F495386

General Info

Members Datasets Scaffolds Average Seq Length
1698 730 3396 395

Family's Representative Sequence

Representative Sequence 3300046674|Ga0495588_0041396|Ga0495588_0041396_646_2022
Length 458
Sequence MDKVMPSCLASFSREKNRKHLSQPEADQNNLKWPSRINGWHRHWEDAMQHSEQRDPETTISRRTLVHGLAVCAGATVAGASAALAQGGPXXXXVAPPSTITSPPRDFSPRGAPTTYFWDPDIIAVDPSFNDLAQPNTAIKRLYTGVLWAEGPAWSAQGRYLLWSDIPNNRQMRYSEDDGHVSVFRTPTNNSNGNSFDFQGRQLSCEHLTRRVVRYEHDGTATVLADNFGGKKLNSPNDVVAHPDGSYWFTDPPYGGQLYEGEPDVAGGPSNSGGKLNPRIGQPAGFVPGKRELPTNCYRIDPSGRIDLVVTEEQVPDPNGLCFSPDYKKLYVASTGKGPGDTGAGGKGDMFVFDVGADNKLSNHKRFSDFMVDGVKCGPDGMRCDVNGNVWAASNAGRAVGYSGVTVWSPEGKLLGRIRLPEVCGNVTFGGPKRNRLFMAASQSLYAVYTATQGAGPG

Samples

Sample ID Description Type Environment
1 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
4 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
5 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
6 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
7 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
8 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
9 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
10 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
11 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
12 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
13 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
40 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
41 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
42 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
43 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
44 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
45 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
46 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
47 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
48 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
49 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
50 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
51 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
52 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
53 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
54 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
55 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
56 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
57 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
58 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
59 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
60 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
61 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
62 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
63 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
64 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
65 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
66 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
67 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
68 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
69 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
70 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
71 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
72 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
73 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
74 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
75 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
76 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
77 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
78 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
79 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
80 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
81 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
82 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
83 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
84 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
85 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
86 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
87 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
88 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
89 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
90 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
91 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
92 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
93 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
94 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
95 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
96 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
97 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
98 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
99 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
100 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
101 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
102 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
103 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
104 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
105 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
106 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
107 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
108 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
109 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
110 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
111 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
112 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
113 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
114 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
115 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
116 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
117 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
118 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
119 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
120 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
121 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
122 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
123 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
124 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
125 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
126 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
127 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
128 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
129 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
130 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
131 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
132 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
133 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
134 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
135 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
136 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
137 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
138 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
139 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
140 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
141 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
142 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
143 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
144 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
145 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
146 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
147 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
148 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
149 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
150 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
151 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
152 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
153 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
155 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
157 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
158 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
159 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
160 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
161 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
162 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
163 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
164 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
225 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
226 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
227 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
228 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
229 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
230 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
231 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
233 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
234 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
235 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
236 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
237 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
241 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
242 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
243 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
244 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
245 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
246 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
247 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
248 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
249 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
250 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
251 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
252 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
253 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
254 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
255 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
256 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
257 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
258 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
259 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
260 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
261 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
262 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
263 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
264 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
265 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
266 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
267 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
268 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
269 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
270 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
271 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
272 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
273 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
274 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
275 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
276 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
277 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
278 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
279 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
280 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
281 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
282 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
283 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
284 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
285 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
286 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
287 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
288 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
289 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
290 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
291 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
292 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
293 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
294 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
295 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
296 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
297 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
298 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
299 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
300 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
301 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
302 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
303 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
304 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
305 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
306 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
307 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
308 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
309 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
310 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
311 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
312 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
313 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
314 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
315 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
316 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
317 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
318 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
319 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
320 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
321 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
322 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
323 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
324 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
325 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
326 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
327 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
328 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
329 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
330 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
331 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
332 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
333 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
334 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
335 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
336 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
337 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
338 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
339 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
340 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
341 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
342 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
343 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
344 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
345 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
346 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
347 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
348 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
349 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
350 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
351 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
352 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
353 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
354 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
355 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
356 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
357 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
358 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
359 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
360 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
361 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
362 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
363 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
364 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
365 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
366 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
367 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
368 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
369 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
370 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
371 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
372 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
373 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
374 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
375 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
376 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
377 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
378 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
379 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
380 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
381 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
382 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
383 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
384 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
385 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
386 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
387 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
388 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
389 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
390 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
391 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
392 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
393 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
394 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
395 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
396 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
397 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
398 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
399 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
400 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
401 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
402 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
403 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
404 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
405 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
406 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
407 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
408 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
409 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
410 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
411 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
412 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
413 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
414 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
415 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
416 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
417 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
418 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
419 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
420 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
421 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
422 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
423 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
424 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
425 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
426 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
427 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
428 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
429 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
430 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
431 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
432 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
433 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
434 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
435 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
436 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
437 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
438 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
439 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
440 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
441 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
442 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
443 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
444 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
445 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
446 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
447 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
448 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
449 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
450 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
451 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
452 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
453 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
454 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
455 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
456 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
457 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
458 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
459 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
460 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
461 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
462 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
463 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
464 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
465 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
466 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
467 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
468 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
469 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
470 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
471 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
472 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
473 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
474 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
475 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
476 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
477 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
478 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
479 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
480 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
481 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
482 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
483 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
484 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
485 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
486 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
487 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
488 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
489 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
490 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
491 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
492 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
493 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
494 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
495 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
496 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
497 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
498 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
499 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
500 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
501 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
502 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
503 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
504 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
505 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
506 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
507 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
508 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
509 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
510 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
511 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
512 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
513 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
514 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
515 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
516 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
517 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
518 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
519 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
520 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
521 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
522 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
523 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
524 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
525 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
526 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
527 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
528 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
529 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
530 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
531 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
532 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
533 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
534 2643221733 Bosea sp. Root381 Isolate Unclassified
535 2643221736 Bosea sp. Root483D1 Isolate Unclassified
536 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
537 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
538 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
539 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
540 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
541 2791355199
542 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
543 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
544 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
545 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
546 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
547 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
548 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
549 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
550 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
551 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
552 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
553 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
554 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
555 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
556 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
557 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
558 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
559 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
560 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
561 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
562 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
563 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
564 2841760612 Bosea sp. Tri-49 Isolate Nodule
565 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
566 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
567 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
568 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
569 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
570 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
571 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
572 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
573 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
574 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
575 2842677519 Variovorax sp. R-72495 Isolate Unclassified
576 2844104063 Bosea sp. Tri-39 Isolate Nodule
577 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
578 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
579 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
580 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
581 2851182111 Bosea sp. Tri-44 Isolate Nodule
582 2851246043 Bosea sp. Tri-54 Isolate Nodule
583 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
584 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
585 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
586 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
587 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
588 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
589 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
590 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
591 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
592 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
593 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
594 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
595 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
596 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
597 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
598 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
599 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
600 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
601 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
602 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
603 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
604 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
605 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
606 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
607 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
608 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
609 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
610 2906610324
611 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
612 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
613 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
614 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
615 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
616 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
617 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
618 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
619 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
620 2922368715
621 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
622 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
623 2929520902 Variovorax beijingensis 502 Isolate Unclassified
624 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
625 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
626 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
627 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
628 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
629 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
630 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
631 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
632 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
633 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
634 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
635 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
636 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
637 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
638 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
639 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
640 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
641 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
642 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
643 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
644 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
645 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
646 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
647 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
648 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
649 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
650 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
651 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
652 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
653 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
654 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
655 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
656 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
657 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
658 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
659 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
660 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
661 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
662 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
663 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
664 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
665 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
666 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
667 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
668 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
669 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
670 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
671 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
672 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
673 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
674 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
675 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
676 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
677 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
678 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
679 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
680 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
681 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
682 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
683 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
684 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
685 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
686 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
687 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
688 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
689 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
690 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
691 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
692 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
693 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
694 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
695 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
696 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
697 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
698 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
699 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
700 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
701 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
702 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
703 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
704 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
705 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
706 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
707 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
708 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
709 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
710 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
711 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
712 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
713 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
714 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
715 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
716 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
717 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
718 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
719 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
720 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
721 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
722 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
723 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
724 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
725 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
726 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
727 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
728 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
729 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule
730 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 86.84
Metatranscriptomes 0.47
Isolates 12.68

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.24
Nodule 9.89
Rhizoplane 1.71
Rhizosphere 73.91
Stem 0
Stem Tuber 0
Unclassified 0.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495588_0041396 3300046674 Bacteria 2352
2 JGI25153J46596_10004919 3300003215 Bacteria 7102
3 JGI25153J46596_10009142 3300003215 Bacteria 4643
4 JGI25160J50197_1006732 3300003354 Bacteria 4611
5 Ga0006562J51391_1066649 3300003578 Bacteria 1600
6 JGI25404J52841_10000807 3300003659 Bacteria 4986
7 Ga0055526_1000351 3300003771 Bacteria 37413
8 Ga0055526_1003504 3300003771 Bacteria 9924
9 Ga0055524_1017302 3300003775 Bacteria 2547
10 Ga0055531_10001451 3300003794 Bacteria 17509
11 Ga0058863_11485186 3300004799 Bacteria 1605
12 Ga0058862_11741190 3300004803 Bacteria 1585
13 Ga0065165_1000315 3300005262 Bacteria 78877
14 Ga0065165_1004190 3300005262 Bacteria 9191
15 Ga0065165_1004374 3300005262 Bacteria 8825
16 Ga0065712_10019103 3300005290 Bacteria 1893
17 Ga0065715_10003432 3300005293 Bacteria 5609
18 Ga0065715_10135673 3300005293 Bacteria 1934
19 Ga0065707_10104538 3300005295 Bacteria 2690
20 Ga0070658_10005778 3300005327 Bacteria 10033
21 Ga0070676_10001361 3300005328 Bacteria 12309
22 Ga0070676_10021599 3300005328 Bacteria 3603
23 Ga0070683_100000148 3300005329 Bacteria 45536
24 Ga0070683_100090147 3300005329 Bacteria 2878
25 Ga0070690_100036536 3300005330 Bacteria 3088
26 Ga0070670_100004822 3300005331 Bacteria 11333
27 Ga0070670_100007409 3300005331 Bacteria 9319
28 Ga0070670_100030845 3300005331 Bacteria 4617
29 Ga0070670_100051642 3300005331 Bacteria 3530
30 Ga0070670_100061274 3300005331 Bacteria 3230
31 Ga0068869_100002293 3300005334 Bacteria 11510
32 Ga0068869_100035258 3300005334 Bacteria 3545
33 Ga0068869_100066971 3300005334 Bacteria 2648
34 Ga0070666_10070902 3300005335 Bacteria 2371
35 Ga0070680_100028715 3300005336 Bacteria 4464
36 Ga0070680_100096632 3300005336 Bacteria 2449
37 Ga0070680_100182248 3300005336 Bacteria 1769
38 Ga0070682_100001062 3300005337 Bacteria 15844
39 Ga0070682_100102708 3300005337 Bacteria 1890
40 Ga0068868_100012987 3300005338 Bacteria 6094
41 Ga0068868_100033219 3300005338 Bacteria 3975
42 Ga0068868_100122117 3300005338 Bacteria 2126
43 Ga0068868_100213973 3300005338 Bacteria 1612
44 Ga0070660_100001081 3300005339 Bacteria 18312
45 Ga0070689_100006220 3300005340 Bacteria 8241
46 Ga0070689_100056079 3300005340 Bacteria 3054
47 Ga0070689_100150742 3300005340 Bacteria 1875
48 Ga0070689_100165079 3300005340 Bacteria 1792
49 Ga0070691_10004648 3300005341 Bacteria 6241
50 Ga0070661_100027289 3300005344 Bacteria 4110
51 Ga0070692_10000644 3300005345 Bacteria 11085
52 Ga0070668_100016305 3300005347 Bacteria 5556
53 Ga0070668_100022501 3300005347 Bacteria 4765
54 Ga0070668_100044677 3300005347 Bacteria 3398
55 Ga0070668_100103432 3300005347 Bacteria 2259
56 Ga0070668_100217851 3300005347 Bacteria 1573
57 Ga0070669_100004485 3300005353 Bacteria 10065
58 Ga0070669_100023992 3300005353 Bacteria 4370
59 Ga0070669_100085626 3300005353 Bacteria 2353
60 Ga0070669_100097169 3300005353 Bacteria 2217
61 Ga0070669_100160690 3300005353 Bacteria 1745
62 Ga0070675_100007550 3300005354 Bacteria 8409
63 Ga0070675_100070855 3300005354 Bacteria 2890
64 Ga0070671_100003514 3300005355 Bacteria 12245
65 Ga0070671_100005834 3300005355 Bacteria 9808
66 Ga0070671_100025761 3300005355 Bacteria 4829
67 Ga0070671_100037546 3300005355 Bacteria 4017
68 Ga0070671_100082387 3300005355 Bacteria 2690
69 Ga0070671_100087459 3300005355 Bacteria 2608
70 Ga0070671_100163227 3300005355 Bacteria 1883
71 Ga0070674_100001918 3300005356 Bacteria 11324
72 Ga0070674_100004825 3300005356 Bacteria 7727
73 Ga0070674_100023939 3300005356 Bacteria 3959
74 Ga0070673_100001229 3300005364 Bacteria 14826
75 Ga0070673_100002951 3300005364 Bacteria 10484
76 Ga0070673_100023904 3300005364 Bacteria 4471
77 Ga0070673_100047182 3300005364 Bacteria 3350
78 Ga0070688_100019496 3300005365 Bacteria 3930
79 Ga0070688_100042368 3300005365 Bacteria 2800
80 Ga0070688_100055492 3300005365 Bacteria 2485
81 Ga0070688_100110246 3300005365 Bacteria 1829
82 Ga0070688_100115900 3300005365 Bacteria 1788
83 Ga0070659_100000332 3300005366 Bacteria 36449
84 Ga0070667_100006087 3300005367 Bacteria 10016
85 Ga0070667_100056905 3300005367 Bacteria 3304
86 Ga0070667_100062748 3300005367 Bacteria 3148
87 Ga0070667_100128825 3300005367 Bacteria 2207
88 Ga0070667_100131034 3300005367 Bacteria 2188
89 Ga0070709_10000486 3300005434 Bacteria 23433
90 Ga0070709_10003919 3300005434 Bacteria 8026
91 Ga0070714_100022677 3300005435 Bacteria 5148
92 Ga0070713_100008432 3300005436 Bacteria 7307
93 Ga0070713_100014512 3300005436 Bacteria 5855
94 Ga0070713_100015252 3300005436 Bacteria 5734
95 Ga0070713_100073361 3300005436 Bacteria 2897
96 Ga0070713_100080178 3300005436 Bacteria 2783
97 Ga0070713_100165777 3300005436 Bacteria 1975
98 Ga0070713_100211227 3300005436 Bacteria 1757
99 Ga0070710_10000457 3300005437 Bacteria 19119
100 Ga0070701_10038351 3300005438 Bacteria 2425
101 Ga0070701_10086625 3300005438 Bacteria 1707
102 Ga0070711_100015007 3300005439 Bacteria 4895
103 Ga0070711_100088056 3300005439 Bacteria 2230
104 Ga0070711_100112754 3300005439 Bacteria 1998
105 Ga0070711_100129225 3300005439 Bacteria 1879
106 Ga0070705_100000691 3300005440 Bacteria 19245
107 Ga0070705_100005701 3300005440 Bacteria 6082
108 Ga0070705_100019458 3300005440 Bacteria 3573
109 Ga0070700_100043671 3300005441 Bacteria 2758
110 Ga0070700_100049633 3300005441 Bacteria 2606
111 Ga0070694_100007224 3300005444 Bacteria 6765
112 Ga0070694_100008499 3300005444 Bacteria 6281
113 Ga0070694_100011936 3300005444 Bacteria 5391
114 Ga0070694_100036800 3300005444 Bacteria 3244
115 Ga0070694_100058004 3300005444 Bacteria 2633
116 Ga0070708_100046751 3300005445 Bacteria 3820
117 Ga0070708_100158033 3300005445 Bacteria 2111
118 Ga0070708_100329529 3300005445 Bacteria 1438
119 Ga0070708_100348670 3300005445 Bacteria 1395
120 Ga0070663_100000839 3300005455 Bacteria 16651
121 Ga0070663_100006693 3300005455 Bacteria 6950
122 Ga0070663_100112409 3300005455 Bacteria 2048
123 Ga0070678_100009373 3300005456 Bacteria 5926
124 Ga0070678_100009392 3300005456 Bacteria 5923
125 Ga0070678_100031777 3300005456 Bacteria 3647
126 Ga0070678_100054926 3300005456 Bacteria 2905
127 Ga0070678_100059025 3300005456 Bacteria 2818
128 Ga0070678_100067797 3300005456 Bacteria 2657
129 Ga0070662_100028101 3300005457 Bacteria 3912
130 Ga0070681_10011846 3300005458 Bacteria 8645
131 Ga0070681_10031497 3300005458 Bacteria 5324
132 Ga0068867_100002014 3300005459 Bacteria 14190
133 Ga0068867_100004801 3300005459 Bacteria 9514
134 Ga0068867_100009902 3300005459 Bacteria 6716
135 Ga0068867_100033914 3300005459 Bacteria 3700
136 Ga0068867_100193652 3300005459 Bacteria 1624
137 Ga0070685_10199331 3300005466 Bacteria 1300
138 Ga0070706_100002714 3300005467 Bacteria 17715
139 Ga0070706_100016159 3300005467 Bacteria 6892
140 Ga0070706_100163515 3300005467 Bacteria 2078
141 Ga0070707_100009700 3300005468 Bacteria 8947
142 Ga0070707_100011587 3300005468 Bacteria 8225
143 Ga0070707_100024750 3300005468 Bacteria 5690
144 Ga0070707_100045864 3300005468 Bacteria 4183
145 Ga0070707_100096062 3300005468 Bacteria 2870
146 Ga0070707_100151927 3300005468 Bacteria 2255
147 Ga0070707_100164602 3300005468 Bacteria 2161
148 Ga0070707_100190679 3300005468 Bacteria 1999
149 Ga0070707_100201829 3300005468 Bacteria 1938
150 Ga0070698_100000346 3300005471 Bacteria 47866
151 Ga0070698_100003210 3300005471 Bacteria 18008
152 Ga0070698_100004552 3300005471 Bacteria 15229
153 Ga0070698_100015625 3300005471 Bacteria 8017
154 Ga0070698_100034993 3300005471 Bacteria 5194
155 Ga0070698_100041573 3300005471 Bacteria 4719
156 Ga0070698_100096598 3300005471 Bacteria 2931
157 Ga0070698_100193434 3300005471 Bacteria 1971
158 Ga0070699_100001230 3300005518 Bacteria 23625
159 Ga0070699_100024201 3300005518 Bacteria 5232
160 Ga0070699_100048342 3300005518 Bacteria 3681
161 Ga0070699_100073864 3300005518 Bacteria 2967
162 Ga0070699_100151455 3300005518 Bacteria 2052
163 Ga0070699_100153520 3300005518 Bacteria 2037
164 Ga0070699_100182081 3300005518 Bacteria 1865
165 Ga0070684_100000395 3300005535 Bacteria 29885
166 Ga0070684_100007543 3300005535 Bacteria 8469
167 Ga0070684_100018693 3300005535 Bacteria 5716
168 Ga0070684_100099998 3300005535 Bacteria 2589
169 Ga0070697_100006088 3300005536 Bacteria 9332
170 Ga0070697_100006432 3300005536 Bacteria 9093
171 Ga0070697_100091647 3300005536 Bacteria 2514
172 Ga0068853_100001226 3300005539 Bacteria 18302
173 Ga0068853_100057574 3300005539 Bacteria 3355
174 Ga0068853_100122019 3300005539 Bacteria 2325
175 Ga0068853_100287145 3300005539 Bacteria 1518
176 Ga0070672_100001304 3300005543 Bacteria 15373
177 Ga0070672_100005379 3300005543 Bacteria 8483
178 Ga0070672_100033365 3300005543 Bacteria 3898
179 Ga0070672_100047629 3300005543 Bacteria 3327
180 Ga0070672_100161932 3300005543 Bacteria 1857
181 Ga0070686_100079681 3300005544 Bacteria 2165
182 Ga0070686_100079844 3300005544 Bacteria 2163
183 Ga0070686_100103575 3300005544 Bacteria 1926
184 Ga0070686_100232646 3300005544 Bacteria 1338
185 Ga0070695_100000230 3300005545 Bacteria 27680
186 Ga0070695_100004834 3300005545 Bacteria 7931
187 Ga0070695_100004974 3300005545 Bacteria 7835
188 Ga0070695_100010605 3300005545 Bacteria 5506
189 Ga0070695_100011714 3300005545 Bacteria 5249
190 Ga0070695_100015922 3300005545 Bacteria 4545
191 Ga0070695_100044029 3300005545 Bacteria 2840
192 Ga0070695_100089625 3300005545 Bacteria 2051
193 Ga0070695_100200150 3300005545 Bacteria 1427
194 Ga0070696_100003816 3300005546 Bacteria 10062
195 Ga0070696_100008494 3300005546 Bacteria 6875
196 Ga0070696_100011186 3300005546 Bacteria 6006
197 Ga0070696_100092200 3300005546 Bacteria 2159
198 Ga0070693_100001464 3300005547 Bacteria 10643
199 Ga0070665_100007018 3300005548 Bacteria 11445
200 Ga0070665_100037546 3300005548 Bacteria 4871
201 Ga0070665_100073051 3300005548 Bacteria 3437
202 Ga0070665_100158285 3300005548 Bacteria 2267
203 Ga0070704_100005792 3300005549 Bacteria 7230
204 Ga0070704_100010222 3300005549 Bacteria 5708
205 Ga0070704_100034177 3300005549 Bacteria 3445
206 Ga0070704_100108659 3300005549 Bacteria 2106
207 Ga0070704_100127299 3300005549 Bacteria 1967
208 Ga0070704_100165462 3300005549 Bacteria 1753
209 Ga0070704_100172975 3300005549 Bacteria 1719
210 Ga0068855_100089514 3300005563 Bacteria 3553
211 Ga0068855_100209399 3300005563 Bacteria 2192
212 Ga0068855_100291623 3300005563 Bacteria 1808
213 Ga0070664_100000515 3300005564 Bacteria 29394
214 Ga0070664_100007341 3300005564 Bacteria 8883
215 Ga0070664_100046285 3300005564 Bacteria 3675
216 Ga0070664_100097950 3300005564 Bacteria 2547
217 Ga0070664_100157073 3300005564 Bacteria 2010
218 Ga0070664_100159031 3300005564 Bacteria 1998
219 Ga0068857_100040672 3300005577 Bacteria 4123
220 Ga0068854_100081713 3300005578 Bacteria 2387
221 Ga0068854_100252579 3300005578 Bacteria 1408
222 Ga0068856_100003318 3300005614 Bacteria 16350
223 Ga0068856_100123599 3300005614 Bacteria 2590
224 Ga0070702_100028461 3300005615 Bacteria 3028
225 Ga0068852_100067246 3300005616 Bacteria 3133
226 Ga0068852_100241244 3300005616 Bacteria 1727
227 Ga0068859_100007794 3300005617 Bacteria 10869
228 Ga0068859_100008319 3300005617 Bacteria 10514
229 Ga0068859_100010316 3300005617 Bacteria 9402
230 Ga0068859_100025039 3300005617 Bacteria 5990
231 Ga0068859_100034185 3300005617 Bacteria 5103
232 Ga0068859_100049189 3300005617 Bacteria 4234
233 Ga0068859_100186637 3300005617 Bacteria 2157
234 Ga0068859_100206325 3300005617 Bacteria 2050
235 Ga0068864_100009127 3300005618 Bacteria 8174
236 Ga0068864_100016671 3300005618 Bacteria 6122
237 Ga0068864_100041875 3300005618 Bacteria 3918
238 Ga0068864_100124593 3300005618 Bacteria 2307
239 Ga0068864_100126263 3300005618 Bacteria 2293
240 Ga0068866_10001643 3300005718 Bacteria 9427
241 Ga0068866_10031174 3300005718 Bacteria 2566
242 Ga0068861_100073259 3300005719 Bacteria 2660
243 Ga0068851_10011220 3300005834 Bacteria 4197
244 Ga0068851_10022541 3300005834 Bacteria 3070
245 Ga0068870_10004098 3300005840 Bacteria 6234
246 Ga0068863_100009263 3300005841 Bacteria 9605
247 Ga0068863_100066183 3300005841 Bacteria 3418
248 Ga0068863_100103210 3300005841 Bacteria 2712
249 Ga0068858_100141957 3300005842 Bacteria 2255
250 Ga0068860_100000222 3300005843 Bacteria 88724
251 Ga0068860_100034889 3300005843 Bacteria 4826
252 Ga0068860_100327686 3300005843 Bacteria 1504
253 Ga0068862_100010279 3300005844 Bacteria 7721
254 Ga0068862_100010761 3300005844 Bacteria 7552
255 Ga0068862_100014159 3300005844 Bacteria 6612
256 Ga0068862_100021843 3300005844 Bacteria 5351
257 Ga0068862_100036902 3300005844 Bacteria 4142
258 Ga0081455_10000080 3300005937 Bacteria 104190
259 Ga0081455_10000161 3300005937 Bacteria 82092
260 Ga0081455_10001725 3300005937 Bacteria 26473
261 Ga0081455_10012953 3300005937 Bacteria 8272
262 Ga0081455_10015705 3300005937 Bacteria 7339
263 Ga0081455_10027867 3300005937 Bacteria 5171
264 Ga0081455_10031429 3300005937 Bacteria 4805
265 Ga0081455_10083294 3300005937 Bacteria 2614
266 Ga0081455_10106197 3300005937 Bacteria 2242
267 Ga0081455_10171138 3300005937 Bacteria 1654
268 Ga0081540_1000642 3300005983 Bacteria 33163
269 Ga0081540_1000914 3300005983 Bacteria 26584
270 Ga0081540_1004331 3300005983 Bacteria 10872
271 Ga0081540_1008099 3300005983 Bacteria 7381
272 Ga0081540_1008761 3300005983 Bacteria 7033
273 Ga0081540_1011538 3300005983 Bacteria 5903
274 Ga0081540_1012457 3300005983 Bacteria 5596
275 Ga0081540_1017354 3300005983 Bacteria 4459
276 Ga0081540_1049780 3300005983 Bacteria 2087
277 Ga0081539_10000845 3300005985 Bacteria 58627
278 Ga0081539_10004736 3300005985 Bacteria 14714
279 Ga0081539_10006536 3300005985 Bacteria 11121
280 Ga0081539_10028313 3300005985 Bacteria 3526
281 Ga0081539_10033166 3300005985 Bacteria 3150
282 Ga0081539_10062665 3300005985 Bacteria 2032
283 Ga0070717_10000445 3300006028 Bacteria 26264
284 Ga0070717_10007173 3300006028 Bacteria 8259
285 Ga0070717_10124122 3300006028 Bacteria 2215
286 Ga0070717_10279343 3300006028 Bacteria 1481
287 Ga0075365_10049929 3300006038 Bacteria 2758
288 Ga0075365_10100813 3300006038 Bacteria 1977
289 Ga0075368_10044171 3300006042 Bacteria 1757
290 Ga0075368_10065329 3300006042 Bacteria 1462
291 Ga0075364_10000678 3300006051 Bacteria 17703
292 Ga0075364_10000816 3300006051 Bacteria 16437
293 Ga0075432_10032841 3300006058 Bacteria 1798
294 Ga0070715_10021431 3300006163 Bacteria 2506
295 Ga0070716_100002383 3300006173 Bacteria 8649
296 Ga0070712_100015842 3300006175 Bacteria 4860
297 Ga0070712_100017478 3300006175 Bacteria 4643
298 Ga0070712_100042703 3300006175 Bacteria 3119
299 Ga0070712_100114820 3300006175 Bacteria 2017
300 Ga0075362_10026745 3300006177 Bacteria 2466
301 Ga0075367_10005020 3300006178 Bacteria 6525
302 Ga0075367_10044477 3300006178 Bacteria 2603
303 Ga0075367_10071421 3300006178 Bacteria 2088
304 Ga0075367_10075019 3300006178 Bacteria 2039
305 Ga0075367_10082264 3300006178 Bacteria 1949
306 Ga0075366_10000856 3300006195 Bacteria 14683
307 Ga0075366_10000905 3300006195 Bacteria 14363
308 Ga0075366_10005409 3300006195 Bacteria 6918
309 Ga0075366_10008580 3300006195 Bacteria 5688
310 Ga0075366_10060700 3300006195 Bacteria 2246
311 Ga0075366_10074682 3300006195 Bacteria 2022
312 Ga0097621_100007944 3300006237 Bacteria 7613
313 Ga0097621_100104846 3300006237 Bacteria 2383
314 Ga0075370_10001184 3300006353 Bacteria 10978
315 Ga0075370_10007505 3300006353 Bacteria 5558
316 Ga0075370_10011359 3300006353 Bacteria 4676
317 Ga0068871_100033975 3300006358 Bacteria 4043
318 Ga0068871_100092819 3300006358 Bacteria 2518
319 Ga0068871_100117974 3300006358 Bacteria 2239
320 Ga0075428_100003718 3300006844 Bacteria 16720
321 Ga0075428_100008208 3300006844 Bacteria 11583
322 Ga0075428_100012867 3300006844 Bacteria 9311
323 Ga0075428_100068546 3300006844 Bacteria 3881
324 Ga0075428_100074382 3300006844 Bacteria 3711
325 Ga0075428_100092259 3300006844 Bacteria 3302
326 Ga0075428_100106864 3300006844 Bacteria 3051
327 Ga0075428_100118702 3300006844 Bacteria 2880
328 Ga0075428_100293646 3300006844 Bacteria 1748
329 Ga0075430_100000088 3300006846 Bacteria 52573
330 Ga0075430_100009119 3300006846 Bacteria 8381
331 Ga0075430_100010610 3300006846 Bacteria 7806
332 Ga0075430_100028288 3300006846 Bacteria 4762
333 Ga0075431_100000986 3300006847 Bacteria 25337
334 Ga0075431_100009718 3300006847 Bacteria 9661
335 Ga0075431_100012421 3300006847 Bacteria 8595
336 Ga0075431_100028276 3300006847 Bacteria 5758
337 Ga0075431_100028624 3300006847 Bacteria 5728
338 Ga0075431_100040844 3300006847 Bacteria 4782
339 Ga0075431_100046479 3300006847 Bacteria 4476
340 Ga0075431_100046924 3300006847 Bacteria 4454
341 Ga0075431_100050940 3300006847 Bacteria 4270
342 Ga0075431_100097648 3300006847 Bacteria 3033
343 Ga0075431_100109569 3300006847 Bacteria 2850
344 Ga0075431_100120979 3300006847 Bacteria 2701
345 Ga0075431_100198033 3300006847 Bacteria 2056
346 Ga0075431_100204237 3300006847 Bacteria 2021
347 Ga0075431_100422764 3300006847 Bacteria 1332
348 Ga0075433_10002688 3300006852 Bacteria 13580
349 Ga0075433_10002891 3300006852 Bacteria 13167
350 Ga0075433_10002980 3300006852 Bacteria 13009
351 Ga0075433_10010671 3300006852 Bacteria 7387
352 Ga0075433_10010872 3300006852 Bacteria 7317
353 Ga0075433_10015682 3300006852 Bacteria 6224
354 Ga0075433_10016744 3300006852 Bacteria 6052
355 Ga0075433_10022800 3300006852 Bacteria 5260
356 Ga0075433_10045536 3300006852 Bacteria 3814
357 Ga0075433_10068601 3300006852 Bacteria 3113
358 Ga0075433_10127143 3300006852 Bacteria 2263
359 Ga0075433_10171175 3300006852 Bacteria 1932
360 Ga0075433_10302073 3300006852 Bacteria 1417
361 Ga0075434_100002381 3300006871 Bacteria 16508
362 Ga0075434_100003494 3300006871 Bacteria 14055
363 Ga0075434_100006184 3300006871 Bacteria 10962
364 Ga0075434_100008186 3300006871 Bacteria 9700
365 Ga0075434_100013374 3300006871 Bacteria 7806
366 Ga0075434_100021784 3300006871 Bacteria 6233
367 Ga0075434_100037146 3300006871 Bacteria 4821
368 Ga0075434_100052972 3300006871 Bacteria 4032
369 Ga0075434_100069170 3300006871 Bacteria 3519
370 Ga0075434_100094589 3300006871 Bacteria 2993
371 Ga0075434_100107253 3300006871 Bacteria 2803
372 Ga0075434_100157590 3300006871 Bacteria 2289
373 Ga0075434_100163226 3300006871 Bacteria 2248
374 Ga0075434_100183446 3300006871 Bacteria 2113
375 Ga0075434_100194172 3300006871 Bacteria 2050
376 Ga0075434_100369385 3300006871 Bacteria 1455
377 Ga0075429_100000555 3300006880 Bacteria 28571
378 Ga0075429_100005512 3300006880 Bacteria 10897
379 Ga0075429_100010439 3300006880 Bacteria 8035
380 Ga0075429_100013820 3300006880 Bacteria 7001
381 Ga0075429_100016895 3300006880 Bacteria 6313
382 Ga0075429_100026783 3300006880 Bacteria 5006
383 Ga0075429_100098834 3300006880 Bacteria 2546
384 Ga0075429_100142868 3300006880 Bacteria 2095
385 Ga0075429_100200814 3300006880 Bacteria 1747
386 Ga0075429_100268188 3300006880 Bacteria 1495
387 Ga0068865_100002565 3300006881 Bacteria 10775
388 Ga0068865_100004347 3300006881 Bacteria 8548
389 Ga0075436_100001553 3300006914 Bacteria 15679
390 Ga0075436_100059954 3300006914 Bacteria 2628
391 Ga0097620_100007793 3300006931 Bacteria 10869
392 Ga0097620_100008319 3300006931 Bacteria 10514
393 Ga0097620_100010316 3300006931 Bacteria 9402
394 Ga0097620_100025040 3300006931 Bacteria 5990
395 Ga0097620_100034186 3300006931 Bacteria 5103
396 Ga0097620_100049186 3300006931 Bacteria 4234
397 Ga0097620_100186638 3300006931 Bacteria 2157
398 Ga0097620_100206326 3300006931 Bacteria 2050
399 Ga0099824_1014445 3300006942 Bacteria 7835
400 Ga0075435_100005520 3300007076 Bacteria 8841
401 Ga0075435_100008483 3300007076 Bacteria 7375
402 Ga0075435_100013632 3300007076 Bacteria 6055
403 Ga0075435_100037343 3300007076 Bacteria 3867
404 Ga0075435_100043987 3300007076 Bacteria 3577
405 Ga0075435_100068695 3300007076 Bacteria 2887
406 Ga0075435_100094823 3300007076 Bacteria 2467
407 Ga0075435_100133225 3300007076 Bacteria 2080
408 Ga0075435_100233309 3300007076 Bacteria 1563
409 Ga0075435_100242314 3300007076 Bacteria 1534
410 Ga0099794_10040397 3300007265 Bacteria 2218
411 Ga0099794_10041554 3300007265 Bacteria 2190
412 Ga0099795_10031993 3300007788 Bacteria 1816
413 Ga0105240_10000427 3300009093 Bacteria 78108
414 Ga0105240_10233130 3300009093 Bacteria 2138
415 Ga0111539_10000205 3300009094 Bacteria 69920
416 Ga0111539_10002082 3300009094 Bacteria 26730
417 Ga0111539_10003143 3300009094 Bacteria 21843
418 Ga0111539_10004506 3300009094 Bacteria 18215
419 Ga0111539_10004845 3300009094 Bacteria 17538
420 Ga0111539_10005412 3300009094 Bacteria 16520
421 Ga0111539_10015192 3300009094 Bacteria 9590
422 Ga0111539_10053485 3300009094 Bacteria 4806
423 Ga0111539_10070021 3300009094 Bacteria 4141
424 Ga0111539_10077793 3300009094 Bacteria 3904
425 Ga0111539_10216065 3300009094 Bacteria 2233
426 Ga0111539_10264260 3300009094 Bacteria 2003
427 Ga0105245_10148881 3300009098 Bacteria 2211
428 Ga0105247_10034407 3300009101 Bacteria 3085
429 Ga0114129_10000722 3300009147 Bacteria 41913
430 Ga0114129_10001217 3300009147 Bacteria 34192
431 Ga0114129_10004791 3300009147 Bacteria 19126
432 Ga0114129_10006303 3300009147 Bacteria 16822
433 Ga0114129_10010000 3300009147 Bacteria 13520
434 Ga0114129_10011045 3300009147 Bacteria 12863
435 Ga0114129_10011216 3300009147 Bacteria 12774
436 Ga0114129_10011456 3300009147 Bacteria 12627
437 Ga0114129_10012186 3300009147 Bacteria 12232
438 Ga0114129_10026763 3300009147 Bacteria 8169
439 Ga0114129_10031611 3300009147 Bacteria 7482
440 Ga0114129_10041559 3300009147 Bacteria 6478
441 Ga0114129_10049194 3300009147 Bacteria 5924
442 Ga0114129_10059337 3300009147 Bacteria 5349
443 Ga0114129_10089245 3300009147 Bacteria 4273
444 Ga0114129_10092082 3300009147 Bacteria 4200
445 Ga0114129_10112040 3300009147 Bacteria 3763
446 Ga0114129_10112106 3300009147 Bacteria 3762
447 Ga0114129_10127269 3300009147 Bacteria 3501
448 Ga0114129_10158620 3300009147 Bacteria 3093
449 Ga0114129_10162870 3300009147 Bacteria 3045
450 Ga0114129_10165922 3300009147 Bacteria 3014
451 Ga0114129_10170137 3300009147 Bacteria 2971
452 Ga0114129_10192551 3300009147 Bacteria 2768
453 Ga0105243_10043894 3300009148 Bacteria 3505
454 Ga0105243_10078705 3300009148 Bacteria 2685
455 Ga0105241_10016909 3300009174 Bacteria 5354
456 Ga0105241_10254853 3300009174 Bacteria 1489
457 Ga0105242_10073243 3300009176 Bacteria 2847
458 Ga0105248_10005501 3300009177 Bacteria 13908
459 Ga0105248_10117609 3300009177 Bacteria 2998
460 Ga0105248_10133873 3300009177 Bacteria 2797
461 Ga0105248_10337789 3300009177 Bacteria 1696
462 Ga0105248_10378267 3300009177 Bacteria 1594
463 Ga0105237_10013789 3300009545 Bacteria 8461
464 Ga0105237_10014620 3300009545 Bacteria 8200
465 Ga0105237_10093214 3300009545 Bacteria 3001
466 Ga0105237_10100105 3300009545 Bacteria 2890
467 Ga0105238_10145339 3300009551 Bacteria 2348
468 Ga0105238_10384429 3300009551 Bacteria 1395
469 Ga0105249_10001777 3300009553 Bacteria 18790
470 Ga0105249_10135988 3300009553 Bacteria 2352
471 Ga0105239_10022197 3300010375 Bacteria 6996
472 Ga0105239_10034375 3300010375 Bacteria 5566
473 Ga0105239_10053529 3300010375 Bacteria 4427
474 Ga0105239_10058807 3300010375 Bacteria 4218
475 Ga0105239_10111312 3300010375 Bacteria 3035
476 Ga0105246_10040304 3300011119 Bacteria 3151
477 Ga0105246_10048875 3300011119 Bacteria 2893
478 Ga0157373_10000574 3300013100 Bacteria 28681
479 Ga0157373_10001127 3300013100 Bacteria 20527
480 Ga0157371_10177010 3300013102 Bacteria 1525
481 Ga0157369_10027066 3300013105 Bacteria 6358
482 Ga0157369_10047099 3300013105 Bacteria 4683
483 Ga0171462_1045 3300013250 Bacteria 50984
484 Ga0157374_10146707 3300013296 Bacteria 2292
485 Ga0157374_10278732 3300013296 Bacteria 1650
486 Ga0157378_10037713 3300013297 Bacteria 4283
487 Ga0157378_10042649 3300013297 Bacteria 4027
488 Ga0157378_10166762 3300013297 Bacteria 2063
489 Ga0157378_10210118 3300013297 Bacteria 1845
490 Ga0163162_10139268 3300013306 Bacteria 2538
491 Ga0163162_10485948 3300013306 Bacteria 1366
492 Ga0157372_10001263 3300013307 Bacteria 27405
493 Ga0157372_10191594 3300013307 Bacteria 2368
494 Ga0157372_10234545 3300013307 Bacteria 2128
495 Ga0157372_10457301 3300013307 Bacteria 1488
496 Ga0157375_10004827 3300013308 Bacteria 11710
497 Ga0157375_10038656 3300013308 Bacteria 4582
498 Ga0157375_10119824 3300013308 Bacteria 2739
499 Ga0163163_10031956 3300014325 Bacteria 5083
500 Ga0163163_10046564 3300014325 Bacteria 4260
501 Ga0163163_10059185 3300014325 Bacteria 3789
502 Ga0163163_10134022 3300014325 Bacteria 2518
503 Ga0163163_10260276 3300014325 Bacteria 1786
504 Ga0157380_10077400 3300014326 Bacteria 2711
505 Ga0157380_10168787 3300014326 Bacteria 1909
506 Ga0157380_10324186 3300014326 Bacteria 1429
507 Ga0182008_10058113 3300014497 Bacteria 1910
508 Ga0157379_10007148 3300014968 Bacteria 9654
509 Ga0157379_10059481 3300014968 Bacteria 3416
510 Ga0157379_10108235 3300014968 Bacteria 2495
511 Ga0157379_10116515 3300014968 Bacteria 2403
512 Ga0157376_10029890 3300014969 Bacteria 4343
513 Ga0157376_10050411 3300014969 Bacteria 3454
514 Ga0157376_10097527 3300014969 Bacteria 2560
515 Ga0157376_10137156 3300014969 Bacteria 2191
516 Ga0157376_10162524 3300014969 Bacteria 2026
517 Ga0182006_1003147 3300015261 Bacteria 8631
518 Ga0182006_1052718 3300015261 Bacteria 1562
519 Ga0163161_10007275 3300017792 Bacteria 7643
520 Ga0163161_10074373 3300017792 Bacteria 2491
521 Ga0206354_11288361 3300020081 Bacteria 1599
522 Ga0214544_1009253 3300021320 Bacteria 15597
523 Ga0214542_1000025 3300021321 Bacteria 183588
524 Ga0214545_1000014 3300021324 Bacteria 183588
525 Ga0214543_1000034 3300021327 Bacteria 183712
526 Ga0213874_10021454 3300021377 Bacteria 1781
527 Ga0213876_10000506 3300021384 Bacteria 30344
528 Ga0209148_1000773 3300025254 Bacteria 23969
529 Ga0209233_1016211 3300025261 Bacteria 2057
530 Ga0209455_1002825 3300025272 Bacteria 6457
531 Ga0209130_1000045 3300025284 Bacteria 240278
532 Ga0209675_1002625 3300025291 Bacteria 9097
533 Ga0209025_1000932 3300025294 Bacteria 44615
534 Ga0209564_1000075 3300025295 Bacteria 285760
535 Ga0209564_1015176 3300025295 Bacteria 3151
536 Ga0209758_1000008 3300025297 Bacteria 1215263
537 Ga0209758_1000097 3300025297 Bacteria 230529
538 Ga0209758_1000141 3300025297 Bacteria 172481
539 Ga0209758_1000282 3300025297 Bacteria 100746
540 Ga0209758_1002234 3300025297 Bacteria 20121
541 Ga0209758_1008672 3300025297 Bacteria 6524
542 Ga0209758_1011027 3300025297 Bacteria 5297
543 Ga0209758_1011485 3300025297 Bacteria 5120
544 Ga0209758_1032875 3300025297 Bacteria 2096
545 Ga0209256_1002013 3300025299 Bacteria 18122
546 Ga0209256_1002896 3300025299 Bacteria 13002
547 Ga0207426_1000437 3300025302 Bacteria 67439
548 Ga0207426_1001098 3300025302 Bacteria 24902
549 Ga0207426_1007699 3300025302 Bacteria 4472
550 Ga0207426_1011889 3300025302 Bacteria 3294
551 Ga0209257_1005807 3300025304 Bacteria 8390
552 Ga0207656_10042682 3300025321 Bacteria 1931
553 Ga0207653_10011710 3300025885 Bacteria 2736
554 Ga0207682_10001931 3300025893 Bacteria 9419
555 Ga0207682_10075047 3300025893 Bacteria 1439
556 Ga0207682_10089740 3300025893 Bacteria 1331
557 Ga0207692_10002216 3300025898 Bacteria 7439
558 Ga0207692_10094978 3300025898 Bacteria 1625
559 Ga0207692_10150500 3300025898 Bacteria 1332
560 Ga0207642_10008904 3300025899 Bacteria 3468
561 Ga0207710_10006353 3300025900 Bacteria 5050
562 Ga0207710_10035654 3300025900 Bacteria 2189
563 Ga0207688_10050613 3300025901 Bacteria 2326
564 Ga0207688_10071745 3300025901 Bacteria 1966
565 Ga0207680_10176934 3300025903 Bacteria 1440
566 Ga0207647_10016240 3300025904 Bacteria 5083
567 Ga0207699_10003729 3300025906 Bacteria 7278
568 Ga0207699_10004469 3300025906 Bacteria 6685
569 Ga0207645_10001315 3300025907 Bacteria 20396
570 Ga0207645_10029667 3300025907 Bacteria 3525
571 Ga0207643_10000406 3300025908 Bacteria 28650
572 Ga0207643_10131529 3300025908 Bacteria 1489
573 Ga0207643_10147531 3300025908 Bacteria 1408
574 Ga0207684_10003897 3300025910 Bacteria 14303
575 Ga0207684_10013583 3300025910 Bacteria 7038
576 Ga0207684_10013914 3300025910 Bacteria 6950
577 Ga0207684_10014077 3300025910 Bacteria 6907
578 Ga0207684_10018456 3300025910 Bacteria 5973
579 Ga0207684_10206094 3300025910 Bacteria 1696
580 Ga0207654_10002995 3300025911 Bacteria 8570
581 Ga0207654_10015208 3300025911 Bacteria 3989
582 Ga0207654_10062338 3300025911 Bacteria 2184
583 Ga0207707_10000019 3300025912 Bacteria 206008
584 Ga0207707_10035607 3300025912 Bacteria 4352
585 Ga0207707_10153908 3300025912 Bacteria 2010
586 Ga0207695_10000062 3300025913 Bacteria 351979
587 Ga0207671_10000377 3300025914 Bacteria 63306
588 Ga0207671_10183332 3300025914 Bacteria 1630
589 Ga0207671_10190855 3300025914 Bacteria 1598
590 Ga0207693_10015868 3300025915 Bacteria 6032
591 Ga0207693_10021206 3300025915 Bacteria 5164
592 Ga0207693_10054379 3300025915 Bacteria 3140
593 Ga0207693_10107453 3300025915 Bacteria 2189
594 Ga0207693_10144864 3300025915 Bacteria 1868
595 Ga0207663_10013985 3300025916 Bacteria 4380
596 Ga0207663_10061402 3300025916 Bacteria 2385
597 Ga0207663_10074820 3300025916 Bacteria 2196
598 Ga0207663_10100153 3300025916 Bacteria 1944
599 Ga0207660_10015260 3300025917 Bacteria 5069
600 Ga0207660_10019690 3300025917 Bacteria 4516
601 Ga0207660_10129316 3300025917 Bacteria 1921
602 Ga0207660_10216768 3300025917 Bacteria 1500
603 Ga0207657_10000158 3300025919 Bacteria 69402
604 Ga0207657_10059953 3300025919 Bacteria 3267
605 Ga0207646_10002726 3300025922 Bacteria 20668
606 Ga0207646_10008458 3300025922 Bacteria 10310
607 Ga0207646_10010701 3300025922 Bacteria 8930
608 Ga0207646_10080974 3300025922 Bacteria 2903
609 Ga0207646_10082733 3300025922 Bacteria 2871
610 Ga0207646_10084375 3300025922 Bacteria 2842
611 Ga0207646_10212343 3300025922 Bacteria 1748
612 Ga0207681_10003707 3300025923 Bacteria 9494
613 Ga0207681_10015896 3300025923 Bacteria 4698
614 Ga0207681_10107478 3300025923 Bacteria 2024
615 Ga0207681_10212400 3300025923 Bacteria 1492
616 Ga0207650_10001113 3300025925 Bacteria 19790
617 Ga0207650_10002324 3300025925 Bacteria 13252
618 Ga0207650_10029534 3300025925 Bacteria 3942
619 Ga0207650_10031535 3300025925 Bacteria 3828
620 Ga0207650_10069187 3300025925 Bacteria 2652
621 Ga0207659_10000549 3300025926 Bacteria 22440
622 Ga0207659_10005606 3300025926 Bacteria 7625
623 Ga0207659_10030802 3300025926 Unclassified 3668
624 Ga0207659_10191549 3300025926 Bacteria 1628
625 Ga0207659_10210920 3300025926 Bacteria 1556
626 Ga0207687_10014320 3300025927 Bacteria 5189
627 Ga0207700_10014243 3300025928 Bacteria 5204
628 Ga0207700_10042768 3300025928 Bacteria 3324
629 Ga0207700_10065940 3300025928 Bacteria 2765
630 Ga0207700_10250871 3300025928 Bacteria 1512
631 Ga0207664_10044247 3300025929 Bacteria 3486
632 Ga0207664_10096840 3300025929 Bacteria 2430
633 Ga0207664_10191753 3300025929 Bacteria 1760
634 Ga0207644_10010696 3300025931 Bacteria 6050
635 Ga0207644_10013517 3300025931 Bacteria 5445
636 Ga0207644_10112314 3300025931 Bacteria 2062
637 Ga0207644_10164529 3300025931 Bacteria 1727
638 Ga0207690_10003241 3300025932 Bacteria 9763
639 Ga0207690_10200963 3300025932 Bacteria 1514
640 Ga0207706_10065945 3300025933 Bacteria 3187
641 Ga0207706_10085144 3300025933 Bacteria 2779
642 Ga0207706_10148443 3300025933 Bacteria 2062
643 Ga0207686_10031590 3300025934 Bacteria 3145
644 Ga0207709_10013330 3300025935 Bacteria 4536
645 Ga0207709_10016421 3300025935 Bacteria 4115
646 Ga0207709_10026693 3300025935 Bacteria 3319
647 Ga0207709_10099724 3300025935 Bacteria 1917
648 Ga0207670_10090939 3300025936 Bacteria 2157
649 Ga0207669_10002598 3300025937 Bacteria 7722
650 Ga0207669_10016318 3300025937 Bacteria 3770
651 Ga0207669_10050029 3300025937 Bacteria 2495
652 Ga0207704_10024707 3300025938 Bacteria 3264
653 Ga0207704_10101860 3300025938 Bacteria 1916
654 Ga0207704_10164905 3300025938 Bacteria 1581
655 Ga0207665_10001763 3300025939 Bacteria 14531
656 Ga0207691_10000754 3300025940 Bacteria 31954
657 Ga0207691_10002193 3300025940 Bacteria 19089
658 Ga0207691_10002935 3300025940 Bacteria 16639
659 Ga0207691_10004947 3300025940 Bacteria 12853
660 Ga0207691_10011314 3300025940 Bacteria 8561
661 Ga0207691_10013516 3300025940 Bacteria 7808
662 Ga0207691_10087034 3300025940 Bacteria 2803
663 Ga0207711_10020135 3300025941 Bacteria 5559
664 Ga0207711_10085982 3300025941 Bacteria 2756
665 Ga0207711_10096173 3300025941 Bacteria 2613
666 Ga0207711_10262211 3300025941 Bacteria 1588
667 Ga0207711_10302697 3300025941 Bacteria 1475
668 Ga0207689_10001549 3300025942 Bacteria 21793
669 Ga0207689_10008662 3300025942 Bacteria 8857
670 Ga0207689_10016340 3300025942 Bacteria 6287
671 Ga0207689_10025703 3300025942 Bacteria 4933
672 Ga0207689_10036764 3300025942 Bacteria 4064
673 Ga0207689_10126547 3300025942 Bacteria 2102
674 Ga0207661_10002131 3300025944 Bacteria 13613
675 Ga0207661_10024499 3300025944 Bacteria 4574
676 Ga0207661_10038507 3300025944 Bacteria 3748
677 Ga0207661_10066742 3300025944 Bacteria 2923
678 Ga0207679_10002969 3300025945 Bacteria 10516
679 Ga0207679_10006070 3300025945 Bacteria 7617
680 Ga0207679_10024614 3300025945 Bacteria 4129
681 Ga0207679_10059593 3300025945 Bacteria 2833
682 Ga0207679_10068402 3300025945 Bacteria 2668
683 Ga0207679_10080426 3300025945 Bacteria 2488
684 Ga0207667_10017801 3300025949 Bacteria 7989
685 Ga0207651_10000137 3300025960 Bacteria 31859
686 Ga0207651_10004004 3300025960 Bacteria 7328
687 Ga0207651_10004657 3300025960 Bacteria 6951
688 Ga0207651_10023383 3300025960 Bacteria 3800
689 Ga0207668_10188325 3300025972 Bacteria 1633
690 Ga0207640_10117890 3300025981 Bacteria 1895
691 Ga0207658_10099850 3300025986 Bacteria 2271
692 Ga0207658_10165305 3300025986 Bacteria 1817
693 Ga0207677_10043429 3300026023 Bacteria 2988
694 Ga0207677_10143685 3300026023 Bacteria 1831
695 Ga0207703_10007069 3300026035 Bacteria 8930
696 Ga0207703_10012711 3300026035 Bacteria 6564
697 Ga0207703_10069954 3300026035 Bacteria 2896
698 Ga0207703_10113714 3300026035 Bacteria 2314
699 Ga0207703_10214969 3300026035 Bacteria 1716
700 Ga0207639_10032270 3300026041 Bacteria 3854
701 Ga0207639_10045461 3300026041 Bacteria 3307
702 Ga0207639_10072221 3300026041 Bacteria 2701
703 Ga0207639_10188550 3300026041 Bacteria 1760
704 Ga0207678_10001746 3300026067 Bacteria 19901
705 Ga0207678_10002804 3300026067 Bacteria 15808
706 Ga0207678_10021209 3300026067 Bacteria 5695
707 Ga0207678_10037986 3300026067 Bacteria 4187
708 Ga0207678_10056027 3300026067 Bacteria 3395
709 Ga0207678_10074754 3300026067 Bacteria 2903
710 Ga0207708_10006345 3300026075 Bacteria 8766
711 Ga0207708_10043006 3300026075 Bacteria 3442
712 Ga0207708_10066326 3300026075 Bacteria 2760
713 Ga0207708_10167787 3300026075 Bacteria 1736
714 Ga0207702_10004617 3300026078 Bacteria 12203
715 Ga0207702_10050904 3300026078 Bacteria 3498
716 Ga0207702_10139495 3300026078 Bacteria 2192
717 Ga0207641_10037894 3300026088 Bacteria 4029
718 Ga0207641_10092305 3300026088 Bacteria 2651
719 Ga0207641_10346482 3300026088 Bacteria 1415
720 Ga0207648_10001985 3300026089 Bacteria 22355
721 Ga0207648_10008746 3300026089 Bacteria 9758
722 Ga0207648_10010726 3300026089 Bacteria 8662
723 Ga0207648_10020630 3300026089 Bacteria 5932
724 Ga0207648_10030334 3300026089 Bacteria 4790
725 Ga0207648_10042949 3300026089 Bacteria 3970
726 Ga0207648_10047260 3300026089 Bacteria 3773
727 Ga0207648_10066575 3300026089 Bacteria 3142
728 Ga0207648_10127698 3300026089 Bacteria 2237
729 Ga0207648_10232700 3300026089 Bacteria 1639
730 Ga0207676_10006758 3300026095 Bacteria 8119
731 Ga0207676_10063032 3300026095 Bacteria 2943
732 Ga0207676_10092985 3300026095 Bacteria 2481
733 Ga0207676_10104213 3300026095 Bacteria 2359
734 Ga0207674_10002036 3300026116 Bacteria 25652
735 Ga0207674_10004850 3300026116 Bacteria 16107
736 Ga0207675_100006420 3300026118 Bacteria 11134
737 Ga0207675_100022055 3300026118 Bacteria 5928
738 Ga0207683_10001853 3300026121 Bacteria 18701
739 Ga0207683_10004778 3300026121 Bacteria 11660
740 Ga0207683_10005724 3300026121 Bacteria 10662
741 Ga0207683_10007680 3300026121 Bacteria 9233
742 Ga0207683_10108631 3300026121 Bacteria 2482
743 Ga0207698_10019740 3300026142 Bacteria 4621
744 Ga0207698_10060913 3300026142 Bacteria 2937
745 Ga0207698_10084300 3300026142 Bacteria 2576
746 Ga0207698_10128163 3300026142 Bacteria 2163
747 Ga0209389_1000004 3300027296 Bacteria 263759
748 Ga0209589_1000002 3300027357 Bacteria 708598
749 Ga0209489_100002 3300027361 Bacteria 708609
750 Ga0209489_100777 3300027361 Bacteria 63061
751 Ga0209700_100002 3300027363 Bacteria 708598
752 Ga0209700_100013 3300027363 Bacteria 341906
753 Ga0209968_1001306 3300027526 Bacteria 3804
754 Ga0209999_1001517 3300027543 Bacteria 4002
755 Ga0209983_1000879 3300027665 Bacteria 6625
756 Ga0209588_1052615 3300027671 Bacteria 1317
757 Ga0209971_1000005 3300027682 Bacteria 108671
758 Ga0209966_1000010 3300027695 Bacteria 86172
759 Ga0209966_1022387 3300027695 Bacteria 1235
760 Ga0209998_10000729 3300027717 Bacteria 8650
761 Ga0209974_10019491 3300027876 Bacteria 2249
762 Ga0207428_10000503 3300027907 Bacteria 46699
763 Ga0207428_10000526 3300027907 Bacteria 45700
764 Ga0207428_10008432 3300027907 Bacteria 9304
765 Ga0207428_10009239 3300027907 Bacteria 8853
766 Ga0207428_10020041 3300027907 Bacteria 5691
767 Ga0207428_10028626 3300027907 Bacteria 4627
768 Ga0207428_10054947 3300027907 Bacteria 3168
769 Ga0268266_10004621 3300028379 Bacteria 13133
770 Ga0268266_10009307 3300028379 Bacteria 8664
771 Ga0268266_10009873 3300028379 Bacteria 8391
772 Ga0268266_10027379 3300028379 Bacteria 4847
773 Ga0268266_10035847 3300028379 Bacteria 4219
774 Ga0268266_10073968 3300028379 Bacteria 2958
775 Ga0268266_10142020 3300028379 Bacteria 2155
776 Ga0268266_10276123 3300028379 Bacteria 1561
777 Ga0268265_10006468 3300028380 Bacteria 7942
778 Ga0268265_10015922 3300028380 Bacteria 5157
779 Ga0268265_10030405 3300028380 Bacteria 3889
780 Ga0268265_10031131 3300028380 Bacteria 3851
781 Ga0268265_10032954 3300028380 Bacteria 3761
782 Ga0268265_10056453 3300028380 Bacteria 2987
783 Ga0268265_10142675 3300028380 Bacteria 2007
784 Ga0268265_10284337 3300028380 Bacteria 1481
785 Ga0268264_10000042 3300028381 Bacteria 372069
786 Ga0268264_10028575 3300028381 Bacteria 4562
787 Ga0268264_10083907 3300028381 Bacteria 2730
788 Ga0268264_10144047 3300028381 Bacteria 2128
789 Ga0268264_10146314 3300028381 Bacteria 2113
790 Ga0265319_1005086 3300028563 Bacteria 6384
791 Ga0265334_10053462 3300028573 Bacteria 1542
792 Ga0265318_10019017 3300028577 Bacteria 2792
793 Ga0307517_10061999 3300028786 Bacteria 3526
794 Ga0307515_10000034 3300028794 Bacteria 344640
795 Ga0307515_10000043 3300028794 Bacteria 304612
796 Ga0307515_10000658 3300028794 Bacteria 79766
797 Ga0307515_10003847 3300028794 Bacteria 31390
798 Ga0307515_10007630 3300028794 Bacteria 21340
799 Ga0307515_10007679 3300028794 Bacteria 21251
800 Ga0307515_10050509 3300028794 Bacteria 6225
801 Ga0307515_10148183 3300028794 Bacteria 2471
802 Ga0265338_10055019 3300028800 Bacteria 3543
803 Ga0307511_10101318 3300030521 Bacteria 1889
804 Ga0307512_10027620 3300030522 Bacteria 4990
805 Ga0316176_1196748 3300030732 Bacteria 1758
806 Ga0314311_1081389 3300030733 Bacteria 3793
807 Ga0316181_1168214 3300030744 Bacteria 3759
808 Ga0316182_1029803 3300030745 Bacteria 3739
809 Ga0316182_1254532 3300030745 Bacteria 3386
810 Ga0265330_10059230 3300031235 Bacteria 1668
811 Ga0265332_10049273 3300031238 Bacteria 1811
812 Ga0265325_10003069 3300031241 Bacteria 11034
813 Ga0265325_10028296 3300031241 Bacteria 3022
814 Ga0265325_10028299 3300031241 Bacteria 3022
815 Ga0265329_10016424 3300031242 Bacteria 2564
816 Ga0265339_10056436 3300031249 Bacteria 2127
817 Ga0265331_10025045 3300031250 Bacteria 3013
818 Ga0265316_10049711 3300031344 Bacteria 3301
819 Ga0307513_10009436 3300031456 Bacteria 12342
820 Ga0307513_10191686 3300031456 Bacteria 1895
821 Ga0307509_10024775 3300031507 Bacteria 6714
822 Ga0307408_100017573 3300031548 Bacteria 4788
823 Ga0307408_100076577 3300031548 Bacteria 2489
824 Ga0265313_10001744 3300031595 Bacteria 19971
825 Ga0265313_10019983 3300031595 Bacteria 3709
826 Ga0307508_10000029 3300031616 Bacteria 168411
827 Ga0307508_10000254 3300031616 Bacteria 65091
828 Ga0307508_10027341 3300031616 Bacteria 5164
829 Ga0307508_10036036 3300031616 Bacteria 4456
830 Ga0307514_10046015 3300031649 Bacteria 3410
831 Ga0265314_10019737 3300031711 Bacteria 5214
832 Ga0265342_10008945 3300031712 Bacteria 7113
833 Ga0265342_10065595 3300031712 Bacteria 2127
834 Ga0307516_10001248 3300031730 Bacteria 35383
835 Ga0307516_10011266 3300031730 Bacteria 9744
836 Ga0307516_10026325 3300031730 Bacteria 5908
837 Ga0307516_10032423 3300031730 Bacteria 5262
838 Ga0307516_10056391 3300031730 Bacteria 3831
839 Ga0307516_10061322 3300031730 Bacteria 3649
840 Ga0307516_10093389 3300031730 Bacteria 2834
841 Ga0307405_10024902 3300031731 Bacteria 3427
842 Ga0307410_10135643 3300031852 Bacteria 1814
843 Ga0307410_10200494 3300031852 Bacteria 1523
844 Ga0307406_10000237 3300031901 Bacteria 33519
845 Ga0307406_10178370 3300031901 Bacteria 1544
846 Ga0307416_100004867 3300032002 Bacteria 8175
847 Ga0307416_100056947 3300032002 Bacteria 3158
848 Ga0307416_100086696 3300032002 Bacteria 2670
849 Ga0307414_10035490 3300032004 Bacteria 3319
850 Ga0307415_100083837 3300032126 Bacteria 2285
851 Ga0307507_10024242 3300033179 Bacteria 6622
852 Ga0307507_10052067 3300033179 Bacteria 3932
853 Ga0307510_10016828 3300033180 Bacteria 8627
854 Ga0307510_10057391 3300033180 Bacteria 4041
855 Ga0307510_10076408 3300033180 Bacteria 3295
856 Ga0315911_1000004 3300033442 Bacteria 472637
857 Ga0316215_1000806 3300033544 Bacteria 3154
858 Ga0373958_0016674 3300034819 Bacteria 1312
859 Ga0373928_0002368 3300035084 Bacteria 3662
860 Ga0373940_0007439 3300035088 Bacteria 2473
861 Ga0373940_0015176 3300035088 Bacteria 1891
862 Ga0373944_0022195 3300035089 Bacteria 1843
863 Ga0373951_0023048 3300035091 Bacteria 1436
864 Ga0373951_0027357 3300035091 Bacteria 1331
865 Ga0373932_0003971 3300035112 Bacteria 3523
866 Ga0373936_0039328 3300035113 Bacteria 1892
867 Ga0373939_0016010 3300035114 Bacteria 1971
868 Ga0373941_0013234 3300035115 Bacteria 2176
869 Ga0373945_0044148 3300035116 Bacteria 1620
870 Ga0373954_0027979 3300035118 Bacteria 2590
871 Ga0373960_0008472 3300035121 Bacteria 2465
872 Ga0373943_0004760 3300035170 Bacteria 6139
873 Ga0373943_0029106 3300035170 Bacteria 2608
874 Ga0373943_0107525 3300035170 Unclassified 1467
875 Ga0373946_0012322 3300035171 Bacteria 3198
876 Ga0373946_0017680 3300035171 Bacteria 2731
877 Ga0373955_0008914 3300035172 Bacteria 4678
878 Ga0373955_0049971 3300035172 Bacteria 2272
879 Ga0373961_0002541 3300035241 Bacteria 4705
880 Ga0373961_0016865 3300035241 Bacteria 1886
881 Ga0373924_0021101 3300035410 Bacteria 2539
882 Ga0373924_0074369 3300035410 Bacteria 1437
883 Ga0373924_0080923 3300035410 Bacteria 1381
884 Ga0373931_0001091 3300035691 Bacteria 11503
885 Ga0373931_0092916 3300035691 Bacteria 1684
886 Ga0373935_0004029 3300035692 Bacteria 8588
887 Ga0373935_0028466 3300035692 Bacteria 3454
888 Ga0373935_0062673 3300035692 Bacteria 2382
889 Ga0373935_0160183 3300035692 Bacteria 1533
890 Ga0373927_0001617 3300035695 Bacteria 16890
891 Ga0373927_0009798 3300035695 Bacteria 6425
892 Ga0373927_0013714 3300035695 Bacteria 5381
893 Ga0373927_0017298 3300035695 Bacteria 4746
894 Ga0373927_0075038 3300035695 Bacteria 2189
895 Ga0373927_0113251 3300035695 Bacteria 1768
896 Ga0373927_0183081 3300035695 Bacteria 1374
897 Ga0373933_0042619 3300035724 Bacteria 2683
898 Ga0373947_0004404 3300035725 Bacteria 8259
899 Ga0373947_0041394 3300035725 Bacteria 2747
900 Ga0373947_0093017 3300035725 Bacteria 1884
901 Ga0373947_0111534 3300035725 Bacteria 1729
902 Ga0373947_0129524 3300035725 Bacteria 1609
903 Ga0373937_0081009 3300036401 Bacteria 3003
904 Ga0373937_0154375 3300036401 Bacteria 2151
905 Ga0373937_0197618 3300036401 Bacteria 1890
906 Ga0373937_0270565 3300036401 Bacteria 1603
907 Ga0373925_0002598 3300037068 Bacteria 14354
908 Ga0373925_0008312 3300037068 Bacteria 7556
909 Ga0373925_0011431 3300037068 Bacteria 6429
910 Ga0373925_0016597 3300037068 Bacteria 5334
911 Ga0373925_0022159 3300037068 Bacteria 4632
912 Ga0373925_0082144 3300037068 Bacteria 2451
913 Ga0395900_0001273 3300037418 Bacteria 30829
914 Ga0395900_0029419 3300037418 Bacteria 5635
915 Ga0395900_0078677 3300037418 Bacteria 3388
916 Ga0395898_0011222 3300037466 Bacteria 9326
917 Ga0395898_0122261 3300037466 Bacteria 2494
918 Ga0395905_0010802 3300037471 Bacteria 8847
919 Ga0395905_0011753 3300037471 Bacteria 8452
920 Ga0395901_0000813 3300038443 Bacteria 34571
921 Ga0395901_0002416 3300038443 Bacteria 18962
922 Ga0395901_0017486 3300038443 Bacteria 7318
923 Ga0436365_0399885 3300039437 Bacteria 5357
924 Ga0436365_0685473 3300039437 Bacteria 1831
925 Ga0436365_0966736 3300039437 Bacteria 2106
926 Ga0436365_1091064 3300039437 Bacteria 30337
927 Ga0436360_0603982 3300039438 Bacteria 1984
928 Ga0436361_0014467 3300039447 Bacteria 5498
929 Ga0436363_1558913 3300039450 Bacteria 3651
930 Ga0436362_0827926 3300039453 Bacteria 4231
931 Ga0439447_015027 3300041407 Bacteria 2157
932 Ga0439453_0013066 3300041408 Bacteria 1407
933 Ga0439465_0024030 3300041413 Bacteria 1919
934 Ga0451807_1880289 3300041486 Bacteria 3052
935 Ga0451853_4010219 3300041512 Bacteria 1357
936 Ga0439433_0007202 3300041999 Bacteria 2401
937 Ga0439448_0017984 3300042005 Bacteria 2161
938 Ga0439449_0005236 3300042007 Bacteria 4976
939 Ga0439457_018810 3300042014 Bacteria 1535
940 Ga0439458_0024943 3300042157 Bacteria 1400
941 Ga0439434_0003597 3300042435 Bacteria 4526
942 Ga0439435_0001533 3300042436 Bacteria 4309
943 Ga0439435_0022258 3300042436 Bacteria 1653
944 Ga0439459_0008511 3300042438 Bacteria 1755
945 Ga0439464_0002353 3300042439 Bacteria 4644
946 Ga0439460_0000381 3300042461 Bacteria 9443
947 Ga0451577_0001628 3300042876 Bacteria 29133
948 Ga0451577_0023399 3300042876 Bacteria 5634
949 Ga0451577_0034628 3300042876 Bacteria 4550
950 Ga0466972_0000079 3300044658 Bacteria 90348
951 Ga0466972_0004328 3300044658 Bacteria 7093
952 Ga0466972_0062953 3300044658 Bacteria 1777
953 Ga0453683_0006780 3300044673 Bacteria 7822
954 Ga0453683_0015117 3300044673 Bacteria 5010
955 Ga0453683_0091854 3300044673 Bacteria 1903
956 Ga0466966_0001208 3300044684 Bacteria 16568
957 Ga0466961_0000020 3300044693 Bacteria 107610
958 Ga0466963_0028383 3300044694 Bacteria 3592
959 Ga0466963_0047564 3300044694 Bacteria 2831
960 Ga0466964_0023432 3300044706 Bacteria 2400
961 Ga0453684_0117634 3300044712 Bacteria 3216
962 Ga0453684_0124488 3300044712 Bacteria 3105
963 Ga0466968_0001947 3300044735 Bacteria 7490
964 Ga0466957_0040886 3300044842 Bacteria 2802
965 Ga0466957_0118930 3300044842 Bacteria 1683
966 Ga0466960_0000424 3300044901 Bacteria 14510
967 Ga0451576_0042039 3300045051 Bacteria 4826
968 Ga0451576_0049108 3300045051 Bacteria 4428
969 Ga0451576_0053448 3300045051 Bacteria 4231
970 Ga0451576_0106958 3300045051 Bacteria 2910
971 Ga0451576_0120908 3300045051 Bacteria 2726
972 Ga0451576_0134449 3300045051 Bacteria 2578
973 Ga0451576_0198840 3300045051 Bacteria 2093
974 Ga0451576_0335142 3300045051 Bacteria 1583
975 Ga0466967_0053468 3300045976 Bacteria 3549
976 Ga0466967_0054863 3300045976 Bacteria 3509
977 Ga0466967_0118266 3300045976 Bacteria 2444
978 Ga0495603_0000660 3300046455 Bacteria 19483
979 Ga0495603_0033928 3300046455 Bacteria 3070
980 Ga0495603_0044317 3300046455 Bacteria 2654
981 Ga0495603_0063873 3300046455 Bacteria 2171
982 Ga0495629_0000467 3300046459 Bacteria 33859
983 Ga0495629_0006153 3300046459 Bacteria 8909
984 Ga0495629_0008755 3300046459 Bacteria 7441
985 Ga0495638_0007605 3300046460 Bacteria 7750
986 Ga0495650_0025999 3300046471 Bacteria 2732
987 Ga0495580_0001503 3300046472 Bacteria 20499
988 Ga0495580_0001799 3300046472 Bacteria 18843
989 Ga0495580_0003523 3300046472 Bacteria 13298
990 Ga0495580_0003995 3300046472 Bacteria 12443
991 Ga0495580_0148736 3300046472 Bacteria 1623
992 Ga0495582_0000163 3300046473 Bacteria 35979
993 Ga0495582_0087857 3300046473 Bacteria 1731
994 Ga0495639_0000640 3300046475 Bacteria 16156
995 Ga0495662_0000890 3300046476 Bacteria 14606
996 Ga0495664_0006716 3300046477 Bacteria 6363
997 Ga0495664_0008332 3300046477 Bacteria 5781
998 Ga0495664_0018995 3300046477 Bacteria 3947
999 Ga0495594_0001989 3300046499 Bacteria 10649
1000 Ga0495594_0019812 3300046499 Bacteria 3578
1001 Ga0495594_0052058 3300046499 Bacteria 2254
1002 Ga0495606_0005210 3300046507 Bacteria 12548
1003 Ga0495608_0023223 3300046511 Bacteria 4251
1004 Ga0495610_0049618 3300046512 Bacteria 2054
1005 Ga0495610_0049894 3300046512 Bacteria 2046
1006 Ga0495616_0044813 3300046513 Bacteria 2242
1007 Ga0495616_0102732 3300046513 Bacteria 1339
1008 Ga0495618_0099480 3300046514 Bacteria 1861
1009 Ga0495630_0002387 3300046517 Bacteria 13052
1010 Ga0495630_0188276 3300046517 Bacteria 1574
1011 Ga0495632_0061048 3300046519 Bacteria 1830
1012 Ga0495666_0023818 3300046526 Bacteria 3028
1013 Ga0495642_0026594 3300046528 Bacteria 2299
1014 Ga0495652_0014517 3300046529 Bacteria 7068
1015 Ga0495652_0017934 3300046529 Bacteria 6316
1016 Ga0495652_0048165 3300046529 Bacteria 3654
1017 Ga0495652_0146261 3300046529 Bacteria 1852
1018 Ga0495665_0000853 3300046531 Bacteria 15971
1019 Ga0495665_0032167 3300046531 Bacteria 2805
1020 Ga0495665_0047667 3300046531 Bacteria 2273
1021 Ga0495640_0046380 3300046533 Bacteria 3011
1022 Ga0495640_0054761 3300046533 Bacteria 2731
1023 Ga0495586_0023014 3300046535 Bacteria 3327
1024 Ga0495586_0160395 3300046535 Bacteria 1268
1025 Ga0495609_0020183 3300046538 Bacteria 3080
1026 Ga0495621_0003684 3300046539 Bacteria 4240
1027 Ga0495621_0025661 3300046539 Bacteria 1982
1028 Ga0495597_0049260 3300046542 Bacteria 1862
1029 Ga0495645_0084621 3300046543 Bacteria 2271
1030 Ga0495645_0176430 3300046543 Bacteria 1467
1031 Ga0495667_0015729 3300046559 Bacteria 5115
1032 Ga0495668_0013473 3300046616 Bacteria 4820
1033 Ga0495668_0038325 3300046616 Bacteria 2679
1034 Ga0495668_0070317 3300046616 Bacteria 1924
1035 Ga0495634_0001271 3300046642 Bacteria 23127
1036 Ga0495634_0032253 3300046642 Bacteria 3603
1037 Ga0495634_0056534 3300046642 Bacteria 2621
1038 Ga0495634_0068190 3300046642 Bacteria 2351
1039 Ga0495625_0001907 3300046660 Bacteria 23574
1040 Ga0495625_0088915 3300046660 Bacteria 2139
1041 Ga0495635_0001312 3300046663 Bacteria 16576
1042 Ga0495635_0002205 3300046663 Bacteria 13252
1043 Ga0495635_0044562 3300046663 Bacteria 3061
1044 Ga0495659_0050651 3300046664 Bacteria 1511
1045 Ga0495588_0033944 3300046674 Bacteria 2580
1046 Ga0495588_0135776 3300046674 Bacteria 1298
1047 Ga0495657_0005817 3300046675 Bacteria 9710
1048 Ga0495599_0060189 3300046678 Bacteria 2374
1049 Ga0495623_0010915 3300046679 Bacteria 5881
1050 Ga0495646_0009169 3300046680 Bacteria 6279
1051 Ga0495647_0000813 3300046681 Bacteria 9324
1052 Ga0495647_0041185 3300046681 Bacteria 1758
1053 Ga0495658_0000512 3300046683 Bacteria 21274
1054 Ga0495658_0020852 3300046683 Bacteria 3447
1055 Ga0495669_0009883 3300046684 Bacteria 4032
1056 Ga0495669_0022731 3300046684 Bacteria 2725
1057 Ga0495613_0002976 3300046689 Bacteria 12687
1058 Ga0495613_0021834 3300046689 Bacteria 4771
1059 Ga0495624_0118546 3300046690 Bacteria 1626
1060 Ga0495649_0015433 3300046694 Bacteria 4347
1061 Ga0495600_0011910 3300046809 Bacteria 5432
1062 Ga0495581_0002361 3300047315 Bacteria 10645
1063 Ga0495581_0104951 3300047315 Bacteria 1642
1064 Ga0495604_0002858 3300047317 Bacteria 13846
1065 Ga0495604_0007702 3300047317 Bacteria 8532
1066 Ga0495636_0027112 3300047318 Bacteria 2333
1067 Ga0495674_0013125 3300047319 Bacteria 7791
1068 Ga0495674_0013620 3300047319 Bacteria 7639
1069 Ga0495674_0032266 3300047319 Bacteria 4751
1070 Ga0495674_0041754 3300047319 Bacteria 4095
1071 Ga0495674_0098223 3300047319 Bacteria 2494
1072 Ga0495674_0103022 3300047319 Bacteria 2427
1073 Ga0495674_0141783 3300047319 Bacteria 2020
1074 Ga0495672_0023022 3300047320 Bacteria 4038
1075 Ga0495676_0015607 3300047321 Bacteria 6756
1076 Ga0495676_0077796 3300047321 Bacteria 2528
1077 Ga0495680_0040441 3300047322 Bacteria 3715
1078 Ga0495683_0043664 3300047323 Bacteria 2256
1079 Ga0495684_0004305 3300047471 Bacteria 11116
1080 Ga0495684_0074199 3300047471 Bacteria 2584
1081 Ga0495686_0051333 3300047472 Bacteria 2588
1082 Ga0495593_0000331 3300047673 Bacteria 26196
1083 Ga0495593_0005960 3300047673 Bacteria 7176
1084 Ga0495593_0070872 3300047673 Bacteria 1810
1085 Ga0495602_0021275 3300048088 Bacteria 6391
1086 Ga0495602_0021985 3300048088 Bacteria 6254
1087 Ga0495602_0156477 3300048088 Unclassified 1784
1088 Ga0495626_0024063 3300048091 Bacteria 2989
1089 Ga0496100_0055959 3300048903 Bacteria 2579
1090 Ga0496101_0144295 3300048904 Bacteria 1817
1091 Ga0496102_0086923 3300048905 Bacteria 2888
1092 Ga0496103_0088336 3300048906 Bacteria 1954
1093 Ga0496103_0109750 3300048906 Bacteria 1752
1094 Ga0496104_0001245 3300048907 Bacteria 21918
1095 Ga0496104_0011338 3300048907 Bacteria 7979
1096 Ga0496106_0002916 3300048909 Bacteria 12733
1097 Ga0496106_0015718 3300048909 Bacteria 5600
1098 Ga0496106_0142894 3300048909 Bacteria 1883
1099 Ga0496106_0261259 3300048909 Bacteria 1385
1100 Ga0496107_0026368 3300048910 Bacteria 4119
1101 Ga0496107_0211072 3300048910 Bacteria 1444
1102 Ga0496108_0011169 3300048911 Bacteria 7295
1103 Ga0496109_0002719 3300048912 Bacteria 14823
1104 Ga0496109_0124506 3300048912 Bacteria 2403
1105 Ga0496109_0124959 3300048912 Bacteria 2398
1106 Ga0496109_0152092 3300048912 Bacteria 2167
1107 Ga0496109_0398011 3300048912 Bacteria 1301
1108 Ga0496111_0026614 3300048914 Bacteria 4086
1109 Ga0496112_0010367 3300048915 Bacteria 8451
1110 Ga0496112_0116852 3300048915 Bacteria 2637
1111 Ga0496113_0046136 3300048916 Bacteria 3235
1112 Ga0496113_0051116 3300048916 Bacteria 3084
1113 Ga0496114_0025961 3300048917 Bacteria 4793
1114 Ga0496114_0100711 3300048917 Bacteria 2466
1115 Ga0496114_0312275 3300048917 Bacteria 1388
1116 Ga0496116_0008689 3300048919 Bacteria 8776
1117 Ga0496118_0008129 3300048921 Bacteria 10925
1118 Ga0496118_0050306 3300048921 Bacteria 3200
1119 Ga0496119_0003004 3300048922 Bacteria 17875
1120 Ga0496119_0086514 3300048922 Bacteria 1791
1121 Ga0496119_0107521 3300048922 Bacteria 1555
1122 Ga0496120_0006997 3300048923 Bacteria 8484
1123 Ga0496120_0032809 3300048923 Bacteria 3126
1124 Ga0496121_0002114 3300048924 Bacteria 31228
1125 Ga0496121_0017623 3300048924 Bacteria 7276
1126 Ga0496121_0023103 3300048924 Bacteria 6003
1127 Ga0496121_0064825 3300048924 Bacteria 2976
1128 Ga0496121_0114622 3300048924 Bacteria 2048
1129 Ga0496121_0155212 3300048924 Bacteria 1680
1130 Ga0496124_0001351 3300048927 Bacteria 36722
1131 Ga0496124_0224205 3300048927 Bacteria 1411
1132 Ga0496124_0230414 3300048927 Bacteria 1385
1133 Ga0496125_0022471 3300048928 Bacteria 5857
1134 Ga0496125_0032671 3300048928 Bacteria 4619
1135 Ga0496126_0006139 3300048929 Bacteria 13464
1136 Ga0496126_0026642 3300048929 Bacteria 5539
1137 Ga0496126_0034021 3300048929 Bacteria 4791
1138 Ga0496126_0056000 3300048929 Bacteria 3565
1139 Ga0496126_0067884 3300048929 Bacteria 3185
1140 Ga0496126_0068667 3300048929 Bacteria 3163
1141 Ga0496126_0088661 3300048929 Bacteria 2725
1142 Ga0496126_0105057 3300048929 Bacteria 2467
1143 Ga0496126_0195700 3300048929 Bacteria 1709
1144 Ga0501031_0021719 3300049568 Bacteria 4183
1145 Ga0501031_0047802 3300049568 Bacteria 2789
1146 Ga0501033_0001553 3300049570 Bacteria 20280
1147 Ga0501033_0006440 3300049570 Bacteria 9189
1148 Ga0501033_0011030 3300049570 Bacteria 6919
1149 Ga0501033_0171726 3300049570 Bacteria 1557
1150 Ga0501033_0208141 3300049570 Bacteria 1395
1151 Ga0501034_0022821 3300049571 Bacteria 6374
1152 Ga0501034_0092220 3300049571 Bacteria 3026
1153 Ga0501034_0206136 3300049571 Bacteria 1922
1154 Ga0501034_0297099 3300049571 Bacteria 1552
1155 Ga0501036_0001752 3300049572 Bacteria 16857
1156 Ga0501036_0006667 3300049572 Bacteria 9387
1157 Ga0501036_0067669 3300049572 Bacteria 3022
1158 Ga0501036_0206690 3300049572 Bacteria 1650
1159 Ga0501037_0002039 3300049573 Bacteria 14652
1160 Ga0501037_0017188 3300049573 Bacteria 5325
1161 Ga0501037_0107075 3300049573 Bacteria 2014
1162 Ga0501037_0240970 3300049573 Bacteria 1267
1163 Ga0501038_0003805 3300049574 Bacteria 14041
1164 Ga0501038_0057046 3300049574 Bacteria 3354
1165 Ga0501038_0191476 3300049574 Bacteria 1645
1166 Ga0501039_0000865 3300049575 Bacteria 21916
1167 Ga0501039_0059881 3300049575 Bacteria 2949
1168 Ga0501039_0077555 3300049575 Bacteria 2584
1169 Ga0501039_0120892 3300049575 Bacteria 2052
1170 Ga0501039_0193644 3300049575 Bacteria 1598
1171 Ga0501039_0234433 3300049575 Bacteria 1443
1172 Ga0501039_0240206 3300049575 Bacteria 1424
1173 Ga0501039_0254394 3300049575 Bacteria 1381
1174 Ga0501040_0194235 3300049576 Bacteria 1441
1175 Ga0501040_0195096 3300049576 Bacteria 1437
1176 Ga0501041_0024906 3300049577 Bacteria 3595
1177 Ga0501041_0051707 3300049577 Bacteria 2504
1178 Ga0501041_0085190 3300049577 Bacteria 1948
1179 Ga0501041_0167998 3300049577 Bacteria 1372
1180 Ga0501042_0002120 3300049578 Bacteria 12028
1181 Ga0501042_0040745 3300049578 Bacteria 3301
1182 Ga0501042_0071724 3300049578 Bacteria 2478
1183 Ga0501042_0265502 3300049578 Bacteria 1239
1184 Ga0501043_0001418 3300049579 Bacteria 20936
1185 Ga0501043_0002177 3300049579 Bacteria 16719
1186 Ga0501043_0010294 3300049579 Bacteria 7331
1187 Ga0501043_0024560 3300049579 Bacteria 4729
1188 Ga0501043_0039758 3300049579 Bacteria 3697
1189 Ga0501043_0150349 3300049579 Bacteria 1822
1190 Ga0501043_0155034 3300049579 Bacteria 1791
1191 Ga0501046_0001680 3300049580 Bacteria 21164
1192 Ga0501046_0050607 3300049580 Bacteria 3281
1193 Ga0501046_0080192 3300049580 Bacteria 2523
1194 Ga0501046_0156835 3300049580 Bacteria 1714
1195 Ga0501046_0179803 3300049580 Bacteria 1582
1196 Ga0501047_0004987 3300049581 Bacteria 12457
1197 Ga0501047_0045841 3300049581 Bacteria 4226
1198 Ga0501047_0084339 3300049581 Bacteria 3053
1199 Ga0501047_0116350 3300049581 Bacteria 2555
1200 Ga0501047_0140943 3300049581 Bacteria 2289
1201 Ga0501047_0176240 3300049581 Bacteria 2005
1202 Ga0501048_0007273 3300049582 Bacteria 8395
1203 Ga0501048_0010235 3300049582 Bacteria 7013
1204 Ga0501048_0010642 3300049582 Bacteria 6861
1205 Ga0501048_0011366 3300049582 Bacteria 6640
1206 Ga0501048_0053281 3300049582 Bacteria 2878
1207 Ga0501048_0089603 3300049582 Bacteria 2170
1208 Ga0501048_0118500 3300049582 Bacteria 1870
1209 Ga0501067_0002446 3300049583 Bacteria 10264
1210 Ga0501067_0030866 3300049583 Bacteria 2973
1211 Ga0501067_0045880 3300049583 Bacteria 2426
1212 Ga0501068_0010598 3300049584 Bacteria 5183
1213 Ga0501068_0021887 3300049584 Bacteria 3735
1214 Ga0501068_0080345 3300049584 Bacteria 2000
1215 Ga0501069_0002887 3300049585 Bacteria 8819
1216 Ga0501069_0024820 3300049585 Bacteria 3273
1217 Ga0501069_0053728 3300049585 Bacteria 2243
1218 Ga0501070_0006386 3300049586 Bacteria 10030
1219 Ga0501070_0021654 3300049586 Bacteria 5390
1220 Ga0501070_0276554 3300049586 Bacteria 1370
1221 Ga0501071_0001305 3300049587 Bacteria 14212
1222 Ga0501071_0024877 3300049587 Bacteria 4190
1223 Ga0501071_0052423 3300049587 Bacteria 2942
1224 Ga0501072_0016027 3300049588 Bacteria 5747
1225 Ga0501072_0077306 3300049588 Bacteria 2635
1226 Ga0501072_0150528 3300049588 Bacteria 1855
1227 Ga0501072_0163640 3300049588 Bacteria 1775
1228 Ga0501073_0013232 3300049589 Bacteria 6013
1229 Ga0501073_0084163 3300049589 Bacteria 2213
1230 Ga0501073_0199375 3300049589 Bacteria 1384
1231 Ga0501074_0001868 3300049590 Bacteria 14437
1232 Ga0501074_0026753 3300049590 Bacteria 4183
1233 Ga0501074_0032936 3300049590 Bacteria 3755
1234 Ga0501074_0045794 3300049590 Bacteria 3163
1235 Ga0501074_0065122 3300049590 Bacteria 2623
1236 Ga0501075_0017473 3300049591 Bacteria 5183
1237 Ga0501075_0031114 3300049591 Bacteria 3959
1238 Ga0501075_0034069 3300049591 Bacteria 3790
1239 Ga0501075_0132342 3300049591 Bacteria 1900
1240 Ga0501076_0014051 3300049592 Bacteria 6018
1241 Ga0501076_0017780 3300049592 Bacteria 5405
1242 Ga0501076_0029417 3300049592 Bacteria 4273
1243 Ga0501076_0043259 3300049592 Bacteria 3548
1244 Ga0501076_0115580 3300049592 Bacteria 2171
1245 Ga0501076_0132694 3300049592 Bacteria 2020
1246 Ga0501076_0148802 3300049592 Bacteria 1904
1247 Ga0501077_0015591 3300049593 Bacteria 4785
1248 Ga0501077_0026027 3300049593 Bacteria 3712
1249 Ga0501077_0031586 3300049593 Bacteria 3370
1250 Ga0501077_0033064 3300049593 Bacteria 3293
1251 Ga0501077_0097997 3300049593 Bacteria 1858
1252 Ga0501077_0145134 3300049593 Bacteria 1505
1253 Ga0501249_004137 3300049679 Bacteria 2937
1254 Ga0501225_0010347 3300049705 Bacteria 2642
1255 Ga0501079_0001542 3300049741 Bacteria 16318
1256 Ga0501079_0003813 3300049741 Bacteria 11139
1257 Ga0501079_0011309 3300049741 Bacteria 6808
1258 Ga0501079_0020988 3300049741 Bacteria 4992
1259 Ga0501079_0085214 3300049741 Bacteria 2445
1260 Ga0501079_0145497 3300049741 Bacteria 1847
1261 Ga0501080_0007581 3300049742 Bacteria 9810
1262 Ga0501080_0017651 3300049742 Bacteria 6599
1263 Ga0501080_0084578 3300049742 Bacteria 2947
1264 Ga0501080_0114015 3300049742 Bacteria 2506
1265 Ga0501080_0253186 3300049742 Bacteria 1605
1266 Ga0501081_0005169 3300049743 Bacteria 8400
1267 Ga0501081_0009148 3300049743 Bacteria 6447
1268 Ga0501081_0022757 3300049743 Bacteria 4195
1269 Ga0501081_0029605 3300049743 Bacteria 3701
1270 Ga0501081_0035335 3300049743 Bacteria 3402
1271 Ga0501081_0054447 3300049743 Bacteria 2764
1272 Ga0501083_0007474 3300049744 Bacteria 7741
1273 Ga0501083_0012144 3300049744 Bacteria 6029
1274 Ga0501083_0020189 3300049744 Bacteria 4635
1275 Ga0501083_0038161 3300049744 Bacteria 3266
1276 Ga0501083_0160417 3300049744 Bacteria 1471
1277 Ga0501262_000299 3300049759 Bacteria 6034
1278 Ga0501035_0011638 3300049822 Bacteria 8156
1279 Ga0501035_0018905 3300049822 Bacteria 6348
1280 Ga0501035_0097326 3300049822 Bacteria 2584
1281 Ga0501044_0036860 3300049823 Bacteria 5114
1282 Ga0501044_0134533 3300049823 Bacteria 2464
1283 Ga0501045_0005175 3300049824 Bacteria 9019
1284 Ga0501045_0019952 3300049824 Bacteria 4784
1285 Ga0501045_0022962 3300049824 Bacteria 4471
1286 nmdc:mga03683_580_c1 3300050489 Bacteria 10481
1287 nmdc:mga03n38_2842_c1 3300050490 Bacteria 5449
1288 nmdc:mga00v17_15536_c1 3300050491 Bacteria 4273
1289 nmdc:mga0yw44_52105_c1 3300050492 Bacteria 2480
1290 nmdc:mga0yw44_8904_c1 3300050492 Bacteria 5034
1291 nmdc:mga0k408_1112_c1 3300050493 Bacteria 14734
1292 nmdc:mga0k408_19707_c1 3300050493 Bacteria 3773
1293 nmdc:mga0k408_346_c1 3300050493 Bacteria 25314
1294 nmdc:mga0k408_7919_c1 3300050493 Bacteria 5691
1295 nmdc:mga0k408_9424_c2 3300050493 Bacteria 1843
1296 nmdc:mga0k408_9464_c1 3300050493 Bacteria 5252
1297 nmdc:mga06z11_15319_c1 3300050494 Bacteria 3419
1298 nmdc:mga06z11_41330_c1 3300050494 Bacteria 2307
1299 nmdc:mga07m45_14954_c1 3300050496 Bacteria 4143
1300 nmdc:mga07m45_4134_c1 3300050496 Bacteria 7084
1301 nmdc:mga07m45_55321_c1 3300050496 Bacteria 2243
1302 nmdc:mga07m45_9845_c1 3300050496 Bacteria 4973
1303 nmdc:mga05p37_101475_c1 3300050507 Bacteria 3543
1304 nmdc:mga05p37_104823_c1 3300050507 Bacteria 3479
1305 nmdc:mga05p37_11277_c1 3300050507 Bacteria 10629
1306 nmdc:mga05p37_13987_c1 3300050507 Bacteria 9624
1307 nmdc:mga05p37_14391_c1 3300050507 Bacteria 9498
1308 nmdc:mga05p37_152277_c1 3300050507 Bacteria 2828
1309 nmdc:mga05p37_180636_c1 3300050507 Bacteria 2567
1310 nmdc:mga05p37_24403_c1 3300050507 Bacteria 7348
1311 nmdc:mga05p37_24615_c1 3300050507 Bacteria 7318
1312 nmdc:mga05p37_2488_c1 3300050507 Bacteria 21424
1313 nmdc:mga05p37_3181_c1 3300050507 Bacteria 19102
1314 nmdc:mga05p37_3321_c1 3300050507 Bacteria 18762
1315 nmdc:mga05p37_340435_c1 3300050507 Bacteria 1769
1316 nmdc:mga05p37_47749_c1 3300050507 Bacteria 5265
1317 nmdc:mga05p37_54345_c1 3300050507 Bacteria 4926
1318 nmdc:mga05p37_55103_c2 3300050507 Bacteria 2988
1319 nmdc:mga05p37_579593_c1 3300050507 Bacteria 1271
1320 nmdc:mga05p37_61882_c1 3300050507 Bacteria 4607
1321 nmdc:mga05p37_64428_c1 3300050507 Bacteria 4510
1322 nmdc:mga05p37_69165_c1 3300050507 Bacteria 4343
1323 nmdc:mga05p37_7536_c1 3300050507 Bacteria 12830
1324 nmdc:mga05p37_75434_c1 3300050507 Bacteria 4151
1325 nmdc:mga05p37_90235_c1 3300050507 Bacteria 3777
1326 nmdc:mga09592_132745_c1 3300050508 Bacteria 2143
1327 nmdc:mga09592_133468_c1 3300050508 Bacteria 2138
1328 nmdc:mga09592_30120_c1 3300050508 Bacteria 4516
1329 nmdc:mga09592_37965_c1 3300050508 Bacteria 4041
1330 nmdc:mga09592_4918_c1 3300050508 Bacteria 10833
1331 nmdc:mga09592_55671_c1 3300050508 Bacteria 3342
1332 nmdc:mga09592_83192_c1 3300050508 Bacteria 2728
1333 nmdc:mga09592_8656_c1 3300050508 Bacteria 8280
1334 nmdc:mga0qj67_207947_c1 3300050509 Bacteria 1590
1335 nmdc:mga0qj67_21731_c1 3300050509 Bacteria 4924
1336 nmdc:mga0qj67_31254_c1 3300050509 Bacteria 4147
1337 nmdc:mga0qj67_39740_c1 3300050509 Bacteria 3696
1338 nmdc:mga0qj67_5521_c1 3300050509 Bacteria 9244
1339 nmdc:mga0qj67_58392_c1 3300050509 Bacteria 3059
1340 nmdc:mga0qj67_64776_c1 3300050509 Bacteria 2908
1341 nmdc:mga0qj67_85883_c1 3300050509 Bacteria 2524
1342 nmdc:mga06r32_108008_c1 3300050510 Bacteria 2735
1343 nmdc:mga06r32_142293_c1 3300050510 Bacteria 2376
1344 nmdc:mga06r32_142_c1 3300050510 Bacteria 53686
1345 nmdc:mga06r32_15351_c1 3300050510 Bacteria 6959
1346 nmdc:mga06r32_155752_c1 3300050510 Bacteria 2266
1347 nmdc:mga06r32_211788_c1 3300050510 Bacteria 1926
1348 nmdc:mga06r32_302851_c1 3300050510 Bacteria 1584
1349 nmdc:mga06r32_32305_c1 3300050510 Bacteria 4924
1350 nmdc:mga06r32_383449_c1 3300050510 Bacteria 1388
1351 nmdc:mga06r32_52270_c1 3300050510 Bacteria 3913
1352 nmdc:mga06r32_58496_c1 3300050510 Bacteria 3704
1353 nmdc:mga06r32_6124_c1 3300050510 Bacteria 10804
1354 nmdc:mga06r32_9269_c1 3300050510 Bacteria 8873
1355 nmdc:mga06r32_9276_c1 3300050510 Bacteria 8870
1356 nmdc:mga06r32_93765_c1 3300050510 Bacteria 2937
1357 nmdc:mga08y16_112136_c1 3300050511 Bacteria 2839
1358 nmdc:mga08y16_155353_c1 3300050511 Bacteria 2377
1359 nmdc:mga08y16_204_c3 3300050511 Bacteria 8325
1360 nmdc:mga08y16_250_c1 3300050511 Bacteria 48435
1361 nmdc:mga08y16_25309_c1 3300050511 Bacteria 6258
1362 nmdc:mga08y16_2965_c1 3300050511 Bacteria 17489
1363 nmdc:mga08y16_51069_c1 3300050511 Bacteria 4326
1364 nmdc:mga08y16_6645_c1 3300050511 Bacteria 12132
1365 nmdc:mga08y16_84543_c1 3300050511 Bacteria 3307
1366 nmdc:mga08y16_95168_c1 3300050511 Unclassified 3102
1367 nmdc:mga0n895_101627_c1 3300050512 Bacteria 2885
1368 nmdc:mga0n895_10268_c1 3300050512 Bacteria 8255
1369 nmdc:mga0n895_112705_c1 3300050512 Bacteria 2737
1370 nmdc:mga0n895_12893_c1 3300050512 Bacteria 7512
1371 nmdc:mga0n895_131382_c1 3300050512 Bacteria 2529
1372 nmdc:mga0n895_160692_c1 3300050512 Bacteria 2278
1373 nmdc:mga0n895_169523_c1 3300050512 Bacteria 2215
1374 nmdc:mga0n895_20353_c1 3300050512 Bacteria 5126
1375 nmdc:mga0n895_248652_c1 3300050512 Bacteria 1805
1376 nmdc:mga0n895_25698_c1 3300050512 Bacteria 5568
1377 nmdc:mga0n895_3178_c1 3300050512 Bacteria 13125
1378 nmdc:mga0n895_419_c1 3300050512 Bacteria 28472
1379 nmdc:mga0n895_60203_c1 3300050512 Bacteria 3747
1380 nmdc:mga0n895_803_c1 3300050512 Bacteria 22459
1381 nmdc:mga0n895_81600_c1 3300050512 Bacteria 3223
1382 nmdc:mga0rr50_108557_c1 3300050513 Bacteria 2193
1383 nmdc:mga0rr50_13755_c1 3300050513 Bacteria 5282
1384 nmdc:mga0rr50_23455_c1 3300050513 Bacteria 4256
1385 nmdc:mga0rr50_37460_c1 3300050513 Bacteria 3501
1386 nmdc:mga08x19_1474_c1 3300050514 Bacteria 14579
1387 nmdc:mga0a205_116472_c1 3300050515 Bacteria 2571
1388 nmdc:mga0a205_144871_c1 3300050515 Bacteria 2276
1389 nmdc:mga0a205_151348_c1 3300050515 Bacteria 2220
1390 nmdc:mga0a205_1651_c1 3300050515 Bacteria 19181
1391 nmdc:mga0a205_16932_c1 3300050515 Bacteria 6825
1392 nmdc:mga0a205_17702_c1 3300050515 Bacteria 6687
1393 nmdc:mga0a205_18222_c1 3300050515 Bacteria 6596
1394 nmdc:mga0a205_20683_c1 3300050515 Bacteria 6215
1395 nmdc:mga0a205_211118_c1 3300050515 Bacteria 1829
1396 nmdc:mga0a205_3138_c2 3300050515 Bacteria 13217
1397 nmdc:mga0a205_31482_c1 3300050515 Bacteria 5081
1398 nmdc:mga0a205_334431_c1 3300050515 Bacteria 1384
1399 nmdc:mga0a205_40438_c1 3300050515 Bacteria 4488
1400 nmdc:mga0a205_756_c1 3300050515 Bacteria 26070
1401 nmdc:mga0a205_7684_c2 3300050515 Bacteria 9115
1402 Ga0495601_0141072 3300053077 Bacteria 1572
1403 Ga0495612_0024110 3300053078 Bacteria 2443
1404 Ga0495619_0048113 3300053085 Bacteria 2810
1405 Ga0495619_0077485 3300053085 Bacteria 2233
1406 Ga0500578_0035295 3300053086 Bacteria 3214
1407 Ga0500643_000018 3300053087 Bacteria 296505
1408 Ga0500651_0016981 3300053093 Bacteria 4480
1409 Ga0500566_0000038 3300053094 Bacteria 66925
1410 Ga0500566_0003392 3300053094 Bacteria 9510
1411 Ga0500640_007905 3300053095 Bacteria 4174
1412 Ga0500640_021426 3300053095 Bacteria 2788
1413 Ga0500641_0003063 3300053096 Bacteria 5928
1414 Ga0500641_0012847 3300053096 Bacteria 3066
1415 Ga0500554_000388 3300053102 Bacteria 9498
1416 Ga0500555_001110 3300053103 Bacteria 8901
1417 Ga0500556_0032311 3300053104 Bacteria 1787
1418 Ga0500557_000008 3300053105 Bacteria 127284
1419 Ga0500562_011823 3300053108 Bacteria 2217
1420 Ga0500572_000010 3300053111 Bacteria 67071
1421 Ga0500572_009784 3300053111 Bacteria 2275
1422 Ga0500595_000414 3300053119 Bacteria 27179
1423 Ga0500595_003164 3300053119 Bacteria 7796
1424 Ga0500595_014908 3300053119 Bacteria 2935
1425 Ga0500595_023353 3300053119 Bacteria 2175
1426 Ga0500614_000527 3300053123 Bacteria 9848
1427 Ga0500642_0024247 3300053130 Bacteria 2448
1428 Ga0500559_0001128 3300053136 Bacteria 16079
1429 Ga0500559_0001831 3300053136 Bacteria 11598
1430 Ga0500568_0041774 3300053139 Bacteria 1841
1431 Ga0500573_0025983 3300053140 Bacteria 3365
1432 Ga0500590_027576 3300053148 Bacteria 2946
1433 Ga0500603_000506 3300053150 Bacteria 9885
1434 Ga0500603_001672 3300053150 Bacteria 4996
1435 Ga0500604_0018315 3300053151 Bacteria 1950
1436 Ga0500616_0010066 3300053153 Bacteria 5682
1437 Ga0500616_0067602 3300053153 Bacteria 1832
1438 Ga0500620_011369 3300053155 Bacteria 2384
1439 Ga0500622_0043388 3300053156 Bacteria 2332
1440 Ga0500630_017682 3300053159 Bacteria 3517
1441 Ga0500639_000034 3300053163 Bacteria 66994
1442 Ga0500636_0000618 3300053177 Bacteria 19228
1443 Ga0500636_0030876 3300053177 Bacteria 3171
1444 Ga0500636_0063419 3300053177 Bacteria 2153
1445 Ga0500636_0118470 3300053177 Bacteria 1487
1446 Ga0500637_0001326 3300053178 Bacteria 10428
1447 Ga0500637_0074915 3300053178 Bacteria 1949
1448 Ga0500637_0100285 3300053178 Bacteria 1679
1449 Ga0500625_004205 3300053729 Bacteria 5838
1450 Ga0500645_002184 3300053730 Bacteria 8954
1451 Ga0500645_019887 3300053730 Bacteria 2085
1452 Ga0500609_002717 3300053731 Bacteria 2520
1453 Ga0500552_001233 3300053733 Bacteria 2426
1454 Ga0500596_001579 3300053735 Bacteria 4626
1455 Ga0500601_001069 3300053737 Bacteria 3102
1456 Ga0501084_0002479 3300054114 Bacteria 14868
1457 Ga0501084_0002704 3300054114 Bacteria 14281
1458 Ga0501084_0003774 3300054114 Bacteria 12316
1459 Ga0501084_0010622 3300054114 Bacteria 7618
1460 Ga0501084_0060361 3300054114 Bacteria 3175
1461 Ga0501084_0072728 3300054114 Bacteria 2879
1462 Ga0501084_0150206 3300054114 Bacteria 1963
1463 Ga0501084_0362235 3300054114 Bacteria 1225
1464 Ga0500661_001493 3300055283 Bacteria 4389
1465 Ga0590071_008059 3300059421 Bacteria 2489
1466 Ga0587077_010797 3300059493 Bacteria 1421
1467 Ga0587082_008852 3300059504 Bacteria 1415
1468 Ga0587111_0013118 3300060346 Bacteria 1475
1469 Ga0587111_0016186 3300060346 Bacteria 1373
1470 Ga0501082_0001991 3300060353 Bacteria 17945
1471 Ga0501082_0003830 3300060353 Bacteria 13152
1472 Ga0501082_0004398 3300060353 Bacteria 12303
1473 Ga0501082_0012904 3300060353 Bacteria 7182
1474 Ga0501082_0032420 3300060353 Bacteria 4506
1475 Ga0501082_0050516 3300060353 Bacteria 3585
1476 Ga0501082_0094844 3300060353 Bacteria 2578
1477 Ga0501082_0120666 3300060353 Bacteria 2272
1478 Ga0501082_0199776 3300060353 Bacteria 1739
1479 Ga0530510_0018987 3300061734 Bacteria 4876
1480 Ga0530510_0218526 3300061734 Bacteria 1416
1481 2507510851 2507262055 Bacteria 8048963
1482 2508544668 2508501009 Bacteria 7784016
1483 2508697116 2508501042 Bacteria 8719808
1484 2511395630 2511231028 Bacteria 8046582
1485 2513623858 2513237092 Bacteria 8341956
1486 2513637639 2513237094 Bacteria 8789602
1487 2513649508 2513237095 Bacteria 8976980
1488 2513655816 2513237096 Bacteria 8722461
1489 2513696483 2513237101 Bacteria 7952346
1490 2513704248 2513237102 Bacteria 7703324
1491 2513719326 2513237104 Bacteria 10034502
1492 2513856688 2513237137 Bacteria 9558895
1493 2513874504 2513237139 Bacteria 8737671
1494 2513917271 2513237145 Bacteria 8979722
1495 2515630720 2515154112 Bacteria 8294334
1496 2517100423 2517093001 Bacteria 9002274
1497 2517895445 2517572143 Bacteria 9484767
1498 2524437284 2524023205 Bacteria 8918781
1499 2528855277 2528768022 Bacteria 10457665
1500 2587754296 2585428062 Bacteria 6842168
1501 2617377971 2617270741 Bacteria 8201522
1502 2644727632 2643221733 Bacteria 5690728
1503 2644743777 2643221736 Bacteria 6608466
1504 2671122121 2667528175 Bacteria 7532676
1505 2723842989 2721755755 Bacteria 8322773
1506 2745076753 2744054633 Bacteria 8678936
1507 2793065128 2791355196 Bacteria 7323613
1508 2793069424 2791355197 Bacteria 8420563
1509 2793082456
1510 2805916499 2802429603 Bacteria 8777136
1511 2818237978 2816332527 Bacteria 8933356
1512 2824601530 2824600985 Bacteria 8488197
1513 2824617198 2824609381 Bacteria 8672835
1514 2824619009 2824617872 Bacteria 8814715
1515 2824627471 2824626560 Bacteria 8813858
1516 2824637855 2824635225 Bacteria 8785348
1517 2824644637 2824644064 Bacteria 8743947
1518 2824653661 2824653114 Bacteria 8493680
1519 2824663033 2824661429 Bacteria 9877870
1520 2824673183 2824671348 Bacteria 8369588
1521 2824680524 2824679649 Bacteria 8248951
1522 2824689903 2824687955 Bacteria 8360029
1523 2824698032 2824696289 Bacteria 8335049
1524 2824709867 2824704595 Bacteria 9667483
1525 2824715833 2824714736 Bacteria 8717648
1526 2824724223 2824723954 Bacteria 8758240
1527 2824746241 2824746037 Bacteria 7911610
1528 2824757000 2824753945 Bacteria 9787441
1529 2824770128 2824763712 Bacteria 9792355
1530 2824778528 2824773399 Bacteria 8360218
1531 2838129781 2838122688 Bacteria 8803140
1532 2841764903 2841760612 Bacteria 6454112
1533 2841917038 2841911363 Bacteria 6173697
1534 2841922659 2841917233 Bacteria 6173500
1535 2841943043 2841941048 Bacteria 8688029
1536 2841956720 2841949485 Bacteria 8680857
1537 2841960377 2841957949 Bacteria 8652217
1538 2841968323 2841966195 Bacteria 8673214
1539 2841976471 2841974524 Bacteria 8931498
1540 2841987838 2841983080 Bacteria 8395090
1541 2842042848 2842038055 Bacteria 8002051
1542 2842050889 2842045827 Bacteria 8006841
1543 2842680379 2842677519 Bacteria 5615038
1544 2844107649 2844104063 Bacteria 6440972
1545 2844317089 2844315083 Bacteria 8138177
1546 2847938421 2847930680 Bacteria 9342022
1547 2847944386 2847939898 Bacteria 8606328
1548 2849081381 2849076700 Bacteria 7039503
1549 2851183600 2851182111 Bacteria 6047226
1550 2851249755 2851246043 Bacteria 6439203
1551 2857512038 2857509624 Bacteria 7472071
1552 2874597566 2874590934 Bacteria 8299676
1553 2874616623 2874612657 Bacteria 8252029
1554 2874630477 2874628541 Bacteria 8630250
1555 2874649129 2874645413 Bacteria 8214782
1556 2876768048 2876761206 Bacteria 10111113
1557 2876774961 2876771140 Bacteria 8287509
1558 2876822287 2876818435 Bacteria 8274608
1559 2879078049 2879074833 Bacteria 8279565
1560 2879088657 2879083081 Bacteria 8587928
1561 2879104000 2879099564 Bacteria 10442239
1562 2879132400 2879127579 Bacteria 8294491
1563 2879145301 2879142872 Bacteria 8267021
1564 2885194550 2885192300 Bacteria 5882526
1565 2885367067 2885366525 Bacteria 8326213
1566 2885382179 2885374607 Bacteria 8927485
1567 2885416486 2885409591 Bacteria 9235467
1568 2888381704 2888378607 Bacteria 9652610
1569 2888388935 2888388044 Bacteria 7304136
1570 2888422088 2888419890 Bacteria 7857137
1571 2894241291 2894232714 Bacteria 8834183
1572 2903735056 2903727486 Bacteria 8281579
1573 2903751326 2903748898 Bacteria 9972761
1574 2904667627 2904666416 Bacteria 8226587
1575 2904698790 2904690495 Bacteria 9412302
1576 2904719036 2904711408 Bacteria 9771557
1577 2906604172 2906602504 Bacteria 8295279
1578 2906615935
1579 2906635156 2906626472 Bacteria 8826946
1580 2906639031 2906635258 Bacteria 8601019
1581 2906647983 2906643746 Bacteria 8722424
1582 2906662079 2906660503 Bacteria 8595048
1583 2908740949 2908739725 Bacteria 8628932
1584 2908758041 2908756301 Bacteria 8864324
1585 2917701040 2917699015 Bacteria 7043791
1586 2919467419 2919462493 Bacteria 5817112
1587 2922367073 2922361189 Bacteria 7436256
1588 2922371389
1589 2922390148 2922386360 Bacteria 7017218
1590 2922393725 2922393267 Bacteria 8285685
1591 2929523925 2929520902 Bacteria 6765052
1592 2929623238 2929615660 Bacteria 9193770
1593 2929630918 2929624759 Bacteria 9339455
1594 2932786094 2932784394 Bacteria 9704911
1595 2932799142 2932794094 Bacteria 7915132
1596 2932803935 2932801729 Bacteria 7987968
1597 2932811964 2932809354 Bacteria 9135765
1598 2932822550 2932818245 Bacteria 9955613
1599 2932831137 2932828146 Bacteria 9745859
1600 2933585142 2933577622 Bacteria 9116884
1601 2935612927 2935608549 Bacteria 8203142
1602 2935624077 2935616580 Bacteria 9032984
1603 2935631030 2935630451 Bacteria 8169952
1604 2935640277 2935638405 Bacteria 10015038
1605 2935666885 2935665750 Bacteria 9571747
1606 2935684351 2935675223 Bacteria 9928132
1607 2935691343 2935684952 Bacteria 9590419
1608 2935699902 2935694250 Bacteria 9291695
1609 2935704640 2935703347 Bacteria 10242284
1610 2935719177 2935713505 Bacteria 9608509
1611 2935729223 2935722832 Bacteria 9608746
1612 2935737536 2935732158 Bacteria 9706831
1613 2935746912 2935741537 Bacteria 9707219
1614 2935758289 2935750917 Bacteria 9590372
1615 2935762460 2935760218 Bacteria 9817913
1616 2935777288 2935769743 Bacteria 7878163
1617 2935780393 2935777560 Bacteria 8077691
1618 2935793208 2935785616 Bacteria 7962367
1619 2935801196 2935793552 Bacteria 8012592
1620 2935803957 2935801545 Bacteria 9301974
1621 2935811876 2935810662 Bacteria 9401221
1622 2935824415 2935819856 Bacteria 8261050
1623 2935829760 2935827899 Bacteria 10038562
1624 2935842883 2935837841 Bacteria 9454360
1625 2935852440 2935847175 Bacteria 8228321
1626 2935862423 2935855204 Bacteria 9035059
1627 2935870558 2935864058 Bacteria 9784707
1628 2935881140 2935873716 Bacteria 9632195
1629 2935884259 2935883170 Bacteria 7964738
1630 2935912413 2935908558 Bacteria 8568796
1631 2935921754 2935916978 Bacteria 9113783
1632 2935929698 2935926038 Bacteria 8601059
1633 2935938930 2935934488 Bacteria 8602579
1634 2935948235 2935942939 Bacteria 8599779
1635 2935954959 2935951376 Bacteria 8602333
1636 2935962227 2935959822 Bacteria 7869783
1637 2935972007 2935967501 Bacteria 8603075
1638 2935979345 2935975950 Bacteria 8347125
1639 2935988080 2935984226 Bacteria 8302647
1640 2935993637 2935992306 Bacteria 9802711
1641 2936004533 2936002035 Bacteria 9362176
1642 2936038459 2936037263 Bacteria 9446081
1643 2936059369 2936055302 Bacteria 8785755
1644 2940563801 2940556831 Bacteria 9590747
1645 2941507682 2941507105 Bacteria 8166816
1646 2941516109 2941515067 Bacteria 8166720
1647 2941523183 2941523033 Bacteria 8169134
1648 2941533861 2941531003 Bacteria 7653939
1649 2941544132 2941538514 Bacteria 9402094
1650 2945947880 2945945610 Bacteria 5951079
1651 2954768171 2954767861 Bacteria 5535784
1652 3005476884 3005474847 Bacteria 9259049
1653 3005485353 3005483717 Bacteria 7877331
1654 3005507277 3005506211 Bacteria 6943378
1655 3005594637 3005587118 Bacteria 7794411
1656 3005596721 3005594810 Bacteria 8716512
1657 3005712790 3005710791 Bacteria 7622528
1658 8006929068 8006926726 Bacteria 6749210
1659 8006934533 8006933436 Bacteria 10410654
1660 8006966611 8006964411 Bacteria 8966052
1661 8006974503 8006973647 Bacteria 10679141
1662 8006989457 8006984368 Bacteria 9651211
1663 8006997924 8006994254 Bacteria 8309700
1664 8016516240 8016511872 Bacteria 9921665
1665 8016523636 8016522445 Bacteria 8156687
1666 8016537155 8016530956 Bacteria 8155261
1667 8016541414 8016539877 Bacteria 8155419
1668 8016551838 8016548790 Bacteria 8155074
1669 8016560220 8016557553 Bacteria 8154380
1670 8016566807 8016566248 Bacteria 8158151
1671 8016579540 8016575299 Bacteria 8154085
1672 8016589315 8016583857 Bacteria 10421953
1673 8016598138 8016595262 Bacteria 8149947
1674 8016604278 8016603502 Bacteria 8731218
1675 8016620863 8016613128 Bacteria 8794220
1676 8016629125 8016622563 Bacteria 7999408
1677 8016633662 8016630954 Bacteria 9217207
1678 8017060292 8017057580 Bacteria 10023680
1679 8019542682 8019538911 Bacteria 7872763
1680 8019548057 8019547302 Bacteria 7996444
1681 8019564144 8019555841 Bacteria 9642137
1682 8019574220 8019565922 Bacteria 9639779
1683 8019579819 8019576017 Bacteria 10049540
1684 8019587525 8019586578 Bacteria 10212056
1685 8019603813 8019597564 Bacteria 10041141
1686 8019614725 8019608314 Bacteria 10042931
1687 8019636846 8019629233 Bacteria 8687553
1688 8019642759 8019638758 Bacteria 9062356
1689 8019649832 8019648815 Bacteria 10014479
1690 8019664669 8019659431 Bacteria 8577854
1691 8019674258 8019668869 Bacteria 8791617
1692 8019681862 8019678201 Bacteria 8863603
1693 8019693925 8019687851 Bacteria 8712826
1694 8055748974 8055742211 Bacteria 9226248
1695 8056674952 8056673599 Bacteria 7871253
1696 8056694584 8056689827 Bacteria 6712655
1697 8056972012 8056967851 Bacteria 9038162
1698 8057533070 8057529695 Bacteria 6306553
1699 Ga0495588_0041396
1700 JGI25153J46596_10004919
1701 JGI25153J46596_10009142
1702 JGI25160J50197_1006732
1703 Ga0006562J51391_1066649
1704 JGI25404J52841_10000807
1705 Ga0055526_1000351
1706 Ga0055526_1003504
1707 Ga0055524_1017302
1708 Ga0055531_10001451
1709 Ga0058863_11485186
1710 Ga0058862_11741190
1711 Ga0065165_1000315
1712 Ga0065165_1004190
1713 Ga0065165_1004374
1714 Ga0065712_10019103
1715 Ga0065715_10003432
1716 Ga0065715_10135673
1717 Ga0065707_10104538
1718 Ga0070658_10005778
1719 Ga0070676_10001361
1720 Ga0070676_10021599
1721 Ga0070683_100000148
1722 Ga0070683_100090147
1723 Ga0070690_100036536
1724 Ga0070670_100004822
1725 Ga0070670_100007409
1726 Ga0070670_100030845
1727 Ga0070670_100051642
1728 Ga0070670_100061274
1729 Ga0068869_100002293
1730 Ga0068869_100035258
1731 Ga0068869_100066971
1732 Ga0070666_10070902
1733 Ga0070680_100028715
1734 Ga0070680_100096632
1735 Ga0070680_100182248
1736 Ga0070682_100001062
1737 Ga0070682_100102708
1738 Ga0068868_100012987
1739 Ga0068868_100033219
1740 Ga0068868_100122117
1741 Ga0068868_100213973
1742 Ga0070660_100001081
1743 Ga0070689_100006220
1744 Ga0070689_100056079
1745 Ga0070689_100150742
1746 Ga0070689_100165079
1747 Ga0070691_10004648
1748 Ga0070661_100027289
1749 Ga0070692_10000644
1750 Ga0070668_100016305
1751 Ga0070668_100022501
1752 Ga0070668_100044677
1753 Ga0070668_100103432
1754 Ga0070668_100217851
1755 Ga0070669_100004485
1756 Ga0070669_100023992
1757 Ga0070669_100085626
1758 Ga0070669_100097169
1759 Ga0070669_100160690
1760 Ga0070675_100007550
1761 Ga0070675_100070855
1762 Ga0070671_100003514
1763 Ga0070671_100005834
1764 Ga0070671_100025761
1765 Ga0070671_100037546
1766 Ga0070671_100082387
1767 Ga0070671_100087459
1768 Ga0070671_100163227
1769 Ga0070674_100001918
1770 Ga0070674_100004825
1771 Ga0070674_100023939
1772 Ga0070673_100001229
1773 Ga0070673_100002951
1774 Ga0070673_100023904
1775 Ga0070673_100047182
1776 Ga0070688_100019496
1777 Ga0070688_100042368
1778 Ga0070688_100055492
1779 Ga0070688_100110246
1780 Ga0070688_100115900
1781 Ga0070659_100000332
1782 Ga0070667_100006087
1783 Ga0070667_100056905
1784 Ga0070667_100062748
1785 Ga0070667_100128825
1786 Ga0070667_100131034
1787 Ga0070709_10000486
1788 Ga0070709_10003919
1789 Ga0070714_100022677
1790 Ga0070713_100008432
1791 Ga0070713_100014512
1792 Ga0070713_100015252
1793 Ga0070713_100073361
1794 Ga0070713_100080178
1795 Ga0070713_100165777
1796 Ga0070713_100211227
1797 Ga0070710_10000457
1798 Ga0070701_10038351
1799 Ga0070701_10086625
1800 Ga0070711_100015007
1801 Ga0070711_100088056
1802 Ga0070711_100112754
1803 Ga0070711_100129225
1804 Ga0070705_100000691
1805 Ga0070705_100005701
1806 Ga0070705_100019458
1807 Ga0070700_100043671
1808 Ga0070700_100049633
1809 Ga0070694_100007224
1810 Ga0070694_100008499
1811 Ga0070694_100011936
1812 Ga0070694_100036800
1813 Ga0070694_100058004
1814 Ga0070708_100046751
1815 Ga0070708_100158033
1816 Ga0070708_100329529
1817 Ga0070708_100348670
1818 Ga0070663_100000839
1819 Ga0070663_100006693
1820 Ga0070663_100112409
1821 Ga0070678_100009373
1822 Ga0070678_100009392
1823 Ga0070678_100031777
1824 Ga0070678_100054926
1825 Ga0070678_100059025
1826 Ga0070678_100067797
1827 Ga0070662_100028101
1828 Ga0070681_10011846
1829 Ga0070681_10031497
1830 Ga0068867_100002014
1831 Ga0068867_100004801
1832 Ga0068867_100009902
1833 Ga0068867_100033914
1834 Ga0068867_100193652
1835 Ga0070685_10199331
1836 Ga0070706_100002714
1837 Ga0070706_100016159
1838 Ga0070706_100163515
1839 Ga0070707_100009700
1840 Ga0070707_100011587
1841 Ga0070707_100024750
1842 Ga0070707_100045864
1843 Ga0070707_100096062
1844 Ga0070707_100151927
1845 Ga0070707_100164602
1846 Ga0070707_100190679
1847 Ga0070707_100201829
1848 Ga0070698_100000346
1849 Ga0070698_100003210
1850 Ga0070698_100004552
1851 Ga0070698_100015625
1852 Ga0070698_100034993
1853 Ga0070698_100041573
1854 Ga0070698_100096598
1855 Ga0070698_100193434
1856 Ga0070699_100001230
1857 Ga0070699_100024201
1858 Ga0070699_100048342
1859 Ga0070699_100073864
1860 Ga0070699_100151455
1861 Ga0070699_100153520
1862 Ga0070699_100182081
1863 Ga0070684_100000395
1864 Ga0070684_100007543
1865 Ga0070684_100018693
1866 Ga0070684_100099998
1867 Ga0070697_100006088
1868 Ga0070697_100006432
1869 Ga0070697_100091647
1870 Ga0068853_100001226
1871 Ga0068853_100057574
1872 Ga0068853_100122019
1873 Ga0068853_100287145
1874 Ga0070672_100001304
1875 Ga0070672_100005379
1876 Ga0070672_100033365
1877 Ga0070672_100047629
1878 Ga0070672_100161932
1879 Ga0070686_100079681
1880 Ga0070686_100079844
1881 Ga0070686_100103575
1882 Ga0070686_100232646
1883 Ga0070695_100000230
1884 Ga0070695_100004834
1885 Ga0070695_100004974
1886 Ga0070695_100010605
1887 Ga0070695_100011714
1888 Ga0070695_100015922
1889 Ga0070695_100044029
1890 Ga0070695_100089625
1891 Ga0070695_100200150
1892 Ga0070696_100003816
1893 Ga0070696_100008494
1894 Ga0070696_100011186
1895 Ga0070696_100092200
1896 Ga0070693_100001464
1897 Ga0070665_100007018
1898 Ga0070665_100037546
1899 Ga0070665_100073051
1900 Ga0070665_100158285
1901 Ga0070704_100005792
1902 Ga0070704_100010222
1903 Ga0070704_100034177
1904 Ga0070704_100108659
1905 Ga0070704_100127299
1906 Ga0070704_100165462
1907 Ga0070704_100172975
1908 Ga0068855_100089514
1909 Ga0068855_100209399
1910 Ga0068855_100291623
1911 Ga0070664_100000515
1912 Ga0070664_100007341
1913 Ga0070664_100046285
1914 Ga0070664_100097950
1915 Ga0070664_100157073
1916 Ga0070664_100159031
1917 Ga0068857_100040672
1918 Ga0068854_100081713
1919 Ga0068854_100252579
1920 Ga0068856_100003318
1921 Ga0068856_100123599
1922 Ga0070702_100028461
1923 Ga0068852_100067246
1924 Ga0068852_100241244
1925 Ga0068859_100007794
1926 Ga0068859_100008319
1927 Ga0068859_100010316
1928 Ga0068859_100025039
1929 Ga0068859_100034185
1930 Ga0068859_100049189
1931 Ga0068859_100186637
1932 Ga0068859_100206325
1933 Ga0068864_100009127
1934 Ga0068864_100016671
1935 Ga0068864_100041875
1936 Ga0068864_100124593
1937 Ga0068864_100126263
1938 Ga0068866_10001643
1939 Ga0068866_10031174
1940 Ga0068861_100073259
1941 Ga0068851_10011220
1942 Ga0068851_10022541
1943 Ga0068870_10004098
1944 Ga0068863_100009263
1945 Ga0068863_100066183
1946 Ga0068863_100103210
1947 Ga0068858_100141957
1948 Ga0068860_100000222
1949 Ga0068860_100034889
1950 Ga0068860_100327686
1951 Ga0068862_100010279
1952 Ga0068862_100010761
1953 Ga0068862_100014159
1954 Ga0068862_100021843
1955 Ga0068862_100036902
1956 Ga0081455_10000080
1957 Ga0081455_10000161
1958 Ga0081455_10001725
1959 Ga0081455_10012953
1960 Ga0081455_10015705
1961 Ga0081455_10027867
1962 Ga0081455_10031429
1963 Ga0081455_10083294
1964 Ga0081455_10106197
1965 Ga0081455_10171138
1966 Ga0081540_1000642
1967 Ga0081540_1000914
1968 Ga0081540_1004331
1969 Ga0081540_1008099
1970 Ga0081540_1008761
1971 Ga0081540_1011538
1972 Ga0081540_1012457
1973 Ga0081540_1017354
1974 Ga0081540_1049780
1975 Ga0081539_10000845
1976 Ga0081539_10004736
1977 Ga0081539_10006536
1978 Ga0081539_10028313
1979 Ga0081539_10033166
1980 Ga0081539_10062665
1981 Ga0070717_10000445
1982 Ga0070717_10007173
1983 Ga0070717_10124122
1984 Ga0070717_10279343
1985 Ga0075365_10049929
1986 Ga0075365_10100813
1987 Ga0075368_10044171
1988 Ga0075368_10065329
1989 Ga0075364_10000678
1990 Ga0075364_10000816
1991 Ga0075432_10032841
1992 Ga0070715_10021431
1993 Ga0070716_100002383
1994 Ga0070712_100015842
1995 Ga0070712_100017478
1996 Ga0070712_100042703
1997 Ga0070712_100114820
1998 Ga0075362_10026745
1999 Ga0075367_10005020
2000 Ga0075367_10044477
2001 Ga0075367_10071421
2002 Ga0075367_10075019
2003 Ga0075367_10082264
2004 Ga0075366_10000856
2005 Ga0075366_10000905
2006 Ga0075366_10005409
2007 Ga0075366_10008580
2008 Ga0075366_10060700
2009 Ga0075366_10074682
2010 Ga0097621_100007944
2011 Ga0097621_100104846
2012 Ga0075370_10001184
2013 Ga0075370_10007505
2014 Ga0075370_10011359
2015 Ga0068871_100033975
2016 Ga0068871_100092819
2017 Ga0068871_100117974
2018 Ga0075428_100003718
2019 Ga0075428_100008208
2020 Ga0075428_100012867
2021 Ga0075428_100068546
2022 Ga0075428_100074382
2023 Ga0075428_100092259
2024 Ga0075428_100106864
2025 Ga0075428_100118702
2026 Ga0075428_100293646
2027 Ga0075430_100000088
2028 Ga0075430_100009119
2029 Ga0075430_100010610
2030 Ga0075430_100028288
2031 Ga0075431_100000986
2032 Ga0075431_100009718
2033 Ga0075431_100012421
2034 Ga0075431_100028276
2035 Ga0075431_100028624
2036 Ga0075431_100040844
2037 Ga0075431_100046479
2038 Ga0075431_100046924
2039 Ga0075431_100050940
2040 Ga0075431_100097648
2041 Ga0075431_100109569
2042 Ga0075431_100120979
2043 Ga0075431_100198033
2044 Ga0075431_100204237
2045 Ga0075431_100422764
2046 Ga0075433_10002688
2047 Ga0075433_10002891
2048 Ga0075433_10002980
2049 Ga0075433_10010671
2050 Ga0075433_10010872
2051 Ga0075433_10015682
2052 Ga0075433_10016744
2053 Ga0075433_10022800
2054 Ga0075433_10045536
2055 Ga0075433_10068601
2056 Ga0075433_10127143
2057 Ga0075433_10171175
2058 Ga0075433_10302073
2059 Ga0075434_100002381
2060 Ga0075434_100003494
2061 Ga0075434_100006184
2062 Ga0075434_100008186
2063 Ga0075434_100013374
2064 Ga0075434_100021784
2065 Ga0075434_100037146
2066 Ga0075434_100052972
2067 Ga0075434_100069170
2068 Ga0075434_100094589
2069 Ga0075434_100107253
2070 Ga0075434_100157590
2071 Ga0075434_100163226
2072 Ga0075434_100183446
2073 Ga0075434_100194172
2074 Ga0075434_100369385
2075 Ga0075429_100000555
2076 Ga0075429_100005512
2077 Ga0075429_100010439
2078 Ga0075429_100013820
2079 Ga0075429_100016895
2080 Ga0075429_100026783
2081 Ga0075429_100098834
2082 Ga0075429_100142868
2083 Ga0075429_100200814
2084 Ga0075429_100268188
2085 Ga0068865_100002565
2086 Ga0068865_100004347
2087 Ga0075436_100001553
2088 Ga0075436_100059954
2089 Ga0097620_100007793
2090 Ga0097620_100008319
2091 Ga0097620_100010316
2092 Ga0097620_100025040
2093 Ga0097620_100034186
2094 Ga0097620_100049186
2095 Ga0097620_100186638
2096 Ga0097620_100206326
2097 Ga0099824_1014445
2098 Ga0075435_100005520
2099 Ga0075435_100008483
2100 Ga0075435_100013632
2101 Ga0075435_100037343
2102 Ga0075435_100043987
2103 Ga0075435_100068695
2104 Ga0075435_100094823
2105 Ga0075435_100133225
2106 Ga0075435_100233309
2107 Ga0075435_100242314
2108 Ga0099794_10040397
2109 Ga0099794_10041554
2110 Ga0099795_10031993
2111 Ga0105240_10000427
2112 Ga0105240_10233130
2113 Ga0111539_10000205
2114 Ga0111539_10002082
2115 Ga0111539_10003143
2116 Ga0111539_10004506
2117 Ga0111539_10004845
2118 Ga0111539_10005412
2119 Ga0111539_10015192
2120 Ga0111539_10053485
2121 Ga0111539_10070021
2122 Ga0111539_10077793
2123 Ga0111539_10216065
2124 Ga0111539_10264260
2125 Ga0105245_10148881
2126 Ga0105247_10034407
2127 Ga0114129_10000722
2128 Ga0114129_10001217
2129 Ga0114129_10004791
2130 Ga0114129_10006303
2131 Ga0114129_10010000
2132 Ga0114129_10011045
2133 Ga0114129_10011216
2134 Ga0114129_10011456
2135 Ga0114129_10012186
2136 Ga0114129_10026763
2137 Ga0114129_10031611
2138 Ga0114129_10041559
2139 Ga0114129_10049194
2140 Ga0114129_10059337
2141 Ga0114129_10089245
2142 Ga0114129_10092082
2143 Ga0114129_10112040
2144 Ga0114129_10112106
2145 Ga0114129_10127269
2146 Ga0114129_10158620
2147 Ga0114129_10162870
2148 Ga0114129_10165922
2149 Ga0114129_10170137
2150 Ga0114129_10192551
2151 Ga0105243_10043894
2152 Ga0105243_10078705
2153 Ga0105241_10016909
2154 Ga0105241_10254853
2155 Ga0105242_10073243
2156 Ga0105248_10005501
2157 Ga0105248_10117609
2158 Ga0105248_10133873
2159 Ga0105248_10337789
2160 Ga0105248_10378267
2161 Ga0105237_10013789
2162 Ga0105237_10014620
2163 Ga0105237_10093214
2164 Ga0105237_10100105
2165 Ga0105238_10145339
2166 Ga0105238_10384429
2167 Ga0105249_10001777
2168 Ga0105249_10135988
2169 Ga0105239_10022197
2170 Ga0105239_10034375
2171 Ga0105239_10053529
2172 Ga0105239_10058807
2173 Ga0105239_10111312
2174 Ga0105246_10040304
2175 Ga0105246_10048875
2176 Ga0157373_10000574
2177 Ga0157373_10001127
2178 Ga0157371_10177010
2179 Ga0157369_10027066
2180 Ga0157369_10047099
2181 Ga0171462_1045
2182 Ga0157374_10146707
2183 Ga0157374_10278732
2184 Ga0157378_10037713
2185 Ga0157378_10042649
2186 Ga0157378_10166762
2187 Ga0157378_10210118
2188 Ga0163162_10139268
2189 Ga0163162_10485948
2190 Ga0157372_10001263
2191 Ga0157372_10191594
2192 Ga0157372_10234545
2193 Ga0157372_10457301
2194 Ga0157375_10004827
2195 Ga0157375_10038656
2196 Ga0157375_10119824
2197 Ga0163163_10031956
2198 Ga0163163_10046564
2199 Ga0163163_10059185
2200 Ga0163163_10134022
2201 Ga0163163_10260276
2202 Ga0157380_10077400
2203 Ga0157380_10168787
2204 Ga0157380_10324186
2205 Ga0182008_10058113
2206 Ga0157379_10007148
2207 Ga0157379_10059481
2208 Ga0157379_10108235
2209 Ga0157379_10116515
2210 Ga0157376_10029890
2211 Ga0157376_10050411
2212 Ga0157376_10097527
2213 Ga0157376_10137156
2214 Ga0157376_10162524
2215 Ga0182006_1003147
2216 Ga0182006_1052718
2217 Ga0163161_10007275
2218 Ga0163161_10074373
2219 Ga0206354_11288361
2220 Ga0214544_1009253
2221 Ga0214542_1000025
2222 Ga0214545_1000014
2223 Ga0214543_1000034
2224 Ga0213874_10021454
2225 Ga0213876_10000506
2226 Ga0209148_1000773
2227 Ga0209233_1016211
2228 Ga0209455_1002825
2229 Ga0209130_1000045
2230 Ga0209675_1002625
2231 Ga0209025_1000932
2232 Ga0209564_1000075
2233 Ga0209564_1015176
2234 Ga0209758_1000008
2235 Ga0209758_1000097
2236 Ga0209758_1000141
2237 Ga0209758_1000282
2238 Ga0209758_1002234
2239 Ga0209758_1008672
2240 Ga0209758_1011027
2241 Ga0209758_1011485
2242 Ga0209758_1032875
2243 Ga0209256_1002013
2244 Ga0209256_1002896
2245 Ga0207426_1000437
2246 Ga0207426_1001098
2247 Ga0207426_1007699
2248 Ga0207426_1011889
2249 Ga0209257_1005807
2250 Ga0207656_10042682
2251 Ga0207653_10011710
2252 Ga0207682_10001931
2253 Ga0207682_10075047
2254 Ga0207682_10089740
2255 Ga0207692_10002216
2256 Ga0207692_10094978
2257 Ga0207692_10150500
2258 Ga0207642_10008904
2259 Ga0207710_10006353
2260 Ga0207710_10035654
2261 Ga0207688_10050613
2262 Ga0207688_10071745
2263 Ga0207680_10176934
2264 Ga0207647_10016240
2265 Ga0207699_10003729
2266 Ga0207699_10004469
2267 Ga0207645_10001315
2268 Ga0207645_10029667
2269 Ga0207643_10000406
2270 Ga0207643_10131529
2271 Ga0207643_10147531
2272 Ga0207684_10003897
2273 Ga0207684_10013583
2274 Ga0207684_10013914
2275 Ga0207684_10014077
2276 Ga0207684_10018456
2277 Ga0207684_10206094
2278 Ga0207654_10002995
2279 Ga0207654_10015208
2280 Ga0207654_10062338
2281 Ga0207707_10000019
2282 Ga0207707_10035607
2283 Ga0207707_10153908
2284 Ga0207695_10000062
2285 Ga0207671_10000377
2286 Ga0207671_10183332
2287 Ga0207671_10190855
2288 Ga0207693_10015868
2289 Ga0207693_10021206
2290 Ga0207693_10054379
2291 Ga0207693_10107453
2292 Ga0207693_10144864
2293 Ga0207663_10013985
2294 Ga0207663_10061402
2295 Ga0207663_10074820
2296 Ga0207663_10100153
2297 Ga0207660_10015260
2298 Ga0207660_10019690
2299 Ga0207660_10129316
2300 Ga0207660_10216768
2301 Ga0207657_10000158
2302 Ga0207657_10059953
2303 Ga0207646_10002726
2304 Ga0207646_10008458
2305 Ga0207646_10010701
2306 Ga0207646_10080974
2307 Ga0207646_10082733
2308 Ga0207646_10084375
2309 Ga0207646_10212343
2310 Ga0207681_10003707
2311 Ga0207681_10015896
2312 Ga0207681_10107478
2313 Ga0207681_10212400
2314 Ga0207650_10001113
2315 Ga0207650_10002324
2316 Ga0207650_10029534
2317 Ga0207650_10031535
2318 Ga0207650_10069187
2319 Ga0207659_10000549
2320 Ga0207659_10005606
2321 Ga0207659_10030802
2322 Ga0207659_10191549
2323 Ga0207659_10210920
2324 Ga0207687_10014320
2325 Ga0207700_10014243
2326 Ga0207700_10042768
2327 Ga0207700_10065940
2328 Ga0207700_10250871
2329 Ga0207664_10044247
2330 Ga0207664_10096840
2331 Ga0207664_10191753
2332 Ga0207644_10010696
2333 Ga0207644_10013517
2334 Ga0207644_10112314
2335 Ga0207644_10164529
2336 Ga0207690_10003241
2337 Ga0207690_10200963
2338 Ga0207706_10065945
2339 Ga0207706_10085144
2340 Ga0207706_10148443
2341 Ga0207686_10031590
2342 Ga0207709_10013330
2343 Ga0207709_10016421
2344 Ga0207709_10026693
2345 Ga0207709_10099724
2346 Ga0207670_10090939
2347 Ga0207669_10002598
2348 Ga0207669_10016318
2349 Ga0207669_10050029
2350 Ga0207704_10024707
2351 Ga0207704_10101860
2352 Ga0207704_10164905
2353 Ga0207665_10001763
2354 Ga0207691_10000754
2355 Ga0207691_10002193
2356 Ga0207691_10002935
2357 Ga0207691_10004947
2358 Ga0207691_10011314
2359 Ga0207691_10013516
2360 Ga0207691_10087034
2361 Ga0207711_10020135
2362 Ga0207711_10085982
2363 Ga0207711_10096173
2364 Ga0207711_10262211
2365 Ga0207711_10302697
2366 Ga0207689_10001549
2367 Ga0207689_10008662
2368 Ga0207689_10016340
2369 Ga0207689_10025703
2370 Ga0207689_10036764
2371 Ga0207689_10126547
2372 Ga0207661_10002131
2373 Ga0207661_10024499
2374 Ga0207661_10038507
2375 Ga0207661_10066742
2376 Ga0207679_10002969
2377 Ga0207679_10006070
2378 Ga0207679_10024614
2379 Ga0207679_10059593
2380 Ga0207679_10068402
2381 Ga0207679_10080426
2382 Ga0207667_10017801
2383 Ga0207651_10000137
2384 Ga0207651_10004004
2385 Ga0207651_10004657
2386 Ga0207651_10023383
2387 Ga0207668_10188325
2388 Ga0207640_10117890
2389 Ga0207658_10099850
2390 Ga0207658_10165305
2391 Ga0207677_10043429
2392 Ga0207677_10143685
2393 Ga0207703_10007069
2394 Ga0207703_10012711
2395 Ga0207703_10069954
2396 Ga0207703_10113714
2397 Ga0207703_10214969
2398 Ga0207639_10032270
2399 Ga0207639_10045461
2400 Ga0207639_10072221
2401 Ga0207639_10188550
2402 Ga0207678_10001746
2403 Ga0207678_10002804
2404 Ga0207678_10021209
2405 Ga0207678_10037986
2406 Ga0207678_10056027
2407 Ga0207678_10074754
2408 Ga0207708_10006345
2409 Ga0207708_10043006
2410 Ga0207708_10066326
2411 Ga0207708_10167787
2412 Ga0207702_10004617
2413 Ga0207702_10050904
2414 Ga0207702_10139495
2415 Ga0207641_10037894
2416 Ga0207641_10092305
2417 Ga0207641_10346482
2418 Ga0207648_10001985
2419 Ga0207648_10008746
2420 Ga0207648_10010726
2421 Ga0207648_10020630
2422 Ga0207648_10030334
2423 Ga0207648_10042949
2424 Ga0207648_10047260
2425 Ga0207648_10066575
2426 Ga0207648_10127698
2427 Ga0207648_10232700
2428 Ga0207676_10006758
2429 Ga0207676_10063032
2430 Ga0207676_10092985
2431 Ga0207676_10104213
2432 Ga0207674_10002036
2433 Ga0207674_10004850
2434 Ga0207675_100006420
2435 Ga0207675_100022055
2436 Ga0207683_10001853
2437 Ga0207683_10004778
2438 Ga0207683_10005724
2439 Ga0207683_10007680
2440 Ga0207683_10108631
2441 Ga0207698_10019740
2442 Ga0207698_10060913
2443 Ga0207698_10084300
2444 Ga0207698_10128163
2445 Ga0209389_1000004
2446 Ga0209589_1000002
2447 Ga0209489_100002
2448 Ga0209489_100777
2449 Ga0209700_100002
2450 Ga0209700_100013
2451 Ga0209968_1001306
2452 Ga0209999_1001517
2453 Ga0209983_1000879
2454 Ga0209588_1052615
2455 Ga0209971_1000005
2456 Ga0209966_1000010
2457 Ga0209966_1022387
2458 Ga0209998_10000729
2459 Ga0209974_10019491
2460 Ga0207428_10000503
2461 Ga0207428_10000526
2462 Ga0207428_10008432
2463 Ga0207428_10009239
2464 Ga0207428_10020041
2465 Ga0207428_10028626
2466 Ga0207428_10054947
2467 Ga0268266_10004621
2468 Ga0268266_10009307
2469 Ga0268266_10009873
2470 Ga0268266_10027379
2471 Ga0268266_10035847
2472 Ga0268266_10073968
2473 Ga0268266_10142020
2474 Ga0268266_10276123
2475 Ga0268265_10006468
2476 Ga0268265_10015922
2477 Ga0268265_10030405
2478 Ga0268265_10031131
2479 Ga0268265_10032954
2480 Ga0268265_10056453
2481 Ga0268265_10142675
2482 Ga0268265_10284337
2483 Ga0268264_10000042
2484 Ga0268264_10028575
2485 Ga0268264_10083907
2486 Ga0268264_10144047
2487 Ga0268264_10146314
2488 Ga0265319_1005086
2489 Ga0265334_10053462
2490 Ga0265318_10019017
2491 Ga0307517_10061999
2492 Ga0307515_10000034
2493 Ga0307515_10000043
2494 Ga0307515_10000658
2495 Ga0307515_10003847
2496 Ga0307515_10007630
2497 Ga0307515_10007679
2498 Ga0307515_10050509
2499 Ga0307515_10148183
2500 Ga0265338_10055019
2501 Ga0307511_10101318
2502 Ga0307512_10027620
2503 Ga0316176_1196748
2504 Ga0314311_1081389
2505 Ga0316181_1168214
2506 Ga0316182_1029803
2507 Ga0316182_1254532
2508 Ga0265330_10059230
2509 Ga0265332_10049273
2510 Ga0265325_10003069
2511 Ga0265325_10028296
2512 Ga0265325_10028299
2513 Ga0265329_10016424
2514 Ga0265339_10056436
2515 Ga0265331_10025045
2516 Ga0265316_10049711
2517 Ga0307513_10009436
2518 Ga0307513_10191686
2519 Ga0307509_10024775
2520 Ga0307408_100017573
2521 Ga0307408_100076577
2522 Ga0265313_10001744
2523 Ga0265313_10019983
2524 Ga0307508_10000029
2525 Ga0307508_10000254
2526 Ga0307508_10027341
2527 Ga0307508_10036036
2528 Ga0307514_10046015
2529 Ga0265314_10019737
2530 Ga0265342_10008945
2531 Ga0265342_10065595
2532 Ga0307516_10001248
2533 Ga0307516_10011266
2534 Ga0307516_10026325
2535 Ga0307516_10032423
2536 Ga0307516_10056391
2537 Ga0307516_10061322
2538 Ga0307516_10093389
2539 Ga0307405_10024902
2540 Ga0307410_10135643
2541 Ga0307410_10200494
2542 Ga0307406_10000237
2543 Ga0307406_10178370
2544 Ga0307416_100004867
2545 Ga0307416_100056947
2546 Ga0307416_100086696
2547 Ga0307414_10035490
2548 Ga0307415_100083837
2549 Ga0307507_10024242
2550 Ga0307507_10052067
2551 Ga0307510_10016828
2552 Ga0307510_10057391
2553 Ga0307510_10076408
2554 Ga0315911_1000004
2555 Ga0316215_1000806
2556 Ga0373958_0016674
2557 Ga0373928_0002368
2558 Ga0373940_0007439
2559 Ga0373940_0015176
2560 Ga0373944_0022195
2561 Ga0373951_0023048
2562 Ga0373951_0027357
2563 Ga0373932_0003971
2564 Ga0373936_0039328
2565 Ga0373939_0016010
2566 Ga0373941_0013234
2567 Ga0373945_0044148
2568 Ga0373954_0027979
2569 Ga0373960_0008472
2570 Ga0373943_0004760
2571 Ga0373943_0029106
2572 Ga0373943_0107525
2573 Ga0373946_0012322
2574 Ga0373946_0017680
2575 Ga0373955_0008914
2576 Ga0373955_0049971
2577 Ga0373961_0002541
2578 Ga0373961_0016865
2579 Ga0373924_0021101
2580 Ga0373924_0074369
2581 Ga0373924_0080923
2582 Ga0373931_0001091
2583 Ga0373931_0092916
2584 Ga0373935_0004029
2585 Ga0373935_0028466
2586 Ga0373935_0062673
2587 Ga0373935_0160183
2588 Ga0373927_0001617
2589 Ga0373927_0009798
2590 Ga0373927_0013714
2591 Ga0373927_0017298
2592 Ga0373927_0075038
2593 Ga0373927_0113251
2594 Ga0373927_0183081
2595 Ga0373933_0042619
2596 Ga0373947_0004404
2597 Ga0373947_0041394
2598 Ga0373947_0093017
2599 Ga0373947_0111534
2600 Ga0373947_0129524
2601 Ga0373937_0081009
2602 Ga0373937_0154375
2603 Ga0373937_0197618
2604 Ga0373937_0270565
2605 Ga0373925_0002598
2606 Ga0373925_0008312
2607 Ga0373925_0011431
2608 Ga0373925_0016597
2609 Ga0373925_0022159
2610 Ga0373925_0082144
2611 Ga0395900_0001273
2612 Ga0395900_0029419
2613 Ga0395900_0078677
2614 Ga0395898_0011222
2615 Ga0395898_0122261
2616 Ga0395905_0010802
2617 Ga0395905_0011753
2618 Ga0395901_0000813
2619 Ga0395901_0002416
2620 Ga0395901_0017486
2621 Ga0436365_0399885
2622 Ga0436365_0685473
2623 Ga0436365_0966736
2624 Ga0436365_1091064
2625 Ga0436360_0603982
2626 Ga0436361_0014467
2627 Ga0436363_1558913
2628 Ga0436362_0827926
2629 Ga0439447_015027
2630 Ga0439453_0013066
2631 Ga0439465_0024030
2632 Ga0451807_1880289
2633 Ga0451853_4010219
2634 Ga0439433_0007202
2635 Ga0439448_0017984
2636 Ga0439449_0005236
2637 Ga0439457_018810
2638 Ga0439458_0024943
2639 Ga0439434_0003597
2640 Ga0439435_0001533
2641 Ga0439435_0022258
2642 Ga0439459_0008511
2643 Ga0439464_0002353
2644 Ga0439460_0000381
2645 Ga0451577_0001628
2646 Ga0451577_0023399
2647 Ga0451577_0034628
2648 Ga0466972_0000079
2649 Ga0466972_0004328
2650 Ga0466972_0062953
2651 Ga0453683_0006780
2652 Ga0453683_0015117
2653 Ga0453683_0091854
2654 Ga0466966_0001208
2655 Ga0466961_0000020
2656 Ga0466963_0028383
2657 Ga0466963_0047564
2658 Ga0466964_0023432
2659 Ga0453684_0117634
2660 Ga0453684_0124488
2661 Ga0466968_0001947
2662 Ga0466957_0040886
2663 Ga0466957_0118930
2664 Ga0466960_0000424
2665 Ga0451576_0042039
2666 Ga0451576_0049108
2667 Ga0451576_0053448
2668 Ga0451576_0106958
2669 Ga0451576_0120908
2670 Ga0451576_0134449
2671 Ga0451576_0198840
2672 Ga0451576_0335142
2673 Ga0466967_0053468
2674 Ga0466967_0054863
2675 Ga0466967_0118266
2676 Ga0495603_0000660
2677 Ga0495603_0033928
2678 Ga0495603_0044317
2679 Ga0495603_0063873
2680 Ga0495629_0000467
2681 Ga0495629_0006153
2682 Ga0495629_0008755
2683 Ga0495638_0007605
2684 Ga0495650_0025999
2685 Ga0495580_0001503
2686 Ga0495580_0001799
2687 Ga0495580_0003523
2688 Ga0495580_0003995
2689 Ga0495580_0148736
2690 Ga0495582_0000163
2691 Ga0495582_0087857
2692 Ga0495639_0000640
2693 Ga0495662_0000890
2694 Ga0495664_0006716
2695 Ga0495664_0008332
2696 Ga0495664_0018995
2697 Ga0495594_0001989
2698 Ga0495594_0019812
2699 Ga0495594_0052058
2700 Ga0495606_0005210
2701 Ga0495608_0023223
2702 Ga0495610_0049618
2703 Ga0495610_0049894
2704 Ga0495616_0044813
2705 Ga0495616_0102732
2706 Ga0495618_0099480
2707 Ga0495630_0002387
2708 Ga0495630_0188276
2709 Ga0495632_0061048
2710 Ga0495666_0023818
2711 Ga0495642_0026594
2712 Ga0495652_0014517
2713 Ga0495652_0017934
2714 Ga0495652_0048165
2715 Ga0495652_0146261
2716 Ga0495665_0000853
2717 Ga0495665_0032167
2718 Ga0495665_0047667
2719 Ga0495640_0046380
2720 Ga0495640_0054761
2721 Ga0495586_0023014
2722 Ga0495586_0160395
2723 Ga0495609_0020183
2724 Ga0495621_0003684
2725 Ga0495621_0025661
2726 Ga0495597_0049260
2727 Ga0495645_0084621
2728 Ga0495645_0176430
2729 Ga0495667_0015729
2730 Ga0495668_0013473
2731 Ga0495668_0038325
2732 Ga0495668_0070317
2733 Ga0495634_0001271
2734 Ga0495634_0032253
2735 Ga0495634_0056534
2736 Ga0495634_0068190
2737 Ga0495625_0001907
2738 Ga0495625_0088915
2739 Ga0495635_0001312
2740 Ga0495635_0002205
2741 Ga0495635_0044562
2742 Ga0495659_0050651
2743 Ga0495588_0033944
2744 Ga0495588_0135776
2745 Ga0495657_0005817
2746 Ga0495599_0060189
2747 Ga0495623_0010915
2748 Ga0495646_0009169
2749 Ga0495647_0000813
2750 Ga0495647_0041185
2751 Ga0495658_0000512
2752 Ga0495658_0020852
2753 Ga0495669_0009883
2754 Ga0495669_0022731
2755 Ga0495613_0002976
2756 Ga0495613_0021834
2757 Ga0495624_0118546
2758 Ga0495649_0015433
2759 Ga0495600_0011910
2760 Ga0495581_0002361
2761 Ga0495581_0104951
2762 Ga0495604_0002858
2763 Ga0495604_0007702
2764 Ga0495636_0027112
2765 Ga0495674_0013125
2766 Ga0495674_0013620
2767 Ga0495674_0032266
2768 Ga0495674_0041754
2769 Ga0495674_0098223
2770 Ga0495674_0103022
2771 Ga0495674_0141783
2772 Ga0495672_0023022
2773 Ga0495676_0015607
2774 Ga0495676_0077796
2775 Ga0495680_0040441
2776 Ga0495683_0043664
2777 Ga0495684_0004305
2778 Ga0495684_0074199
2779 Ga0495686_0051333
2780 Ga0495593_0000331
2781 Ga0495593_0005960
2782 Ga0495593_0070872
2783 Ga0495602_0021275
2784 Ga0495602_0021985
2785 Ga0495602_0156477
2786 Ga0495626_0024063
2787 Ga0496100_0055959
2788 Ga0496101_0144295
2789 Ga0496102_0086923
2790 Ga0496103_0088336
2791 Ga0496103_0109750
2792 Ga0496104_0001245
2793 Ga0496104_0011338
2794 Ga0496106_0002916
2795 Ga0496106_0015718
2796 Ga0496106_0142894
2797 Ga0496106_0261259
2798 Ga0496107_0026368
2799 Ga0496107_0211072
2800 Ga0496108_0011169
2801 Ga0496109_0002719
2802 Ga0496109_0124506
2803 Ga0496109_0124959
2804 Ga0496109_0152092
2805 Ga0496109_0398011
2806 Ga0496111_0026614
2807 Ga0496112_0010367
2808 Ga0496112_0116852
2809 Ga0496113_0046136
2810 Ga0496113_0051116
2811 Ga0496114_0025961
2812 Ga0496114_0100711
2813 Ga0496114_0312275
2814 Ga0496116_0008689
2815 Ga0496118_0008129
2816 Ga0496118_0050306
2817 Ga0496119_0003004
2818 Ga0496119_0086514
2819 Ga0496119_0107521
2820 Ga0496120_0006997
2821 Ga0496120_0032809
2822 Ga0496121_0002114
2823 Ga0496121_0017623
2824 Ga0496121_0023103
2825 Ga0496121_0064825
2826 Ga0496121_0114622
2827 Ga0496121_0155212
2828 Ga0496124_0001351
2829 Ga0496124_0224205
2830 Ga0496124_0230414
2831 Ga0496125_0022471
2832 Ga0496125_0032671
2833 Ga0496126_0006139
2834 Ga0496126_0026642
2835 Ga0496126_0034021
2836 Ga0496126_0056000
2837 Ga0496126_0067884
2838 Ga0496126_0068667
2839 Ga0496126_0088661
2840 Ga0496126_0105057
2841 Ga0496126_0195700
2842 Ga0501031_0021719
2843 Ga0501031_0047802
2844 Ga0501033_0001553
2845 Ga0501033_0006440
2846 Ga0501033_0011030
2847 Ga0501033_0171726
2848 Ga0501033_0208141
2849 Ga0501034_0022821
2850 Ga0501034_0092220
2851 Ga0501034_0206136
2852 Ga0501034_0297099
2853 Ga0501036_0001752
2854 Ga0501036_0006667
2855 Ga0501036_0067669
2856 Ga0501036_0206690
2857 Ga0501037_0002039
2858 Ga0501037_0017188
2859 Ga0501037_0107075
2860 Ga0501037_0240970
2861 Ga0501038_0003805
2862 Ga0501038_0057046
2863 Ga0501038_0191476
2864 Ga0501039_0000865
2865 Ga0501039_0059881
2866 Ga0501039_0077555
2867 Ga0501039_0120892
2868 Ga0501039_0193644
2869 Ga0501039_0234433
2870 Ga0501039_0240206
2871 Ga0501039_0254394
2872 Ga0501040_0194235
2873 Ga0501040_0195096
2874 Ga0501041_0024906
2875 Ga0501041_0051707
2876 Ga0501041_0085190
2877 Ga0501041_0167998
2878 Ga0501042_0002120
2879 Ga0501042_0040745
2880 Ga0501042_0071724
2881 Ga0501042_0265502
2882 Ga0501043_0001418
2883 Ga0501043_0002177
2884 Ga0501043_0010294
2885 Ga0501043_0024560
2886 Ga0501043_0039758
2887 Ga0501043_0150349
2888 Ga0501043_0155034
2889 Ga0501046_0001680
2890 Ga0501046_0050607
2891 Ga0501046_0080192
2892 Ga0501046_0156835
2893 Ga0501046_0179803
2894 Ga0501047_0004987
2895 Ga0501047_0045841
2896 Ga0501047_0084339
2897 Ga0501047_0116350
2898 Ga0501047_0140943
2899 Ga0501047_0176240
2900 Ga0501048_0007273
2901 Ga0501048_0010235
2902 Ga0501048_0010642
2903 Ga0501048_0011366
2904 Ga0501048_0053281
2905 Ga0501048_0089603
2906 Ga0501048_0118500
2907 Ga0501067_0002446
2908 Ga0501067_0030866
2909 Ga0501067_0045880
2910 Ga0501068_0010598
2911 Ga0501068_0021887
2912 Ga0501068_0080345
2913 Ga0501069_0002887
2914 Ga0501069_0024820
2915 Ga0501069_0053728
2916 Ga0501070_0006386
2917 Ga0501070_0021654
2918 Ga0501070_0276554
2919 Ga0501071_0001305
2920 Ga0501071_0024877
2921 Ga0501071_0052423
2922 Ga0501072_0016027
2923 Ga0501072_0077306
2924 Ga0501072_0150528
2925 Ga0501072_0163640
2926 Ga0501073_0013232
2927 Ga0501073_0084163
2928 Ga0501073_0199375
2929 Ga0501074_0001868
2930 Ga0501074_0026753
2931 Ga0501074_0032936
2932 Ga0501074_0045794
2933 Ga0501074_0065122
2934 Ga0501075_0017473
2935 Ga0501075_0031114
2936 Ga0501075_0034069
2937 Ga0501075_0132342
2938 Ga0501076_0014051
2939 Ga0501076_0017780
2940 Ga0501076_0029417
2941 Ga0501076_0043259
2942 Ga0501076_0115580
2943 Ga0501076_0132694
2944 Ga0501076_0148802
2945 Ga0501077_0015591
2946 Ga0501077_0026027
2947 Ga0501077_0031586
2948 Ga0501077_0033064
2949 Ga0501077_0097997
2950 Ga0501077_0145134
2951 Ga0501249_004137
2952 Ga0501225_0010347
2953 Ga0501079_0001542
2954 Ga0501079_0003813
2955 Ga0501079_0011309
2956 Ga0501079_0020988
2957 Ga0501079_0085214
2958 Ga0501079_0145497
2959 Ga0501080_0007581
2960 Ga0501080_0017651
2961 Ga0501080_0084578
2962 Ga0501080_0114015
2963 Ga0501080_0253186
2964 Ga0501081_0005169
2965 Ga0501081_0009148
2966 Ga0501081_0022757
2967 Ga0501081_0029605
2968 Ga0501081_0035335
2969 Ga0501081_0054447
2970 Ga0501083_0007474
2971 Ga0501083_0012144
2972 Ga0501083_0020189
2973 Ga0501083_0038161
2974 Ga0501083_0160417
2975 Ga0501262_000299
2976 Ga0501035_0011638
2977 Ga0501035_0018905
2978 Ga0501035_0097326
2979 Ga0501044_0036860
2980 Ga0501044_0134533
2981 Ga0501045_0005175
2982 Ga0501045_0019952
2983 Ga0501045_0022962
2984 nmdc:mga03683_580_c1
2985 nmdc:mga03n38_2842_c1
2986 nmdc:mga00v17_15536_c1
2987 nmdc:mga0yw44_52105_c1
2988 nmdc:mga0yw44_8904_c1
2989 nmdc:mga0k408_1112_c1
2990 nmdc:mga0k408_19707_c1
2991 nmdc:mga0k408_346_c1
2992 nmdc:mga0k408_7919_c1
2993 nmdc:mga0k408_9424_c2
2994 nmdc:mga0k408_9464_c1
2995 nmdc:mga06z11_15319_c1
2996 nmdc:mga06z11_41330_c1
2997 nmdc:mga07m45_14954_c1
2998 nmdc:mga07m45_4134_c1
2999 nmdc:mga07m45_55321_c1
3000 nmdc:mga07m45_9845_c1
3001 nmdc:mga05p37_101475_c1
3002 nmdc:mga05p37_104823_c1
3003 nmdc:mga05p37_11277_c1
3004 nmdc:mga05p37_13987_c1
3005 nmdc:mga05p37_14391_c1
3006 nmdc:mga05p37_152277_c1
3007 nmdc:mga05p37_180636_c1
3008 nmdc:mga05p37_24403_c1
3009 nmdc:mga05p37_24615_c1
3010 nmdc:mga05p37_2488_c1
3011 nmdc:mga05p37_3181_c1
3012 nmdc:mga05p37_3321_c1
3013 nmdc:mga05p37_340435_c1
3014 nmdc:mga05p37_47749_c1
3015 nmdc:mga05p37_54345_c1
3016 nmdc:mga05p37_55103_c2
3017 nmdc:mga05p37_579593_c1
3018 nmdc:mga05p37_61882_c1
3019 nmdc:mga05p37_64428_c1
3020 nmdc:mga05p37_69165_c1
3021 nmdc:mga05p37_7536_c1
3022 nmdc:mga05p37_75434_c1
3023 nmdc:mga05p37_90235_c1
3024 nmdc:mga09592_132745_c1
3025 nmdc:mga09592_133468_c1
3026 nmdc:mga09592_30120_c1
3027 nmdc:mga09592_37965_c1
3028 nmdc:mga09592_4918_c1
3029 nmdc:mga09592_55671_c1
3030 nmdc:mga09592_83192_c1
3031 nmdc:mga09592_8656_c1
3032 nmdc:mga0qj67_207947_c1
3033 nmdc:mga0qj67_21731_c1
3034 nmdc:mga0qj67_31254_c1
3035 nmdc:mga0qj67_39740_c1
3036 nmdc:mga0qj67_5521_c1
3037 nmdc:mga0qj67_58392_c1
3038 nmdc:mga0qj67_64776_c1
3039 nmdc:mga0qj67_85883_c1
3040 nmdc:mga06r32_108008_c1
3041 nmdc:mga06r32_142293_c1
3042 nmdc:mga06r32_142_c1
3043 nmdc:mga06r32_15351_c1
3044 nmdc:mga06r32_155752_c1
3045 nmdc:mga06r32_211788_c1
3046 nmdc:mga06r32_302851_c1
3047 nmdc:mga06r32_32305_c1
3048 nmdc:mga06r32_383449_c1
3049 nmdc:mga06r32_52270_c1
3050 nmdc:mga06r32_58496_c1
3051 nmdc:mga06r32_6124_c1
3052 nmdc:mga06r32_9269_c1
3053 nmdc:mga06r32_9276_c1
3054 nmdc:mga06r32_93765_c1
3055 nmdc:mga08y16_112136_c1
3056 nmdc:mga08y16_155353_c1
3057 nmdc:mga08y16_204_c3
3058 nmdc:mga08y16_250_c1
3059 nmdc:mga08y16_25309_c1
3060 nmdc:mga08y16_2965_c1
3061 nmdc:mga08y16_51069_c1
3062 nmdc:mga08y16_6645_c1
3063 nmdc:mga08y16_84543_c1
3064 nmdc:mga08y16_95168_c1
3065 nmdc:mga0n895_101627_c1
3066 nmdc:mga0n895_10268_c1
3067 nmdc:mga0n895_112705_c1
3068 nmdc:mga0n895_12893_c1
3069 nmdc:mga0n895_131382_c1
3070 nmdc:mga0n895_160692_c1
3071 nmdc:mga0n895_169523_c1
3072 nmdc:mga0n895_20353_c1
3073 nmdc:mga0n895_248652_c1
3074 nmdc:mga0n895_25698_c1
3075 nmdc:mga0n895_3178_c1
3076 nmdc:mga0n895_419_c1
3077 nmdc:mga0n895_60203_c1
3078 nmdc:mga0n895_803_c1
3079 nmdc:mga0n895_81600_c1
3080 nmdc:mga0rr50_108557_c1
3081 nmdc:mga0rr50_13755_c1
3082 nmdc:mga0rr50_23455_c1
3083 nmdc:mga0rr50_37460_c1
3084 nmdc:mga08x19_1474_c1
3085 nmdc:mga0a205_116472_c1
3086 nmdc:mga0a205_144871_c1
3087 nmdc:mga0a205_151348_c1
3088 nmdc:mga0a205_1651_c1
3089 nmdc:mga0a205_16932_c1
3090 nmdc:mga0a205_17702_c1
3091 nmdc:mga0a205_18222_c1
3092 nmdc:mga0a205_20683_c1
3093 nmdc:mga0a205_211118_c1
3094 nmdc:mga0a205_3138_c2
3095 nmdc:mga0a205_31482_c1
3096 nmdc:mga0a205_334431_c1
3097 nmdc:mga0a205_40438_c1
3098 nmdc:mga0a205_756_c1
3099 nmdc:mga0a205_7684_c2
3100 Ga0495601_0141072
3101 Ga0495612_0024110
3102 Ga0495619_0048113
3103 Ga0495619_0077485
3104 Ga0500578_0035295
3105 Ga0500643_000018
3106 Ga0500651_0016981
3107 Ga0500566_0000038
3108 Ga0500566_0003392
3109 Ga0500640_007905
3110 Ga0500640_021426
3111 Ga0500641_0003063
3112 Ga0500641_0012847
3113 Ga0500554_000388
3114 Ga0500555_001110
3115 Ga0500556_0032311
3116 Ga0500557_000008
3117 Ga0500562_011823
3118 Ga0500572_000010
3119 Ga0500572_009784
3120 Ga0500595_000414
3121 Ga0500595_003164
3122 Ga0500595_014908
3123 Ga0500595_023353
3124 Ga0500614_000527
3125 Ga0500642_0024247
3126 Ga0500559_0001128
3127 Ga0500559_0001831
3128 Ga0500568_0041774
3129 Ga0500573_0025983
3130 Ga0500590_027576
3131 Ga0500603_000506
3132 Ga0500603_001672
3133 Ga0500604_0018315
3134 Ga0500616_0010066
3135 Ga0500616_0067602
3136 Ga0500620_011369
3137 Ga0500622_0043388
3138 Ga0500630_017682
3139 Ga0500639_000034
3140 Ga0500636_0000618
3141 Ga0500636_0030876
3142 Ga0500636_0063419
3143 Ga0500636_0118470
3144 Ga0500637_0001326
3145 Ga0500637_0074915
3146 Ga0500637_0100285
3147 Ga0500625_004205
3148 Ga0500645_002184
3149 Ga0500645_019887
3150 Ga0500609_002717
3151 Ga0500552_001233
3152 Ga0500596_001579
3153 Ga0500601_001069
3154 Ga0501084_0002479
3155 Ga0501084_0002704
3156 Ga0501084_0003774
3157 Ga0501084_0010622
3158 Ga0501084_0060361
3159 Ga0501084_0072728
3160 Ga0501084_0150206
3161 Ga0501084_0362235
3162 Ga0500661_001493
3163 Ga0590071_008059
3164 Ga0587077_010797
3165 Ga0587082_008852
3166 Ga0587111_0013118
3167 Ga0587111_0016186
3168 Ga0501082_0001991
3169 Ga0501082_0003830
3170 Ga0501082_0004398
3171 Ga0501082_0012904
3172 Ga0501082_0032420
3173 Ga0501082_0050516
3174 Ga0501082_0094844
3175 Ga0501082_0120666
3176 Ga0501082_0199776
3177 Ga0530510_0018987
3178 Ga0530510_0218526
3179 2507510851
3180 2508544668
3181 2508697116
3182 2511395630
3183 2513623858
3184 2513637639
3185 2513649508
3186 2513655816
3187 2513696483
3188 2513704248
3189 2513719326
3190 2513856688
3191 2513874504
3192 2513917271
3193 2515630720
3194 2517100423
3195 2517895445
3196 2524437284
3197 2528855277
3198 2587754296
3199 2617377971
3200 2644727632
3201 2644743777
3202 2671122121
3203 2723842989
3204 2745076753
3205 2793065128
3206 2793069424
3207 2793082456
3208 2805916499
3209 2818237978
3210 2824601530
3211 2824617198
3212 2824619009
3213 2824627471
3214 2824637855
3215 2824644637
3216 2824653661
3217 2824663033
3218 2824673183
3219 2824680524
3220 2824689903
3221 2824698032
3222 2824709867
3223 2824715833
3224 2824724223
3225 2824746241
3226 2824757000
3227 2824770128
3228 2824778528
3229 2838129781
3230 2841764903
3231 2841917038
3232 2841922659
3233 2841943043
3234 2841956720
3235 2841960377
3236 2841968323
3237 2841976471
3238 2841987838
3239 2842042848
3240 2842050889
3241 2842680379
3242 2844107649
3243 2844317089
3244 2847938421
3245 2847944386
3246 2849081381
3247 2851183600
3248 2851249755
3249 2857512038
3250 2874597566
3251 2874616623
3252 2874630477
3253 2874649129
3254 2876768048
3255 2876774961
3256 2876822287
3257 2879078049
3258 2879088657
3259 2879104000
3260 2879132400
3261 2879145301
3262 2885194550
3263 2885367067
3264 2885382179
3265 2885416486
3266 2888381704
3267 2888388935
3268 2888422088
3269 2894241291
3270 2903735056
3271 2903751326
3272 2904667627
3273 2904698790
3274 2904719036
3275 2906604172
3276 2906615935
3277 2906635156
3278 2906639031
3279 2906647983
3280 2906662079
3281 2908740949
3282 2908758041
3283 2917701040
3284 2919467419
3285 2922367073
3286 2922371389
3287 2922390148
3288 2922393725
3289 2929523925
3290 2929623238
3291 2929630918
3292 2932786094
3293 2932799142
3294 2932803935
3295 2932811964
3296 2932822550
3297 2932831137
3298 2933585142
3299 2935612927
3300 2935624077
3301 2935631030
3302 2935640277
3303 2935666885
3304 2935684351
3305 2935691343
3306 2935699902
3307 2935704640
3308 2935719177
3309 2935729223
3310 2935737536
3311 2935746912
3312 2935758289
3313 2935762460
3314 2935777288
3315 2935780393
3316 2935793208
3317 2935801196
3318 2935803957
3319 2935811876
3320 2935824415
3321 2935829760
3322 2935842883
3323 2935852440
3324 2935862423
3325 2935870558
3326 2935881140
3327 2935884259
3328 2935912413
3329 2935921754
3330 2935929698
3331 2935938930
3332 2935948235
3333 2935954959
3334 2935962227
3335 2935972007
3336 2935979345
3337 2935988080
3338 2935993637
3339 2936004533
3340 2936038459
3341 2936059369
3342 2940563801
3343 2941507682
3344 2941516109
3345 2941523183
3346 2941533861
3347 2941544132
3348 2945947880
3349 2954768171
3350 3005476884
3351 3005485353
3352 3005507277
3353 3005594637
3354 3005596721
3355 3005712790
3356 8006929068
3357 8006934533
3358 8006966611
3359 8006974503
3360 8006989457
3361 8006997924
3362 8016516240
3363 8016523636
3364 8016537155
3365 8016541414
3366 8016551838
3367 8016560220
3368 8016566807
3369 8016579540
3370 8016589315
3371 8016598138
3372 8016604278
3373 8016620863
3374 8016629125
3375 8016633662
3376 8017060292
3377 8019542682
3378 8019548057
3379 8019564144
3380 8019574220
3381 8019579819
3382 8019587525
3383 8019603813
3384 8019614725
3385 8019636846
3386 8019642759
3387 8019649832
3388 8019664669
3389 8019674258
3390 8019681862
3391 8019693925
3392 8055748974
3393 8056674952
3394 8056694584
3395 8056972012
3396 8057533070

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08450

SGL

SMP-30/Gluconolactonase/LRE-like region

148

443

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3e5z-assembly2.cif.gz_B x-ray structure of the putative gluconolactonase in protein family pf08450. northeast structural genomics consortium target drr130. 0.9035 60 388
3e5z-assembly2.cif.gz_B x-ray structure of the putative gluconolactonase in protein family pf08450. northeast structural genomics consortium target drr130. 0.8945 60 388
3dr2-assembly1.cif.gz_A structural and functional analyses of xc5397 from xanthomonas campestris: a gluconolactonase important in glucose secondary metabolic pathways 0.8721 60 382
3dr2-assembly1.cif.gz_B structural and functional analyses of xc5397 from xanthomonas campestris: a gluconolactonase important in glucose secondary metabolic pathways 0.831 47 382
3dr2-assembly1.cif.gz_B structural and functional analyses of xc5397 from xanthomonas campestris: a gluconolactonase important in glucose secondary metabolic pathways 0.8202 47 382
ID Description Score Start End Superfamily
3e5zB00 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.9025 60 388 2.120.10.30
3e5zB00 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.8935 60 388 2.120.10.30
3dr2A00 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.8721 60 382 2.120.10.30
3dr2A00 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.8184 60 382 2.120.10.30
af_A0A1D6MZQ1_4_154_2.120.10.30 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.8033 87 187 2.120.10.30
ID Description Score Start End GO Terms
AF-A0A0S6UZS5-F1-model_v4 Gluconolactonase 0.9899 43 390 GO:0016787
AF-A0A529X5G7-F1-model_v4 SMP-30/gluconolactonase/LRE family protein 0.9896 63 154 GO:0016787
AF-A0A1Q7ZQ57-F1-model_v4 Gluconolactonase 0.9872 60 390 GO:0016787
AF-A0A3S1QCC4-F1-model_v4 deleted 0.9868 63 199
AF-A0A529MUM4-F1-model_v4 SMP-30/gluconolactonase/LRE family protein 0.9868 78 193 GO:0016787

Map