ga0068855_100000163 | |||
| 1935 | Ga0068855_100003338 | |||
| 1936 | Ga0068855_100017460 | |||
| 1937 | Ga0068855_100040253 | |||
| 1938 | Ga0068855_100042316 | |||
| 1939 | Ga0068855_100093945 | |||
| 1940 | Ga0068855_100342694 | |||
| 1941 | Ga0070664_100000717 | |||
| 1942 | Ga0070664_100014158 | |||
| 1943 | Ga0070664_100021741 | |||
| 1944 | Ga0070664_100109262 | |||
| 1945 | Ga0070664_100117107 | |||
| 1946 | Ga0068857_100000126 | |||
| 1947 | Ga0068857_100000282 | |||
| 1948 | Ga0068857_100002754 | |||
| 1949 | Ga0068857_100010471 | |||
| 1950 | Ga0068857_100015555 | |||
| 1951 | Ga0068857_100120054 | |||
| 1952 | Ga0068857_100152264 | |||
| 1953 | Ga0068857_100185985 | |||
| 1954 | Ga0068854_100001188 | |||
| 1955 | Ga0068854_100004579 | |||
| 1956 | Ga0068854_100049588 | |||
| 1957 | Ga0068854_100114310 | |||
| 1958 | Ga0068854_100197224 | |||
| 1959 | Ga0068856_100000829 | |||
| 1960 | Ga0068856_100001618 | |||
| 1961 | Ga0068856_100008781 | |||
| 1962 | Ga0068856_100015666 | |||
| 1963 | Ga0068856_100017271 | |||
| 1964 | Ga0068856_100020012 | |||
| 1965 | Ga0068856_100025549 | |||
| 1966 | Ga0068856_100142030 | |||
| 1967 | Ga0068856_100552669 | |||
| 1968 | Ga0068852_100001212 | |||
| 1969 | Ga0068852_100001802 | |||
| 1970 | Ga0068852_100011615 | |||
| 1971 | Ga0068852_100014847 | |||
| 1972 | Ga0068852_100027877 | |||
| 1973 | Ga0068852_100042816 | |||
| 1974 | Ga0068852_100060278 | |||
| 1975 | Ga0068852_100125832 | |||
| 1976 | Ga0068852_100146568 | |||
| 1977 | Ga0068852_100149977 | |||
| 1978 | Ga0068859_100000362 | |||
| 1979 | Ga0068859_100001327 | |||
| 1980 | Ga0068859_100007893 | |||
| 1981 | Ga0068859_100021629 | |||
| 1982 | Ga0068859_100033933 | |||
| 1983 | Ga0068859_100036132 | |||
| 1984 | Ga0068859_100048838 | |||
| 1985 | Ga0068859_100078513 | |||
| 1986 | Ga0068859_100182707 | |||
| 1987 | Ga0068859_100212187 | |||
| 1988 | Ga0068864_100000060 | |||
| 1989 | Ga0068864_100001144 | |||
| 1990 | Ga0068864_100001235 | |||
| 1991 | Ga0068864_100001458 | |||
| 1992 | Ga0068864_100001720 | |||
| 1993 | Ga0068864_100006305 | |||
| 1994 | Ga0068864_100006905 | |||
| 1995 | Ga0068864_100012818 | |||
| 1996 | Ga0068864_100014170 | |||
| 1997 | Ga0068864_100031578 | |||
| 1998 | Ga0068864_100045792 | |||
| 1999 | Ga0068864_100209715 | |||
| 2000 | Ga0068864_100373558 | |||
| 2001 | Ga0068866_10012950 | |||
| 2002 | Ga0068866_10017834 | |||
| 2003 | Ga0068861_100153505 | |||
| 2004 | Ga0068861_100161740 | |||
| 2005 | Ga0068851_10009143 | |||
| 2006 | Ga0068851_10015035 | |||
| 2007 | Ga0068851_10018843 | |||
| 2008 | Ga0068870_10038534 | |||
| 2009 | Ga0068863_100000023 | |||
| 2010 | Ga0068863_100000816 | |||
| 2011 | Ga0068863_100000921 | |||
| 2012 | Ga0068863_100002037 | |||
| 2013 | Ga0068863_100002790 | |||
| 2014 | Ga0068863_100011421 | |||
| 2015 | Ga0068863_100027758 | |||
| 2016 | Ga0068863_100046008 | |||
| 2017 | Ga0068863_100051205 | |||
| 2018 | Ga0068863_100064532 | |||
| 2019 | Ga0068863_100075590 | |||
| 2020 | Ga0068863_100094097 | |||
| 2021 | Ga0068863_100139703 | |||
| 2022 | Ga0068858_100000184 | |||
| 2023 | Ga0068858_100002655 | |||
| 2024 | Ga0068858_100003884 | |||
| 2025 | Ga0068858_100005521 | |||
| 2026 | Ga0068858_100008834 | |||
| 2027 | Ga0068858_100010815 | |||
| 2028 | Ga0068858_100017181 | |||
| 2029 | Ga0068858_100017613 | |||
| 2030 | Ga0068858_100024599 | |||
| 2031 | Ga0068858_100183823 | |||
| 2032 | Ga0068860_100000037 | |||
| 2033 | Ga0068860_100001374 | |||
| 2034 | Ga0068860_100001926 | |||
| 2035 | Ga0068860_100005298 | |||
| 2036 | Ga0068860_100006472 | |||
| 2037 | Ga0068860_100009999 | |||
| 2038 | Ga0068860_100012899 | |||
| 2039 | Ga0068860_100055109 | |||
| 2040 | Ga0068860_100099994 | |||
| 2041 | Ga0068862_100000368 | |||
| 2042 | Ga0068862_100001850 | |||
| 2043 | Ga0068862_100001992 | |||
| 2044 | Ga0068862_100005412 | |||
| 2045 | Ga0068862_100021712 | |||
| 2046 | Ga0068862_100065009 | |||
| 2047 | Ga0068862_100074074 | |||
| 2048 | Ga0068862_100121722 | |||
| 2049 | Ga0068862_100159121 | |||
| 2050 | Ga0068862_100166159 | |||
| 2051 | Ga0068862_100270917 | |||
| 2052 | Ga0081455_10000188 | |||
| 2053 | Ga0081455_10000446 | |||
| 2054 | Ga0081455_10003238 | |||
| 2055 | Ga0081455_10054505 | |||
| 2056 | Ga0081538_10038343 | |||
| 2057 | Ga0081539_10011316 | |||
| 2058 | Ga0070717_10000431 | |||
| 2059 | Ga0070717_10028219 | |||
| 2060 | Ga0070717_10034440 | |||
| 2061 | Ga0075365_10095347 | |||
| 2062 | Ga0075368_10012410 | |||
| 2063 | Ga0070715_10000864 | |||
| 2064 | Ga0070712_100000198 | |||
| 2065 | Ga0070712_100000207 | |||
| 2066 | Ga0070712_100015655 | |||
| 2067 | Ga0075362_10038968 | |||
| 2068 | Ga0075367_10004458 | |||
| 2069 | Ga0075366_10110660 | |||
| 2070 | Ga0097621_100002177 | |||
| 2071 | Ga0097621_100006196 | |||
| 2072 | Ga0097621_100028359 | |||
| 2073 | Ga0097621_100035885 | |||
| 2074 | Ga0097621_100076903 | |||
| 2075 | Ga0097621_100166525 | |||
| 2076 | Ga0097621_100348526 | |||
| 2077 | Ga0068871_100006155 | |||
| 2078 | Ga0068871_100012935 | |||
| 2079 | Ga0068871_100073910 | |||
| 2080 | Ga0068871_100091013 | |||
| 2081 | Ga0068871_100113143 | |||
| 2082 | Ga0068871_100122014 | |||
| 2083 | Ga0068871_100154726 | |||
| 2084 | Ga0068871_100336819 | |||
| 2085 | Ga0075428_100007695 | |||
| 2086 | Ga0075428_100291367 | |||
| 2087 | Ga0075430_100028740 | |||
| 2088 | Ga0075430_100132952 | |||
| 2089 | Ga0075431_100000030 | |||
| 2090 | Ga0075431_100183844 | |||
| 2091 | Ga0075433_10020998 | |||
| 2092 | Ga0075434_100000615 | |||
| 2093 | Ga0075429_100002466 | |||
| 2094 | Ga0068865_100014298 | |||
| 2095 | Ga0068865_100018962 | |||
| 2096 | Ga0068865_100060126 | |||
| 2097 | Ga0068865_100093689 | |||
| 2098 | Ga0068865_100118688 | |||
| 2099 | Ga0068865_100131508 | |||
| 2100 | Ga0075436_100000629 | |||
| 2101 | Ga0097620_100000362 | |||
| 2102 | Ga0097620_100001327 | |||
| 2103 | Ga0097620_100007893 | |||
| 2104 | Ga0097620_100021628 | |||
| 2105 | Ga0097620_100033936 | |||
| 2106 | Ga0097620_100036130 | |||
| 2107 | Ga0097620_100048838 | |||
| 2108 | Ga0097620_100182713 | |||
| 2109 | Ga0097620_100212187 | |||
| 2110 | Ga0079104_1017749 | |||
| 2111 | Ga0075435_100014156 | |||
| 2112 | Ga0075435_100024559 | |||
| 2113 | Ga0075435_100148397 | |||
| 2114 | Ga0105250_10025153 | |||
| 2115 | Ga0105240_10000575 | |||
| 2116 | Ga0105240_10006449 | |||
| 2117 | Ga0105240_10009561 | |||
| 2118 | Ga0105240_10012472 | |||
| 2119 | Ga0105240_10029016 | |||
| 2120 | Ga0105240_10033483 | |||
| 2121 | Ga0105240_10035946 | |||
| 2122 | Ga0105240_10051295 | |||
| 2123 | Ga0105240_10072531 | |||
| 2124 | Ga0105240_10110459 | |||
| 2125 | Ga0105240_10132195 | |||
| 2126 | Ga0105240_10155951 | |||
| 2127 | Ga0105240_10172106 | |||
| 2128 | Ga0105240_10209542 | |||
| 2129 | Ga0105240_10309677 | |||
| 2130 | Ga0105240_10310348 | |||
| 2131 | Ga0105240_10603449 | |||
| 2132 | Ga0111539_10000699 | |||
| 2133 | Ga0111539_10090632 | |||
| 2134 | Ga0111539_10234643 | |||
| 2135 | Ga0111539_10315446 | |||
| 2136 | Ga0111539_10415906 | |||
| 2137 | Ga0105245_10000326 | |||
| 2138 | Ga0105245_10003113 | |||
| 2139 | Ga0105245_10006170 | |||
| 2140 | Ga0105245_10062960 | |||
| 2141 | Ga0105247_10000668 | |||
| 2142 | Ga0105247_10006488 | |||
| 2143 | Ga0105247_10016387 | |||
| 2144 | Ga0105247_10108498 | |||
| 2145 | Ga0114129_10044265 | |||
| 2146 | Ga0114129_10144129 | |||
| 2147 | Ga0114129_10590189 | |||
| 2148 | Ga0105243_10024838 | |||
| 2149 | Ga0105241_10013600 | |||
| 2150 | Ga0105241_10031106 | |||
| 2151 | Ga0105241_10101356 | |||
| 2152 | Ga0105241_10351517 | |||
| 2153 | Ga0105242_10000991 | |||
| 2154 | Ga0105242_10004538 | |||
| 2155 | Ga0105242_10013402 | |||
| 2156 | Ga0105248_10000001 | |||
| 2157 | Ga0105248_10000123 | |||
| 2158 | Ga0105248_10000159 | |||
| 2159 | Ga0105248_10000516 | |||
| 2160 | Ga0105248_10001489 | |||
| 2161 | Ga0105248_10001737 | |||
| 2162 | Ga0105248_10008337 | |||
| 2163 | Ga0105248_10023976 | |||
| 2164 | Ga0105248_10024334 | |||
| 2165 | Ga0105248_10026848 | |||
| 2166 | Ga0105248_10058452 | |||
| 2167 | Ga0105248_10113116 | |||
| 2168 | Ga0105248_10182660 | |||
| 2169 | Ga0105248_10186208 | |||
| 2170 | Ga0105248_10279034 | |||
| 2171 | Ga0105237_10016895 | |||
| 2172 | Ga0105237_10018114 | |||
| 2173 | Ga0105237_10160027 | |||
| 2174 | Ga0105237_10388158 | |||
| 2175 | Ga0105238_10006259 | |||
| 2176 | Ga0105238_10013529 | |||
| 2177 | Ga0105238_10014921 | |||
| 2178 | Ga0105238_10022470 | |||
| 2179 | Ga0105238_10029292 | |||
| 2180 | Ga0105238_10089598 | |||
| 2181 | Ga0105238_10280028 | |||
| 2182 | Ga0105249_10005221 | |||
| 2183 | Ga0105249_10008214 | |||
| 2184 | Ga0105249_10020199 | |||
| 2185 | Ga0105249_10054338 | |||
| 2186 | Ga0105249_10087387 | |||
| 2187 | Ga0105249_10107216 | |||
| 2188 | Ga0105249_10180266 | |||
| 2189 | Ga0105249_10472483 | |||
| 2190 | Ga0105239_10000221 | |||
| 2191 | Ga0105239_10018893 | |||
| 2192 | Ga0105239_10044346 | |||
| 2193 | Ga0105239_10082240 | |||
| 2194 | Ga0105239_10100766 | |||
| 2195 | Ga0105239_10110588 | |||
| 2196 | Ga0157327_1001018 | |||
| 2197 | Ga0157373_10001328 | |||
| 2198 | Ga0157373_10005545 | |||
| 2199 | Ga0157373_10010426 | |||
| 2200 | Ga0157373_10010771 | |||
| 2201 | Ga0157373_10042515 | |||
| 2202 | Ga0157373_10101482 | |||
| 2203 | Ga0157373_10131181 | |||
| 2204 | Ga0157373_10140085 | |||
| 2205 | Ga0157373_10165370 | |||
| 2206 | Ga0157371_10000784 | |||
| 2207 | Ga0157371_10041345 | |||
| 2208 | Ga0157371_10117260 | |||
| 2209 | Ga0157371_10226202 | |||
| 2210 | Ga0157370_10033453 | |||
| 2211 | Ga0157370_10060396 | |||
| 2212 | Ga0157370_10224077 | |||
| 2213 | Ga0157369_10000385 | |||
| 2214 | Ga0157369_10015115 | |||
| 2215 | Ga0157369_10016270 | |||
| 2216 | Ga0157369_10028551 | |||
| 2217 | Ga0157369_10098254 | |||
| 2218 | Ga0157369_10101663 | |||
| 2219 | Ga0157369_10144238 | |||
| 2220 | Ga0157369_10531001 | |||
| 2221 | Ga0157374_10016363 | |||
| 2222 | Ga0157374_10038823 | |||
| 2223 | Ga0157374_10047960 | |||
| 2224 | Ga0157378_10048179 | |||
| 2225 | Ga0157378_10061412 | |||
| 2226 | Ga0157378_10104811 | |||
| 2227 | Ga0163162_10044909 | |||
| 2228 | Ga0163162_10117588 | |||
| 2229 | Ga0163162_10198346 | |||
| 2230 | Ga0163162_10387446 | |||
| 2231 | Ga0163162_10545758 | |||
| 2232 | Ga0157372_10008989 | |||
| 2233 | Ga0157372_10155586 | |||
| 2234 | Ga0157375_10002431 | |||
| 2235 | Ga0157375_10003764 | |||
| 2236 | Ga0157375_10039336 | |||
| 2237 | Ga0163163_10000338 | |||
| 2238 | Ga0163163_10001060 | |||
| 2239 | Ga0163163_10006099 | |||
| 2240 | Ga0163163_10013742 | |||
| 2241 | Ga0163163_10103120 | |||
| 2242 | Ga0163163_10137440 | |||
| 2243 | Ga0163163_10210444 | |||
| 2244 | Ga0163163_10261292 | |||
| 2245 | Ga0163163_10262561 | |||
| 2246 | Ga0163163_10321634 | |||
| 2247 | Ga0157380_10002546 | |||
| 2248 | Ga0157380_10008597 | |||
| 2249 | Ga0157380_10009442 | |||
| 2250 | Ga0157380_10014739 | |||
| 2251 | Ga0157380_10080210 | |||
| 2252 | Ga0157380_10093079 | |||
| 2253 | Ga0157377_10023595 | |||
| 2254 | Ga0157377_10099818 | |||
| 2255 | Ga0157379_10001118 | |||
| 2256 | Ga0157379_10001552 | |||
| 2257 | Ga0157379_10002249 | |||
| 2258 | Ga0157379_10002695 | |||
| 2259 | Ga0157379_10010858 | |||
| 2260 | Ga0157379_10012631 | |||
| 2261 | Ga0157379_10046072 | |||
| 2262 | Ga0157379_10054531 | |||
| 2263 | Ga0157379_10087356 | |||
| 2264 | Ga0157379_10092777 | |||
| 2265 | Ga0157379_10149029 | |||
| 2266 | Ga0157379_10364823 | |||
| 2267 | Ga0157376_10015671 | |||
| 2268 | Ga0163161_10010609 | |||
| 2269 | Ga0213872_10000095 | |||
| 2270 | Ga0213872_10015461 | |||
| 2271 | Ga0213872_10033658 | |||
| 2272 | Ga0213876_10012133 | |||
| 2273 | Ga0209148_1012167 | |||
| 2274 | Ga0209676_1000019 | |||
| 2275 | Ga0209758_1000036 | |||
| 2276 | Ga0209050_1011605 | |||
| 2277 | Ga0207697_10000584 | |||
| 2278 | Ga0207696_1018269 | |||
| 2279 | Ga0207682_10000453 | |||
| 2280 | Ga0207682_10001897 | |||
| 2281 | Ga0207642_10016122 | |||
| 2282 | Ga0207710_10000722 | |||
| 2283 | Ga0207710_10013135 | |||
| 2284 | Ga0207688_10001613 | |||
| 2285 | Ga0207688_10010810 | |||
| 2286 | Ga0207680_10001404 | |||
| 2287 | Ga0207680_10003774 | |||
| 2288 | Ga0207680_10007639 | |||
| 2289 | Ga0207680_10013386 | |||
| 2290 | Ga0207680_10150050 | |||
| 2291 | Ga0207680_10154525 | |||
| 2292 | Ga0207647_10000575 | |||
| 2293 | Ga0207647_10033358 | |||
| 2294 | Ga0207647_10050223 | |||
| 2295 | Ga0207647_10094731 | |||
| 2296 | Ga0207685_10062992 | |||
| 2297 | Ga0207699_10000598 | |||
| 2298 | Ga0207645_10017137 | |||
| 2299 | Ga0207645_10035085 | |||
| 2300 | Ga0207643_10012861 | |||
| 2301 | Ga0207643_10099665 | |||
| 2302 | Ga0207705_10000059 | |||
| 2303 | Ga0207705_10000260 | |||
| 2304 | Ga0207705_10001692 | |||
| 2305 | Ga0207705_10003911 | |||
| 2306 | Ga0207705_10004275 | |||
| 2307 | Ga0207705_10007630 | |||
| 2308 | Ga0207705_10011851 | |||
| 2309 | Ga0207705_10012858 | |||
| 2310 | Ga0207705_10015880 | |||
| 2311 | Ga0207705_10031663 | |||
| 2312 | Ga0207705_10048019 | |||
| 2313 | Ga0207705_10053153 | |||
| 2314 | Ga0207705_10065689 | |||
| 2315 | Ga0207705_10080162 | |||
| 2316 | Ga0207705_10099364 | |||
| 2317 | Ga0207705_10123701 | |||
| 2318 | Ga0207684_10029412 | |||
| 2319 | Ga0207654_10112503 | |||
| 2320 | Ga0207707_10033485 | |||
| 2321 | Ga0207695_10000012 | |||
| 2322 | Ga0207695_10006706 | |||
| 2323 | Ga0207695_10010547 | |||
| 2324 | Ga0207695_10022543 | |||
| 2325 | Ga0207695_10053694 | |||
| 2326 | Ga0207695_10057609 | |||
| 2327 | Ga0207695_10099801 | |||
| 2328 | Ga0207695_10149758 | |||
| 2329 | Ga0207695_10166656 | |||
| 2330 | Ga0207695_10174746 | |||
| 2331 | Ga0207695_10385441 | |||
| 2332 | Ga0207671_10050560 | |||
| 2333 | Ga0207671_10067584 | |||
| 2334 | Ga0207693_10000007 | |||
| 2335 | Ga0207693_10000052 | |||
| 2336 | Ga0207693_10071651 | |||
| 2337 | Ga0207663_10144738 | |||
| 2338 | Ga0207660_10001180 | |||
| 2339 | Ga0207660_10006502 | |||
| 2340 | Ga0207660_10023204 | |||
| 2341 | Ga0207660_10040427 | |||
| 2342 | Ga0207660_10122121 | |||
| 2343 | Ga0207660_10172271 | |||
| 2344 | Ga0207657_10000031 | |||
| 2345 | Ga0207657_10006220 | |||
| 2346 | Ga0207657_10006383 | |||
| 2347 | Ga0207657_10011019 | |||
| 2348 | Ga0207657_10015222 | |||
| 2349 | Ga0207657_10019527 | |||
| 2350 | Ga0207657_10059926 | |||
| 2351 | Ga0207649_10000112 | |||
| 2352 | Ga0207649_10000394 | |||
| 2353 | Ga0207649_10010690 | |||
| 2354 | Ga0207649_10012162 | |||
| 2355 | Ga0207649_10012291 | |||
| 2356 | Ga0207649_10014810 | |||
| 2357 | Ga0207649_10292555 | |||
| 2358 | Ga0207652_10021635 | |||
| 2359 | Ga0207652_10030193 | |||
| 2360 | Ga0207652_10072121 | |||
| 2361 | Ga0207652_10083464 | |||
| 2362 | Ga0207652_10118948 | |||
| 2363 | Ga0207652_10174123 | |||
| 2364 | Ga0207652_10178769 | |||
| 2365 | Ga0207652_10232298 | |||
| 2366 | Ga0207652_10238570 | |||
| 2367 | Ga0207646_10024779 | |||
| 2368 | Ga0207681_10001333 | |||
| 2369 | Ga0207681_10003060 | |||
| 2370 | Ga0207681_10004527 | |||
| 2371 | Ga0207681_10042703 | |||
| 2372 | Ga0207681_10127386 | |||
| 2373 | Ga0207694_10000055 | |||
| 2374 | Ga0207694_10000526 | |||
| 2375 | Ga0207694_10003458 | |||
| 2376 | Ga0207694_10016498 | |||
| 2377 | Ga0207694_10070641 | |||
| 2378 | Ga0207694_10075804 | |||
| 2379 | Ga0207694_10153788 | |||
| 2380 | Ga0207694_10248405 | |||
| 2381 | Ga0207694_10380643 | |||
| 2382 | Ga0207650_10000350 | |||
| 2383 | Ga0207650_10001366 | |||
| 2384 | Ga0207650_10001451 | |||
| 2385 | Ga0207650_10002939 | |||
| 2386 | Ga0207650_10004442 | |||
| 2387 | Ga0207650_10007278 | |||
| 2388 | Ga0207650_10017000 | |||
| 2389 | Ga0207650_10031318 | |||
| 2390 | Ga0207650_10033598 | |||
| 2391 | Ga0207650_10040601 | |||
| 2392 | Ga0207650_10192941 | |||
| 2393 | Ga0207650_10230402 | |||
| 2394 | Ga0207659_10001907 | |||
| 2395 | Ga0207659_10058251 | |||
| 2396 | Ga0207687_10002526 | |||
| 2397 | Ga0207687_10042578 | |||
| 2398 | Ga0207687_10160106 | |||
| 2399 | Ga0207700_10000015 | |||
| 2400 | Ga0207700_10008151 | |||
| 2401 | Ga0207700_10040061 | |||
| 2402 | Ga0207700_10057060 | |||
| 2403 | Ga0207664_10025456 | |||
| 2404 | Ga0207664_10143186 | |||
| 2405 | Ga0207644_10000153 | |||
| 2406 | Ga0207644_10000954 | |||
| 2407 | Ga0207644_10002867 | |||
| 2408 | Ga0207644_10004200 | |||
| 2409 | Ga0207644_10005195 | |||
| 2410 | Ga0207644_10012164 | |||
| 2411 | Ga0207644_10020767 | |||
| 2412 | Ga0207644_10021850 | |||
| 2413 | Ga0207644_10042575 | |||
| 2414 | Ga0207644_10045488 | |||
| 2415 | Ga0207644_10113914 | |||
| 2416 | Ga0207644_10147139 | |||
| 2417 | Ga0207644_10229199 | |||
| 2418 | Ga0207644_10258551 | |||
| 2419 | Ga0207690_10000132 | |||
| 2420 | Ga0207690_10000382 | |||
| 2421 | Ga0207690_10002417 | |||
| 2422 | Ga0207690_10002543 | |||
| 2423 | Ga0207690_10003206 | |||
| 2424 | Ga0207690_10029122 | |||
| 2425 | Ga0207690_10038583 | |||
| 2426 | Ga0207690_10082426 | |||
| 2427 | Ga0207690_10130552 | |||
| 2428 | Ga0207706_10000028 | |||
| 2429 | Ga0207706_10002096 | |||
| 2430 | Ga0207706_10008999 | |||
| 2431 | Ga0207706_10019364 | |||
| 2432 | Ga0207706_10024040 | |||
| 2433 | Ga0207706_10062316 | |||
| 2434 | Ga0207706_10142626 | |||
| 2435 | Ga0207686_10057220 | |||
| 2436 | Ga0207709_10062657 | |||
| 2437 | Ga0207670_10040007 | |||
| 2438 | Ga0207669_10004855 | |||
| 2439 | Ga0207669_10068479 | |||
| 2440 | Ga0207704_10087298 | |||
| 2441 | Ga0207704_10203047 | |||
| 2442 | Ga0207665_10004501 | |||
| 2443 | Ga0207665_10007716 | |||
| 2444 | Ga0207691_10000143 | |||
| 2445 | Ga0207691_10013013 | |||
| 2446 | Ga0207691_10054524 | |||
| 2447 | Ga0207691_10157892 | |||
| 2448 | Ga0207691_10264950 | |||
| 2449 | Ga0207711_10000001 | |||
| 2450 | Ga0207711_10000100 | |||
| 2451 | Ga0207711_10000500 | |||
| 2452 | Ga0207711_10001375 | |||
| 2453 | Ga0207711_10001810 | |||
| 2454 | Ga0207711_10002836 | |||
| 2455 | Ga0207711_10005132 | |||
| 2456 | Ga0207711_10005966 | |||
| 2457 | Ga0207711_10006042 | |||
| 2458 | Ga0207711_10009820 | |||
| 2459 | Ga0207711_10016947 | |||
| 2460 | Ga0207711_10030815 | |||
| 2461 | Ga0207711_10114514 | |||
| 2462 | Ga0207711_10204995 | |||
| 2463 | Ga0207689_10000092 | |||
| 2464 | Ga0207689_10006575 | |||
| 2465 | Ga0207689_10168800 | |||
| 2466 | Ga0207689_10245723 | |||
| 2467 | Ga0207661_10003597 | |||
| 2468 | Ga0207661_10004356 | |||
| 2469 | Ga0207661_10051724 | |||
| 2470 | Ga0207661_10072094 | |||
| 2471 | Ga0207661_10312576 | |||
| 2472 | Ga0207679_10000488 | |||
| 2473 | Ga0207679_10004617 | |||
| 2474 | Ga0207679_10007146 | |||
| 2475 | Ga0207679_10061457 | |||
| 2476 | Ga0207679_10072064 | |||
| 2477 | Ga0207679_10088583 | |||
| 2478 | Ga0207679_10124462 | |||
| 2479 | Ga0207679_10291479 | |||
| 2480 | Ga0207667_10000068 | |||
| 2481 | Ga0207667_10003386 | |||
| 2482 | Ga0207667_10006235 | |||
| 2483 | Ga0207667_10014559 | |||
| 2484 | Ga0207667_10019487 | |||
| 2485 | Ga0207667_10023984 | |||
| 2486 | Ga0207667_10041974 | |||
| 2487 | Ga0207667_10043597 | |||
| 2488 | Ga0207667_10068586 | |||
| 2489 | Ga0207667_10070757 | |||
| 2490 | Ga0207667_10113280 | |||
| 2491 | Ga0207667_10115913 | |||
| 2492 | Ga0207667_10127380 | |||
| 2493 | Ga0207651_10000176 | |||
| 2494 | Ga0207651_10004585 | |||
| 2495 | Ga0207651_10006875 | |||
| 2496 | Ga0207651_10007344 | |||
| 2497 | Ga0207651_10008312 | |||
| 2498 | Ga0207651_10014015 | |||
| 2499 | Ga0207651_10072242 | |||
| 2500 | Ga0207651_10119160 | |||
| 2501 | Ga0207712_10000269 | |||
| 2502 | Ga0207712_10001855 | |||
| 2503 | Ga0207712_10003847 | |||
| 2504 | Ga0207712_10032706 | |||
| 2505 | Ga0207668_10000035 | |||
| 2506 | Ga0207668_10000080 | |||
| 2507 | Ga0207668_10024477 | |||
| 2508 | Ga0207668_10046120 | |||
| 2509 | Ga0207668_10071989 | |||
| 2510 | Ga0207640_10000423 | |||
| 2511 | Ga0207640_10000922 | |||
| 2512 | Ga0207640_10001385 | |||
| 2513 | Ga0207640_10191918 | |||
| 2514 | Ga0207658_10000300 | |||
| 2515 | Ga0207658_10000966 | |||
| 2516 | Ga0207658_10010339 | |||
| 2517 | Ga0207658_10014800 | |||
| 2518 | Ga0207658_10016561 | |||
| 2519 | Ga0207658_10033830 | |||
| 2520 | Ga0207658_10045204 | |||
| 2521 | Ga0207658_10058268 | |||
| 2522 | Ga0207658_10183459 | |||
| 2523 | Ga0207677_10051313 | |||
| 2524 | Ga0207677_10057162 | |||
| 2525 | Ga0207703_10000273 | |||
| 2526 | Ga0207703_10000515 | |||
| 2527 | Ga0207703_10001587 | |||
| 2528 | Ga0207703_10003524 | |||
| 2529 | Ga0207703_10004802 | |||
| 2530 | Ga0207703_10007602 | |||
| 2531 | Ga0207703_10014105 | |||
| 2532 | Ga0207703_10016679 | |||
| 2533 | Ga0207703_10022556 | |||
| 2534 | Ga0207703_10032227 | |||
| 2535 | Ga0207703_10099612 | |||
| 2536 | Ga0207703_10156353 | |||
| 2537 | Ga0207703_10163377 | |||
| 2538 | Ga0207639_10000131 | |||
| 2539 | Ga0207639_10000608 | |||
| 2540 | Ga0207639_10005686 | |||
| 2541 | Ga0207639_10018014 | |||
| 2542 | Ga0207639_10022568 | |||
| 2543 | Ga0207639_10036872 | |||
| 2544 | Ga0207639_10041904 | |||
| 2545 | Ga0207678_10005050 | |||
| 2546 | Ga0207678_10036093 | |||
| 2547 | Ga0207678_10067806 | |||
| 2548 | Ga0207678_10077304 | |||
| 2549 | Ga0207678_10231032 | |||
| 2550 | Ga0207678_10234459 | |||
| 2551 | Ga0207702_10000011 | |||
| 2552 | Ga0207702_10000247 | |||
| 2553 | Ga0207702_10000465 | |||
| 2554 | Ga0207702_10004072 | |||
| 2555 | Ga0207702_10011347 | |||
| 2556 | Ga0207702_10015773 | |||
| 2557 | Ga0207702_10027235 | |||
| 2558 | Ga0207702_10042865 | |||
| 2559 | Ga0207702_10066763 | |||
| 2560 | Ga0207702_10082576 | |||
| 2561 | Ga0207702_10108242 | |||
| 2562 | Ga0207702_10138457 | |||
| 2563 | Ga0207702_10153119 | |||
| 2564 | Ga0207641_10000067 | |||
| 2565 | Ga0207641_10000221 | |||
| 2566 | Ga0207641_10003540 | |||
| 2567 | Ga0207641_10005042 | |||
| 2568 | Ga0207641_10005367 | |||
| 2569 | Ga0207641_10011553 | |||
| 2570 | Ga0207641_10013846 | |||
| 2571 | Ga0207641_10031905 | |||
| 2572 | Ga0207641_10036437 | |||
| 2573 | Ga0207641_10051295 | |||
| 2574 | Ga0207641_10051908 | |||
| 2575 | Ga0207641_10064790 | |||
| 2576 | Ga0207641_10344348 | |||
| 2577 | Ga0207648_10010642 | |||
| 2578 | Ga0207648_10011747 | |||
| 2579 | Ga0207648_10027465 | |||
| 2580 | Ga0207676_10000501 | |||
| 2581 | Ga0207676_10000970 | |||
| 2582 | Ga0207676_10002026 | |||
| 2583 | Ga0207676_10003162 | |||
| 2584 | Ga0207676_10004385 | |||
| 2585 | Ga0207676_10019165 | |||
| 2586 | Ga0207676_10135140 | |||
| 2587 | Ga0207676_10232763 | |||
| 2588 | Ga0207676_10444329 | |||
| 2589 | Ga0207674_10000002 | |||
| 2590 | Ga0207674_10000289 | |||
| 2591 | Ga0207674_10002652 | |||
| 2592 | Ga0207674_10006972 | |||
| 2593 | Ga0207674_10020324 | |||
| 2594 | Ga0207674_10045599 | |||
| 2595 | Ga0207674_10052612 | |||
| 2596 | Ga0207674_10289773 | |||
| 2597 | Ga0207675_100001358 | |||
| 2598 | Ga0207675_100010615 | |||
| 2599 | Ga0207675_100070549 | |||
| 2600 | Ga0207675_100100232 | |||
| 2601 | Ga0207675_100215026 | |||
| 2602 | Ga0207675_100341589 | |||
| 2603 | Ga0207683_10005080 | |||
| 2604 | Ga0207683_10007284 | |||
| 2605 | Ga0207683_10091340 | |||
| 2606 | Ga0207698_10000944 | |||
| 2607 | Ga0207698_10001888 | |||
| 2608 | Ga0207698_10001974 | |||
| 2609 | Ga0207698_10025187 | |||
| 2610 | Ga0207698_10028417 | |||
| 2611 | Ga0207698_10065494 | |||
| 2612 | Ga0207698_10138293 | |||
| 2613 | Ga0207698_10221799 | |||
| 2614 | Ga0209371_1001305 | |||
| 2615 | Ga0209999_1001545 | |||
| 2616 | Ga0210002_1001847 | |||
| 2617 | Ga0209983_1002070 | |||
| 2618 | Ga0209983_1005542 | |||
| 2619 | Ga0209971_1020083 | |||
| 2620 | Ga0209974_10005564 | |||
| 2621 | Ga0207428_10003010 | |||
| 2622 | Ga0207428_10018693 | |||
| 2623 | Ga0265354_1002230 | |||
| 2624 | Ga0265356_1002140 | |||
| 2625 | Ga0268266_10000003 | |||
| 2626 | Ga0268266_10000433 | |||
| 2627 | Ga0268266_10012368 | |||
| 2628 | Ga0268266_10022881 | |||
| 2629 | Ga0268266_10126578 | |||
| 2630 | Ga0268266_10154045 | |||
| 2631 | Ga0268266_10156822 | |||
| 2632 | Ga0268265_10001127 | |||
| 2633 | Ga0268265_10004921 | |||
| 2634 | Ga0268265_10017295 | |||
| 2635 | Ga0268265_10020623 | |||
| 2636 | Ga0268265_10023115 | |||
| 2637 | Ga0268265_10024930 | |||
| 2638 | Ga0268265_10073794 | |||
| 2639 | Ga0268265_10134573 | |||
| 2640 | Ga0268265_10178525 | |||
| 2641 | Ga0268265_10253489 | |||
| 2642 | Ga0268264_10000002 | |||
| 2643 | Ga0268264_10000211 | |||
| 2644 | Ga0268264_10001360 | |||
| 2645 | Ga0268264_10001461 | |||
| 2646 | Ga0268264_10005259 | |||
| 2647 | Ga0268264_10006022 | |||
| 2648 | Ga0268264_10016792 | |||
| 2649 | Ga0268264_10022226 | |||
| 2650 | Ga0268264_10022679 | |||
| 2651 | Ga0268264_10139291 | |||
| 2652 | Ga0265334_10027542 | |||
| 2653 | Ga0265338_10027623 | |||
| 2654 | Ga0265338_10045428 | |||
| 2655 | Ga0265338_10092279 | |||
| 2656 | Ga0265338_10202534 | |||
| 2657 | Ga0307511_10000702 | |||
| 2658 | Ga0307511_10019143 | |||
| 2659 | Ga0307511_10041367 | |||
| 2660 | Ga0265330_10051134 | |||
| 2661 | Ga0265325_10012767 | |||
| 2662 | Ga0265325_10024044 | |||
| 2663 | Ga0265340_10000057 | |||
| 2664 | Ga0265340_10004434 | |||
| 2665 | Ga0265339_10056129 | |||
| 2666 | Ga0265331_10000003 | |||
| 2667 | Ga0265331_10000699 | |||
| 2668 | Ga0265331_10005579 | |||
| 2669 | Ga0265331_10047123 | |||
| 2670 | Ga0265327_10000150 | |||
| 2671 | Ga0265327_10004373 | |||
| 2672 | Ga0265316_10001355 | |||
| 2673 | Ga0265316_10053447 | |||
| 2674 | Ga0265316_10070827 | |||
| 2675 | Ga0265316_10089788 | |||
| 2676 | Ga0265316_10188160 | |||
| 2677 | Ga0307513_10000053 | |||
| 2678 | Ga0307513_10007003 | |||
| 2679 | Ga0307513_10016636 | |||
| 2680 | Ga0307513_10021089 | |||
| 2681 | Ga0307513_10023455 | |||
| 2682 | Ga0307513_10030889 | |||
| 2683 | Ga0307513_10036720 | |||
| 2684 | Ga0307513_10243362 | |||
| 2685 | Ga0307509_10000080 | |||
| 2686 | Ga0307509_10005263 | |||
| 2687 | Ga0307408_100000027 | |||
| 2688 | Ga0307408_100025262 | |||
| 2689 | Ga0307408_100028628 | |||
| 2690 | Ga0307408_100053473 | |||
| 2691 | Ga0307408_100056503 | |||
| 2692 | Ga0307408_100156577 | |||
| 2693 | Ga0307408_100191565 | |||
| 2694 | Ga0307408_100341720 | |||
| 2695 | Ga0265313_10008061 | |||
| 2696 | Ga0265313_10091213 | |||
| 2697 | Ga0307508_10100667 | |||
| 2698 | Ga0307514_10177556 | |||
| 2699 | Ga0316579_10043800 | |||
| 2700 | Ga0265314_10000144 | |||
| 2701 | Ga0265314_10013734 | |||
| 2702 | Ga0265342_10003874 | |||
| 2703 | Ga0265342_10079805 | |||
| 2704 | Ga0316576_10001484 | |||
| 2705 | Ga0316576_10114326 | |||
| 2706 | Ga0316578_10081503 | |||
| 2707 | Ga0307516_10000373 | |||
| 2708 | Ga0307405_10004908 | |||
| 2709 | Ga0307405_10006394 | |||
| 2710 | Ga0307405_10007913 | |||
| 2711 | Ga0307405_10017942 | |||
| 2712 | Ga0307405_10019010 | |||
| 2713 | Ga0307405_10024043 | |||
| 2714 | Ga0307405_10031889 | |||
| 2715 | Ga0307405_10092545 | |||
| 2716 | Ga0307405_10138807 | |||
| 2717 | Ga0307405_10155671 | |||
| 2718 | Ga0316577_10021927 | |||
| 2719 | Ga0307413_10002489 | |||
| 2720 | Ga0307413_10002573 | |||
| 2721 | Ga0307413_10005899 | |||
| 2722 | Ga0307413_10009767 | |||
| 2723 | Ga0307413_10010047 | |||
| 2724 | Ga0307413_10014725 | |||
| 2725 | Ga0307413_10039773 | |||
| 2726 | Ga0307413_10054577 | |||
| 2727 | Ga0307413_10060391 | |||
| 2728 | Ga0307413_10090775 | |||
| 2729 | Ga0307413_10099200 | |||
| 2730 | Ga0307413_10252446 | |||
| 2731 | Ga0307410_10000175 | |||
| 2732 | Ga0307410_10000545 | |||
| 2733 | Ga0307410_10001188 | |||
| 2734 | Ga0307410_10003532 | |||
| 2735 | Ga0307410_10006146 | |||
| 2736 | Ga0307410_10010793 | |||
| 2737 | Ga0307410_10012638 | |||
| 2738 | Ga0307410_10034934 | |||
| 2739 | Ga0307410_10051814 | |||
| 2740 | Ga0307410_10073487 | |||
| 2741 | Ga0307410_10088707 | |||
| 2742 | Ga0307410_10112788 | |||
| 2743 | Ga0307410_10152653 | |||
| 2744 | Ga0307410_10333818 | |||
| 2745 | Ga0307406_10015494 | |||
| 2746 | Ga0307406_10021032 | |||
| 2747 | Ga0307406_10028133 | |||
| 2748 | Ga0307406_10038973 | |||
| 2749 | Ga0307406_10143549 | |||
| 2750 | Ga0307407_10000303 | |||
| 2751 | Ga0307407_10003997 | |||
| 2752 | Ga0307407_10004468 | |||
| 2753 | Ga0307407_10006848 | |||
| 2754 | Ga0307407_10012812 | |||
| 2755 | Ga0307407_10049138 | |||
| 2756 | Ga0307407_10056095 | |||
| 2757 | Ga0307407_10136796 | |||
| 2758 | Ga0307412_10006021 | |||
| 2759 | Ga0307412_10009278 | |||
| 2760 | Ga0307412_10028265 | |||
| 2761 | Ga0307412_10032337 | |||
| 2762 | Ga0307412_10076487 | |||
| 2763 | Ga0307412_10081648 | |||
| 2764 | Ga0307412_10177723 | |||
| 2765 | Ga0307409_100001912 | |||
| 2766 | Ga0307409_100005400 | |||
| 2767 | Ga0307409_100007431 | |||
| 2768 | Ga0307409_100007713 | |||
| 2769 | Ga0307409_100008635 | |||
| 2770 | Ga0307409_100009145 | |||
| 2771 | Ga0307409_100014898 | |||
| 2772 | Ga0307409_100043833 | |||
| 2773 | Ga0307409_100045472 | |||
| 2774 | Ga0307409_100063632 | |||
| 2775 | Ga0307409_100084021 | |||
| 2776 | Ga0307409_100113299 | |||
| 2777 | Ga0307409_100147805 | |||
| 2778 | Ga0307409_100207302 | |||
| 2779 | Ga0307409_100209835 | |||
| 2780 | Ga0307416_100001201 | |||
| 2781 | Ga0307416_100006793 | |||
| 2782 | Ga0307416_100026619 | |||
| 2783 | Ga0307416_100037169 | |||
| 2784 | Ga0307416_100041564 | |||
| 2785 | Ga0307416_100117585 | |||
| 2786 | Ga0307416_100124866 | |||
| 2787 | Ga0307416_100148304 | |||
| 2788 | Ga0307416_100163898 | |||
| 2789 | Ga0307416_100249106 | |||
| 2790 | Ga0307416_100392345 | |||
| 2791 | Ga0307414_10000602 | |||
| 2792 | Ga0307414_10010053 | |||
| 2793 | Ga0307414_10013053 | |||
| 2794 | Ga0307414_10014003 | |||
| 2795 | Ga0307414_10014223 | |||
| 2796 | Ga0307414_10015455 | |||
| 2797 | Ga0307414_10022036 | |||
| 2798 | Ga0307414_10023693 | |||
| 2799 | Ga0307414_10099754 | |||
| 2800 | Ga0307414_10101626 | |||
| 2801 | Ga0307414_10102648 | |||
| 2802 | Ga0307414_10107239 | |||
| 2803 | Ga0307414_10152594 | |||
| 2804 | Ga0307414_10176785 | |||
| 2805 | Ga0307414_10312943 | |||
| 2806 | Ga0307411_10001321 | |||
| 2807 | Ga0307411_10001648 | |||
| 2808 | Ga0307411_10003440 | |||
| 2809 | Ga0307411_10004197 | |||
| 2810 | Ga0307411_10017429 | |||
| 2811 | Ga0307411_10020865 | |||
| 2812 | Ga0307411_10029260 | |||
| 2813 | Ga0307411_10029612 | |||
| 2814 | Ga0307411_10039979 | |||
| 2815 | Ga0307411_10047799 | |||
| 2816 | Ga0307411_10098570 | |||
| 2817 | Ga0307411_10127528 | |||
| 2818 | Ga0307411_10133798 | |||
| 2819 | Ga0307411_10204037 | |||
| 2820 | Ga0307411_10264840 | |||
| 2821 | Ga0307415_100000189 | |||
| 2822 | Ga0307415_100015269 | |||
| 2823 | Ga0307415_100020507 | |||
| 2824 | Ga0307415_100033778 | |||
| 2825 | Ga0307415_100087554 | |||
| 2826 | Ga0307415_100119412 | |||
| 2827 | Ga0307415_100121330 | |||
| 2828 | Ga0373934_0072203 | |||
| 2829 | Ga0373923_0001884 | |||
| 2830 | Ga0373936_0003587 | |||
| 2831 | Ga0373939_0034685 | |||
| 2832 | Ga0373939_0046249 | |||
| 2833 | Ga0373956_0089620 | |||
| 2834 | Ga0373943_0004047 | |||
| 2835 | Ga0373946_0026404 | |||
| 2836 | Ga0373946_0031247 | |||
| 2837 | Ga0373955_0004423 | |||
| 2838 | Ga0373955_0100628 | |||
| 2839 | Ga0316574_0000061 | |||
| 2840 | Ga0316574_0125439 | |||
| 2841 | Ga0373931_0031688 | |||
| 2842 | Ga0373935_0074051 | |||
| 2843 | Ga0373935_0131372 | |||
| 2844 | Ga0373927_0000579 | |||
| 2845 | Ga0373927_0023218 | |||
| 2846 | Ga0373927_0083674 | |||
| 2847 | Ga0373933_0006446 | |||
| 2848 | Ga0373933_0109626 | |||
| 2849 | Ga0373947_0003842 | |||
| 2850 | Ga0373947_0009709 | |||
| 2851 | Ga0373937_0068538 | |||
| 2852 | Ga0373937_0075907 | |||
| 2853 | Ga0373937_0163606 | |||
| 2854 | Ga0373937_0300529 | |||
| 2855 | Ga0316582_0182571 | |||
| 2856 | Ga0316584_0238252 | |||
| 2857 | Ga0373925_0000032 | |||
| 2858 | Ga0373925_0299766 | |||
| 2859 | Ga0395899_0000706 | |||
| 2860 | Ga0395899_0003405 | |||
| 2861 | Ga0395899_0009462 | |||
| 2862 | Ga0395899_0012861 | |||
| 2863 | Ga0395899_0025525 | |||
| 2864 | Ga0395899_0033002 | |||
| 2865 | Ga0395899_0033147 | |||
| 2866 | Ga0395899_0041887 | |||
| 2867 | Ga0395899_0067424 | |||
| 2868 | Ga0395899_0073673 | |||
| 2869 | Ga0395899_0078064 | |||
| 2870 | Ga0395899_0105689 | |||
| 2871 | Ga0395899_0158320 | |||
| 2872 | Ga0395899_0161518 | |||
| 2873 | Ga0395900_0000161 | |||
| 2874 | Ga0395900_0000564 | |||
| 2875 | Ga0395900_0001237 | |||
| 2876 | Ga0395900_0002796 | |||
| 2877 | Ga0395900_0003293 | |||
| 2878 | Ga0395900_0008912 | |||
| 2879 | Ga0395900_0009593 | |||
| 2880 | Ga0395900_0010430 | |||
| 2881 | Ga0395900_0012370 | |||
| 2882 | Ga0395900_0012720 | |||
| 2883 | Ga0395900_0013337 | |||
| 2884 | Ga0395900_0014134 | |||
| 2885 | Ga0395900_0017498 | |||
| 2886 | Ga0395900_0027408 | |||
| 2887 | Ga0395900_0029417 | |||
| 2888 | Ga0395900_0030364 | |||
| 2889 | Ga0395900_0031449 | |||
| 2890 | Ga0395900_0040892 | |||
| 2891 | Ga0395900_0046022 | |||
| 2892 | Ga0395900_0050105 | |||
| 2893 | Ga0395900_0053986 | |||
| 2894 | Ga0395900_0065795 | |||
| 2895 | Ga0395900_0067719 | |||
| 2896 | Ga0395900_0071173 | |||
| 2897 | Ga0395900_0071585 | |||
| 2898 | Ga0395900_0072834 | |||
| 2899 | Ga0395900_0083974 | |||
| 2900 | Ga0395900_0111582 | |||
| 2901 | Ga0395900_0170170 | |||
| 2902 | Ga0395900_0197808 | |||
| 2903 | Ga0395900_0277371 | |||
| 2904 | Ga0395900_0385620 | |||
| 2905 | Ga0395900_0396975 | |||
| 2906 | Ga0395900_0586281 | |||
| 2907 | Ga0395898_0000937 | |||
| 2908 | Ga0395898_0000941 | |||
| 2909 | Ga0395898_0003514 | |||
| 2910 | Ga0395898_0006784 | |||
| 2911 | Ga0395898_0011630 | |||
| 2912 | Ga0395898_0013212 | |||
| 2913 | Ga0395898_0016800 | |||
| 2914 | Ga0395898_0019019 | |||
| 2915 | Ga0395898_0026042 | |||
| 2916 | Ga0395898_0032814 | |||
| 2917 | Ga0395898_0037999 | |||
| 2918 | Ga0395898_0063664 | |||
| 2919 | Ga0395898_0073073 | |||
| 2920 | Ga0395898_0093168 | |||
| 2921 | Ga0395898_0137221 | |||
| 2922 | Ga0395898_0201413 | |||
| 2923 | Ga0395898_0334720 | |||
| 2924 | Ga0395905_0000083 | |||
| 2925 | Ga0395905_0000120 | |||
| 2926 | Ga0395905_0002555 | |||
| 2927 | Ga0395905_0004314 | |||
| 2928 | Ga0395905_0004476 | |||
| 2929 | Ga0395905_0008284 | |||
| 2930 | Ga0395905_0010588 | |||
| 2931 | Ga0395905_0011011 | |||
| 2932 | Ga0395905_0011304 | |||
| 2933 | Ga0395905_0012589 | |||
| 2934 | Ga0395905_0014055 | |||
| 2935 | Ga0395905_0016902 | |||
| 2936 | Ga0395905_0016967 | |||
| 2937 | Ga0395905_0020231 | |||
| 2938 | Ga0395905_0023856 | |||
| 2939 | Ga0395905_0035763 | |||
| 2940 | Ga0395905_0045411 | |||
| 2941 | Ga0395905_0053044 | |||
| 2942 | Ga0395905_0062426 | |||
| 2943 | Ga0395905_0107179 | |||
| 2944 | Ga0395905_0107343 | |||
| 2945 | Ga0395905_0122928 | |||
| 2946 | Ga0395905_0142387 | |||
| 2947 | Ga0395905_0145286 | |||
| 2948 | Ga0395905_0169065 | |||
| 2949 | Ga0395905_0194796 | |||
| 2950 | Ga0395905_0255386 | |||
| 2951 | Ga0395905_0282847 | |||
| 2952 | Ga0395905_0298394 | |||
| 2953 | Ga0395905_0357729 | |||
| 2954 | Ga0436364_0395728 | |||
| 2955 | Ga0436364_0501730 | |||
| 2956 | Ga0436364_1341123 | |||
| 2957 | Ga0395901_0000276 | |||
| 2958 | Ga0395901_0001229 | |||
| 2959 | Ga0395901_0001252 | |||
| 2960 | Ga0395901_0004800 | |||
| 2961 | Ga0395901_0006565 | |||
| 2962 | Ga0395901_0009498 | |||
| 2963 | Ga0395901_0010154 | |||
| 2964 | Ga0395901_0014604 | |||
| 2965 | Ga0395901_0018714 | |||
| 2966 | Ga0395901_0020870 | |||
| 2967 | Ga0395901_0024605 | |||
| 2968 | Ga0395901_0030423 | |||
| 2969 | Ga0395901_0034405 | |||
| 2970 | Ga0395901_0039030 | |||
| 2971 | Ga0395901_0040708 | |||
| 2972 | Ga0395901_0041173 | |||
| 2973 | Ga0395901_0042757 | |||
| 2974 | Ga0395901_0043629 | |||
| 2975 | Ga0395901_0044205 | |||
| 2976 | Ga0395901_0048700 | |||
| 2977 | Ga0395901_0048854 | |||
| 2978 | Ga0395901_0064107 | |||
| 2979 | Ga0395901_0065885 | |||
| 2980 | Ga0395901_0088904 | |||
| 2981 | Ga0395901_0106327 | |||
| 2982 | Ga0395901_0134696 | |||
| 2983 | Ga0395901_0147081 | |||
| 2984 | Ga0395901_0153857 | |||
| 2985 | Ga0395901_0181472 | |||
| 2986 | Ga0395901_0269503 | |||
| 2987 | Ga0395901_0308312 | |||
| 2988 | Ga0395901_0388821 | |||
| 2989 | Ga0436365_1773598 | |||
| 2990 | Ga0436361_0004926 | |||
| 2991 | Ga0436361_0065571 | |||
| 2992 | Ga0436361_0118183 | |||
| 2993 | Ga0436361_0205215 | |||
| 2994 | Ga0436361_0866516 | |||
| 2995 | Ga0436361_1168029 | |||
| 2996 | Ga0436363_0550910 | |||
| 2997 | Ga0436363_0571997 | |||
| 2998 | Ga0439453_0008562 | |||
| 2999 | Ga0439466_0006862 | |||
| 3000 | Ga0451800_0302824 | |||
| 3001 | Ga0451849_1565031 | |||
| 3002 | Ga0439445_0003832 | |||
| 3003 | Ga0439448_0004443 | |||
| 3004 | Ga0439456_006236 | |||
| 3005 | Ga0450911_000007 | |||
| 3006 | Ga0450920_000278 | |||
| 3007 | Ga0450923_002228 | |||
| 3008 | Ga0450895_003634 | |||
| 3009 | Ga0450896_002559 | |||
| 3010 | Ga0450904_000067 | |||
| 3011 | Ga0450905_000582 | |||
| 3012 | Ga0450889_000141 | |||
| 3013 | Ga0450910_005558 | |||
| 3014 | Ga0439446_0000383 | |||
| 3015 | Ga0439446_0001120 | |||
| 3016 | Ga0439458_0000032 | |||
| 3017 | Ga0439458_0002553 | |||
| 3018 | Ga0450908_000265 | |||
| 3019 | Ga0450908_003190 | |||
| 3020 | Ga0439434_0003438 | |||
| 3021 | Ga0439435_0001973 | |||
| 3022 | Ga0439444_0002224 | |||
| 3023 | Ga0439464_0000318 | |||
| 3024 | Ga0450916_000442 | |||
| 3025 | Ga0451577_0067545 | |||
| 3026 | Ga0466965_0101828 | |||
| 3027 | Ga0466966_0000052 | |||
| 3028 | Ga0466966_0034309 | |||
| 3029 | Ga0466966_0064283 | |||
| 3030 | Ga0466966_0081582 | |||
| 3031 | Ga0466966_0082546 | |||
| 3032 | Ga0466966_0125775 | |||
| 3033 | Ga0466961_0001787 | |||
| 3034 | Ga0466961_0011411 | |||
| 3035 | Ga0466963_0011115 | |||
| 3036 | Ga0466963_0012079 | |||
| 3037 | Ga0466963_0030107 | |||
| 3038 | Ga0466963_0086326 | |||
| 3039 | Ga0466963_0110357 | |||
| 3040 | Ga0466964_0031435 | |||
| 3041 | Ga0466964_0042256 | |||
| 3042 | Ga0453684_0000163 | |||
| 3043 | Ga0453684_0247613 | |||
| 3044 | Ga0466971_0004987 | |||
| 3045 | Ga0466971_0023710 | |||
| 3046 | Ga0466968_0002072 | |||
| 3047 | Ga0466970_0003695 | |||
| 3048 | Ga0466970_0008527 | |||
| 3049 | Ga0466957_0001514 | |||
| 3050 | Ga0466957_0006445 | |||
| 3051 | Ga0466957_0006813 | |||
| 3052 | Ga0466957_0117274 | |||
| 3053 | Ga0466960_0052762 | |||
| 3054 | Ga0466959_0047089 | |||
| 3055 | Ga0466959_0112168 | |||
| 3056 | Ga0466959_0116516 | |||
| 3057 | Ga0451576_0002793 | |||
| 3058 | Ga0451576_0014659 | |||
| 3059 | Ga0466958_0000611 | |||
| 3060 | Ga0466958_0001430 | |||
| 3061 | Ga0466958_0001793 | |||
| 3062 | Ga0466958_0004940 | |||
| 3063 | Ga0466958_0007406 | |||
| 3064 | Ga0466958_0037514 | |||
| 3065 | Ga0466958_0054753 | |||
| 3066 | Ga0466958_0092641 | |||
| 3067 | Ga0466967_0000483 | |||
| 3068 | Ga0466967_0004145 | |||
| 3069 | Ga0466967_0005217 | |||
| 3070 | Ga0466967_0030098 | |||
| 3071 | Ga0466967_0099604 | |||
| 3072 | Ga0466967_0136172 | |||
| 3073 | Ga0466967_0147006 | |||
| 3074 | Ga0466967_0159424 | |||
| 3075 | Ga0466967_0231576 | |||
| 3076 | Ga0466967_0307946 | |||
| 3077 | Ga0495592_0205628 | |||
| 3078 | Ga0495629_0058673 | |||
| 3079 | Ga0495638_0004727 | |||
| 3080 | Ga0495580_0002818 | |||
| 3081 | Ga0495580_0003423 | |||
| 3082 | Ga0495607_0073945 | |||
| 3083 | Ga0495583_0028723 | |||
| 3084 | Ga0495583_0072037 | |||
| 3085 | Ga0495606_0002415 | |||
| 3086 | Ga0495610_0035142 | |||
| 3087 | Ga0495628_0126028 | |||
| 3088 | Ga0495632_0082677 | |||
| 3089 | Ga0495643_0002441 | |||
| 3090 | Ga0495643_0009118 | |||
| 3091 | Ga0495644_0047002 | |||
| 3092 | Ga0495663_0000251 | |||
| 3093 | Ga0495663_0054613 | |||
| 3094 | Ga0495642_0016247 | |||
| 3095 | Ga0495598_0013733 | |||
| 3096 | Ga0495621_0000065 | |||
| 3097 | Ga0495621_0000335 | |||
| 3098 | Ga0495621_0006404 | |||
| 3099 | Ga0495621_0011646 | |||
| 3100 | Ga0495597_0003150 | |||
| 3101 | Ga0495622_0001712 | |||
| 3102 | Ga0495633_0048995 | |||
| 3103 | Ga0495633_0088885 | |||
| 3104 | Ga0495668_0021731 | |||
| 3105 | Ga0495668_0113705 | |||
| 3106 | Ga0495668_0139562 | |||
| 3107 | Ga0495611_0065882 | |||
| 3108 | Ga0495625_0019083 | |||
| 3109 | Ga0495625_0022933 | |||
| 3110 | Ga0495625_0033218 | |||
| 3111 | Ga0495659_0066328 | |||
| 3112 | Ga0495588_0089837 | |||
| 3113 | Ga0495623_0074196 | |||
| 3114 | Ga0495647_0037770 | |||
| 3115 | Ga0495647_0044901 | |||
| 3116 | Ga0495658_0005618 | |||
| 3117 | Ga0495669_0000885 | |||
| 3118 | Ga0495669_0002616 | |||
| 3119 | Ga0495669_0010555 | |||
| 3120 | Ga0495669_0017149 | |||
| 3121 | Ga0495669_0026244 | |||
| 3122 | Ga0495669_0032532 | |||
| 3123 | Ga0495669_0060341 | |||
| 3124 | Ga0495670_0000467 | |||
| 3125 | Ga0495671_0060155 | |||
| 3126 | Ga0495649_0001380 | |||
| 3127 | Ga0495649_0009555 | |||
| 3128 | Ga0495604_0110888 | |||
| 3129 | Ga0495636_0017966 | |||
| 3130 | Ga0495677_0007969 | |||
| 3131 | Ga0495685_037274 | |||
| 3132 | Ga0495681_0042831 | |||
| 3133 | Ga0495684_0113899 | |||
| 3134 | Ga0495686_0000007 | |||
| 3135 | Ga0495686_0145206 | |||
| 3136 | Ga0495602_0034792 | |||
| 3137 | Ga0495602_0273450 | |||
| 3138 | Ga0496100_0076279 | |||
| 3139 | Ga0496100_0214748 | |||
| 3140 | Ga0496101_0001530 | |||
| 3141 | Ga0496101_0004925 | |||
| 3142 | Ga0496101_0039685 | |||
| 3143 | Ga0496101_0303664 | |||
| 3144 | Ga0496102_0003565 | |||
| 3145 | Ga0496102_0008489 | |||
| 3146 | Ga0496102_0018960 | |||
| 3147 | Ga0496102_0132100 | |||
| 3148 | Ga0496104_0032386 | |||
| 3149 | Ga0496104_0055098 | |||
| 3150 | Ga0496104_0056808 | |||
| 3151 | Ga0496104_0336598 | |||
| 3152 | Ga0496104_0504597 | |||
| 3153 | Ga0496105_0023452 | |||
| 3154 | Ga0496105_0121608 | |||
| 3155 | Ga0496105_0206307 | |||
| 3156 | Ga0496106_0000881 | |||
| 3157 | Ga0496106_0020944 | |||
| 3158 | Ga0496106_0070256 | |||
| 3159 | Ga0496107_0002088 | |||
| 3160 | Ga0496107_0002535 | |||
| 3161 | Ga0496107_0034798 | |||
| 3162 | Ga0496107_0150026 | |||
| 3163 | Ga0496108_0006866 | |||
| 3164 | Ga0496108_0025773 | |||
| 3165 | Ga0496108_0027380 | |||
| 3166 | Ga0496108_0030881 | |||
| 3167 | Ga0496108_0031348 | |||
| 3168 | Ga0496108_0051897 | |||
| 3169 | Ga0496108_0070888 | |||
| 3170 | Ga0496109_0003841 | |||
| 3171 | Ga0496109_0007667 | |||
| 3172 | Ga0496109_0013067 | |||
| 3173 | Ga0496109_0031031 | |||
| 3174 | Ga0496109_0043330 | |||
| 3175 | Ga0496109_0043367 | |||
| 3176 | Ga0496109_0079959 | |||
| 3177 | Ga0496110_0000847 | |||
| 3178 | Ga0496110_0003016 | |||
| 3179 | Ga0496110_0009800 | |||
| 3180 | Ga0496110_0019847 | |||
| 3181 | Ga0496110_0029386 | |||
| 3182 | Ga0496110_0032481 | |||
| 3183 | Ga0496110_0096527 | |||
| 3184 | Ga0496110_0130783 | |||
| 3185 | Ga0496110_0292961 | |||
| 3186 | Ga0496111_0003138 | |||
| 3187 | Ga0496111_0005026 | |||
| 3188 | Ga0496111_0008249 | |||
| 3189 | Ga0496111_0012396 | |||
| 3190 | Ga0496111_0044338 | |||
| 3191 | Ga0496111_0047561 | |||
| 3192 | Ga0496111_0055331 | |||
| 3193 | Ga0496111_0143949 | |||
| 3194 | Ga0496112_0005760 | |||
| 3195 | Ga0496112_0008648 | |||
| 3196 | Ga0496112_0014514 | |||
| 3197 | Ga0496112_0041388 | |||
| 3198 | Ga0496112_0109951 | |||
| 3199 | Ga0496112_0185709 | |||
| 3200 | Ga0496112_0294548 | |||
| 3201 | Ga0496112_0344824 | |||
| 3202 | Ga0496113_0002271 | |||
| 3203 | Ga0496113_0007556 | |||
| 3204 | Ga0496113_0060370 | |||
| 3205 | Ga0496113_0100372 | |||
| 3206 | Ga0496113_0115289 | |||
| 3207 | Ga0496113_0252400 | |||
| 3208 | Ga0496114_0000109 | |||
| 3209 | Ga0496114_0001264 | |||
| 3210 | Ga0496114_0014914 | |||
| 3211 | Ga0496114_0016520 | |||
| 3212 | Ga0496114_0030935 | |||
| 3213 | Ga0496114_0146898 | |||
| 3214 | Ga0496115_0000447 | |||
| 3215 | Ga0496115_0000691 | |||
| 3216 | Ga0496115_0008083 | |||
| 3217 | Ga0496115_0008980 | |||
| 3218 | Ga0496117_0000706 | |||
| 3219 | Ga0496117_0006611 | |||
| 3220 | Ga0496118_0006086 | |||
| 3221 | Ga0496121_0000152 | |||
| 3222 | Ga0496121_0001030 | |||
| 3223 | Ga0496123_0090884 | |||
| 3224 | Ga0496124_0005367 | |||
| 3225 | Ga0495682_0001304 | |||
| 3226 | Ga0501032_0005037 | |||
| 3227 | Ga0501032_0052026 | |||
| 3228 | Ga0501032_0097713 | |||
| 3229 | Ga0501033_0090880 | |||
| 3230 | Ga0501034_0030391 | |||
| 3231 | Ga0501036_0007193 | |||
| 3232 | Ga0501036_0009386 | |||
| 3233 | Ga0501037_0035800 | |||
| 3234 | Ga0501038_0000135 | |||
| 3235 | Ga0501039_0008528 | |||
| 3236 | Ga0501039_0132316 | |||
| 3237 | Ga0501040_0003605 | |||
| 3238 | Ga0501040_0004637 | |||
| 3239 | Ga0501040_0035662 | |||
| 3240 | Ga0501041_0003908 | |||
| 3241 | Ga0501041_0011078 | |||
| 3242 | Ga0501041_0012729 | |||
| 3243 | Ga0501041_0036174 | |||
| 3244 | Ga0501042_0000799 | |||
| 3245 | Ga0501042_0006057 | |||
| 3246 | Ga0501042_0116361 | |||
| 3247 | Ga0501043_0036359 | |||
| 3248 | Ga0501046_0010488 | |||
| 3249 | Ga0501046_0022852 | |||
| 3250 | Ga0501046_0105494 | |||
| 3251 | Ga0501047_0032978 | |||
| 3252 | Ga0501047_0102099 | |||
| 3253 | Ga0501048_0001057 | |||
| 3254 | Ga0501048_0015262 | |||
| 3255 | Ga0501067_0000259 | |||
| 3256 | Ga0501067_0000544 | |||
| 3257 | Ga0501067_0021162 | |||
| 3258 | Ga0501068_0056910 | |||
| 3259 | Ga0501068_0057411 | |||
| 3260 | Ga0501068_0070020 | |||
| 3261 | Ga0501070_0031320 | |||
| 3262 | Ga0501070_0058976 | |||
| 3263 | Ga0501071_0029786 | |||
| 3264 | Ga0501071_0191676 | |||
| 3265 | Ga0501072_0001227 | |||
| 3266 | Ga0501072_0033612 | |||
| 3267 | Ga0501072_0143707 | |||
| 3268 | Ga0501073_0000031 | |||
| 3269 | Ga0501073_0001765 | |||
| 3270 | Ga0501073_0009721 | |||
| 3271 | Ga0501073_0049117 | |||
| 3272 | Ga0501073_0111547 | |||
| 3273 | Ga0501074_0107412 | |||
| 3274 | Ga0501075_0000698 | |||
| 3275 | Ga0501075_0113084 | |||
| 3276 | Ga0501075_0114087 | |||
| 3277 | Ga0501075_0114846 | |||
| 3278 | Ga0501076_0000465 | |||
| 3279 | Ga0501076_0001807 | |||
| 3280 | Ga0501076_0050393 | |||
| 3281 | Ga0501076_0056565 | |||
| 3282 | Ga0501076_0118784 | |||
| 3283 | Ga0501076_0146855 | |||
| 3284 | Ga0501077_0001769 | |||
| 3285 | Ga0501077_0002091 | |||
| 3286 | Ga0501077_0015802 | |||
| 3287 | Ga0501077_0197296 | |||
| 3288 | Ga0501221_007061 | |||
| 3289 | Ga0501079_0000409 | |||
| 3290 | Ga0501079_0001622 | |||
| 3291 | Ga0501079_0003562 | |||
| 3292 | Ga0501079_0017011 | |||
| 3293 | Ga0501079_0092447 | |||
| 3294 | Ga0501079_0097791 | |||
| 3295 | Ga0501080_0005598 | |||
| 3296 | Ga0501080_0006326 | |||
| 3297 | Ga0501080_0055388 | |||
| 3298 | Ga0501080_0109150 | |||
| 3299 | Ga0501080_0111106 | |||
| 3300 | Ga0501081_0000363 | |||
| 3301 | Ga0501081_0025740 | |||
| 3302 | Ga0501081_0070552 | |||
| 3303 | Ga0501081_0350417 | |||
| 3304 | Ga0501083_0013202 | |||
| 3305 | Ga0501083_0157945 | |||
| 3306 | Ga0501263_008775 | |||
| 3307 | Ga0501268_002091 | |||
| 3308 | Ga0501273_006899 | |||
| 3309 | Ga0501035_0000618 | |||
| 3310 | Ga0501035_0015401 | |||
| 3311 | Ga0501035_0030681 | |||
| 3312 | Ga0501035_0040551 | |||
| 3313 | Ga0501035_0100666 | |||
| 3314 | Ga0501035_0185967 | |||
| 3315 | Ga0501044_0001081 | |||
| 3316 | Ga0501044_0004523 | |||
| 3317 | Ga0501044_0127466 | |||
| 3318 | Ga0501045_0080094 | |||
| 3319 | Ga0501045_0088190 | |||
| 3320 | Ga0501226_000006 | |||
| 3321 | nmdc:mga03683_50937_c1 | |||
| 3322 | nmdc:mga00v17_175882_c1 | |||
| 3323 | nmdc:mga0k408_112009_c1 | |||
| 3324 | nmdc:mga06z11_17568_c1 | |||
| 3325 | nmdc:mga04h51_9183_c1 | |||
| 3326 | nmdc:mga05p37_33127_c1 | |||
| 3327 | nmdc:mga09592_1337_c1 | |||
| 3328 | nmdc:mga06r32_159_c1 | |||
| 3329 | nmdc:mga08y16_1034_c1 | |||
| 3330 | nmdc:mga08y16_114907_c1 | |||
| 3331 | nmdc:mga08y16_146877_c1 | |||
| 3332 | nmdc:mga08y16_2154_c1 | |||
| 3333 | nmdc:mga08y16_411063_c1 | |||
| 3334 | nmdc:mga08y16_472917_c1 | |||
| 3335 | nmdc:mga0n895_3766_c1 | |||
| 3336 | nmdc:mga0rr50_12004_c1 | |||
| 3337 | nmdc:mga0rr50_34091_c1 | |||
| 3338 | nmdc:mga08x19_268468_c1 | |||
| 3339 | nmdc:mga08x19_41_c1 | |||
| 3340 | nmdc:mga0a205_101691_c1 | |||
| 3341 | nmdc:mga0a205_6033_c1 | |||
| 3342 | Ga0500635_0000135 | |||
| 3343 | Ga0500578_0048163 | |||
| 3344 | Ga0500583_0011173 | |||
| 3345 | Ga0500651_0090474 | |||
| 3346 | Ga0500555_001450 | |||
| 3347 | Ga0500556_0000347 | |||
| 3348 | Ga0500595_006321 | |||
| 3349 | Ga0500595_015464 | |||
| 3350 | Ga0500614_000771 | |||
| 3351 | Ga0500658_0001563 | |||
| 3352 | Ga0500590_073402 | |||
| 3353 | Ga0500616_0000018 | |||
| 3354 | Ga0500622_0006629 | |||
| 3355 | Ga0500637_0029175 | |||
| 3356 | Ga0500596_002973 | |||
| 3357 | Ga0501084_0002732 | |||
| 3358 | Ga0501084_0003976 | |||
| 3359 | Ga0501084_0009092 | |||
| 3360 | Ga0501084_0009238 | |||
| 3361 | Ga0501082_0005061 | |||
| 3362 | Ga0501082_0032521 | |||
| 3363 | Ga0501082_0053997 | |||
| 3364 | Ga0501082_0105042 | |||
| 3365 | Ga0466962_0014551 | |||
| 3366 | Ga0530510_0000311 | |||
| 3367 | Ga0530510_0016297 | |||
| 3368 | Ga0530510_0049929 | |||
| 3369 | 2524609398 | |||
| 3370 | 2547376338 | |||
| 3371 | 2554816907 | |||
| 3372 | 2600445433 | |||
| 3373 | 2602009832 | |||
| 3374 | 2608379805 | |||
| 3375 | 2729145656 | |||
| 3376 | 2739287941 | |||
| 3377 | 2739293253 | |||
| 3378 | 2808907470 | |||
| 3379 | 2808941492 | |||
| 3380 | 2823424316 | |||
| 3381 | 2842808659 | |||
| 3382 | 2843694595 | |||
| 3383 | 2846035022 | |||
| 3384 | 2846040699 | |||
| 3385 | 2885429442 | |||
| 3386 | 2919504045 | |||
| 3387 | 2926065382 | |||
| 3388 | 2990268689 | |||
| 3389 | 2993694604 | |||
| 3390 | 2998348405 | |||
| 3391 | 3007253208 | |||
| 3392 | 3007317999 | |||
| 3393 | 640486827 | |||
| 3394 | 651174681 | |||
| 3395 | 8011356674 | |||
| 3396 | 8034965657 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7xnt-assembly1.cif.gz_C | crystal structure of pfhppd-y13161 complex | 0.9554 | 18 | 354 |
| 1cjx-assembly1.cif.gz_D | crystal structure of pseudomonas fluorescens hppd | 0.9515 | 18 | 366 |
| 7xnt-assembly1.cif.gz_G | crystal structure of pfhppd-y13161 complex | 0.9494 | 18 | 356 |
| 1cjx-assembly1.cif.gz_D | crystal structure of pseudomonas fluorescens hppd | 0.9409 | 18 | 366 |
| 7xnt-assembly1.cif.gz_C | crystal structure of pfhppd-y13161 complex | 0.9409 | 18 | 354 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1cjxD01 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.9729 | 18 | 157 | 3.10.180.10 |
| 1cjxC02 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.9686 | 171 | 366 | 3.10.180.10 |
| 1cjxC02 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.9359 | 171 | 366 | 3.10.180.10 |
| 3zgjA02 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.9293 | 174 | 360 | 3.10.180.10 |
| af_A0A1D8PHL9_249_477_3.10.180.10 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.9281 | 168 | 366 | 3.10.180.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5R2MT65-F1-model_v4 | 4-hydroxyphenylpyruvate dioxygenase | 1.004 | 175 | 254 |
GO:0003868
GO:0006572 |
| AF-A0A529ME57-F1-model_v4 | 4-hydroxyphenylpyruvate dioxygenase | 1.002 | 173 | 234 |
GO:0051213
|
| AF-A0A534IIP9-F1-model_v4 | 4-hydroxyphenylpyruvate dioxygenase | 0.9956 | 19 | 111 |
GO:0051213
|
| AF-A0A655V840-F1-model_v4 | deleted | 0.9921 | 170 | 366 |
|
| AF-A0A534BBA7-F1-model_v4 | 4-hydroxyphenylpyruvate dioxygenase | 0.9903 | 19 | 130 |
GO:0051213
|