F495386
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1698 | 730 | 3396 | 395 |
Family's Representative Sequence
| Representative Sequence | 3300046674|Ga0495588_0041396|Ga0495588_0041396_646_2022 |
| Length | 458 |
| Sequence | MDKVMPSCLASFSREKNRKHLSQPEADQNNLKWPSRINGWHRHWEDAMQHSEQRDPETTISRRTLVHGLAVCAGATVAGASAALAQGGPXXXXVAPPSTITSPPRDFSPRGAPTTYFWDPDIIAVDPSFNDLAQPNTAIKRLYTGVLWAEGPAWSAQGRYLLWSDIPNNRQMRYSEDDGHVSVFRTPTNNSNGNSFDFQGRQLSCEHLTRRVVRYEHDGTATVLADNFGGKKLNSPNDVVAHPDGSYWFTDPPYGGQLYEGEPDVAGGPSNSGGKLNPRIGQPAGFVPGKRELPTNCYRIDPSGRIDLVVTEEQVPDPNGLCFSPDYKKLYVASTGKGPGDTGAGGKGDMFVFDVGADNKLSNHKRFSDFMVDGVKCGPDGMRCDVNGNVWAASNAGRAVGYSGVTVWSPEGKLLGRIRLPEVCGNVTFGGPKRNRLFMAASQSLYAVYTATQGAGPG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 3 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 4 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 5 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 6 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 7 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 8 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 9 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 10 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 11 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 12 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 13 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 21 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 25 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 37 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 54 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 62 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 64 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 70 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 72 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 73 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 74 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 76 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 77 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 78 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 79 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 80 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 81 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 82 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 83 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 84 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 85 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 86 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 87 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 88 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 89 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 91 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 92 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 93 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 94 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 95 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 96 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 97 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 98 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 99 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 100 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 102 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 103 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 104 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 105 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 106 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 107 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 108 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 109 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 110 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 111 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 113 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 114 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 115 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 116 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013250 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 | Metagenome | Rhizosphere |
| 134 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 142 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 145 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 147 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 148 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 149 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 150 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 151 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 152 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 153 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 158 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 160 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 162 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 225 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 226 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 227 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 228 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 237 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 241 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 242 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 243 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 244 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 245 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 246 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 247 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 248 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 249 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 250 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 251 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 252 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 253 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 254 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 255 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 256 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 257 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 258 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 259 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 260 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 261 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 262 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 263 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 264 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 265 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 266 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 267 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 268 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 269 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 270 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 271 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 272 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 273 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 274 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 275 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 276 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 277 | 3300033544 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 | Metagenome | Unclassified |
| 278 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 279 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 280 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 281 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 282 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 283 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 284 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 285 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 286 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 287 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 288 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 289 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 290 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 291 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 292 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 293 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 294 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 295 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 296 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 297 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 298 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 299 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 300 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 301 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 302 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 303 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 304 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 305 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 306 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 307 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 308 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 309 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 310 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 311 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 312 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 313 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 314 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 315 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 316 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 317 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 318 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 319 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 320 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 321 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 322 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 323 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 324 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 325 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 326 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 327 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 328 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 329 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 330 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 331 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 332 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 333 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 334 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 335 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 336 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 337 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 338 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 339 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 397 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 398 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 399 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 400 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 401 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 402 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 403 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 404 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 405 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 406 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 407 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 408 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 409 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 410 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 411 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 412 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 413 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 414 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 415 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 416 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 417 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 418 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 419 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 420 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 421 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 422 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 423 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 424 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 425 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 426 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 427 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 428 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 429 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 430 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 431 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 432 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 433 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 434 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 435 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 436 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 437 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 438 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 439 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 440 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 441 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 442 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 443 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 444 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 445 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 446 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 447 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 448 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 449 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 450 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 451 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 452 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 453 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 454 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 455 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 456 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 457 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 458 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 459 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 460 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 461 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 462 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 463 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 464 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 465 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 466 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 467 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 468 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 469 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 470 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 471 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 472 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 473 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 474 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 475 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 476 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 477 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 478 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 479 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 480 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 481 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 482 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 483 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 484 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 485 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 486 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 487 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 488 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 489 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 490 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 491 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 492 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 493 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 494 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 495 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 496 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 497 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 498 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 499 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 500 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 501 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 502 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 503 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 504 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 505 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 506 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 507 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 508 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 509 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 510 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 511 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 512 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 513 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 514 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 515 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 516 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 517 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 518 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 519 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 520 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 521 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 522 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 523 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 524 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 525 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 526 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 527 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 528 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 529 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 530 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 531 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 532 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 533 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 534 | 2643221733 | Bosea sp. Root381 | Isolate | Unclassified |
| 535 | 2643221736 | Bosea sp. Root483D1 | Isolate | Unclassified |
| 536 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 537 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 538 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 539 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 540 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 541 | 2791355199 | |||
| 542 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 543 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 544 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 545 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 546 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 547 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 548 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 549 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 550 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 551 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 552 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 553 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 554 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 555 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 556 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 557 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 558 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 559 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 560 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 561 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 562 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 563 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 564 | 2841760612 | Bosea sp. Tri-49 | Isolate | Nodule |
| 565 | 2841911363 | Bosea caraganae RCAM04685 | Isolate | Nodule |
| 566 | 2841917233 | Bosea caraganae RCAM04680 | Isolate | Nodule |
| 567 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 568 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 569 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 570 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 571 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 572 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 573 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 574 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 575 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 576 | 2844104063 | Bosea sp. Tri-39 | Isolate | Nodule |
| 577 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 578 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 579 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 580 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 581 | 2851182111 | Bosea sp. Tri-44 | Isolate | Nodule |
| 582 | 2851246043 | Bosea sp. Tri-54 | Isolate | Nodule |
| 583 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 584 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 585 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 586 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 587 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 588 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 589 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 590 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 591 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 592 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 593 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 594 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 595 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 596 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 597 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 598 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 599 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 600 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 601 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 602 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 603 | 2894232714 | Microvirga tunisiensis Lmie10 | Isolate | Nodule |
| 604 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 605 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 606 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 607 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 608 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 609 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 610 | 2906610324 | |||
| 611 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 612 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 613 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 614 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 615 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 616 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 617 | 2917699015 | Bosea sp. F3-2 | Isolate | Rhizosphere |
| 618 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 619 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 620 | 2922368715 | |||
| 621 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 622 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 623 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 624 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 625 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 626 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 627 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 628 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 629 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 630 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 631 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 632 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 633 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 634 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 635 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 636 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 637 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 638 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 639 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 640 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 641 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 642 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 643 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 644 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 645 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 646 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 647 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 648 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 649 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 650 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 651 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 652 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 653 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 654 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 655 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 656 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 657 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 658 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 659 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 660 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 661 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 662 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 663 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 664 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 665 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 666 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 667 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 668 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 669 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 670 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 671 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 672 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 673 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 674 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 675 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 676 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 677 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 678 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 679 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 680 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 681 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 682 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 683 | 2954767861 | Variovorax sp. TBS-050B | Isolate | Rhizosphere |
| 684 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 685 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 686 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 687 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 688 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 689 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 690 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 691 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 692 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 693 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 694 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 695 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 696 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 697 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 698 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 699 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 700 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 701 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 702 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 703 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 704 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 705 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 706 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 707 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 708 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 709 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 710 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 711 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 712 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 713 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 714 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 715 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 716 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 717 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 718 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 719 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 720 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 721 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 722 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 723 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 724 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 725 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 726 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 727 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 728 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 729 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
| 730 | 8057529695 | Bosea vestrisii A18/4-2 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 86.84 |
| Metatranscriptomes | 0.47 |
| Isolates | 12.68 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.24 |
| Nodule | 9.89 |
| Rhizoplane | 1.71 |
| Rhizosphere | 73.91 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.24 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495588_0041396 | 3300046674 | Bacteria | 2352 |
| 2 | JGI25153J46596_10004919 | 3300003215 | Bacteria | 7102 |
| 3 | JGI25153J46596_10009142 | 3300003215 | Bacteria | 4643 |
| 4 | JGI25160J50197_1006732 | 3300003354 | Bacteria | 4611 |
| 5 | Ga0006562J51391_1066649 | 3300003578 | Bacteria | 1600 |
| 6 | JGI25404J52841_10000807 | 3300003659 | Bacteria | 4986 |
| 7 | Ga0055526_1000351 | 3300003771 | Bacteria | 37413 |
| 8 | Ga0055526_1003504 | 3300003771 | Bacteria | 9924 |
| 9 | Ga0055524_1017302 | 3300003775 | Bacteria | 2547 |
| 10 | Ga0055531_10001451 | 3300003794 | Bacteria | 17509 |
| 11 | Ga0058863_11485186 | 3300004799 | Bacteria | 1605 |
| 12 | Ga0058862_11741190 | 3300004803 | Bacteria | 1585 |
| 13 | Ga0065165_1000315 | 3300005262 | Bacteria | 78877 |
| 14 | Ga0065165_1004190 | 3300005262 | Bacteria | 9191 |
| 15 | Ga0065165_1004374 | 3300005262 | Bacteria | 8825 |
| 16 | Ga0065712_10019103 | 3300005290 | Bacteria | 1893 |
| 17 | Ga0065715_10003432 | 3300005293 | Bacteria | 5609 |
| 18 | Ga0065715_10135673 | 3300005293 | Bacteria | 1934 |
| 19 | Ga0065707_10104538 | 3300005295 | Bacteria | 2690 |
| 20 | Ga0070658_10005778 | 3300005327 | Bacteria | 10033 |
| 21 | Ga0070676_10001361 | 3300005328 | Bacteria | 12309 |
| 22 | Ga0070676_10021599 | 3300005328 | Bacteria | 3603 |
| 23 | Ga0070683_100000148 | 3300005329 | Bacteria | 45536 |
| 24 | Ga0070683_100090147 | 3300005329 | Bacteria | 2878 |
| 25 | Ga0070690_100036536 | 3300005330 | Bacteria | 3088 |
| 26 | Ga0070670_100004822 | 3300005331 | Bacteria | 11333 |
| 27 | Ga0070670_100007409 | 3300005331 | Bacteria | 9319 |
| 28 | Ga0070670_100030845 | 3300005331 | Bacteria | 4617 |
| 29 | Ga0070670_100051642 | 3300005331 | Bacteria | 3530 |
| 30 | Ga0070670_100061274 | 3300005331 | Bacteria | 3230 |
| 31 | Ga0068869_100002293 | 3300005334 | Bacteria | 11510 |
| 32 | Ga0068869_100035258 | 3300005334 | Bacteria | 3545 |
| 33 | Ga0068869_100066971 | 3300005334 | Bacteria | 2648 |
| 34 | Ga0070666_10070902 | 3300005335 | Bacteria | 2371 |
| 35 | Ga0070680_100028715 | 3300005336 | Bacteria | 4464 |
| 36 | Ga0070680_100096632 | 3300005336 | Bacteria | 2449 |
| 37 | Ga0070680_100182248 | 3300005336 | Bacteria | 1769 |
| 38 | Ga0070682_100001062 | 3300005337 | Bacteria | 15844 |
| 39 | Ga0070682_100102708 | 3300005337 | Bacteria | 1890 |
| 40 | Ga0068868_100012987 | 3300005338 | Bacteria | 6094 |
| 41 | Ga0068868_100033219 | 3300005338 | Bacteria | 3975 |
| 42 | Ga0068868_100122117 | 3300005338 | Bacteria | 2126 |
| 43 | Ga0068868_100213973 | 3300005338 | Bacteria | 1612 |
| 44 | Ga0070660_100001081 | 3300005339 | Bacteria | 18312 |
| 45 | Ga0070689_100006220 | 3300005340 | Bacteria | 8241 |
| 46 | Ga0070689_100056079 | 3300005340 | Bacteria | 3054 |
| 47 | Ga0070689_100150742 | 3300005340 | Bacteria | 1875 |
| 48 | Ga0070689_100165079 | 3300005340 | Bacteria | 1792 |
| 49 | Ga0070691_10004648 | 3300005341 | Bacteria | 6241 |
| 50 | Ga0070661_100027289 | 3300005344 | Bacteria | 4110 |
| 51 | Ga0070692_10000644 | 3300005345 | Bacteria | 11085 |
| 52 | Ga0070668_100016305 | 3300005347 | Bacteria | 5556 |
| 53 | Ga0070668_100022501 | 3300005347 | Bacteria | 4765 |
| 54 | Ga0070668_100044677 | 3300005347 | Bacteria | 3398 |
| 55 | Ga0070668_100103432 | 3300005347 | Bacteria | 2259 |
| 56 | Ga0070668_100217851 | 3300005347 | Bacteria | 1573 |
| 57 | Ga0070669_100004485 | 3300005353 | Bacteria | 10065 |
| 58 | Ga0070669_100023992 | 3300005353 | Bacteria | 4370 |
| 59 | Ga0070669_100085626 | 3300005353 | Bacteria | 2353 |
| 60 | Ga0070669_100097169 | 3300005353 | Bacteria | 2217 |
| 61 | Ga0070669_100160690 | 3300005353 | Bacteria | 1745 |
| 62 | Ga0070675_100007550 | 3300005354 | Bacteria | 8409 |
| 63 | Ga0070675_100070855 | 3300005354 | Bacteria | 2890 |
| 64 | Ga0070671_100003514 | 3300005355 | Bacteria | 12245 |
| 65 | Ga0070671_100005834 | 3300005355 | Bacteria | 9808 |
| 66 | Ga0070671_100025761 | 3300005355 | Bacteria | 4829 |
| 67 | Ga0070671_100037546 | 3300005355 | Bacteria | 4017 |
| 68 | Ga0070671_100082387 | 3300005355 | Bacteria | 2690 |
| 69 | Ga0070671_100087459 | 3300005355 | Bacteria | 2608 |
| 70 | Ga0070671_100163227 | 3300005355 | Bacteria | 1883 |
| 71 | Ga0070674_100001918 | 3300005356 | Bacteria | 11324 |
| 72 | Ga0070674_100004825 | 3300005356 | Bacteria | 7727 |
| 73 | Ga0070674_100023939 | 3300005356 | Bacteria | 3959 |
| 74 | Ga0070673_100001229 | 3300005364 | Bacteria | 14826 |
| 75 | Ga0070673_100002951 | 3300005364 | Bacteria | 10484 |
| 76 | Ga0070673_100023904 | 3300005364 | Bacteria | 4471 |
| 77 | Ga0070673_100047182 | 3300005364 | Bacteria | 3350 |
| 78 | Ga0070688_100019496 | 3300005365 | Bacteria | 3930 |
| 79 | Ga0070688_100042368 | 3300005365 | Bacteria | 2800 |
| 80 | Ga0070688_100055492 | 3300005365 | Bacteria | 2485 |
| 81 | Ga0070688_100110246 | 3300005365 | Bacteria | 1829 |
| 82 | Ga0070688_100115900 | 3300005365 | Bacteria | 1788 |
| 83 | Ga0070659_100000332 | 3300005366 | Bacteria | 36449 |
| 84 | Ga0070667_100006087 | 3300005367 | Bacteria | 10016 |
| 85 | Ga0070667_100056905 | 3300005367 | Bacteria | 3304 |
| 86 | Ga0070667_100062748 | 3300005367 | Bacteria | 3148 |
| 87 | Ga0070667_100128825 | 3300005367 | Bacteria | 2207 |
| 88 | Ga0070667_100131034 | 3300005367 | Bacteria | 2188 |
| 89 | Ga0070709_10000486 | 3300005434 | Bacteria | 23433 |
| 90 | Ga0070709_10003919 | 3300005434 | Bacteria | 8026 |
| 91 | Ga0070714_100022677 | 3300005435 | Bacteria | 5148 |
| 92 | Ga0070713_100008432 | 3300005436 | Bacteria | 7307 |
| 93 | Ga0070713_100014512 | 3300005436 | Bacteria | 5855 |
| 94 | Ga0070713_100015252 | 3300005436 | Bacteria | 5734 |
| 95 | Ga0070713_100073361 | 3300005436 | Bacteria | 2897 |
| 96 | Ga0070713_100080178 | 3300005436 | Bacteria | 2783 |
| 97 | Ga0070713_100165777 | 3300005436 | Bacteria | 1975 |
| 98 | Ga0070713_100211227 | 3300005436 | Bacteria | 1757 |
| 99 | Ga0070710_10000457 | 3300005437 | Bacteria | 19119 |
| 100 | Ga0070701_10038351 | 3300005438 | Bacteria | 2425 |
| 101 | Ga0070701_10086625 | 3300005438 | Bacteria | 1707 |
| 102 | Ga0070711_100015007 | 3300005439 | Bacteria | 4895 |
| 103 | Ga0070711_100088056 | 3300005439 | Bacteria | 2230 |
| 104 | Ga0070711_100112754 | 3300005439 | Bacteria | 1998 |
| 105 | Ga0070711_100129225 | 3300005439 | Bacteria | 1879 |
| 106 | Ga0070705_100000691 | 3300005440 | Bacteria | 19245 |
| 107 | Ga0070705_100005701 | 3300005440 | Bacteria | 6082 |
| 108 | Ga0070705_100019458 | 3300005440 | Bacteria | 3573 |
| 109 | Ga0070700_100043671 | 3300005441 | Bacteria | 2758 |
| 110 | Ga0070700_100049633 | 3300005441 | Bacteria | 2606 |
| 111 | Ga0070694_100007224 | 3300005444 | Bacteria | 6765 |
| 112 | Ga0070694_100008499 | 3300005444 | Bacteria | 6281 |
| 113 | Ga0070694_100011936 | 3300005444 | Bacteria | 5391 |
| 114 | Ga0070694_100036800 | 3300005444 | Bacteria | 3244 |
| 115 | Ga0070694_100058004 | 3300005444 | Bacteria | 2633 |
| 116 | Ga0070708_100046751 | 3300005445 | Bacteria | 3820 |
| 117 | Ga0070708_100158033 | 3300005445 | Bacteria | 2111 |
| 118 | Ga0070708_100329529 | 3300005445 | Bacteria | 1438 |
| 119 | Ga0070708_100348670 | 3300005445 | Bacteria | 1395 |
| 120 | Ga0070663_100000839 | 3300005455 | Bacteria | 16651 |
| 121 | Ga0070663_100006693 | 3300005455 | Bacteria | 6950 |
| 122 | Ga0070663_100112409 | 3300005455 | Bacteria | 2048 |
| 123 | Ga0070678_100009373 | 3300005456 | Bacteria | 5926 |
| 124 | Ga0070678_100009392 | 3300005456 | Bacteria | 5923 |
| 125 | Ga0070678_100031777 | 3300005456 | Bacteria | 3647 |
| 126 | Ga0070678_100054926 | 3300005456 | Bacteria | 2905 |
| 127 | Ga0070678_100059025 | 3300005456 | Bacteria | 2818 |
| 128 | Ga0070678_100067797 | 3300005456 | Bacteria | 2657 |
| 129 | Ga0070662_100028101 | 3300005457 | Bacteria | 3912 |
| 130 | Ga0070681_10011846 | 3300005458 | Bacteria | 8645 |
| 131 | Ga0070681_10031497 | 3300005458 | Bacteria | 5324 |
| 132 | Ga0068867_100002014 | 3300005459 | Bacteria | 14190 |
| 133 | Ga0068867_100004801 | 3300005459 | Bacteria | 9514 |
| 134 | Ga0068867_100009902 | 3300005459 | Bacteria | 6716 |
| 135 | Ga0068867_100033914 | 3300005459 | Bacteria | 3700 |
| 136 | Ga0068867_100193652 | 3300005459 | Bacteria | 1624 |
| 137 | Ga0070685_10199331 | 3300005466 | Bacteria | 1300 |
| 138 | Ga0070706_100002714 | 3300005467 | Bacteria | 17715 |
| 139 | Ga0070706_100016159 | 3300005467 | Bacteria | 6892 |
| 140 | Ga0070706_100163515 | 3300005467 | Bacteria | 2078 |
| 141 | Ga0070707_100009700 | 3300005468 | Bacteria | 8947 |
| 142 | Ga0070707_100011587 | 3300005468 | Bacteria | 8225 |
| 143 | Ga0070707_100024750 | 3300005468 | Bacteria | 5690 |
| 144 | Ga0070707_100045864 | 3300005468 | Bacteria | 4183 |
| 145 | Ga0070707_100096062 | 3300005468 | Bacteria | 2870 |
| 146 | Ga0070707_100151927 | 3300005468 | Bacteria | 2255 |
| 147 | Ga0070707_100164602 | 3300005468 | Bacteria | 2161 |
| 148 | Ga0070707_100190679 | 3300005468 | Bacteria | 1999 |
| 149 | Ga0070707_100201829 | 3300005468 | Bacteria | 1938 |
| 150 | Ga0070698_100000346 | 3300005471 | Bacteria | 47866 |
| 151 | Ga0070698_100003210 | 3300005471 | Bacteria | 18008 |
| 152 | Ga0070698_100004552 | 3300005471 | Bacteria | 15229 |
| 153 | Ga0070698_100015625 | 3300005471 | Bacteria | 8017 |
| 154 | Ga0070698_100034993 | 3300005471 | Bacteria | 5194 |
| 155 | Ga0070698_100041573 | 3300005471 | Bacteria | 4719 |
| 156 | Ga0070698_100096598 | 3300005471 | Bacteria | 2931 |
| 157 | Ga0070698_100193434 | 3300005471 | Bacteria | 1971 |
| 158 | Ga0070699_100001230 | 3300005518 | Bacteria | 23625 |
| 159 | Ga0070699_100024201 | 3300005518 | Bacteria | 5232 |
| 160 | Ga0070699_100048342 | 3300005518 | Bacteria | 3681 |
| 161 | Ga0070699_100073864 | 3300005518 | Bacteria | 2967 |
| 162 | Ga0070699_100151455 | 3300005518 | Bacteria | 2052 |
| 163 | Ga0070699_100153520 | 3300005518 | Bacteria | 2037 |
| 164 | Ga0070699_100182081 | 3300005518 | Bacteria | 1865 |
| 165 | Ga0070684_100000395 | 3300005535 | Bacteria | 29885 |
| 166 | Ga0070684_100007543 | 3300005535 | Bacteria | 8469 |
| 167 | Ga0070684_100018693 | 3300005535 | Bacteria | 5716 |
| 168 | Ga0070684_100099998 | 3300005535 | Bacteria | 2589 |
| 169 | Ga0070697_100006088 | 3300005536 | Bacteria | 9332 |
| 170 | Ga0070697_100006432 | 3300005536 | Bacteria | 9093 |
| 171 | Ga0070697_100091647 | 3300005536 | Bacteria | 2514 |
| 172 | Ga0068853_100001226 | 3300005539 | Bacteria | 18302 |
| 173 | Ga0068853_100057574 | 3300005539 | Bacteria | 3355 |
| 174 | Ga0068853_100122019 | 3300005539 | Bacteria | 2325 |
| 175 | Ga0068853_100287145 | 3300005539 | Bacteria | 1518 |
| 176 | Ga0070672_100001304 | 3300005543 | Bacteria | 15373 |
| 177 | Ga0070672_100005379 | 3300005543 | Bacteria | 8483 |
| 178 | Ga0070672_100033365 | 3300005543 | Bacteria | 3898 |
| 179 | Ga0070672_100047629 | 3300005543 | Bacteria | 3327 |
| 180 | Ga0070672_100161932 | 3300005543 | Bacteria | 1857 |
| 181 | Ga0070686_100079681 | 3300005544 | Bacteria | 2165 |
| 182 | Ga0070686_100079844 | 3300005544 | Bacteria | 2163 |
| 183 | Ga0070686_100103575 | 3300005544 | Bacteria | 1926 |
| 184 | Ga0070686_100232646 | 3300005544 | Bacteria | 1338 |
| 185 | Ga0070695_100000230 | 3300005545 | Bacteria | 27680 |
| 186 | Ga0070695_100004834 | 3300005545 | Bacteria | 7931 |
| 187 | Ga0070695_100004974 | 3300005545 | Bacteria | 7835 |
| 188 | Ga0070695_100010605 | 3300005545 | Bacteria | 5506 |
| 189 | Ga0070695_100011714 | 3300005545 | Bacteria | 5249 |
| 190 | Ga0070695_100015922 | 3300005545 | Bacteria | 4545 |
| 191 | Ga0070695_100044029 | 3300005545 | Bacteria | 2840 |
| 192 | Ga0070695_100089625 | 3300005545 | Bacteria | 2051 |
| 193 | Ga0070695_100200150 | 3300005545 | Bacteria | 1427 |
| 194 | Ga0070696_100003816 | 3300005546 | Bacteria | 10062 |
| 195 | Ga0070696_100008494 | 3300005546 | Bacteria | 6875 |
| 196 | Ga0070696_100011186 | 3300005546 | Bacteria | 6006 |
| 197 | Ga0070696_100092200 | 3300005546 | Bacteria | 2159 |
| 198 | Ga0070693_100001464 | 3300005547 | Bacteria | 10643 |
| 199 | Ga0070665_100007018 | 3300005548 | Bacteria | 11445 |
| 200 | Ga0070665_100037546 | 3300005548 | Bacteria | 4871 |
| 201 | Ga0070665_100073051 | 3300005548 | Bacteria | 3437 |
| 202 | Ga0070665_100158285 | 3300005548 | Bacteria | 2267 |
| 203 | Ga0070704_100005792 | 3300005549 | Bacteria | 7230 |
| 204 | Ga0070704_100010222 | 3300005549 | Bacteria | 5708 |
| 205 | Ga0070704_100034177 | 3300005549 | Bacteria | 3445 |
| 206 | Ga0070704_100108659 | 3300005549 | Bacteria | 2106 |
| 207 | Ga0070704_100127299 | 3300005549 | Bacteria | 1967 |
| 208 | Ga0070704_100165462 | 3300005549 | Bacteria | 1753 |
| 209 | Ga0070704_100172975 | 3300005549 | Bacteria | 1719 |
| 210 | Ga0068855_100089514 | 3300005563 | Bacteria | 3553 |
| 211 | Ga0068855_100209399 | 3300005563 | Bacteria | 2192 |
| 212 | Ga0068855_100291623 | 3300005563 | Bacteria | 1808 |
| 213 | Ga0070664_100000515 | 3300005564 | Bacteria | 29394 |
| 214 | Ga0070664_100007341 | 3300005564 | Bacteria | 8883 |
| 215 | Ga0070664_100046285 | 3300005564 | Bacteria | 3675 |
| 216 | Ga0070664_100097950 | 3300005564 | Bacteria | 2547 |
| 217 | Ga0070664_100157073 | 3300005564 | Bacteria | 2010 |
| 218 | Ga0070664_100159031 | 3300005564 | Bacteria | 1998 |
| 219 | Ga0068857_100040672 | 3300005577 | Bacteria | 4123 |
| 220 | Ga0068854_100081713 | 3300005578 | Bacteria | 2387 |
| 221 | Ga0068854_100252579 | 3300005578 | Bacteria | 1408 |
| 222 | Ga0068856_100003318 | 3300005614 | Bacteria | 16350 |
| 223 | Ga0068856_100123599 | 3300005614 | Bacteria | 2590 |
| 224 | Ga0070702_100028461 | 3300005615 | Bacteria | 3028 |
| 225 | Ga0068852_100067246 | 3300005616 | Bacteria | 3133 |
| 226 | Ga0068852_100241244 | 3300005616 | Bacteria | 1727 |
| 227 | Ga0068859_100007794 | 3300005617 | Bacteria | 10869 |
| 228 | Ga0068859_100008319 | 3300005617 | Bacteria | 10514 |
| 229 | Ga0068859_100010316 | 3300005617 | Bacteria | 9402 |
| 230 | Ga0068859_100025039 | 3300005617 | Bacteria | 5990 |
| 231 | Ga0068859_100034185 | 3300005617 | Bacteria | 5103 |
| 232 | Ga0068859_100049189 | 3300005617 | Bacteria | 4234 |
| 233 | Ga0068859_100186637 | 3300005617 | Bacteria | 2157 |
| 234 | Ga0068859_100206325 | 3300005617 | Bacteria | 2050 |
| 235 | Ga0068864_100009127 | 3300005618 | Bacteria | 8174 |
| 236 | Ga0068864_100016671 | 3300005618 | Bacteria | 6122 |
| 237 | Ga0068864_100041875 | 3300005618 | Bacteria | 3918 |
| 238 | Ga0068864_100124593 | 3300005618 | Bacteria | 2307 |
| 239 | Ga0068864_100126263 | 3300005618 | Bacteria | 2293 |
| 240 | Ga0068866_10001643 | 3300005718 | Bacteria | 9427 |
| 241 | Ga0068866_10031174 | 3300005718 | Bacteria | 2566 |
| 242 | Ga0068861_100073259 | 3300005719 | Bacteria | 2660 |
| 243 | Ga0068851_10011220 | 3300005834 | Bacteria | 4197 |
| 244 | Ga0068851_10022541 | 3300005834 | Bacteria | 3070 |
| 245 | Ga0068870_10004098 | 3300005840 | Bacteria | 6234 |
| 246 | Ga0068863_100009263 | 3300005841 | Bacteria | 9605 |
| 247 | Ga0068863_100066183 | 3300005841 | Bacteria | 3418 |
| 248 | Ga0068863_100103210 | 3300005841 | Bacteria | 2712 |
| 249 | Ga0068858_100141957 | 3300005842 | Bacteria | 2255 |
| 250 | Ga0068860_100000222 | 3300005843 | Bacteria | 88724 |
| 251 | Ga0068860_100034889 | 3300005843 | Bacteria | 4826 |
| 252 | Ga0068860_100327686 | 3300005843 | Bacteria | 1504 |
| 253 | Ga0068862_100010279 | 3300005844 | Bacteria | 7721 |
| 254 | Ga0068862_100010761 | 3300005844 | Bacteria | 7552 |
| 255 | Ga0068862_100014159 | 3300005844 | Bacteria | 6612 |
| 256 | Ga0068862_100021843 | 3300005844 | Bacteria | 5351 |
| 257 | Ga0068862_100036902 | 3300005844 | Bacteria | 4142 |
| 258 | Ga0081455_10000080 | 3300005937 | Bacteria | 104190 |
| 259 | Ga0081455_10000161 | 3300005937 | Bacteria | 82092 |
| 260 | Ga0081455_10001725 | 3300005937 | Bacteria | 26473 |
| 261 | Ga0081455_10012953 | 3300005937 | Bacteria | 8272 |
| 262 | Ga0081455_10015705 | 3300005937 | Bacteria | 7339 |
| 263 | Ga0081455_10027867 | 3300005937 | Bacteria | 5171 |
| 264 | Ga0081455_10031429 | 3300005937 | Bacteria | 4805 |
| 265 | Ga0081455_10083294 | 3300005937 | Bacteria | 2614 |
| 266 | Ga0081455_10106197 | 3300005937 | Bacteria | 2242 |
| 267 | Ga0081455_10171138 | 3300005937 | Bacteria | 1654 |
| 268 | Ga0081540_1000642 | 3300005983 | Bacteria | 33163 |
| 269 | Ga0081540_1000914 | 3300005983 | Bacteria | 26584 |
| 270 | Ga0081540_1004331 | 3300005983 | Bacteria | 10872 |
| 271 | Ga0081540_1008099 | 3300005983 | Bacteria | 7381 |
| 272 | Ga0081540_1008761 | 3300005983 | Bacteria | 7033 |
| 273 | Ga0081540_1011538 | 3300005983 | Bacteria | 5903 |
| 274 | Ga0081540_1012457 | 3300005983 | Bacteria | 5596 |
| 275 | Ga0081540_1017354 | 3300005983 | Bacteria | 4459 |
| 276 | Ga0081540_1049780 | 3300005983 | Bacteria | 2087 |
| 277 | Ga0081539_10000845 | 3300005985 | Bacteria | 58627 |
| 278 | Ga0081539_10004736 | 3300005985 | Bacteria | 14714 |
| 279 | Ga0081539_10006536 | 3300005985 | Bacteria | 11121 |
| 280 | Ga0081539_10028313 | 3300005985 | Bacteria | 3526 |
| 281 | Ga0081539_10033166 | 3300005985 | Bacteria | 3150 |
| 282 | Ga0081539_10062665 | 3300005985 | Bacteria | 2032 |
| 283 | Ga0070717_10000445 | 3300006028 | Bacteria | 26264 |
| 284 | Ga0070717_10007173 | 3300006028 | Bacteria | 8259 |
| 285 | Ga0070717_10124122 | 3300006028 | Bacteria | 2215 |
| 286 | Ga0070717_10279343 | 3300006028 | Bacteria | 1481 |
| 287 | Ga0075365_10049929 | 3300006038 | Bacteria | 2758 |
| 288 | Ga0075365_10100813 | 3300006038 | Bacteria | 1977 |
| 289 | Ga0075368_10044171 | 3300006042 | Bacteria | 1757 |
| 290 | Ga0075368_10065329 | 3300006042 | Bacteria | 1462 |
| 291 | Ga0075364_10000678 | 3300006051 | Bacteria | 17703 |
| 292 | Ga0075364_10000816 | 3300006051 | Bacteria | 16437 |
| 293 | Ga0075432_10032841 | 3300006058 | Bacteria | 1798 |
| 294 | Ga0070715_10021431 | 3300006163 | Bacteria | 2506 |
| 295 | Ga0070716_100002383 | 3300006173 | Bacteria | 8649 |
| 296 | Ga0070712_100015842 | 3300006175 | Bacteria | 4860 |
| 297 | Ga0070712_100017478 | 3300006175 | Bacteria | 4643 |
| 298 | Ga0070712_100042703 | 3300006175 | Bacteria | 3119 |
| 299 | Ga0070712_100114820 | 3300006175 | Bacteria | 2017 |
| 300 | Ga0075362_10026745 | 3300006177 | Bacteria | 2466 |
| 301 | Ga0075367_10005020 | 3300006178 | Bacteria | 6525 |
| 302 | Ga0075367_10044477 | 3300006178 | Bacteria | 2603 |
| 303 | Ga0075367_10071421 | 3300006178 | Bacteria | 2088 |
| 304 | Ga0075367_10075019 | 3300006178 | Bacteria | 2039 |
| 305 | Ga0075367_10082264 | 3300006178 | Bacteria | 1949 |
| 306 | Ga0075366_10000856 | 3300006195 | Bacteria | 14683 |
| 307 | Ga0075366_10000905 | 3300006195 | Bacteria | 14363 |
| 308 | Ga0075366_10005409 | 3300006195 | Bacteria | 6918 |
| 309 | Ga0075366_10008580 | 3300006195 | Bacteria | 5688 |
| 310 | Ga0075366_10060700 | 3300006195 | Bacteria | 2246 |
| 311 | Ga0075366_10074682 | 3300006195 | Bacteria | 2022 |
| 312 | Ga0097621_100007944 | 3300006237 | Bacteria | 7613 |
| 313 | Ga0097621_100104846 | 3300006237 | Bacteria | 2383 |
| 314 | Ga0075370_10001184 | 3300006353 | Bacteria | 10978 |
| 315 | Ga0075370_10007505 | 3300006353 | Bacteria | 5558 |
| 316 | Ga0075370_10011359 | 3300006353 | Bacteria | 4676 |
| 317 | Ga0068871_100033975 | 3300006358 | Bacteria | 4043 |
| 318 | Ga0068871_100092819 | 3300006358 | Bacteria | 2518 |
| 319 | Ga0068871_100117974 | 3300006358 | Bacteria | 2239 |
| 320 | Ga0075428_100003718 | 3300006844 | Bacteria | 16720 |
| 321 | Ga0075428_100008208 | 3300006844 | Bacteria | 11583 |
| 322 | Ga0075428_100012867 | 3300006844 | Bacteria | 9311 |
| 323 | Ga0075428_100068546 | 3300006844 | Bacteria | 3881 |
| 324 | Ga0075428_100074382 | 3300006844 | Bacteria | 3711 |
| 325 | Ga0075428_100092259 | 3300006844 | Bacteria | 3302 |
| 326 | Ga0075428_100106864 | 3300006844 | Bacteria | 3051 |
| 327 | Ga0075428_100118702 | 3300006844 | Bacteria | 2880 |
| 328 | Ga0075428_100293646 | 3300006844 | Bacteria | 1748 |
| 329 | Ga0075430_100000088 | 3300006846 | Bacteria | 52573 |
| 330 | Ga0075430_100009119 | 3300006846 | Bacteria | 8381 |
| 331 | Ga0075430_100010610 | 3300006846 | Bacteria | 7806 |
| 332 | Ga0075430_100028288 | 3300006846 | Bacteria | 4762 |
| 333 | Ga0075431_100000986 | 3300006847 | Bacteria | 25337 |
| 334 | Ga0075431_100009718 | 3300006847 | Bacteria | 9661 |
| 335 | Ga0075431_100012421 | 3300006847 | Bacteria | 8595 |
| 336 | Ga0075431_100028276 | 3300006847 | Bacteria | 5758 |
| 337 | Ga0075431_100028624 | 3300006847 | Bacteria | 5728 |
| 338 | Ga0075431_100040844 | 3300006847 | Bacteria | 4782 |
| 339 | Ga0075431_100046479 | 3300006847 | Bacteria | 4476 |
| 340 | Ga0075431_100046924 | 3300006847 | Bacteria | 4454 |
| 341 | Ga0075431_100050940 | 3300006847 | Bacteria | 4270 |
| 342 | Ga0075431_100097648 | 3300006847 | Bacteria | 3033 |
| 343 | Ga0075431_100109569 | 3300006847 | Bacteria | 2850 |
| 344 | Ga0075431_100120979 | 3300006847 | Bacteria | 2701 |
| 345 | Ga0075431_100198033 | 3300006847 | Bacteria | 2056 |
| 346 | Ga0075431_100204237 | 3300006847 | Bacteria | 2021 |
| 347 | Ga0075431_100422764 | 3300006847 | Bacteria | 1332 |
| 348 | Ga0075433_10002688 | 3300006852 | Bacteria | 13580 |
| 349 | Ga0075433_10002891 | 3300006852 | Bacteria | 13167 |
| 350 | Ga0075433_10002980 | 3300006852 | Bacteria | 13009 |
| 351 | Ga0075433_10010671 | 3300006852 | Bacteria | 7387 |
| 352 | Ga0075433_10010872 | 3300006852 | Bacteria | 7317 |
| 353 | Ga0075433_10015682 | 3300006852 | Bacteria | 6224 |
| 354 | Ga0075433_10016744 | 3300006852 | Bacteria | 6052 |
| 355 | Ga0075433_10022800 | 3300006852 | Bacteria | 5260 |
| 356 | Ga0075433_10045536 | 3300006852 | Bacteria | 3814 |
| 357 | Ga0075433_10068601 | 3300006852 | Bacteria | 3113 |
| 358 | Ga0075433_10127143 | 3300006852 | Bacteria | 2263 |
| 359 | Ga0075433_10171175 | 3300006852 | Bacteria | 1932 |
| 360 | Ga0075433_10302073 | 3300006852 | Bacteria | 1417 |
| 361 | Ga0075434_100002381 | 3300006871 | Bacteria | 16508 |
| 362 | Ga0075434_100003494 | 3300006871 | Bacteria | 14055 |
| 363 | Ga0075434_100006184 | 3300006871 | Bacteria | 10962 |
| 364 | Ga0075434_100008186 | 3300006871 | Bacteria | 9700 |
| 365 | Ga0075434_100013374 | 3300006871 | Bacteria | 7806 |
| 366 | Ga0075434_100021784 | 3300006871 | Bacteria | 6233 |
| 367 | Ga0075434_100037146 | 3300006871 | Bacteria | 4821 |
| 368 | Ga0075434_100052972 | 3300006871 | Bacteria | 4032 |
| 369 | Ga0075434_100069170 | 3300006871 | Bacteria | 3519 |
| 370 | Ga0075434_100094589 | 3300006871 | Bacteria | 2993 |
| 371 | Ga0075434_100107253 | 3300006871 | Bacteria | 2803 |
| 372 | Ga0075434_100157590 | 3300006871 | Bacteria | 2289 |
| 373 | Ga0075434_100163226 | 3300006871 | Bacteria | 2248 |
| 374 | Ga0075434_100183446 | 3300006871 | Bacteria | 2113 |
| 375 | Ga0075434_100194172 | 3300006871 | Bacteria | 2050 |
| 376 | Ga0075434_100369385 | 3300006871 | Bacteria | 1455 |
| 377 | Ga0075429_100000555 | 3300006880 | Bacteria | 28571 |
| 378 | Ga0075429_100005512 | 3300006880 | Bacteria | 10897 |
| 379 | Ga0075429_100010439 | 3300006880 | Bacteria | 8035 |
| 380 | Ga0075429_100013820 | 3300006880 | Bacteria | 7001 |
| 381 | Ga0075429_100016895 | 3300006880 | Bacteria | 6313 |
| 382 | Ga0075429_100026783 | 3300006880 | Bacteria | 5006 |
| 383 | Ga0075429_100098834 | 3300006880 | Bacteria | 2546 |
| 384 | Ga0075429_100142868 | 3300006880 | Bacteria | 2095 |
| 385 | Ga0075429_100200814 | 3300006880 | Bacteria | 1747 |
| 386 | Ga0075429_100268188 | 3300006880 | Bacteria | 1495 |
| 387 | Ga0068865_100002565 | 3300006881 | Bacteria | 10775 |
| 388 | Ga0068865_100004347 | 3300006881 | Bacteria | 8548 |
| 389 | Ga0075436_100001553 | 3300006914 | Bacteria | 15679 |
| 390 | Ga0075436_100059954 | 3300006914 | Bacteria | 2628 |
| 391 | Ga0097620_100007793 | 3300006931 | Bacteria | 10869 |
| 392 | Ga0097620_100008319 | 3300006931 | Bacteria | 10514 |
| 393 | Ga0097620_100010316 | 3300006931 | Bacteria | 9402 |
| 394 | Ga0097620_100025040 | 3300006931 | Bacteria | 5990 |
| 395 | Ga0097620_100034186 | 3300006931 | Bacteria | 5103 |
| 396 | Ga0097620_100049186 | 3300006931 | Bacteria | 4234 |
| 397 | Ga0097620_100186638 | 3300006931 | Bacteria | 2157 |
| 398 | Ga0097620_100206326 | 3300006931 | Bacteria | 2050 |
| 399 | Ga0099824_1014445 | 3300006942 | Bacteria | 7835 |
| 400 | Ga0075435_100005520 | 3300007076 | Bacteria | 8841 |
| 401 | Ga0075435_100008483 | 3300007076 | Bacteria | 7375 |
| 402 | Ga0075435_100013632 | 3300007076 | Bacteria | 6055 |
| 403 | Ga0075435_100037343 | 3300007076 | Bacteria | 3867 |
| 404 | Ga0075435_100043987 | 3300007076 | Bacteria | 3577 |
| 405 | Ga0075435_100068695 | 3300007076 | Bacteria | 2887 |
| 406 | Ga0075435_100094823 | 3300007076 | Bacteria | 2467 |
| 407 | Ga0075435_100133225 | 3300007076 | Bacteria | 2080 |
| 408 | Ga0075435_100233309 | 3300007076 | Bacteria | 1563 |
| 409 | Ga0075435_100242314 | 3300007076 | Bacteria | 1534 |
| 410 | Ga0099794_10040397 | 3300007265 | Bacteria | 2218 |
| 411 | Ga0099794_10041554 | 3300007265 | Bacteria | 2190 |
| 412 | Ga0099795_10031993 | 3300007788 | Bacteria | 1816 |
| 413 | Ga0105240_10000427 | 3300009093 | Bacteria | 78108 |
| 414 | Ga0105240_10233130 | 3300009093 | Bacteria | 2138 |
| 415 | Ga0111539_10000205 | 3300009094 | Bacteria | 69920 |
| 416 | Ga0111539_10002082 | 3300009094 | Bacteria | 26730 |
| 417 | Ga0111539_10003143 | 3300009094 | Bacteria | 21843 |
| 418 | Ga0111539_10004506 | 3300009094 | Bacteria | 18215 |
| 419 | Ga0111539_10004845 | 3300009094 | Bacteria | 17538 |
| 420 | Ga0111539_10005412 | 3300009094 | Bacteria | 16520 |
| 421 | Ga0111539_10015192 | 3300009094 | Bacteria | 9590 |
| 422 | Ga0111539_10053485 | 3300009094 | Bacteria | 4806 |
| 423 | Ga0111539_10070021 | 3300009094 | Bacteria | 4141 |
| 424 | Ga0111539_10077793 | 3300009094 | Bacteria | 3904 |
| 425 | Ga0111539_10216065 | 3300009094 | Bacteria | 2233 |
| 426 | Ga0111539_10264260 | 3300009094 | Bacteria | 2003 |
| 427 | Ga0105245_10148881 | 3300009098 | Bacteria | 2211 |
| 428 | Ga0105247_10034407 | 3300009101 | Bacteria | 3085 |
| 429 | Ga0114129_10000722 | 3300009147 | Bacteria | 41913 |
| 430 | Ga0114129_10001217 | 3300009147 | Bacteria | 34192 |
| 431 | Ga0114129_10004791 | 3300009147 | Bacteria | 19126 |
| 432 | Ga0114129_10006303 | 3300009147 | Bacteria | 16822 |
| 433 | Ga0114129_10010000 | 3300009147 | Bacteria | 13520 |
| 434 | Ga0114129_10011045 | 3300009147 | Bacteria | 12863 |
| 435 | Ga0114129_10011216 | 3300009147 | Bacteria | 12774 |
| 436 | Ga0114129_10011456 | 3300009147 | Bacteria | 12627 |
| 437 | Ga0114129_10012186 | 3300009147 | Bacteria | 12232 |
| 438 | Ga0114129_10026763 | 3300009147 | Bacteria | 8169 |
| 439 | Ga0114129_10031611 | 3300009147 | Bacteria | 7482 |
| 440 | Ga0114129_10041559 | 3300009147 | Bacteria | 6478 |
| 441 | Ga0114129_10049194 | 3300009147 | Bacteria | 5924 |
| 442 | Ga0114129_10059337 | 3300009147 | Bacteria | 5349 |
| 443 | Ga0114129_10089245 | 3300009147 | Bacteria | 4273 |
| 444 | Ga0114129_10092082 | 3300009147 | Bacteria | 4200 |
| 445 | Ga0114129_10112040 | 3300009147 | Bacteria | 3763 |
| 446 | Ga0114129_10112106 | 3300009147 | Bacteria | 3762 |
| 447 | Ga0114129_10127269 | 3300009147 | Bacteria | 3501 |
| 448 | Ga0114129_10158620 | 3300009147 | Bacteria | 3093 |
| 449 | Ga0114129_10162870 | 3300009147 | Bacteria | 3045 |
| 450 | Ga0114129_10165922 | 3300009147 | Bacteria | 3014 |
| 451 | Ga0114129_10170137 | 3300009147 | Bacteria | 2971 |
| 452 | Ga0114129_10192551 | 3300009147 | Bacteria | 2768 |
| 453 | Ga0105243_10043894 | 3300009148 | Bacteria | 3505 |
| 454 | Ga0105243_10078705 | 3300009148 | Bacteria | 2685 |
| 455 | Ga0105241_10016909 | 3300009174 | Bacteria | 5354 |
| 456 | Ga0105241_10254853 | 3300009174 | Bacteria | 1489 |
| 457 | Ga0105242_10073243 | 3300009176 | Bacteria | 2847 |
| 458 | Ga0105248_10005501 | 3300009177 | Bacteria | 13908 |
| 459 | Ga0105248_10117609 | 3300009177 | Bacteria | 2998 |
| 460 | Ga0105248_10133873 | 3300009177 | Bacteria | 2797 |
| 461 | Ga0105248_10337789 | 3300009177 | Bacteria | 1696 |
| 462 | Ga0105248_10378267 | 3300009177 | Bacteria | 1594 |
| 463 | Ga0105237_10013789 | 3300009545 | Bacteria | 8461 |
| 464 | Ga0105237_10014620 | 3300009545 | Bacteria | 8200 |
| 465 | Ga0105237_10093214 | 3300009545 | Bacteria | 3001 |
| 466 | Ga0105237_10100105 | 3300009545 | Bacteria | 2890 |
| 467 | Ga0105238_10145339 | 3300009551 | Bacteria | 2348 |
| 468 | Ga0105238_10384429 | 3300009551 | Bacteria | 1395 |
| 469 | Ga0105249_10001777 | 3300009553 | Bacteria | 18790 |
| 470 | Ga0105249_10135988 | 3300009553 | Bacteria | 2352 |
| 471 | Ga0105239_10022197 | 3300010375 | Bacteria | 6996 |
| 472 | Ga0105239_10034375 | 3300010375 | Bacteria | 5566 |
| 473 | Ga0105239_10053529 | 3300010375 | Bacteria | 4427 |
| 474 | Ga0105239_10058807 | 3300010375 | Bacteria | 4218 |
| 475 | Ga0105239_10111312 | 3300010375 | Bacteria | 3035 |
| 476 | Ga0105246_10040304 | 3300011119 | Bacteria | 3151 |
| 477 | Ga0105246_10048875 | 3300011119 | Bacteria | 2893 |
| 478 | Ga0157373_10000574 | 3300013100 | Bacteria | 28681 |
| 479 | Ga0157373_10001127 | 3300013100 | Bacteria | 20527 |
| 480 | Ga0157371_10177010 | 3300013102 | Bacteria | 1525 |
| 481 | Ga0157369_10027066 | 3300013105 | Bacteria | 6358 |
| 482 | Ga0157369_10047099 | 3300013105 | Bacteria | 4683 |
| 483 | Ga0171462_1045 | 3300013250 | Bacteria | 50984 |
| 484 | Ga0157374_10146707 | 3300013296 | Bacteria | 2292 |
| 485 | Ga0157374_10278732 | 3300013296 | Bacteria | 1650 |
| 486 | Ga0157378_10037713 | 3300013297 | Bacteria | 4283 |
| 487 | Ga0157378_10042649 | 3300013297 | Bacteria | 4027 |
| 488 | Ga0157378_10166762 | 3300013297 | Bacteria | 2063 |
| 489 | Ga0157378_10210118 | 3300013297 | Bacteria | 1845 |
| 490 | Ga0163162_10139268 | 3300013306 | Bacteria | 2538 |
| 491 | Ga0163162_10485948 | 3300013306 | Bacteria | 1366 |
| 492 | Ga0157372_10001263 | 3300013307 | Bacteria | 27405 |
| 493 | Ga0157372_10191594 | 3300013307 | Bacteria | 2368 |
| 494 | Ga0157372_10234545 | 3300013307 | Bacteria | 2128 |
| 495 | Ga0157372_10457301 | 3300013307 | Bacteria | 1488 |
| 496 | Ga0157375_10004827 | 3300013308 | Bacteria | 11710 |
| 497 | Ga0157375_10038656 | 3300013308 | Bacteria | 4582 |
| 498 | Ga0157375_10119824 | 3300013308 | Bacteria | 2739 |
| 499 | Ga0163163_10031956 | 3300014325 | Bacteria | 5083 |
| 500 | Ga0163163_10046564 | 3300014325 | Bacteria | 4260 |
| 501 | Ga0163163_10059185 | 3300014325 | Bacteria | 3789 |
| 502 | Ga0163163_10134022 | 3300014325 | Bacteria | 2518 |
| 503 | Ga0163163_10260276 | 3300014325 | Bacteria | 1786 |
| 504 | Ga0157380_10077400 | 3300014326 | Bacteria | 2711 |
| 505 | Ga0157380_10168787 | 3300014326 | Bacteria | 1909 |
| 506 | Ga0157380_10324186 | 3300014326 | Bacteria | 1429 |
| 507 | Ga0182008_10058113 | 3300014497 | Bacteria | 1910 |
| 508 | Ga0157379_10007148 | 3300014968 | Bacteria | 9654 |
| 509 | Ga0157379_10059481 | 3300014968 | Bacteria | 3416 |
| 510 | Ga0157379_10108235 | 3300014968 | Bacteria | 2495 |
| 511 | Ga0157379_10116515 | 3300014968 | Bacteria | 2403 |
| 512 | Ga0157376_10029890 | 3300014969 | Bacteria | 4343 |
| 513 | Ga0157376_10050411 | 3300014969 | Bacteria | 3454 |
| 514 | Ga0157376_10097527 | 3300014969 | Bacteria | 2560 |
| 515 | Ga0157376_10137156 | 3300014969 | Bacteria | 2191 |
| 516 | Ga0157376_10162524 | 3300014969 | Bacteria | 2026 |
| 517 | Ga0182006_1003147 | 3300015261 | Bacteria | 8631 |
| 518 | Ga0182006_1052718 | 3300015261 | Bacteria | 1562 |
| 519 | Ga0163161_10007275 | 3300017792 | Bacteria | 7643 |
| 520 | Ga0163161_10074373 | 3300017792 | Bacteria | 2491 |
| 521 | Ga0206354_11288361 | 3300020081 | Bacteria | 1599 |
| 522 | Ga0214544_1009253 | 3300021320 | Bacteria | 15597 |
| 523 | Ga0214542_1000025 | 3300021321 | Bacteria | 183588 |
| 524 | Ga0214545_1000014 | 3300021324 | Bacteria | 183588 |
| 525 | Ga0214543_1000034 | 3300021327 | Bacteria | 183712 |
| 526 | Ga0213874_10021454 | 3300021377 | Bacteria | 1781 |
| 527 | Ga0213876_10000506 | 3300021384 | Bacteria | 30344 |
| 528 | Ga0209148_1000773 | 3300025254 | Bacteria | 23969 |
| 529 | Ga0209233_1016211 | 3300025261 | Bacteria | 2057 |
| 530 | Ga0209455_1002825 | 3300025272 | Bacteria | 6457 |
| 531 | Ga0209130_1000045 | 3300025284 | Bacteria | 240278 |
| 532 | Ga0209675_1002625 | 3300025291 | Bacteria | 9097 |
| 533 | Ga0209025_1000932 | 3300025294 | Bacteria | 44615 |
| 534 | Ga0209564_1000075 | 3300025295 | Bacteria | 285760 |
| 535 | Ga0209564_1015176 | 3300025295 | Bacteria | 3151 |
| 536 | Ga0209758_1000008 | 3300025297 | Bacteria | 1215263 |
| 537 | Ga0209758_1000097 | 3300025297 | Bacteria | 230529 |
| 538 | Ga0209758_1000141 | 3300025297 | Bacteria | 172481 |
| 539 | Ga0209758_1000282 | 3300025297 | Bacteria | 100746 |
| 540 | Ga0209758_1002234 | 3300025297 | Bacteria | 20121 |
| 541 | Ga0209758_1008672 | 3300025297 | Bacteria | 6524 |
| 542 | Ga0209758_1011027 | 3300025297 | Bacteria | 5297 |
| 543 | Ga0209758_1011485 | 3300025297 | Bacteria | 5120 |
| 544 | Ga0209758_1032875 | 3300025297 | Bacteria | 2096 |
| 545 | Ga0209256_1002013 | 3300025299 | Bacteria | 18122 |
| 546 | Ga0209256_1002896 | 3300025299 | Bacteria | 13002 |
| 547 | Ga0207426_1000437 | 3300025302 | Bacteria | 67439 |
| 548 | Ga0207426_1001098 | 3300025302 | Bacteria | 24902 |
| 549 | Ga0207426_1007699 | 3300025302 | Bacteria | 4472 |
| 550 | Ga0207426_1011889 | 3300025302 | Bacteria | 3294 |
| 551 | Ga0209257_1005807 | 3300025304 | Bacteria | 8390 |
| 552 | Ga0207656_10042682 | 3300025321 | Bacteria | 1931 |
| 553 | Ga0207653_10011710 | 3300025885 | Bacteria | 2736 |
| 554 | Ga0207682_10001931 | 3300025893 | Bacteria | 9419 |
| 555 | Ga0207682_10075047 | 3300025893 | Bacteria | 1439 |
| 556 | Ga0207682_10089740 | 3300025893 | Bacteria | 1331 |
| 557 | Ga0207692_10002216 | 3300025898 | Bacteria | 7439 |
| 558 | Ga0207692_10094978 | 3300025898 | Bacteria | 1625 |
| 559 | Ga0207692_10150500 | 3300025898 | Bacteria | 1332 |
| 560 | Ga0207642_10008904 | 3300025899 | Bacteria | 3468 |
| 561 | Ga0207710_10006353 | 3300025900 | Bacteria | 5050 |
| 562 | Ga0207710_10035654 | 3300025900 | Bacteria | 2189 |
| 563 | Ga0207688_10050613 | 3300025901 | Bacteria | 2326 |
| 564 | Ga0207688_10071745 | 3300025901 | Bacteria | 1966 |
| 565 | Ga0207680_10176934 | 3300025903 | Bacteria | 1440 |
| 566 | Ga0207647_10016240 | 3300025904 | Bacteria | 5083 |
| 567 | Ga0207699_10003729 | 3300025906 | Bacteria | 7278 |
| 568 | Ga0207699_10004469 | 3300025906 | Bacteria | 6685 |
| 569 | Ga0207645_10001315 | 3300025907 | Bacteria | 20396 |
| 570 | Ga0207645_10029667 | 3300025907 | Bacteria | 3525 |
| 571 | Ga0207643_10000406 | 3300025908 | Bacteria | 28650 |
| 572 | Ga0207643_10131529 | 3300025908 | Bacteria | 1489 |
| 573 | Ga0207643_10147531 | 3300025908 | Bacteria | 1408 |
| 574 | Ga0207684_10003897 | 3300025910 | Bacteria | 14303 |
| 575 | Ga0207684_10013583 | 3300025910 | Bacteria | 7038 |
| 576 | Ga0207684_10013914 | 3300025910 | Bacteria | 6950 |
| 577 | Ga0207684_10014077 | 3300025910 | Bacteria | 6907 |
| 578 | Ga0207684_10018456 | 3300025910 | Bacteria | 5973 |
| 579 | Ga0207684_10206094 | 3300025910 | Bacteria | 1696 |
| 580 | Ga0207654_10002995 | 3300025911 | Bacteria | 8570 |
| 581 | Ga0207654_10015208 | 3300025911 | Bacteria | 3989 |
| 582 | Ga0207654_10062338 | 3300025911 | Bacteria | 2184 |
| 583 | Ga0207707_10000019 | 3300025912 | Bacteria | 206008 |
| 584 | Ga0207707_10035607 | 3300025912 | Bacteria | 4352 |
| 585 | Ga0207707_10153908 | 3300025912 | Bacteria | 2010 |
| 586 | Ga0207695_10000062 | 3300025913 | Bacteria | 351979 |
| 587 | Ga0207671_10000377 | 3300025914 | Bacteria | 63306 |
| 588 | Ga0207671_10183332 | 3300025914 | Bacteria | 1630 |
| 589 | Ga0207671_10190855 | 3300025914 | Bacteria | 1598 |
| 590 | Ga0207693_10015868 | 3300025915 | Bacteria | 6032 |
| 591 | Ga0207693_10021206 | 3300025915 | Bacteria | 5164 |
| 592 | Ga0207693_10054379 | 3300025915 | Bacteria | 3140 |
| 593 | Ga0207693_10107453 | 3300025915 | Bacteria | 2189 |
| 594 | Ga0207693_10144864 | 3300025915 | Bacteria | 1868 |
| 595 | Ga0207663_10013985 | 3300025916 | Bacteria | 4380 |
| 596 | Ga0207663_10061402 | 3300025916 | Bacteria | 2385 |
| 597 | Ga0207663_10074820 | 3300025916 | Bacteria | 2196 |
| 598 | Ga0207663_10100153 | 3300025916 | Bacteria | 1944 |
| 599 | Ga0207660_10015260 | 3300025917 | Bacteria | 5069 |
| 600 | Ga0207660_10019690 | 3300025917 | Bacteria | 4516 |
| 601 | Ga0207660_10129316 | 3300025917 | Bacteria | 1921 |
| 602 | Ga0207660_10216768 | 3300025917 | Bacteria | 1500 |
| 603 | Ga0207657_10000158 | 3300025919 | Bacteria | 69402 |
| 604 | Ga0207657_10059953 | 3300025919 | Bacteria | 3267 |
| 605 | Ga0207646_10002726 | 3300025922 | Bacteria | 20668 |
| 606 | Ga0207646_10008458 | 3300025922 | Bacteria | 10310 |
| 607 | Ga0207646_10010701 | 3300025922 | Bacteria | 8930 |
| 608 | Ga0207646_10080974 | 3300025922 | Bacteria | 2903 |
| 609 | Ga0207646_10082733 | 3300025922 | Bacteria | 2871 |
| 610 | Ga0207646_10084375 | 3300025922 | Bacteria | 2842 |
| 611 | Ga0207646_10212343 | 3300025922 | Bacteria | 1748 |
| 612 | Ga0207681_10003707 | 3300025923 | Bacteria | 9494 |
| 613 | Ga0207681_10015896 | 3300025923 | Bacteria | 4698 |
| 614 | Ga0207681_10107478 | 3300025923 | Bacteria | 2024 |
| 615 | Ga0207681_10212400 | 3300025923 | Bacteria | 1492 |
| 616 | Ga0207650_10001113 | 3300025925 | Bacteria | 19790 |
| 617 | Ga0207650_10002324 | 3300025925 | Bacteria | 13252 |
| 618 | Ga0207650_10029534 | 3300025925 | Bacteria | 3942 |
| 619 | Ga0207650_10031535 | 3300025925 | Bacteria | 3828 |
| 620 | Ga0207650_10069187 | 3300025925 | Bacteria | 2652 |
| 621 | Ga0207659_10000549 | 3300025926 | Bacteria | 22440 |
| 622 | Ga0207659_10005606 | 3300025926 | Bacteria | 7625 |
| 623 | Ga0207659_10030802 | 3300025926 | Unclassified | 3668 |
| 624 | Ga0207659_10191549 | 3300025926 | Bacteria | 1628 |
| 625 | Ga0207659_10210920 | 3300025926 | Bacteria | 1556 |
| 626 | Ga0207687_10014320 | 3300025927 | Bacteria | 5189 |
| 627 | Ga0207700_10014243 | 3300025928 | Bacteria | 5204 |
| 628 | Ga0207700_10042768 | 3300025928 | Bacteria | 3324 |
| 629 | Ga0207700_10065940 | 3300025928 | Bacteria | 2765 |
| 630 | Ga0207700_10250871 | 3300025928 | Bacteria | 1512 |
| 631 | Ga0207664_10044247 | 3300025929 | Bacteria | 3486 |
| 632 | Ga0207664_10096840 | 3300025929 | Bacteria | 2430 |
| 633 | Ga0207664_10191753 | 3300025929 | Bacteria | 1760 |
| 634 | Ga0207644_10010696 | 3300025931 | Bacteria | 6050 |
| 635 | Ga0207644_10013517 | 3300025931 | Bacteria | 5445 |
| 636 | Ga0207644_10112314 | 3300025931 | Bacteria | 2062 |
| 637 | Ga0207644_10164529 | 3300025931 | Bacteria | 1727 |
| 638 | Ga0207690_10003241 | 3300025932 | Bacteria | 9763 |
| 639 | Ga0207690_10200963 | 3300025932 | Bacteria | 1514 |
| 640 | Ga0207706_10065945 | 3300025933 | Bacteria | 3187 |
| 641 | Ga0207706_10085144 | 3300025933 | Bacteria | 2779 |
| 642 | Ga0207706_10148443 | 3300025933 | Bacteria | 2062 |
| 643 | Ga0207686_10031590 | 3300025934 | Bacteria | 3145 |
| 644 | Ga0207709_10013330 | 3300025935 | Bacteria | 4536 |
| 645 | Ga0207709_10016421 | 3300025935 | Bacteria | 4115 |
| 646 | Ga0207709_10026693 | 3300025935 | Bacteria | 3319 |
| 647 | Ga0207709_10099724 | 3300025935 | Bacteria | 1917 |
| 648 | Ga0207670_10090939 | 3300025936 | Bacteria | 2157 |
| 649 | Ga0207669_10002598 | 3300025937 | Bacteria | 7722 |
| 650 | Ga0207669_10016318 | 3300025937 | Bacteria | 3770 |
| 651 | Ga0207669_10050029 | 3300025937 | Bacteria | 2495 |
| 652 | Ga0207704_10024707 | 3300025938 | Bacteria | 3264 |
| 653 | Ga0207704_10101860 | 3300025938 | Bacteria | 1916 |
| 654 | Ga0207704_10164905 | 3300025938 | Bacteria | 1581 |
| 655 | Ga0207665_10001763 | 3300025939 | Bacteria | 14531 |
| 656 | Ga0207691_10000754 | 3300025940 | Bacteria | 31954 |
| 657 | Ga0207691_10002193 | 3300025940 | Bacteria | 19089 |
| 658 | Ga0207691_10002935 | 3300025940 | Bacteria | 16639 |
| 659 | Ga0207691_10004947 | 3300025940 | Bacteria | 12853 |
| 660 | Ga0207691_10011314 | 3300025940 | Bacteria | 8561 |
| 661 | Ga0207691_10013516 | 3300025940 | Bacteria | 7808 |
| 662 | Ga0207691_10087034 | 3300025940 | Bacteria | 2803 |
| 663 | Ga0207711_10020135 | 3300025941 | Bacteria | 5559 |
| 664 | Ga0207711_10085982 | 3300025941 | Bacteria | 2756 |
| 665 | Ga0207711_10096173 | 3300025941 | Bacteria | 2613 |
| 666 | Ga0207711_10262211 | 3300025941 | Bacteria | 1588 |
| 667 | Ga0207711_10302697 | 3300025941 | Bacteria | 1475 |
| 668 | Ga0207689_10001549 | 3300025942 | Bacteria | 21793 |
| 669 | Ga0207689_10008662 | 3300025942 | Bacteria | 8857 |
| 670 | Ga0207689_10016340 | 3300025942 | Bacteria | 6287 |
| 671 | Ga0207689_10025703 | 3300025942 | Bacteria | 4933 |
| 672 | Ga0207689_10036764 | 3300025942 | Bacteria | 4064 |
| 673 | Ga0207689_10126547 | 3300025942 | Bacteria | 2102 |
| 674 | Ga0207661_10002131 | 3300025944 | Bacteria | 13613 |
| 675 | Ga0207661_10024499 | 3300025944 | Bacteria | 4574 |
| 676 | Ga0207661_10038507 | 3300025944 | Bacteria | 3748 |
| 677 | Ga0207661_10066742 | 3300025944 | Bacteria | 2923 |
| 678 | Ga0207679_10002969 | 3300025945 | Bacteria | 10516 |
| 679 | Ga0207679_10006070 | 3300025945 | Bacteria | 7617 |
| 680 | Ga0207679_10024614 | 3300025945 | Bacteria | 4129 |
| 681 | Ga0207679_10059593 | 3300025945 | Bacteria | 2833 |
| 682 | Ga0207679_10068402 | 3300025945 | Bacteria | 2668 |
| 683 | Ga0207679_10080426 | 3300025945 | Bacteria | 2488 |
| 684 | Ga0207667_10017801 | 3300025949 | Bacteria | 7989 |
| 685 | Ga0207651_10000137 | 3300025960 | Bacteria | 31859 |
| 686 | Ga0207651_10004004 | 3300025960 | Bacteria | 7328 |
| 687 | Ga0207651_10004657 | 3300025960 | Bacteria | 6951 |
| 688 | Ga0207651_10023383 | 3300025960 | Bacteria | 3800 |
| 689 | Ga0207668_10188325 | 3300025972 | Bacteria | 1633 |
| 690 | Ga0207640_10117890 | 3300025981 | Bacteria | 1895 |
| 691 | Ga0207658_10099850 | 3300025986 | Bacteria | 2271 |
| 692 | Ga0207658_10165305 | 3300025986 | Bacteria | 1817 |
| 693 | Ga0207677_10043429 | 3300026023 | Bacteria | 2988 |
| 694 | Ga0207677_10143685 | 3300026023 | Bacteria | 1831 |
| 695 | Ga0207703_10007069 | 3300026035 | Bacteria | 8930 |
| 696 | Ga0207703_10012711 | 3300026035 | Bacteria | 6564 |
| 697 | Ga0207703_10069954 | 3300026035 | Bacteria | 2896 |
| 698 | Ga0207703_10113714 | 3300026035 | Bacteria | 2314 |
| 699 | Ga0207703_10214969 | 3300026035 | Bacteria | 1716 |
| 700 | Ga0207639_10032270 | 3300026041 | Bacteria | 3854 |
| 701 | Ga0207639_10045461 | 3300026041 | Bacteria | 3307 |
| 702 | Ga0207639_10072221 | 3300026041 | Bacteria | 2701 |
| 703 | Ga0207639_10188550 | 3300026041 | Bacteria | 1760 |
| 704 | Ga0207678_10001746 | 3300026067 | Bacteria | 19901 |
| 705 | Ga0207678_10002804 | 3300026067 | Bacteria | 15808 |
| 706 | Ga0207678_10021209 | 3300026067 | Bacteria | 5695 |
| 707 | Ga0207678_10037986 | 3300026067 | Bacteria | 4187 |
| 708 | Ga0207678_10056027 | 3300026067 | Bacteria | 3395 |
| 709 | Ga0207678_10074754 | 3300026067 | Bacteria | 2903 |
| 710 | Ga0207708_10006345 | 3300026075 | Bacteria | 8766 |
| 711 | Ga0207708_10043006 | 3300026075 | Bacteria | 3442 |
| 712 | Ga0207708_10066326 | 3300026075 | Bacteria | 2760 |
| 713 | Ga0207708_10167787 | 3300026075 | Bacteria | 1736 |
| 714 | Ga0207702_10004617 | 3300026078 | Bacteria | 12203 |
| 715 | Ga0207702_10050904 | 3300026078 | Bacteria | 3498 |
| 716 | Ga0207702_10139495 | 3300026078 | Bacteria | 2192 |
| 717 | Ga0207641_10037894 | 3300026088 | Bacteria | 4029 |
| 718 | Ga0207641_10092305 | 3300026088 | Bacteria | 2651 |
| 719 | Ga0207641_10346482 | 3300026088 | Bacteria | 1415 |
| 720 | Ga0207648_10001985 | 3300026089 | Bacteria | 22355 |
| 721 | Ga0207648_10008746 | 3300026089 | Bacteria | 9758 |
| 722 | Ga0207648_10010726 | 3300026089 | Bacteria | 8662 |
| 723 | Ga0207648_10020630 | 3300026089 | Bacteria | 5932 |
| 724 | Ga0207648_10030334 | 3300026089 | Bacteria | 4790 |
| 725 | Ga0207648_10042949 | 3300026089 | Bacteria | 3970 |
| 726 | Ga0207648_10047260 | 3300026089 | Bacteria | 3773 |
| 727 | Ga0207648_10066575 | 3300026089 | Bacteria | 3142 |
| 728 | Ga0207648_10127698 | 3300026089 | Bacteria | 2237 |
| 729 | Ga0207648_10232700 | 3300026089 | Bacteria | 1639 |
| 730 | Ga0207676_10006758 | 3300026095 | Bacteria | 8119 |
| 731 | Ga0207676_10063032 | 3300026095 | Bacteria | 2943 |
| 732 | Ga0207676_10092985 | 3300026095 | Bacteria | 2481 |
| 733 | Ga0207676_10104213 | 3300026095 | Bacteria | 2359 |
| 734 | Ga0207674_10002036 | 3300026116 | Bacteria | 25652 |
| 735 | Ga0207674_10004850 | 3300026116 | Bacteria | 16107 |
| 736 | Ga0207675_100006420 | 3300026118 | Bacteria | 11134 |
| 737 | Ga0207675_100022055 | 3300026118 | Bacteria | 5928 |
| 738 | Ga0207683_10001853 | 3300026121 | Bacteria | 18701 |
| 739 | Ga0207683_10004778 | 3300026121 | Bacteria | 11660 |
| 740 | Ga0207683_10005724 | 3300026121 | Bacteria | 10662 |
| 741 | Ga0207683_10007680 | 3300026121 | Bacteria | 9233 |
| 742 | Ga0207683_10108631 | 3300026121 | Bacteria | 2482 |
| 743 | Ga0207698_10019740 | 3300026142 | Bacteria | 4621 |
| 744 | Ga0207698_10060913 | 3300026142 | Bacteria | 2937 |
| 745 | Ga0207698_10084300 | 3300026142 | Bacteria | 2576 |
| 746 | Ga0207698_10128163 | 3300026142 | Bacteria | 2163 |
| 747 | Ga0209389_1000004 | 3300027296 | Bacteria | 263759 |
| 748 | Ga0209589_1000002 | 3300027357 | Bacteria | 708598 |
| 749 | Ga0209489_100002 | 3300027361 | Bacteria | 708609 |
| 750 | Ga0209489_100777 | 3300027361 | Bacteria | 63061 |
| 751 | Ga0209700_100002 | 3300027363 | Bacteria | 708598 |
| 752 | Ga0209700_100013 | 3300027363 | Bacteria | 341906 |
| 753 | Ga0209968_1001306 | 3300027526 | Bacteria | 3804 |
| 754 | Ga0209999_1001517 | 3300027543 | Bacteria | 4002 |
| 755 | Ga0209983_1000879 | 3300027665 | Bacteria | 6625 |
| 756 | Ga0209588_1052615 | 3300027671 | Bacteria | 1317 |
| 757 | Ga0209971_1000005 | 3300027682 | Bacteria | 108671 |
| 758 | Ga0209966_1000010 | 3300027695 | Bacteria | 86172 |
| 759 | Ga0209966_1022387 | 3300027695 | Bacteria | 1235 |
| 760 | Ga0209998_10000729 | 3300027717 | Bacteria | 8650 |
| 761 | Ga0209974_10019491 | 3300027876 | Bacteria | 2249 |
| 762 | Ga0207428_10000503 | 3300027907 | Bacteria | 46699 |
| 763 | Ga0207428_10000526 | 3300027907 | Bacteria | 45700 |
| 764 | Ga0207428_10008432 | 3300027907 | Bacteria | 9304 |
| 765 | Ga0207428_10009239 | 3300027907 | Bacteria | 8853 |
| 766 | Ga0207428_10020041 | 3300027907 | Bacteria | 5691 |
| 767 | Ga0207428_10028626 | 3300027907 | Bacteria | 4627 |
| 768 | Ga0207428_10054947 | 3300027907 | Bacteria | 3168 |
| 769 | Ga0268266_10004621 | 3300028379 | Bacteria | 13133 |
| 770 | Ga0268266_10009307 | 3300028379 | Bacteria | 8664 |
| 771 | Ga0268266_10009873 | 3300028379 | Bacteria | 8391 |
| 772 | Ga0268266_10027379 | 3300028379 | Bacteria | 4847 |
| 773 | Ga0268266_10035847 | 3300028379 | Bacteria | 4219 |
| 774 | Ga0268266_10073968 | 3300028379 | Bacteria | 2958 |
| 775 | Ga0268266_10142020 | 3300028379 | Bacteria | 2155 |
| 776 | Ga0268266_10276123 | 3300028379 | Bacteria | 1561 |
| 777 | Ga0268265_10006468 | 3300028380 | Bacteria | 7942 |
| 778 | Ga0268265_10015922 | 3300028380 | Bacteria | 5157 |
| 779 | Ga0268265_10030405 | 3300028380 | Bacteria | 3889 |
| 780 | Ga0268265_10031131 | 3300028380 | Bacteria | 3851 |
| 781 | Ga0268265_10032954 | 3300028380 | Bacteria | 3761 |
| 782 | Ga0268265_10056453 | 3300028380 | Bacteria | 2987 |
| 783 | Ga0268265_10142675 | 3300028380 | Bacteria | 2007 |
| 784 | Ga0268265_10284337 | 3300028380 | Bacteria | 1481 |
| 785 | Ga0268264_10000042 | 3300028381 | Bacteria | 372069 |
| 786 | Ga0268264_10028575 | 3300028381 | Bacteria | 4562 |
| 787 | Ga0268264_10083907 | 3300028381 | Bacteria | 2730 |
| 788 | Ga0268264_10144047 | 3300028381 | Bacteria | 2128 |
| 789 | Ga0268264_10146314 | 3300028381 | Bacteria | 2113 |
| 790 | Ga0265319_1005086 | 3300028563 | Bacteria | 6384 |
| 791 | Ga0265334_10053462 | 3300028573 | Bacteria | 1542 |
| 792 | Ga0265318_10019017 | 3300028577 | Bacteria | 2792 |
| 793 | Ga0307517_10061999 | 3300028786 | Bacteria | 3526 |
| 794 | Ga0307515_10000034 | 3300028794 | Bacteria | 344640 |
| 795 | Ga0307515_10000043 | 3300028794 | Bacteria | 304612 |
| 796 | Ga0307515_10000658 | 3300028794 | Bacteria | 79766 |
| 797 | Ga0307515_10003847 | 3300028794 | Bacteria | 31390 |
| 798 | Ga0307515_10007630 | 3300028794 | Bacteria | 21340 |
| 799 | Ga0307515_10007679 | 3300028794 | Bacteria | 21251 |
| 800 | Ga0307515_10050509 | 3300028794 | Bacteria | 6225 |
| 801 | Ga0307515_10148183 | 3300028794 | Bacteria | 2471 |
| 802 | Ga0265338_10055019 | 3300028800 | Bacteria | 3543 |
| 803 | Ga0307511_10101318 | 3300030521 | Bacteria | 1889 |
| 804 | Ga0307512_10027620 | 3300030522 | Bacteria | 4990 |
| 805 | Ga0316176_1196748 | 3300030732 | Bacteria | 1758 |
| 806 | Ga0314311_1081389 | 3300030733 | Bacteria | 3793 |
| 807 | Ga0316181_1168214 | 3300030744 | Bacteria | 3759 |
| 808 | Ga0316182_1029803 | 3300030745 | Bacteria | 3739 |
| 809 | Ga0316182_1254532 | 3300030745 | Bacteria | 3386 |
| 810 | Ga0265330_10059230 | 3300031235 | Bacteria | 1668 |
| 811 | Ga0265332_10049273 | 3300031238 | Bacteria | 1811 |
| 812 | Ga0265325_10003069 | 3300031241 | Bacteria | 11034 |
| 813 | Ga0265325_10028296 | 3300031241 | Bacteria | 3022 |
| 814 | Ga0265325_10028299 | 3300031241 | Bacteria | 3022 |
| 815 | Ga0265329_10016424 | 3300031242 | Bacteria | 2564 |
| 816 | Ga0265339_10056436 | 3300031249 | Bacteria | 2127 |
| 817 | Ga0265331_10025045 | 3300031250 | Bacteria | 3013 |
| 818 | Ga0265316_10049711 | 3300031344 | Bacteria | 3301 |
| 819 | Ga0307513_10009436 | 3300031456 | Bacteria | 12342 |
| 820 | Ga0307513_10191686 | 3300031456 | Bacteria | 1895 |
| 821 | Ga0307509_10024775 | 3300031507 | Bacteria | 6714 |
| 822 | Ga0307408_100017573 | 3300031548 | Bacteria | 4788 |
| 823 | Ga0307408_100076577 | 3300031548 | Bacteria | 2489 |
| 824 | Ga0265313_10001744 | 3300031595 | Bacteria | 19971 |
| 825 | Ga0265313_10019983 | 3300031595 | Bacteria | 3709 |
| 826 | Ga0307508_10000029 | 3300031616 | Bacteria | 168411 |
| 827 | Ga0307508_10000254 | 3300031616 | Bacteria | 65091 |
| 828 | Ga0307508_10027341 | 3300031616 | Bacteria | 5164 |
| 829 | Ga0307508_10036036 | 3300031616 | Bacteria | 4456 |
| 830 | Ga0307514_10046015 | 3300031649 | Bacteria | 3410 |
| 831 | Ga0265314_10019737 | 3300031711 | Bacteria | 5214 |
| 832 | Ga0265342_10008945 | 3300031712 | Bacteria | 7113 |
| 833 | Ga0265342_10065595 | 3300031712 | Bacteria | 2127 |
| 834 | Ga0307516_10001248 | 3300031730 | Bacteria | 35383 |
| 835 | Ga0307516_10011266 | 3300031730 | Bacteria | 9744 |
| 836 | Ga0307516_10026325 | 3300031730 | Bacteria | 5908 |
| 837 | Ga0307516_10032423 | 3300031730 | Bacteria | 5262 |
| 838 | Ga0307516_10056391 | 3300031730 | Bacteria | 3831 |
| 839 | Ga0307516_10061322 | 3300031730 | Bacteria | 3649 |
| 840 | Ga0307516_10093389 | 3300031730 | Bacteria | 2834 |
| 841 | Ga0307405_10024902 | 3300031731 | Bacteria | 3427 |
| 842 | Ga0307410_10135643 | 3300031852 | Bacteria | 1814 |
| 843 | Ga0307410_10200494 | 3300031852 | Bacteria | 1523 |
| 844 | Ga0307406_10000237 | 3300031901 | Bacteria | 33519 |
| 845 | Ga0307406_10178370 | 3300031901 | Bacteria | 1544 |
| 846 | Ga0307416_100004867 | 3300032002 | Bacteria | 8175 |
| 847 | Ga0307416_100056947 | 3300032002 | Bacteria | 3158 |
| 848 | Ga0307416_100086696 | 3300032002 | Bacteria | 2670 |
| 849 | Ga0307414_10035490 | 3300032004 | Bacteria | 3319 |
| 850 | Ga0307415_100083837 | 3300032126 | Bacteria | 2285 |
| 851 | Ga0307507_10024242 | 3300033179 | Bacteria | 6622 |
| 852 | Ga0307507_10052067 | 3300033179 | Bacteria | 3932 |
| 853 | Ga0307510_10016828 | 3300033180 | Bacteria | 8627 |
| 854 | Ga0307510_10057391 | 3300033180 | Bacteria | 4041 |
| 855 | Ga0307510_10076408 | 3300033180 | Bacteria | 3295 |
| 856 | Ga0315911_1000004 | 3300033442 | Bacteria | 472637 |
| 857 | Ga0316215_1000806 | 3300033544 | Bacteria | 3154 |
| 858 | Ga0373958_0016674 | 3300034819 | Bacteria | 1312 |
| 859 | Ga0373928_0002368 | 3300035084 | Bacteria | 3662 |
| 860 | Ga0373940_0007439 | 3300035088 | Bacteria | 2473 |
| 861 | Ga0373940_0015176 | 3300035088 | Bacteria | 1891 |
| 862 | Ga0373944_0022195 | 3300035089 | Bacteria | 1843 |
| 863 | Ga0373951_0023048 | 3300035091 | Bacteria | 1436 |
| 864 | Ga0373951_0027357 | 3300035091 | Bacteria | 1331 |
| 865 | Ga0373932_0003971 | 3300035112 | Bacteria | 3523 |
| 866 | Ga0373936_0039328 | 3300035113 | Bacteria | 1892 |
| 867 | Ga0373939_0016010 | 3300035114 | Bacteria | 1971 |
| 868 | Ga0373941_0013234 | 3300035115 | Bacteria | 2176 |
| 869 | Ga0373945_0044148 | 3300035116 | Bacteria | 1620 |
| 870 | Ga0373954_0027979 | 3300035118 | Bacteria | 2590 |
| 871 | Ga0373960_0008472 | 3300035121 | Bacteria | 2465 |
| 872 | Ga0373943_0004760 | 3300035170 | Bacteria | 6139 |
| 873 | Ga0373943_0029106 | 3300035170 | Bacteria | 2608 |
| 874 | Ga0373943_0107525 | 3300035170 | Unclassified | 1467 |
| 875 | Ga0373946_0012322 | 3300035171 | Bacteria | 3198 |
| 876 | Ga0373946_0017680 | 3300035171 | Bacteria | 2731 |
| 877 | Ga0373955_0008914 | 3300035172 | Bacteria | 4678 |
| 878 | Ga0373955_0049971 | 3300035172 | Bacteria | 2272 |
| 879 | Ga0373961_0002541 | 3300035241 | Bacteria | 4705 |
| 880 | Ga0373961_0016865 | 3300035241 | Bacteria | 1886 |
| 881 | Ga0373924_0021101 | 3300035410 | Bacteria | 2539 |
| 882 | Ga0373924_0074369 | 3300035410 | Bacteria | 1437 |
| 883 | Ga0373924_0080923 | 3300035410 | Bacteria | 1381 |
| 884 | Ga0373931_0001091 | 3300035691 | Bacteria | 11503 |
| 885 | Ga0373931_0092916 | 3300035691 | Bacteria | 1684 |
| 886 | Ga0373935_0004029 | 3300035692 | Bacteria | 8588 |
| 887 | Ga0373935_0028466 | 3300035692 | Bacteria | 3454 |
| 888 | Ga0373935_0062673 | 3300035692 | Bacteria | 2382 |
| 889 | Ga0373935_0160183 | 3300035692 | Bacteria | 1533 |
| 890 | Ga0373927_0001617 | 3300035695 | Bacteria | 16890 |
| 891 | Ga0373927_0009798 | 3300035695 | Bacteria | 6425 |
| 892 | Ga0373927_0013714 | 3300035695 | Bacteria | 5381 |
| 893 | Ga0373927_0017298 | 3300035695 | Bacteria | 4746 |
| 894 | Ga0373927_0075038 | 3300035695 | Bacteria | 2189 |
| 895 | Ga0373927_0113251 | 3300035695 | Bacteria | 1768 |
| 896 | Ga0373927_0183081 | 3300035695 | Bacteria | 1374 |
| 897 | Ga0373933_0042619 | 3300035724 | Bacteria | 2683 |
| 898 | Ga0373947_0004404 | 3300035725 | Bacteria | 8259 |
| 899 | Ga0373947_0041394 | 3300035725 | Bacteria | 2747 |
| 900 | Ga0373947_0093017 | 3300035725 | Bacteria | 1884 |
| 901 | Ga0373947_0111534 | 3300035725 | Bacteria | 1729 |
| 902 | Ga0373947_0129524 | 3300035725 | Bacteria | 1609 |
| 903 | Ga0373937_0081009 | 3300036401 | Bacteria | 3003 |
| 904 | Ga0373937_0154375 | 3300036401 | Bacteria | 2151 |
| 905 | Ga0373937_0197618 | 3300036401 | Bacteria | 1890 |
| 906 | Ga0373937_0270565 | 3300036401 | Bacteria | 1603 |
| 907 | Ga0373925_0002598 | 3300037068 | Bacteria | 14354 |
| 908 | Ga0373925_0008312 | 3300037068 | Bacteria | 7556 |
| 909 | Ga0373925_0011431 | 3300037068 | Bacteria | 6429 |
| 910 | Ga0373925_0016597 | 3300037068 | Bacteria | 5334 |
| 911 | Ga0373925_0022159 | 3300037068 | Bacteria | 4632 |
| 912 | Ga0373925_0082144 | 3300037068 | Bacteria | 2451 |
| 913 | Ga0395900_0001273 | 3300037418 | Bacteria | 30829 |
| 914 | Ga0395900_0029419 | 3300037418 | Bacteria | 5635 |
| 915 | Ga0395900_0078677 | 3300037418 | Bacteria | 3388 |
| 916 | Ga0395898_0011222 | 3300037466 | Bacteria | 9326 |
| 917 | Ga0395898_0122261 | 3300037466 | Bacteria | 2494 |
| 918 | Ga0395905_0010802 | 3300037471 | Bacteria | 8847 |
| 919 | Ga0395905_0011753 | 3300037471 | Bacteria | 8452 |
| 920 | Ga0395901_0000813 | 3300038443 | Bacteria | 34571 |
| 921 | Ga0395901_0002416 | 3300038443 | Bacteria | 18962 |
| 922 | Ga0395901_0017486 | 3300038443 | Bacteria | 7318 |
| 923 | Ga0436365_0399885 | 3300039437 | Bacteria | 5357 |
| 924 | Ga0436365_0685473 | 3300039437 | Bacteria | 1831 |
| 925 | Ga0436365_0966736 | 3300039437 | Bacteria | 2106 |
| 926 | Ga0436365_1091064 | 3300039437 | Bacteria | 30337 |
| 927 | Ga0436360_0603982 | 3300039438 | Bacteria | 1984 |
| 928 | Ga0436361_0014467 | 3300039447 | Bacteria | 5498 |
| 929 | Ga0436363_1558913 | 3300039450 | Bacteria | 3651 |
| 930 | Ga0436362_0827926 | 3300039453 | Bacteria | 4231 |
| 931 | Ga0439447_015027 | 3300041407 | Bacteria | 2157 |
| 932 | Ga0439453_0013066 | 3300041408 | Bacteria | 1407 |
| 933 | Ga0439465_0024030 | 3300041413 | Bacteria | 1919 |
| 934 | Ga0451807_1880289 | 3300041486 | Bacteria | 3052 |
| 935 | Ga0451853_4010219 | 3300041512 | Bacteria | 1357 |
| 936 | Ga0439433_0007202 | 3300041999 | Bacteria | 2401 |
| 937 | Ga0439448_0017984 | 3300042005 | Bacteria | 2161 |
| 938 | Ga0439449_0005236 | 3300042007 | Bacteria | 4976 |
| 939 | Ga0439457_018810 | 3300042014 | Bacteria | 1535 |
| 940 | Ga0439458_0024943 | 3300042157 | Bacteria | 1400 |
| 941 | Ga0439434_0003597 | 3300042435 | Bacteria | 4526 |
| 942 | Ga0439435_0001533 | 3300042436 | Bacteria | 4309 |
| 943 | Ga0439435_0022258 | 3300042436 | Bacteria | 1653 |
| 944 | Ga0439459_0008511 | 3300042438 | Bacteria | 1755 |
| 945 | Ga0439464_0002353 | 3300042439 | Bacteria | 4644 |
| 946 | Ga0439460_0000381 | 3300042461 | Bacteria | 9443 |
| 947 | Ga0451577_0001628 | 3300042876 | Bacteria | 29133 |
| 948 | Ga0451577_0023399 | 3300042876 | Bacteria | 5634 |
| 949 | Ga0451577_0034628 | 3300042876 | Bacteria | 4550 |
| 950 | Ga0466972_0000079 | 3300044658 | Bacteria | 90348 |
| 951 | Ga0466972_0004328 | 3300044658 | Bacteria | 7093 |
| 952 | Ga0466972_0062953 | 3300044658 | Bacteria | 1777 |
| 953 | Ga0453683_0006780 | 3300044673 | Bacteria | 7822 |
| 954 | Ga0453683_0015117 | 3300044673 | Bacteria | 5010 |
| 955 | Ga0453683_0091854 | 3300044673 | Bacteria | 1903 |
| 956 | Ga0466966_0001208 | 3300044684 | Bacteria | 16568 |
| 957 | Ga0466961_0000020 | 3300044693 | Bacteria | 107610 |
| 958 | Ga0466963_0028383 | 3300044694 | Bacteria | 3592 |
| 959 | Ga0466963_0047564 | 3300044694 | Bacteria | 2831 |
| 960 | Ga0466964_0023432 | 3300044706 | Bacteria | 2400 |
| 961 | Ga0453684_0117634 | 3300044712 | Bacteria | 3216 |
| 962 | Ga0453684_0124488 | 3300044712 | Bacteria | 3105 |
| 963 | Ga0466968_0001947 | 3300044735 | Bacteria | 7490 |
| 964 | Ga0466957_0040886 | 3300044842 | Bacteria | 2802 |
| 965 | Ga0466957_0118930 | 3300044842 | Bacteria | 1683 |
| 966 | Ga0466960_0000424 | 3300044901 | Bacteria | 14510 |
| 967 | Ga0451576_0042039 | 3300045051 | Bacteria | 4826 |
| 968 | Ga0451576_0049108 | 3300045051 | Bacteria | 4428 |
| 969 | Ga0451576_0053448 | 3300045051 | Bacteria | 4231 |
| 970 | Ga0451576_0106958 | 3300045051 | Bacteria | 2910 |
| 971 | Ga0451576_0120908 | 3300045051 | Bacteria | 2726 |
| 972 | Ga0451576_0134449 | 3300045051 | Bacteria | 2578 |
| 973 | Ga0451576_0198840 | 3300045051 | Bacteria | 2093 |
| 974 | Ga0451576_0335142 | 3300045051 | Bacteria | 1583 |
| 975 | Ga0466967_0053468 | 3300045976 | Bacteria | 3549 |
| 976 | Ga0466967_0054863 | 3300045976 | Bacteria | 3509 |
| 977 | Ga0466967_0118266 | 3300045976 | Bacteria | 2444 |
| 978 | Ga0495603_0000660 | 3300046455 | Bacteria | 19483 |
| 979 | Ga0495603_0033928 | 3300046455 | Bacteria | 3070 |
| 980 | Ga0495603_0044317 | 3300046455 | Bacteria | 2654 |
| 981 | Ga0495603_0063873 | 3300046455 | Bacteria | 2171 |
| 982 | Ga0495629_0000467 | 3300046459 | Bacteria | 33859 |
| 983 | Ga0495629_0006153 | 3300046459 | Bacteria | 8909 |
| 984 | Ga0495629_0008755 | 3300046459 | Bacteria | 7441 |
| 985 | Ga0495638_0007605 | 3300046460 | Bacteria | 7750 |
| 986 | Ga0495650_0025999 | 3300046471 | Bacteria | 2732 |
| 987 | Ga0495580_0001503 | 3300046472 | Bacteria | 20499 |
| 988 | Ga0495580_0001799 | 3300046472 | Bacteria | 18843 |
| 989 | Ga0495580_0003523 | 3300046472 | Bacteria | 13298 |
| 990 | Ga0495580_0003995 | 3300046472 | Bacteria | 12443 |
| 991 | Ga0495580_0148736 | 3300046472 | Bacteria | 1623 |
| 992 | Ga0495582_0000163 | 3300046473 | Bacteria | 35979 |
| 993 | Ga0495582_0087857 | 3300046473 | Bacteria | 1731 |
| 994 | Ga0495639_0000640 | 3300046475 | Bacteria | 16156 |
| 995 | Ga0495662_0000890 | 3300046476 | Bacteria | 14606 |
| 996 | Ga0495664_0006716 | 3300046477 | Bacteria | 6363 |
| 997 | Ga0495664_0008332 | 3300046477 | Bacteria | 5781 |
| 998 | Ga0495664_0018995 | 3300046477 | Bacteria | 3947 |
| 999 | Ga0495594_0001989 | 3300046499 | Bacteria | 10649 |
| 1000 | Ga0495594_0019812 | 3300046499 | Bacteria | 3578 |
| 1001 | Ga0495594_0052058 | 3300046499 | Bacteria | 2254 |
| 1002 | Ga0495606_0005210 | 3300046507 | Bacteria | 12548 |
| 1003 | Ga0495608_0023223 | 3300046511 | Bacteria | 4251 |
| 1004 | Ga0495610_0049618 | 3300046512 | Bacteria | 2054 |
| 1005 | Ga0495610_0049894 | 3300046512 | Bacteria | 2046 |
| 1006 | Ga0495616_0044813 | 3300046513 | Bacteria | 2242 |
| 1007 | Ga0495616_0102732 | 3300046513 | Bacteria | 1339 |
| 1008 | Ga0495618_0099480 | 3300046514 | Bacteria | 1861 |
| 1009 | Ga0495630_0002387 | 3300046517 | Bacteria | 13052 |
| 1010 | Ga0495630_0188276 | 3300046517 | Bacteria | 1574 |
| 1011 | Ga0495632_0061048 | 3300046519 | Bacteria | 1830 |
| 1012 | Ga0495666_0023818 | 3300046526 | Bacteria | 3028 |
| 1013 | Ga0495642_0026594 | 3300046528 | Bacteria | 2299 |
| 1014 | Ga0495652_0014517 | 3300046529 | Bacteria | 7068 |
| 1015 | Ga0495652_0017934 | 3300046529 | Bacteria | 6316 |
| 1016 | Ga0495652_0048165 | 3300046529 | Bacteria | 3654 |
| 1017 | Ga0495652_0146261 | 3300046529 | Bacteria | 1852 |
| 1018 | Ga0495665_0000853 | 3300046531 | Bacteria | 15971 |
| 1019 | Ga0495665_0032167 | 3300046531 | Bacteria | 2805 |
| 1020 | Ga0495665_0047667 | 3300046531 | Bacteria | 2273 |
| 1021 | Ga0495640_0046380 | 3300046533 | Bacteria | 3011 |
| 1022 | Ga0495640_0054761 | 3300046533 | Bacteria | 2731 |
| 1023 | Ga0495586_0023014 | 3300046535 | Bacteria | 3327 |
| 1024 | Ga0495586_0160395 | 3300046535 | Bacteria | 1268 |
| 1025 | Ga0495609_0020183 | 3300046538 | Bacteria | 3080 |
| 1026 | Ga0495621_0003684 | 3300046539 | Bacteria | 4240 |
| 1027 | Ga0495621_0025661 | 3300046539 | Bacteria | 1982 |
| 1028 | Ga0495597_0049260 | 3300046542 | Bacteria | 1862 |
| 1029 | Ga0495645_0084621 | 3300046543 | Bacteria | 2271 |
| 1030 | Ga0495645_0176430 | 3300046543 | Bacteria | 1467 |
| 1031 | Ga0495667_0015729 | 3300046559 | Bacteria | 5115 |
| 1032 | Ga0495668_0013473 | 3300046616 | Bacteria | 4820 |
| 1033 | Ga0495668_0038325 | 3300046616 | Bacteria | 2679 |
| 1034 | Ga0495668_0070317 | 3300046616 | Bacteria | 1924 |
| 1035 | Ga0495634_0001271 | 3300046642 | Bacteria | 23127 |
| 1036 | Ga0495634_0032253 | 3300046642 | Bacteria | 3603 |
| 1037 | Ga0495634_0056534 | 3300046642 | Bacteria | 2621 |
| 1038 | Ga0495634_0068190 | 3300046642 | Bacteria | 2351 |
| 1039 | Ga0495625_0001907 | 3300046660 | Bacteria | 23574 |
| 1040 | Ga0495625_0088915 | 3300046660 | Bacteria | 2139 |
| 1041 | Ga0495635_0001312 | 3300046663 | Bacteria | 16576 |
| 1042 | Ga0495635_0002205 | 3300046663 | Bacteria | 13252 |
| 1043 | Ga0495635_0044562 | 3300046663 | Bacteria | 3061 |
| 1044 | Ga0495659_0050651 | 3300046664 | Bacteria | 1511 |
| 1045 | Ga0495588_0033944 | 3300046674 | Bacteria | 2580 |
| 1046 | Ga0495588_0135776 | 3300046674 | Bacteria | 1298 |
| 1047 | Ga0495657_0005817 | 3300046675 | Bacteria | 9710 |
| 1048 | Ga0495599_0060189 | 3300046678 | Bacteria | 2374 |
| 1049 | Ga0495623_0010915 | 3300046679 | Bacteria | 5881 |
| 1050 | Ga0495646_0009169 | 3300046680 | Bacteria | 6279 |
| 1051 | Ga0495647_0000813 | 3300046681 | Bacteria | 9324 |
| 1052 | Ga0495647_0041185 | 3300046681 | Bacteria | 1758 |
| 1053 | Ga0495658_0000512 | 3300046683 | Bacteria | 21274 |
| 1054 | Ga0495658_0020852 | 3300046683 | Bacteria | 3447 |
| 1055 | Ga0495669_0009883 | 3300046684 | Bacteria | 4032 |
| 1056 | Ga0495669_0022731 | 3300046684 | Bacteria | 2725 |
| 1057 | Ga0495613_0002976 | 3300046689 | Bacteria | 12687 |
| 1058 | Ga0495613_0021834 | 3300046689 | Bacteria | 4771 |
| 1059 | Ga0495624_0118546 | 3300046690 | Bacteria | 1626 |
| 1060 | Ga0495649_0015433 | 3300046694 | Bacteria | 4347 |
| 1061 | Ga0495600_0011910 | 3300046809 | Bacteria | 5432 |
| 1062 | Ga0495581_0002361 | 3300047315 | Bacteria | 10645 |
| 1063 | Ga0495581_0104951 | 3300047315 | Bacteria | 1642 |
| 1064 | Ga0495604_0002858 | 3300047317 | Bacteria | 13846 |
| 1065 | Ga0495604_0007702 | 3300047317 | Bacteria | 8532 |
| 1066 | Ga0495636_0027112 | 3300047318 | Bacteria | 2333 |
| 1067 | Ga0495674_0013125 | 3300047319 | Bacteria | 7791 |
| 1068 | Ga0495674_0013620 | 3300047319 | Bacteria | 7639 |
| 1069 | Ga0495674_0032266 | 3300047319 | Bacteria | 4751 |
| 1070 | Ga0495674_0041754 | 3300047319 | Bacteria | 4095 |
| 1071 | Ga0495674_0098223 | 3300047319 | Bacteria | 2494 |
| 1072 | Ga0495674_0103022 | 3300047319 | Bacteria | 2427 |
| 1073 | Ga0495674_0141783 | 3300047319 | Bacteria | 2020 |
| 1074 | Ga0495672_0023022 | 3300047320 | Bacteria | 4038 |
| 1075 | Ga0495676_0015607 | 3300047321 | Bacteria | 6756 |
| 1076 | Ga0495676_0077796 | 3300047321 | Bacteria | 2528 |
| 1077 | Ga0495680_0040441 | 3300047322 | Bacteria | 3715 |
| 1078 | Ga0495683_0043664 | 3300047323 | Bacteria | 2256 |
| 1079 | Ga0495684_0004305 | 3300047471 | Bacteria | 11116 |
| 1080 | Ga0495684_0074199 | 3300047471 | Bacteria | 2584 |
| 1081 | Ga0495686_0051333 | 3300047472 | Bacteria | 2588 |
| 1082 | Ga0495593_0000331 | 3300047673 | Bacteria | 26196 |
| 1083 | Ga0495593_0005960 | 3300047673 | Bacteria | 7176 |
| 1084 | Ga0495593_0070872 | 3300047673 | Bacteria | 1810 |
| 1085 | Ga0495602_0021275 | 3300048088 | Bacteria | 6391 |
| 1086 | Ga0495602_0021985 | 3300048088 | Bacteria | 6254 |
| 1087 | Ga0495602_0156477 | 3300048088 | Unclassified | 1784 |
| 1088 | Ga0495626_0024063 | 3300048091 | Bacteria | 2989 |
| 1089 | Ga0496100_0055959 | 3300048903 | Bacteria | 2579 |
| 1090 | Ga0496101_0144295 | 3300048904 | Bacteria | 1817 |
| 1091 | Ga0496102_0086923 | 3300048905 | Bacteria | 2888 |
| 1092 | Ga0496103_0088336 | 3300048906 | Bacteria | 1954 |
| 1093 | Ga0496103_0109750 | 3300048906 | Bacteria | 1752 |
| 1094 | Ga0496104_0001245 | 3300048907 | Bacteria | 21918 |
| 1095 | Ga0496104_0011338 | 3300048907 | Bacteria | 7979 |
| 1096 | Ga0496106_0002916 | 3300048909 | Bacteria | 12733 |
| 1097 | Ga0496106_0015718 | 3300048909 | Bacteria | 5600 |
| 1098 | Ga0496106_0142894 | 3300048909 | Bacteria | 1883 |
| 1099 | Ga0496106_0261259 | 3300048909 | Bacteria | 1385 |
| 1100 | Ga0496107_0026368 | 3300048910 | Bacteria | 4119 |
| 1101 | Ga0496107_0211072 | 3300048910 | Bacteria | 1444 |
| 1102 | Ga0496108_0011169 | 3300048911 | Bacteria | 7295 |
| 1103 | Ga0496109_0002719 | 3300048912 | Bacteria | 14823 |
| 1104 | Ga0496109_0124506 | 3300048912 | Bacteria | 2403 |
| 1105 | Ga0496109_0124959 | 3300048912 | Bacteria | 2398 |
| 1106 | Ga0496109_0152092 | 3300048912 | Bacteria | 2167 |
| 1107 | Ga0496109_0398011 | 3300048912 | Bacteria | 1301 |
| 1108 | Ga0496111_0026614 | 3300048914 | Bacteria | 4086 |
| 1109 | Ga0496112_0010367 | 3300048915 | Bacteria | 8451 |
| 1110 | Ga0496112_0116852 | 3300048915 | Bacteria | 2637 |
| 1111 | Ga0496113_0046136 | 3300048916 | Bacteria | 3235 |
| 1112 | Ga0496113_0051116 | 3300048916 | Bacteria | 3084 |
| 1113 | Ga0496114_0025961 | 3300048917 | Bacteria | 4793 |
| 1114 | Ga0496114_0100711 | 3300048917 | Bacteria | 2466 |
| 1115 | Ga0496114_0312275 | 3300048917 | Bacteria | 1388 |
| 1116 | Ga0496116_0008689 | 3300048919 | Bacteria | 8776 |
| 1117 | Ga0496118_0008129 | 3300048921 | Bacteria | 10925 |
| 1118 | Ga0496118_0050306 | 3300048921 | Bacteria | 3200 |
| 1119 | Ga0496119_0003004 | 3300048922 | Bacteria | 17875 |
| 1120 | Ga0496119_0086514 | 3300048922 | Bacteria | 1791 |
| 1121 | Ga0496119_0107521 | 3300048922 | Bacteria | 1555 |
| 1122 | Ga0496120_0006997 | 3300048923 | Bacteria | 8484 |
| 1123 | Ga0496120_0032809 | 3300048923 | Bacteria | 3126 |
| 1124 | Ga0496121_0002114 | 3300048924 | Bacteria | 31228 |
| 1125 | Ga0496121_0017623 | 3300048924 | Bacteria | 7276 |
| 1126 | Ga0496121_0023103 | 3300048924 | Bacteria | 6003 |
| 1127 | Ga0496121_0064825 | 3300048924 | Bacteria | 2976 |
| 1128 | Ga0496121_0114622 | 3300048924 | Bacteria | 2048 |
| 1129 | Ga0496121_0155212 | 3300048924 | Bacteria | 1680 |
| 1130 | Ga0496124_0001351 | 3300048927 | Bacteria | 36722 |
| 1131 | Ga0496124_0224205 | 3300048927 | Bacteria | 1411 |
| 1132 | Ga0496124_0230414 | 3300048927 | Bacteria | 1385 |
| 1133 | Ga0496125_0022471 | 3300048928 | Bacteria | 5857 |
| 1134 | Ga0496125_0032671 | 3300048928 | Bacteria | 4619 |
| 1135 | Ga0496126_0006139 | 3300048929 | Bacteria | 13464 |
| 1136 | Ga0496126_0026642 | 3300048929 | Bacteria | 5539 |
| 1137 | Ga0496126_0034021 | 3300048929 | Bacteria | 4791 |
| 1138 | Ga0496126_0056000 | 3300048929 | Bacteria | 3565 |
| 1139 | Ga0496126_0067884 | 3300048929 | Bacteria | 3185 |
| 1140 | Ga0496126_0068667 | 3300048929 | Bacteria | 3163 |
| 1141 | Ga0496126_0088661 | 3300048929 | Bacteria | 2725 |
| 1142 | Ga0496126_0105057 | 3300048929 | Bacteria | 2467 |
| 1143 | Ga0496126_0195700 | 3300048929 | Bacteria | 1709 |
| 1144 | Ga0501031_0021719 | 3300049568 | Bacteria | 4183 |
| 1145 | Ga0501031_0047802 | 3300049568 | Bacteria | 2789 |
| 1146 | Ga0501033_0001553 | 3300049570 | Bacteria | 20280 |
| 1147 | Ga0501033_0006440 | 3300049570 | Bacteria | 9189 |
| 1148 | Ga0501033_0011030 | 3300049570 | Bacteria | 6919 |
| 1149 | Ga0501033_0171726 | 3300049570 | Bacteria | 1557 |
| 1150 | Ga0501033_0208141 | 3300049570 | Bacteria | 1395 |
| 1151 | Ga0501034_0022821 | 3300049571 | Bacteria | 6374 |
| 1152 | Ga0501034_0092220 | 3300049571 | Bacteria | 3026 |
| 1153 | Ga0501034_0206136 | 3300049571 | Bacteria | 1922 |
| 1154 | Ga0501034_0297099 | 3300049571 | Bacteria | 1552 |
| 1155 | Ga0501036_0001752 | 3300049572 | Bacteria | 16857 |
| 1156 | Ga0501036_0006667 | 3300049572 | Bacteria | 9387 |
| 1157 | Ga0501036_0067669 | 3300049572 | Bacteria | 3022 |
| 1158 | Ga0501036_0206690 | 3300049572 | Bacteria | 1650 |
| 1159 | Ga0501037_0002039 | 3300049573 | Bacteria | 14652 |
| 1160 | Ga0501037_0017188 | 3300049573 | Bacteria | 5325 |
| 1161 | Ga0501037_0107075 | 3300049573 | Bacteria | 2014 |
| 1162 | Ga0501037_0240970 | 3300049573 | Bacteria | 1267 |
| 1163 | Ga0501038_0003805 | 3300049574 | Bacteria | 14041 |
| 1164 | Ga0501038_0057046 | 3300049574 | Bacteria | 3354 |
| 1165 | Ga0501038_0191476 | 3300049574 | Bacteria | 1645 |
| 1166 | Ga0501039_0000865 | 3300049575 | Bacteria | 21916 |
| 1167 | Ga0501039_0059881 | 3300049575 | Bacteria | 2949 |
| 1168 | Ga0501039_0077555 | 3300049575 | Bacteria | 2584 |
| 1169 | Ga0501039_0120892 | 3300049575 | Bacteria | 2052 |
| 1170 | Ga0501039_0193644 | 3300049575 | Bacteria | 1598 |
| 1171 | Ga0501039_0234433 | 3300049575 | Bacteria | 1443 |
| 1172 | Ga0501039_0240206 | 3300049575 | Bacteria | 1424 |
| 1173 | Ga0501039_0254394 | 3300049575 | Bacteria | 1381 |
| 1174 | Ga0501040_0194235 | 3300049576 | Bacteria | 1441 |
| 1175 | Ga0501040_0195096 | 3300049576 | Bacteria | 1437 |
| 1176 | Ga0501041_0024906 | 3300049577 | Bacteria | 3595 |
| 1177 | Ga0501041_0051707 | 3300049577 | Bacteria | 2504 |
| 1178 | Ga0501041_0085190 | 3300049577 | Bacteria | 1948 |
| 1179 | Ga0501041_0167998 | 3300049577 | Bacteria | 1372 |
| 1180 | Ga0501042_0002120 | 3300049578 | Bacteria | 12028 |
| 1181 | Ga0501042_0040745 | 3300049578 | Bacteria | 3301 |
| 1182 | Ga0501042_0071724 | 3300049578 | Bacteria | 2478 |
| 1183 | Ga0501042_0265502 | 3300049578 | Bacteria | 1239 |
| 1184 | Ga0501043_0001418 | 3300049579 | Bacteria | 20936 |
| 1185 | Ga0501043_0002177 | 3300049579 | Bacteria | 16719 |
| 1186 | Ga0501043_0010294 | 3300049579 | Bacteria | 7331 |
| 1187 | Ga0501043_0024560 | 3300049579 | Bacteria | 4729 |
| 1188 | Ga0501043_0039758 | 3300049579 | Bacteria | 3697 |
| 1189 | Ga0501043_0150349 | 3300049579 | Bacteria | 1822 |
| 1190 | Ga0501043_0155034 | 3300049579 | Bacteria | 1791 |
| 1191 | Ga0501046_0001680 | 3300049580 | Bacteria | 21164 |
| 1192 | Ga0501046_0050607 | 3300049580 | Bacteria | 3281 |
| 1193 | Ga0501046_0080192 | 3300049580 | Bacteria | 2523 |
| 1194 | Ga0501046_0156835 | 3300049580 | Bacteria | 1714 |
| 1195 | Ga0501046_0179803 | 3300049580 | Bacteria | 1582 |
| 1196 | Ga0501047_0004987 | 3300049581 | Bacteria | 12457 |
| 1197 | Ga0501047_0045841 | 3300049581 | Bacteria | 4226 |
| 1198 | Ga0501047_0084339 | 3300049581 | Bacteria | 3053 |
| 1199 | Ga0501047_0116350 | 3300049581 | Bacteria | 2555 |
| 1200 | Ga0501047_0140943 | 3300049581 | Bacteria | 2289 |
| 1201 | Ga0501047_0176240 | 3300049581 | Bacteria | 2005 |
| 1202 | Ga0501048_0007273 | 3300049582 | Bacteria | 8395 |
| 1203 | Ga0501048_0010235 | 3300049582 | Bacteria | 7013 |
| 1204 | Ga0501048_0010642 | 3300049582 | Bacteria | 6861 |
| 1205 | Ga0501048_0011366 | 3300049582 | Bacteria | 6640 |
| 1206 | Ga0501048_0053281 | 3300049582 | Bacteria | 2878 |
| 1207 | Ga0501048_0089603 | 3300049582 | Bacteria | 2170 |
| 1208 | Ga0501048_0118500 | 3300049582 | Bacteria | 1870 |
| 1209 | Ga0501067_0002446 | 3300049583 | Bacteria | 10264 |
| 1210 | Ga0501067_0030866 | 3300049583 | Bacteria | 2973 |
| 1211 | Ga0501067_0045880 | 3300049583 | Bacteria | 2426 |
| 1212 | Ga0501068_0010598 | 3300049584 | Bacteria | 5183 |
| 1213 | Ga0501068_0021887 | 3300049584 | Bacteria | 3735 |
| 1214 | Ga0501068_0080345 | 3300049584 | Bacteria | 2000 |
| 1215 | Ga0501069_0002887 | 3300049585 | Bacteria | 8819 |
| 1216 | Ga0501069_0024820 | 3300049585 | Bacteria | 3273 |
| 1217 | Ga0501069_0053728 | 3300049585 | Bacteria | 2243 |
| 1218 | Ga0501070_0006386 | 3300049586 | Bacteria | 10030 |
| 1219 | Ga0501070_0021654 | 3300049586 | Bacteria | 5390 |
| 1220 | Ga0501070_0276554 | 3300049586 | Bacteria | 1370 |
| 1221 | Ga0501071_0001305 | 3300049587 | Bacteria | 14212 |
| 1222 | Ga0501071_0024877 | 3300049587 | Bacteria | 4190 |
| 1223 | Ga0501071_0052423 | 3300049587 | Bacteria | 2942 |
| 1224 | Ga0501072_0016027 | 3300049588 | Bacteria | 5747 |
| 1225 | Ga0501072_0077306 | 3300049588 | Bacteria | 2635 |
| 1226 | Ga0501072_0150528 | 3300049588 | Bacteria | 1855 |
| 1227 | Ga0501072_0163640 | 3300049588 | Bacteria | 1775 |
| 1228 | Ga0501073_0013232 | 3300049589 | Bacteria | 6013 |
| 1229 | Ga0501073_0084163 | 3300049589 | Bacteria | 2213 |
| 1230 | Ga0501073_0199375 | 3300049589 | Bacteria | 1384 |
| 1231 | Ga0501074_0001868 | 3300049590 | Bacteria | 14437 |
| 1232 | Ga0501074_0026753 | 3300049590 | Bacteria | 4183 |
| 1233 | Ga0501074_0032936 | 3300049590 | Bacteria | 3755 |
| 1234 | Ga0501074_0045794 | 3300049590 | Bacteria | 3163 |
| 1235 | Ga0501074_0065122 | 3300049590 | Bacteria | 2623 |
| 1236 | Ga0501075_0017473 | 3300049591 | Bacteria | 5183 |
| 1237 | Ga0501075_0031114 | 3300049591 | Bacteria | 3959 |
| 1238 | Ga0501075_0034069 | 3300049591 | Bacteria | 3790 |
| 1239 | Ga0501075_0132342 | 3300049591 | Bacteria | 1900 |
| 1240 | Ga0501076_0014051 | 3300049592 | Bacteria | 6018 |
| 1241 | Ga0501076_0017780 | 3300049592 | Bacteria | 5405 |
| 1242 | Ga0501076_0029417 | 3300049592 | Bacteria | 4273 |
| 1243 | Ga0501076_0043259 | 3300049592 | Bacteria | 3548 |
| 1244 | Ga0501076_0115580 | 3300049592 | Bacteria | 2171 |
| 1245 | Ga0501076_0132694 | 3300049592 | Bacteria | 2020 |
| 1246 | Ga0501076_0148802 | 3300049592 | Bacteria | 1904 |
| 1247 | Ga0501077_0015591 | 3300049593 | Bacteria | 4785 |
| 1248 | Ga0501077_0026027 | 3300049593 | Bacteria | 3712 |
| 1249 | Ga0501077_0031586 | 3300049593 | Bacteria | 3370 |
| 1250 | Ga0501077_0033064 | 3300049593 | Bacteria | 3293 |
| 1251 | Ga0501077_0097997 | 3300049593 | Bacteria | 1858 |
| 1252 | Ga0501077_0145134 | 3300049593 | Bacteria | 1505 |
| 1253 | Ga0501249_004137 | 3300049679 | Bacteria | 2937 |
| 1254 | Ga0501225_0010347 | 3300049705 | Bacteria | 2642 |
| 1255 | Ga0501079_0001542 | 3300049741 | Bacteria | 16318 |
| 1256 | Ga0501079_0003813 | 3300049741 | Bacteria | 11139 |
| 1257 | Ga0501079_0011309 | 3300049741 | Bacteria | 6808 |
| 1258 | Ga0501079_0020988 | 3300049741 | Bacteria | 4992 |
| 1259 | Ga0501079_0085214 | 3300049741 | Bacteria | 2445 |
| 1260 | Ga0501079_0145497 | 3300049741 | Bacteria | 1847 |
| 1261 | Ga0501080_0007581 | 3300049742 | Bacteria | 9810 |
| 1262 | Ga0501080_0017651 | 3300049742 | Bacteria | 6599 |
| 1263 | Ga0501080_0084578 | 3300049742 | Bacteria | 2947 |
| 1264 | Ga0501080_0114015 | 3300049742 | Bacteria | 2506 |
| 1265 | Ga0501080_0253186 | 3300049742 | Bacteria | 1605 |
| 1266 | Ga0501081_0005169 | 3300049743 | Bacteria | 8400 |
| 1267 | Ga0501081_0009148 | 3300049743 | Bacteria | 6447 |
| 1268 | Ga0501081_0022757 | 3300049743 | Bacteria | 4195 |
| 1269 | Ga0501081_0029605 | 3300049743 | Bacteria | 3701 |
| 1270 | Ga0501081_0035335 | 3300049743 | Bacteria | 3402 |
| 1271 | Ga0501081_0054447 | 3300049743 | Bacteria | 2764 |
| 1272 | Ga0501083_0007474 | 3300049744 | Bacteria | 7741 |
| 1273 | Ga0501083_0012144 | 3300049744 | Bacteria | 6029 |
| 1274 | Ga0501083_0020189 | 3300049744 | Bacteria | 4635 |
| 1275 | Ga0501083_0038161 | 3300049744 | Bacteria | 3266 |
| 1276 | Ga0501083_0160417 | 3300049744 | Bacteria | 1471 |
| 1277 | Ga0501262_000299 | 3300049759 | Bacteria | 6034 |
| 1278 | Ga0501035_0011638 | 3300049822 | Bacteria | 8156 |
| 1279 | Ga0501035_0018905 | 3300049822 | Bacteria | 6348 |
| 1280 | Ga0501035_0097326 | 3300049822 | Bacteria | 2584 |
| 1281 | Ga0501044_0036860 | 3300049823 | Bacteria | 5114 |
| 1282 | Ga0501044_0134533 | 3300049823 | Bacteria | 2464 |
| 1283 | Ga0501045_0005175 | 3300049824 | Bacteria | 9019 |
| 1284 | Ga0501045_0019952 | 3300049824 | Bacteria | 4784 |
| 1285 | Ga0501045_0022962 | 3300049824 | Bacteria | 4471 |
| 1286 | nmdc:mga03683_580_c1 | 3300050489 | Bacteria | 10481 |
| 1287 | nmdc:mga03n38_2842_c1 | 3300050490 | Bacteria | 5449 |
| 1288 | nmdc:mga00v17_15536_c1 | 3300050491 | Bacteria | 4273 |
| 1289 | nmdc:mga0yw44_52105_c1 | 3300050492 | Bacteria | 2480 |
| 1290 | nmdc:mga0yw44_8904_c1 | 3300050492 | Bacteria | 5034 |
| 1291 | nmdc:mga0k408_1112_c1 | 3300050493 | Bacteria | 14734 |
| 1292 | nmdc:mga0k408_19707_c1 | 3300050493 | Bacteria | 3773 |
| 1293 | nmdc:mga0k408_346_c1 | 3300050493 | Bacteria | 25314 |
| 1294 | nmdc:mga0k408_7919_c1 | 3300050493 | Bacteria | 5691 |
| 1295 | nmdc:mga0k408_9424_c2 | 3300050493 | Bacteria | 1843 |
| 1296 | nmdc:mga0k408_9464_c1 | 3300050493 | Bacteria | 5252 |
| 1297 | nmdc:mga06z11_15319_c1 | 3300050494 | Bacteria | 3419 |
| 1298 | nmdc:mga06z11_41330_c1 | 3300050494 | Bacteria | 2307 |
| 1299 | nmdc:mga07m45_14954_c1 | 3300050496 | Bacteria | 4143 |
| 1300 | nmdc:mga07m45_4134_c1 | 3300050496 | Bacteria | 7084 |
| 1301 | nmdc:mga07m45_55321_c1 | 3300050496 | Bacteria | 2243 |
| 1302 | nmdc:mga07m45_9845_c1 | 3300050496 | Bacteria | 4973 |
| 1303 | nmdc:mga05p37_101475_c1 | 3300050507 | Bacteria | 3543 |
| 1304 | nmdc:mga05p37_104823_c1 | 3300050507 | Bacteria | 3479 |
| 1305 | nmdc:mga05p37_11277_c1 | 3300050507 | Bacteria | 10629 |
| 1306 | nmdc:mga05p37_13987_c1 | 3300050507 | Bacteria | 9624 |
| 1307 | nmdc:mga05p37_14391_c1 | 3300050507 | Bacteria | 9498 |
| 1308 | nmdc:mga05p37_152277_c1 | 3300050507 | Bacteria | 2828 |
| 1309 | nmdc:mga05p37_180636_c1 | 3300050507 | Bacteria | 2567 |
| 1310 | nmdc:mga05p37_24403_c1 | 3300050507 | Bacteria | 7348 |
| 1311 | nmdc:mga05p37_24615_c1 | 3300050507 | Bacteria | 7318 |
| 1312 | nmdc:mga05p37_2488_c1 | 3300050507 | Bacteria | 21424 |
| 1313 | nmdc:mga05p37_3181_c1 | 3300050507 | Bacteria | 19102 |
| 1314 | nmdc:mga05p37_3321_c1 | 3300050507 | Bacteria | 18762 |
| 1315 | nmdc:mga05p37_340435_c1 | 3300050507 | Bacteria | 1769 |
| 1316 | nmdc:mga05p37_47749_c1 | 3300050507 | Bacteria | 5265 |
| 1317 | nmdc:mga05p37_54345_c1 | 3300050507 | Bacteria | 4926 |
| 1318 | nmdc:mga05p37_55103_c2 | 3300050507 | Bacteria | 2988 |
| 1319 | nmdc:mga05p37_579593_c1 | 3300050507 | Bacteria | 1271 |
| 1320 | nmdc:mga05p37_61882_c1 | 3300050507 | Bacteria | 4607 |
| 1321 | nmdc:mga05p37_64428_c1 | 3300050507 | Bacteria | 4510 |
| 1322 | nmdc:mga05p37_69165_c1 | 3300050507 | Bacteria | 4343 |
| 1323 | nmdc:mga05p37_7536_c1 | 3300050507 | Bacteria | 12830 |
| 1324 | nmdc:mga05p37_75434_c1 | 3300050507 | Bacteria | 4151 |
| 1325 | nmdc:mga05p37_90235_c1 | 3300050507 | Bacteria | 3777 |
| 1326 | nmdc:mga09592_132745_c1 | 3300050508 | Bacteria | 2143 |
| 1327 | nmdc:mga09592_133468_c1 | 3300050508 | Bacteria | 2138 |
| 1328 | nmdc:mga09592_30120_c1 | 3300050508 | Bacteria | 4516 |
| 1329 | nmdc:mga09592_37965_c1 | 3300050508 | Bacteria | 4041 |
| 1330 | nmdc:mga09592_4918_c1 | 3300050508 | Bacteria | 10833 |
| 1331 | nmdc:mga09592_55671_c1 | 3300050508 | Bacteria | 3342 |
| 1332 | nmdc:mga09592_83192_c1 | 3300050508 | Bacteria | 2728 |
| 1333 | nmdc:mga09592_8656_c1 | 3300050508 | Bacteria | 8280 |
| 1334 | nmdc:mga0qj67_207947_c1 | 3300050509 | Bacteria | 1590 |
| 1335 | nmdc:mga0qj67_21731_c1 | 3300050509 | Bacteria | 4924 |
| 1336 | nmdc:mga0qj67_31254_c1 | 3300050509 | Bacteria | 4147 |
| 1337 | nmdc:mga0qj67_39740_c1 | 3300050509 | Bacteria | 3696 |
| 1338 | nmdc:mga0qj67_5521_c1 | 3300050509 | Bacteria | 9244 |
| 1339 | nmdc:mga0qj67_58392_c1 | 3300050509 | Bacteria | 3059 |
| 1340 | nmdc:mga0qj67_64776_c1 | 3300050509 | Bacteria | 2908 |
| 1341 | nmdc:mga0qj67_85883_c1 | 3300050509 | Bacteria | 2524 |
| 1342 | nmdc:mga06r32_108008_c1 | 3300050510 | Bacteria | 2735 |
| 1343 | nmdc:mga06r32_142293_c1 | 3300050510 | Bacteria | 2376 |
| 1344 | nmdc:mga06r32_142_c1 | 3300050510 | Bacteria | 53686 |
| 1345 | nmdc:mga06r32_15351_c1 | 3300050510 | Bacteria | 6959 |
| 1346 | nmdc:mga06r32_155752_c1 | 3300050510 | Bacteria | 2266 |
| 1347 | nmdc:mga06r32_211788_c1 | 3300050510 | Bacteria | 1926 |
| 1348 | nmdc:mga06r32_302851_c1 | 3300050510 | Bacteria | 1584 |
| 1349 | nmdc:mga06r32_32305_c1 | 3300050510 | Bacteria | 4924 |
| 1350 | nmdc:mga06r32_383449_c1 | 3300050510 | Bacteria | 1388 |
| 1351 | nmdc:mga06r32_52270_c1 | 3300050510 | Bacteria | 3913 |
| 1352 | nmdc:mga06r32_58496_c1 | 3300050510 | Bacteria | 3704 |
| 1353 | nmdc:mga06r32_6124_c1 | 3300050510 | Bacteria | 10804 |
| 1354 | nmdc:mga06r32_9269_c1 | 3300050510 | Bacteria | 8873 |
| 1355 | nmdc:mga06r32_9276_c1 | 3300050510 | Bacteria | 8870 |
| 1356 | nmdc:mga06r32_93765_c1 | 3300050510 | Bacteria | 2937 |
| 1357 | nmdc:mga08y16_112136_c1 | 3300050511 | Bacteria | 2839 |
| 1358 | nmdc:mga08y16_155353_c1 | 3300050511 | Bacteria | 2377 |
| 1359 | nmdc:mga08y16_204_c3 | 3300050511 | Bacteria | 8325 |
| 1360 | nmdc:mga08y16_250_c1 | 3300050511 | Bacteria | 48435 |
| 1361 | nmdc:mga08y16_25309_c1 | 3300050511 | Bacteria | 6258 |
| 1362 | nmdc:mga08y16_2965_c1 | 3300050511 | Bacteria | 17489 |
| 1363 | nmdc:mga08y16_51069_c1 | 3300050511 | Bacteria | 4326 |
| 1364 | nmdc:mga08y16_6645_c1 | 3300050511 | Bacteria | 12132 |
| 1365 | nmdc:mga08y16_84543_c1 | 3300050511 | Bacteria | 3307 |
| 1366 | nmdc:mga08y16_95168_c1 | 3300050511 | Unclassified | 3102 |
| 1367 | nmdc:mga0n895_101627_c1 | 3300050512 | Bacteria | 2885 |
| 1368 | nmdc:mga0n895_10268_c1 | 3300050512 | Bacteria | 8255 |
| 1369 | nmdc:mga0n895_112705_c1 | 3300050512 | Bacteria | 2737 |
| 1370 | nmdc:mga0n895_12893_c1 | 3300050512 | Bacteria | 7512 |
| 1371 | nmdc:mga0n895_131382_c1 | 3300050512 | Bacteria | 2529 |
| 1372 | nmdc:mga0n895_160692_c1 | 3300050512 | Bacteria | 2278 |
| 1373 | nmdc:mga0n895_169523_c1 | 3300050512 | Bacteria | 2215 |
| 1374 | nmdc:mga0n895_20353_c1 | 3300050512 | Bacteria | 5126 |
| 1375 | nmdc:mga0n895_248652_c1 | 3300050512 | Bacteria | 1805 |
| 1376 | nmdc:mga0n895_25698_c1 | 3300050512 | Bacteria | 5568 |
| 1377 | nmdc:mga0n895_3178_c1 | 3300050512 | Bacteria | 13125 |
| 1378 | nmdc:mga0n895_419_c1 | 3300050512 | Bacteria | 28472 |
| 1379 | nmdc:mga0n895_60203_c1 | 3300050512 | Bacteria | 3747 |
| 1380 | nmdc:mga0n895_803_c1 | 3300050512 | Bacteria | 22459 |
| 1381 | nmdc:mga0n895_81600_c1 | 3300050512 | Bacteria | 3223 |
| 1382 | nmdc:mga0rr50_108557_c1 | 3300050513 | Bacteria | 2193 |
| 1383 | nmdc:mga0rr50_13755_c1 | 3300050513 | Bacteria | 5282 |
| 1384 | nmdc:mga0rr50_23455_c1 | 3300050513 | Bacteria | 4256 |
| 1385 | nmdc:mga0rr50_37460_c1 | 3300050513 | Bacteria | 3501 |
| 1386 | nmdc:mga08x19_1474_c1 | 3300050514 | Bacteria | 14579 |
| 1387 | nmdc:mga0a205_116472_c1 | 3300050515 | Bacteria | 2571 |
| 1388 | nmdc:mga0a205_144871_c1 | 3300050515 | Bacteria | 2276 |
| 1389 | nmdc:mga0a205_151348_c1 | 3300050515 | Bacteria | 2220 |
| 1390 | nmdc:mga0a205_1651_c1 | 3300050515 | Bacteria | 19181 |
| 1391 | nmdc:mga0a205_16932_c1 | 3300050515 | Bacteria | 6825 |
| 1392 | nmdc:mga0a205_17702_c1 | 3300050515 | Bacteria | 6687 |
| 1393 | nmdc:mga0a205_18222_c1 | 3300050515 | Bacteria | 6596 |
| 1394 | nmdc:mga0a205_20683_c1 | 3300050515 | Bacteria | 6215 |
| 1395 | nmdc:mga0a205_211118_c1 | 3300050515 | Bacteria | 1829 |
| 1396 | nmdc:mga0a205_3138_c2 | 3300050515 | Bacteria | 13217 |
| 1397 | nmdc:mga0a205_31482_c1 | 3300050515 | Bacteria | 5081 |
| 1398 | nmdc:mga0a205_334431_c1 | 3300050515 | Bacteria | 1384 |
| 1399 | nmdc:mga0a205_40438_c1 | 3300050515 | Bacteria | 4488 |
| 1400 | nmdc:mga0a205_756_c1 | 3300050515 | Bacteria | 26070 |
| 1401 | nmdc:mga0a205_7684_c2 | 3300050515 | Bacteria | 9115 |
| 1402 | Ga0495601_0141072 | 3300053077 | Bacteria | 1572 |
| 1403 | Ga0495612_0024110 | 3300053078 | Bacteria | 2443 |
| 1404 | Ga0495619_0048113 | 3300053085 | Bacteria | 2810 |
| 1405 | Ga0495619_0077485 | 3300053085 | Bacteria | 2233 |
| 1406 | Ga0500578_0035295 | 3300053086 | Bacteria | 3214 |
| 1407 | Ga0500643_000018 | 3300053087 | Bacteria | 296505 |
| 1408 | Ga0500651_0016981 | 3300053093 | Bacteria | 4480 |
| 1409 | Ga0500566_0000038 | 3300053094 | Bacteria | 66925 |
| 1410 | Ga0500566_0003392 | 3300053094 | Bacteria | 9510 |
| 1411 | Ga0500640_007905 | 3300053095 | Bacteria | 4174 |
| 1412 | Ga0500640_021426 | 3300053095 | Bacteria | 2788 |
| 1413 | Ga0500641_0003063 | 3300053096 | Bacteria | 5928 |
| 1414 | Ga0500641_0012847 | 3300053096 | Bacteria | 3066 |
| 1415 | Ga0500554_000388 | 3300053102 | Bacteria | 9498 |
| 1416 | Ga0500555_001110 | 3300053103 | Bacteria | 8901 |
| 1417 | Ga0500556_0032311 | 3300053104 | Bacteria | 1787 |
| 1418 | Ga0500557_000008 | 3300053105 | Bacteria | 127284 |
| 1419 | Ga0500562_011823 | 3300053108 | Bacteria | 2217 |
| 1420 | Ga0500572_000010 | 3300053111 | Bacteria | 67071 |
| 1421 | Ga0500572_009784 | 3300053111 | Bacteria | 2275 |
| 1422 | Ga0500595_000414 | 3300053119 | Bacteria | 27179 |
| 1423 | Ga0500595_003164 | 3300053119 | Bacteria | 7796 |
| 1424 | Ga0500595_014908 | 3300053119 | Bacteria | 2935 |
| 1425 | Ga0500595_023353 | 3300053119 | Bacteria | 2175 |
| 1426 | Ga0500614_000527 | 3300053123 | Bacteria | 9848 |
| 1427 | Ga0500642_0024247 | 3300053130 | Bacteria | 2448 |
| 1428 | Ga0500559_0001128 | 3300053136 | Bacteria | 16079 |
| 1429 | Ga0500559_0001831 | 3300053136 | Bacteria | 11598 |
| 1430 | Ga0500568_0041774 | 3300053139 | Bacteria | 1841 |
| 1431 | Ga0500573_0025983 | 3300053140 | Bacteria | 3365 |
| 1432 | Ga0500590_027576 | 3300053148 | Bacteria | 2946 |
| 1433 | Ga0500603_000506 | 3300053150 | Bacteria | 9885 |
| 1434 | Ga0500603_001672 | 3300053150 | Bacteria | 4996 |
| 1435 | Ga0500604_0018315 | 3300053151 | Bacteria | 1950 |
| 1436 | Ga0500616_0010066 | 3300053153 | Bacteria | 5682 |
| 1437 | Ga0500616_0067602 | 3300053153 | Bacteria | 1832 |
| 1438 | Ga0500620_011369 | 3300053155 | Bacteria | 2384 |
| 1439 | Ga0500622_0043388 | 3300053156 | Bacteria | 2332 |
| 1440 | Ga0500630_017682 | 3300053159 | Bacteria | 3517 |
| 1441 | Ga0500639_000034 | 3300053163 | Bacteria | 66994 |
| 1442 | Ga0500636_0000618 | 3300053177 | Bacteria | 19228 |
| 1443 | Ga0500636_0030876 | 3300053177 | Bacteria | 3171 |
| 1444 | Ga0500636_0063419 | 3300053177 | Bacteria | 2153 |
| 1445 | Ga0500636_0118470 | 3300053177 | Bacteria | 1487 |
| 1446 | Ga0500637_0001326 | 3300053178 | Bacteria | 10428 |
| 1447 | Ga0500637_0074915 | 3300053178 | Bacteria | 1949 |
| 1448 | Ga0500637_0100285 | 3300053178 | Bacteria | 1679 |
| 1449 | Ga0500625_004205 | 3300053729 | Bacteria | 5838 |
| 1450 | Ga0500645_002184 | 3300053730 | Bacteria | 8954 |
| 1451 | Ga0500645_019887 | 3300053730 | Bacteria | 2085 |
| 1452 | Ga0500609_002717 | 3300053731 | Bacteria | 2520 |
| 1453 | Ga0500552_001233 | 3300053733 | Bacteria | 2426 |
| 1454 | Ga0500596_001579 | 3300053735 | Bacteria | 4626 |
| 1455 | Ga0500601_001069 | 3300053737 | Bacteria | 3102 |
| 1456 | Ga0501084_0002479 | 3300054114 | Bacteria | 14868 |
| 1457 | Ga0501084_0002704 | 3300054114 | Bacteria | 14281 |
| 1458 | Ga0501084_0003774 | 3300054114 | Bacteria | 12316 |
| 1459 | Ga0501084_0010622 | 3300054114 | Bacteria | 7618 |
| 1460 | Ga0501084_0060361 | 3300054114 | Bacteria | 3175 |
| 1461 | Ga0501084_0072728 | 3300054114 | Bacteria | 2879 |
| 1462 | Ga0501084_0150206 | 3300054114 | Bacteria | 1963 |
| 1463 | Ga0501084_0362235 | 3300054114 | Bacteria | 1225 |
| 1464 | Ga0500661_001493 | 3300055283 | Bacteria | 4389 |
| 1465 | Ga0590071_008059 | 3300059421 | Bacteria | 2489 |
| 1466 | Ga0587077_010797 | 3300059493 | Bacteria | 1421 |
| 1467 | Ga0587082_008852 | 3300059504 | Bacteria | 1415 |
| 1468 | Ga0587111_0013118 | 3300060346 | Bacteria | 1475 |
| 1469 | Ga0587111_0016186 | 3300060346 | Bacteria | 1373 |
| 1470 | Ga0501082_0001991 | 3300060353 | Bacteria | 17945 |
| 1471 | Ga0501082_0003830 | 3300060353 | Bacteria | 13152 |
| 1472 | Ga0501082_0004398 | 3300060353 | Bacteria | 12303 |
| 1473 | Ga0501082_0012904 | 3300060353 | Bacteria | 7182 |
| 1474 | Ga0501082_0032420 | 3300060353 | Bacteria | 4506 |
| 1475 | Ga0501082_0050516 | 3300060353 | Bacteria | 3585 |
| 1476 | Ga0501082_0094844 | 3300060353 | Bacteria | 2578 |
| 1477 | Ga0501082_0120666 | 3300060353 | Bacteria | 2272 |
| 1478 | Ga0501082_0199776 | 3300060353 | Bacteria | 1739 |
| 1479 | Ga0530510_0018987 | 3300061734 | Bacteria | 4876 |
| 1480 | Ga0530510_0218526 | 3300061734 | Bacteria | 1416 |
| 1481 | 2507510851 | 2507262055 | Bacteria | 8048963 |
| 1482 | 2508544668 | 2508501009 | Bacteria | 7784016 |
| 1483 | 2508697116 | 2508501042 | Bacteria | 8719808 |
| 1484 | 2511395630 | 2511231028 | Bacteria | 8046582 |
| 1485 | 2513623858 | 2513237092 | Bacteria | 8341956 |
| 1486 | 2513637639 | 2513237094 | Bacteria | 8789602 |
| 1487 | 2513649508 | 2513237095 | Bacteria | 8976980 |
| 1488 | 2513655816 | 2513237096 | Bacteria | 8722461 |
| 1489 | 2513696483 | 2513237101 | Bacteria | 7952346 |
| 1490 | 2513704248 | 2513237102 | Bacteria | 7703324 |
| 1491 | 2513719326 | 2513237104 | Bacteria | 10034502 |
| 1492 | 2513856688 | 2513237137 | Bacteria | 9558895 |
| 1493 | 2513874504 | 2513237139 | Bacteria | 8737671 |
| 1494 | 2513917271 | 2513237145 | Bacteria | 8979722 |
| 1495 | 2515630720 | 2515154112 | Bacteria | 8294334 |
| 1496 | 2517100423 | 2517093001 | Bacteria | 9002274 |
| 1497 | 2517895445 | 2517572143 | Bacteria | 9484767 |
| 1498 | 2524437284 | 2524023205 | Bacteria | 8918781 |
| 1499 | 2528855277 | 2528768022 | Bacteria | 10457665 |
| 1500 | 2587754296 | 2585428062 | Bacteria | 6842168 |
| 1501 | 2617377971 | 2617270741 | Bacteria | 8201522 |
| 1502 | 2644727632 | 2643221733 | Bacteria | 5690728 |
| 1503 | 2644743777 | 2643221736 | Bacteria | 6608466 |
| 1504 | 2671122121 | 2667528175 | Bacteria | 7532676 |
| 1505 | 2723842989 | 2721755755 | Bacteria | 8322773 |
| 1506 | 2745076753 | 2744054633 | Bacteria | 8678936 |
| 1507 | 2793065128 | 2791355196 | Bacteria | 7323613 |
| 1508 | 2793069424 | 2791355197 | Bacteria | 8420563 |
| 1509 | 2793082456 | |||
| 1510 | 2805916499 | 2802429603 | Bacteria | 8777136 |
| 1511 | 2818237978 | 2816332527 | Bacteria | 8933356 |
| 1512 | 2824601530 | 2824600985 | Bacteria | 8488197 |
| 1513 | 2824617198 | 2824609381 | Bacteria | 8672835 |
| 1514 | 2824619009 | 2824617872 | Bacteria | 8814715 |
| 1515 | 2824627471 | 2824626560 | Bacteria | 8813858 |
| 1516 | 2824637855 | 2824635225 | Bacteria | 8785348 |
| 1517 | 2824644637 | 2824644064 | Bacteria | 8743947 |
| 1518 | 2824653661 | 2824653114 | Bacteria | 8493680 |
| 1519 | 2824663033 | 2824661429 | Bacteria | 9877870 |
| 1520 | 2824673183 | 2824671348 | Bacteria | 8369588 |
| 1521 | 2824680524 | 2824679649 | Bacteria | 8248951 |
| 1522 | 2824689903 | 2824687955 | Bacteria | 8360029 |
| 1523 | 2824698032 | 2824696289 | Bacteria | 8335049 |
| 1524 | 2824709867 | 2824704595 | Bacteria | 9667483 |
| 1525 | 2824715833 | 2824714736 | Bacteria | 8717648 |
| 1526 | 2824724223 | 2824723954 | Bacteria | 8758240 |
| 1527 | 2824746241 | 2824746037 | Bacteria | 7911610 |
| 1528 | 2824757000 | 2824753945 | Bacteria | 9787441 |
| 1529 | 2824770128 | 2824763712 | Bacteria | 9792355 |
| 1530 | 2824778528 | 2824773399 | Bacteria | 8360218 |
| 1531 | 2838129781 | 2838122688 | Bacteria | 8803140 |
| 1532 | 2841764903 | 2841760612 | Bacteria | 6454112 |
| 1533 | 2841917038 | 2841911363 | Bacteria | 6173697 |
| 1534 | 2841922659 | 2841917233 | Bacteria | 6173500 |
| 1535 | 2841943043 | 2841941048 | Bacteria | 8688029 |
| 1536 | 2841956720 | 2841949485 | Bacteria | 8680857 |
| 1537 | 2841960377 | 2841957949 | Bacteria | 8652217 |
| 1538 | 2841968323 | 2841966195 | Bacteria | 8673214 |
| 1539 | 2841976471 | 2841974524 | Bacteria | 8931498 |
| 1540 | 2841987838 | 2841983080 | Bacteria | 8395090 |
| 1541 | 2842042848 | 2842038055 | Bacteria | 8002051 |
| 1542 | 2842050889 | 2842045827 | Bacteria | 8006841 |
| 1543 | 2842680379 | 2842677519 | Bacteria | 5615038 |
| 1544 | 2844107649 | 2844104063 | Bacteria | 6440972 |
| 1545 | 2844317089 | 2844315083 | Bacteria | 8138177 |
| 1546 | 2847938421 | 2847930680 | Bacteria | 9342022 |
| 1547 | 2847944386 | 2847939898 | Bacteria | 8606328 |
| 1548 | 2849081381 | 2849076700 | Bacteria | 7039503 |
| 1549 | 2851183600 | 2851182111 | Bacteria | 6047226 |
| 1550 | 2851249755 | 2851246043 | Bacteria | 6439203 |
| 1551 | 2857512038 | 2857509624 | Bacteria | 7472071 |
| 1552 | 2874597566 | 2874590934 | Bacteria | 8299676 |
| 1553 | 2874616623 | 2874612657 | Bacteria | 8252029 |
| 1554 | 2874630477 | 2874628541 | Bacteria | 8630250 |
| 1555 | 2874649129 | 2874645413 | Bacteria | 8214782 |
| 1556 | 2876768048 | 2876761206 | Bacteria | 10111113 |
| 1557 | 2876774961 | 2876771140 | Bacteria | 8287509 |
| 1558 | 2876822287 | 2876818435 | Bacteria | 8274608 |
| 1559 | 2879078049 | 2879074833 | Bacteria | 8279565 |
| 1560 | 2879088657 | 2879083081 | Bacteria | 8587928 |
| 1561 | 2879104000 | 2879099564 | Bacteria | 10442239 |
| 1562 | 2879132400 | 2879127579 | Bacteria | 8294491 |
| 1563 | 2879145301 | 2879142872 | Bacteria | 8267021 |
| 1564 | 2885194550 | 2885192300 | Bacteria | 5882526 |
| 1565 | 2885367067 | 2885366525 | Bacteria | 8326213 |
| 1566 | 2885382179 | 2885374607 | Bacteria | 8927485 |
| 1567 | 2885416486 | 2885409591 | Bacteria | 9235467 |
| 1568 | 2888381704 | 2888378607 | Bacteria | 9652610 |
| 1569 | 2888388935 | 2888388044 | Bacteria | 7304136 |
| 1570 | 2888422088 | 2888419890 | Bacteria | 7857137 |
| 1571 | 2894241291 | 2894232714 | Bacteria | 8834183 |
| 1572 | 2903735056 | 2903727486 | Bacteria | 8281579 |
| 1573 | 2903751326 | 2903748898 | Bacteria | 9972761 |
| 1574 | 2904667627 | 2904666416 | Bacteria | 8226587 |
| 1575 | 2904698790 | 2904690495 | Bacteria | 9412302 |
| 1576 | 2904719036 | 2904711408 | Bacteria | 9771557 |
| 1577 | 2906604172 | 2906602504 | Bacteria | 8295279 |
| 1578 | 2906615935 | |||
| 1579 | 2906635156 | 2906626472 | Bacteria | 8826946 |
| 1580 | 2906639031 | 2906635258 | Bacteria | 8601019 |
| 1581 | 2906647983 | 2906643746 | Bacteria | 8722424 |
| 1582 | 2906662079 | 2906660503 | Bacteria | 8595048 |
| 1583 | 2908740949 | 2908739725 | Bacteria | 8628932 |
| 1584 | 2908758041 | 2908756301 | Bacteria | 8864324 |
| 1585 | 2917701040 | 2917699015 | Bacteria | 7043791 |
| 1586 | 2919467419 | 2919462493 | Bacteria | 5817112 |
| 1587 | 2922367073 | 2922361189 | Bacteria | 7436256 |
| 1588 | 2922371389 | |||
| 1589 | 2922390148 | 2922386360 | Bacteria | 7017218 |
| 1590 | 2922393725 | 2922393267 | Bacteria | 8285685 |
| 1591 | 2929523925 | 2929520902 | Bacteria | 6765052 |
| 1592 | 2929623238 | 2929615660 | Bacteria | 9193770 |
| 1593 | 2929630918 | 2929624759 | Bacteria | 9339455 |
| 1594 | 2932786094 | 2932784394 | Bacteria | 9704911 |
| 1595 | 2932799142 | 2932794094 | Bacteria | 7915132 |
| 1596 | 2932803935 | 2932801729 | Bacteria | 7987968 |
| 1597 | 2932811964 | 2932809354 | Bacteria | 9135765 |
| 1598 | 2932822550 | 2932818245 | Bacteria | 9955613 |
| 1599 | 2932831137 | 2932828146 | Bacteria | 9745859 |
| 1600 | 2933585142 | 2933577622 | Bacteria | 9116884 |
| 1601 | 2935612927 | 2935608549 | Bacteria | 8203142 |
| 1602 | 2935624077 | 2935616580 | Bacteria | 9032984 |
| 1603 | 2935631030 | 2935630451 | Bacteria | 8169952 |
| 1604 | 2935640277 | 2935638405 | Bacteria | 10015038 |
| 1605 | 2935666885 | 2935665750 | Bacteria | 9571747 |
| 1606 | 2935684351 | 2935675223 | Bacteria | 9928132 |
| 1607 | 2935691343 | 2935684952 | Bacteria | 9590419 |
| 1608 | 2935699902 | 2935694250 | Bacteria | 9291695 |
| 1609 | 2935704640 | 2935703347 | Bacteria | 10242284 |
| 1610 | 2935719177 | 2935713505 | Bacteria | 9608509 |
| 1611 | 2935729223 | 2935722832 | Bacteria | 9608746 |
| 1612 | 2935737536 | 2935732158 | Bacteria | 9706831 |
| 1613 | 2935746912 | 2935741537 | Bacteria | 9707219 |
| 1614 | 2935758289 | 2935750917 | Bacteria | 9590372 |
| 1615 | 2935762460 | 2935760218 | Bacteria | 9817913 |
| 1616 | 2935777288 | 2935769743 | Bacteria | 7878163 |
| 1617 | 2935780393 | 2935777560 | Bacteria | 8077691 |
| 1618 | 2935793208 | 2935785616 | Bacteria | 7962367 |
| 1619 | 2935801196 | 2935793552 | Bacteria | 8012592 |
| 1620 | 2935803957 | 2935801545 | Bacteria | 9301974 |
| 1621 | 2935811876 | 2935810662 | Bacteria | 9401221 |
| 1622 | 2935824415 | 2935819856 | Bacteria | 8261050 |
| 1623 | 2935829760 | 2935827899 | Bacteria | 10038562 |
| 1624 | 2935842883 | 2935837841 | Bacteria | 9454360 |
| 1625 | 2935852440 | 2935847175 | Bacteria | 8228321 |
| 1626 | 2935862423 | 2935855204 | Bacteria | 9035059 |
| 1627 | 2935870558 | 2935864058 | Bacteria | 9784707 |
| 1628 | 2935881140 | 2935873716 | Bacteria | 9632195 |
| 1629 | 2935884259 | 2935883170 | Bacteria | 7964738 |
| 1630 | 2935912413 | 2935908558 | Bacteria | 8568796 |
| 1631 | 2935921754 | 2935916978 | Bacteria | 9113783 |
| 1632 | 2935929698 | 2935926038 | Bacteria | 8601059 |
| 1633 | 2935938930 | 2935934488 | Bacteria | 8602579 |
| 1634 | 2935948235 | 2935942939 | Bacteria | 8599779 |
| 1635 | 2935954959 | 2935951376 | Bacteria | 8602333 |
| 1636 | 2935962227 | 2935959822 | Bacteria | 7869783 |
| 1637 | 2935972007 | 2935967501 | Bacteria | 8603075 |
| 1638 | 2935979345 | 2935975950 | Bacteria | 8347125 |
| 1639 | 2935988080 | 2935984226 | Bacteria | 8302647 |
| 1640 | 2935993637 | 2935992306 | Bacteria | 9802711 |
| 1641 | 2936004533 | 2936002035 | Bacteria | 9362176 |
| 1642 | 2936038459 | 2936037263 | Bacteria | 9446081 |
| 1643 | 2936059369 | 2936055302 | Bacteria | 8785755 |
| 1644 | 2940563801 | 2940556831 | Bacteria | 9590747 |
| 1645 | 2941507682 | 2941507105 | Bacteria | 8166816 |
| 1646 | 2941516109 | 2941515067 | Bacteria | 8166720 |
| 1647 | 2941523183 | 2941523033 | Bacteria | 8169134 |
| 1648 | 2941533861 | 2941531003 | Bacteria | 7653939 |
| 1649 | 2941544132 | 2941538514 | Bacteria | 9402094 |
| 1650 | 2945947880 | 2945945610 | Bacteria | 5951079 |
| 1651 | 2954768171 | 2954767861 | Bacteria | 5535784 |
| 1652 | 3005476884 | 3005474847 | Bacteria | 9259049 |
| 1653 | 3005485353 | 3005483717 | Bacteria | 7877331 |
| 1654 | 3005507277 | 3005506211 | Bacteria | 6943378 |
| 1655 | 3005594637 | 3005587118 | Bacteria | 7794411 |
| 1656 | 3005596721 | 3005594810 | Bacteria | 8716512 |
| 1657 | 3005712790 | 3005710791 | Bacteria | 7622528 |
| 1658 | 8006929068 | 8006926726 | Bacteria | 6749210 |
| 1659 | 8006934533 | 8006933436 | Bacteria | 10410654 |
| 1660 | 8006966611 | 8006964411 | Bacteria | 8966052 |
| 1661 | 8006974503 | 8006973647 | Bacteria | 10679141 |
| 1662 | 8006989457 | 8006984368 | Bacteria | 9651211 |
| 1663 | 8006997924 | 8006994254 | Bacteria | 8309700 |
| 1664 | 8016516240 | 8016511872 | Bacteria | 9921665 |
| 1665 | 8016523636 | 8016522445 | Bacteria | 8156687 |
| 1666 | 8016537155 | 8016530956 | Bacteria | 8155261 |
| 1667 | 8016541414 | 8016539877 | Bacteria | 8155419 |
| 1668 | 8016551838 | 8016548790 | Bacteria | 8155074 |
| 1669 | 8016560220 | 8016557553 | Bacteria | 8154380 |
| 1670 | 8016566807 | 8016566248 | Bacteria | 8158151 |
| 1671 | 8016579540 | 8016575299 | Bacteria | 8154085 |
| 1672 | 8016589315 | 8016583857 | Bacteria | 10421953 |
| 1673 | 8016598138 | 8016595262 | Bacteria | 8149947 |
| 1674 | 8016604278 | 8016603502 | Bacteria | 8731218 |
| 1675 | 8016620863 | 8016613128 | Bacteria | 8794220 |
| 1676 | 8016629125 | 8016622563 | Bacteria | 7999408 |
| 1677 | 8016633662 | 8016630954 | Bacteria | 9217207 |
| 1678 | 8017060292 | 8017057580 | Bacteria | 10023680 |
| 1679 | 8019542682 | 8019538911 | Bacteria | 7872763 |
| 1680 | 8019548057 | 8019547302 | Bacteria | 7996444 |
| 1681 | 8019564144 | 8019555841 | Bacteria | 9642137 |
| 1682 | 8019574220 | 8019565922 | Bacteria | 9639779 |
| 1683 | 8019579819 | 8019576017 | Bacteria | 10049540 |
| 1684 | 8019587525 | 8019586578 | Bacteria | 10212056 |
| 1685 | 8019603813 | 8019597564 | Bacteria | 10041141 |
| 1686 | 8019614725 | 8019608314 | Bacteria | 10042931 |
| 1687 | 8019636846 | 8019629233 | Bacteria | 8687553 |
| 1688 | 8019642759 | 8019638758 | Bacteria | 9062356 |
| 1689 | 8019649832 | 8019648815 | Bacteria | 10014479 |
| 1690 | 8019664669 | 8019659431 | Bacteria | 8577854 |
| 1691 | 8019674258 | 8019668869 | Bacteria | 8791617 |
| 1692 | 8019681862 | 8019678201 | Bacteria | 8863603 |
| 1693 | 8019693925 | 8019687851 | Bacteria | 8712826 |
| 1694 | 8055748974 | 8055742211 | Bacteria | 9226248 |
| 1695 | 8056674952 | 8056673599 | Bacteria | 7871253 |
| 1696 | 8056694584 | 8056689827 | Bacteria | 6712655 |
| 1697 | 8056972012 | 8056967851 | Bacteria | 9038162 |
| 1698 | 8057533070 | 8057529695 | Bacteria | 6306553 |
| 1699 | Ga0495588_0041396 | |||
| 1700 | JGI25153J46596_10004919 | |||
| 1701 | JGI25153J46596_10009142 | |||
| 1702 | JGI25160J50197_1006732 | |||
| 1703 | Ga0006562J51391_1066649 | |||
| 1704 | JGI25404J52841_10000807 | |||
| 1705 | Ga0055526_1000351 | |||
| 1706 | Ga0055526_1003504 | |||
| 1707 | Ga0055524_1017302 | |||
| 1708 | Ga0055531_10001451 | |||
| 1709 | Ga0058863_11485186 | |||
| 1710 | Ga0058862_11741190 | |||
| 1711 | Ga0065165_1000315 | |||
| 1712 | Ga0065165_1004190 | |||
| 1713 | Ga0065165_1004374 | |||
| 1714 | Ga0065712_10019103 | |||
| 1715 | Ga0065715_10003432 | |||
| 1716 | Ga0065715_10135673 | |||
| 1717 | Ga0065707_10104538 | |||
| 1718 | Ga0070658_10005778 | |||
| 1719 | Ga0070676_10001361 | |||
| 1720 | Ga0070676_10021599 | |||
| 1721 | Ga0070683_100000148 | |||
| 1722 | Ga0070683_100090147 | |||
| 1723 | Ga0070690_100036536 | |||
| 1724 | Ga0070670_100004822 | |||
| 1725 | Ga0070670_100007409 | |||
| 1726 | Ga0070670_100030845 | |||
| 1727 | Ga0070670_100051642 | |||
| 1728 | Ga0070670_100061274 | |||
| 1729 | Ga0068869_100002293 | |||
| 1730 | Ga0068869_100035258 | |||
| 1731 | Ga0068869_100066971 | |||
| 1732 | Ga0070666_10070902 | |||
| 1733 | Ga0070680_100028715 | |||
| 1734 | Ga0070680_100096632 | |||
| 1735 | Ga0070680_100182248 | |||
| 1736 | Ga0070682_100001062 | |||
| 1737 | Ga0070682_100102708 | |||
| 1738 | Ga0068868_100012987 | |||
| 1739 | Ga0068868_100033219 | |||
| 1740 | Ga0068868_100122117 | |||
| 1741 | Ga0068868_100213973 | |||
| 1742 | Ga0070660_100001081 | |||
| 1743 | Ga0070689_100006220 | |||
| 1744 | Ga0070689_100056079 | |||
| 1745 | Ga0070689_100150742 | |||
| 1746 | Ga0070689_100165079 | |||
| 1747 | Ga0070691_10004648 | |||
| 1748 | Ga0070661_100027289 | |||
| 1749 | Ga0070692_10000644 | |||
| 1750 | Ga0070668_100016305 | |||
| 1751 | Ga0070668_100022501 | |||
| 1752 | Ga0070668_100044677 | |||
| 1753 | Ga0070668_100103432 | |||
| 1754 | Ga0070668_100217851 | |||
| 1755 | Ga0070669_100004485 | |||
| 1756 | Ga0070669_100023992 | |||
| 1757 | Ga0070669_100085626 | |||
| 1758 | Ga0070669_100097169 | |||
| 1759 | Ga0070669_100160690 | |||
| 1760 | Ga0070675_100007550 | |||
| 1761 | Ga0070675_100070855 | |||
| 1762 | Ga0070671_100003514 | |||
| 1763 | Ga0070671_100005834 | |||
| 1764 | Ga0070671_100025761 | |||
| 1765 | Ga0070671_100037546 | |||
| 1766 | Ga0070671_100082387 | |||
| 1767 | Ga0070671_100087459 | |||
| 1768 | Ga0070671_100163227 | |||
| 1769 | Ga0070674_100001918 | |||
| 1770 | Ga0070674_100004825 | |||
| 1771 | Ga0070674_100023939 | |||
| 1772 | Ga0070673_100001229 | |||
| 1773 | Ga0070673_100002951 | |||
| 1774 | Ga0070673_100023904 | |||
| 1775 | Ga0070673_100047182 | |||
| 1776 | Ga0070688_100019496 | |||
| 1777 | Ga0070688_100042368 | |||
| 1778 | Ga0070688_100055492 | |||
| 1779 | Ga0070688_100110246 | |||
| 1780 | Ga0070688_100115900 | |||
| 1781 | Ga0070659_100000332 | |||
| 1782 | Ga0070667_100006087 | |||
| 1783 | Ga0070667_100056905 | |||
| 1784 | Ga0070667_100062748 | |||
| 1785 | Ga0070667_100128825 | |||
| 1786 | Ga0070667_100131034 | |||
| 1787 | Ga0070709_10000486 | |||
| 1788 | Ga0070709_10003919 | |||
| 1789 | Ga0070714_100022677 | |||
| 1790 | Ga0070713_100008432 | |||
| 1791 | Ga0070713_100014512 | |||
| 1792 | Ga0070713_100015252 | |||
| 1793 | Ga0070713_100073361 | |||
| 1794 | Ga0070713_100080178 | |||
| 1795 | Ga0070713_100165777 | |||
| 1796 | Ga0070713_100211227 | |||
| 1797 | Ga0070710_10000457 | |||
| 1798 | Ga0070701_10038351 | |||
| 1799 | Ga0070701_10086625 | |||
| 1800 | Ga0070711_100015007 | |||
| 1801 | Ga0070711_100088056 | |||
| 1802 | Ga0070711_100112754 | |||
| 1803 | Ga0070711_100129225 | |||
| 1804 | Ga0070705_100000691 | |||
| 1805 | Ga0070705_100005701 | |||
| 1806 | Ga0070705_100019458 | |||
| 1807 | Ga0070700_100043671 | |||
| 1808 | Ga0070700_100049633 | |||
| 1809 | Ga0070694_100007224 | |||
| 1810 | Ga0070694_100008499 | |||
| 1811 | Ga0070694_100011936 | |||
| 1812 | Ga0070694_100036800 | |||
| 1813 | Ga0070694_100058004 | |||
| 1814 | Ga0070708_100046751 | |||
| 1815 | Ga0070708_100158033 | |||
| 1816 | Ga0070708_100329529 | |||
| 1817 | Ga0070708_100348670 | |||
| 1818 | Ga0070663_100000839 | |||
| 1819 | Ga0070663_100006693 | |||
| 1820 | Ga0070663_100112409 | |||
| 1821 | Ga0070678_100009373 | |||
| 1822 | Ga0070678_100009392 | |||
| 1823 | Ga0070678_100031777 | |||
| 1824 | Ga0070678_100054926 | |||
| 1825 | Ga0070678_100059025 | |||
| 1826 | Ga0070678_100067797 | |||
| 1827 | Ga0070662_100028101 | |||
| 1828 | Ga0070681_10011846 | |||
| 1829 | Ga0070681_10031497 | |||
| 1830 | Ga0068867_100002014 | |||
| 1831 | Ga0068867_100004801 | |||
| 1832 | Ga0068867_100009902 | |||
| 1833 | Ga0068867_100033914 | |||
| 1834 | Ga0068867_100193652 | |||
| 1835 | Ga0070685_10199331 | |||
| 1836 | Ga0070706_100002714 | |||
| 1837 | Ga0070706_100016159 | |||
| 1838 | Ga0070706_100163515 | |||
| 1839 | Ga0070707_100009700 | |||
| 1840 | Ga0070707_100011587 | |||
| 1841 | Ga0070707_100024750 | |||
| 1842 | Ga0070707_100045864 | |||
| 1843 | Ga0070707_100096062 | |||
| 1844 | Ga0070707_100151927 | |||
| 1845 | Ga0070707_100164602 | |||
| 1846 | Ga0070707_100190679 | |||
| 1847 | Ga0070707_100201829 | |||
| 1848 | Ga0070698_100000346 | |||
| 1849 | Ga0070698_100003210 | |||
| 1850 | Ga0070698_100004552 | |||
| 1851 | Ga0070698_100015625 | |||
| 1852 | Ga0070698_100034993 | |||
| 1853 | Ga0070698_100041573 | |||
| 1854 | Ga0070698_100096598 | |||
| 1855 | Ga0070698_100193434 | |||
| 1856 | Ga0070699_100001230 | |||
| 1857 | Ga0070699_100024201 | |||
| 1858 | Ga0070699_100048342 | |||
| 1859 | Ga0070699_100073864 | |||
| 1860 | Ga0070699_100151455 | |||
| 1861 | Ga0070699_100153520 | |||
| 1862 | Ga0070699_100182081 | |||
| 1863 | Ga0070684_100000395 | |||
| 1864 | Ga0070684_100007543 | |||
| 1865 | Ga0070684_100018693 | |||
| 1866 | Ga0070684_100099998 | |||
| 1867 | Ga0070697_100006088 | |||
| 1868 | Ga0070697_100006432 | |||
| 1869 | Ga0070697_100091647 | |||
| 1870 | Ga0068853_100001226 | |||
| 1871 | Ga0068853_100057574 | |||
| 1872 | Ga0068853_100122019 | |||
| 1873 | Ga0068853_100287145 | |||
| 1874 | Ga0070672_100001304 | |||
| 1875 | Ga0070672_100005379 | |||
| 1876 | Ga0070672_100033365 | |||
| 1877 | Ga0070672_100047629 | |||
| 1878 | Ga0070672_100161932 | |||
| 1879 | Ga0070686_100079681 | |||
| 1880 | Ga0070686_100079844 | |||
| 1881 | Ga0070686_100103575 | |||
| 1882 | Ga0070686_100232646 | |||
| 1883 | Ga0070695_100000230 | |||
| 1884 | Ga0070695_100004834 | |||
| 1885 | Ga0070695_100004974 | |||
| 1886 | Ga0070695_100010605 | |||
| 1887 | Ga0070695_100011714 | |||
| 1888 | Ga0070695_100015922 | |||
| 1889 | Ga0070695_100044029 | |||
| 1890 | Ga0070695_100089625 | |||
| 1891 | Ga0070695_100200150 | |||
| 1892 | Ga0070696_100003816 | |||
| 1893 | Ga0070696_100008494 | |||
| 1894 | Ga0070696_100011186 | |||
| 1895 | Ga0070696_100092200 | |||
| 1896 | Ga0070693_100001464 | |||
| 1897 | Ga0070665_100007018 | |||
| 1898 | Ga0070665_100037546 | |||
| 1899 | Ga0070665_100073051 | |||
| 1900 | Ga0070665_100158285 | |||
| 1901 | Ga0070704_100005792 | |||
| 1902 | Ga0070704_100010222 | |||
| 1903 | Ga0070704_100034177 | |||
| 1904 | Ga0070704_100108659 | |||
| 1905 | Ga0070704_100127299 | |||
| 1906 | Ga0070704_100165462 | |||
| 1907 | Ga0070704_100172975 | |||
| 1908 | Ga0068855_100089514 | |||
| 1909 | Ga0068855_100209399 | |||
| 1910 | Ga0068855_100291623 | |||
| 1911 | Ga0070664_100000515 | |||
| 1912 | Ga0070664_100007341 | |||
| 1913 | Ga0070664_100046285 | |||
| 1914 | Ga0070664_100097950 | |||
| 1915 | Ga0070664_100157073 | |||
| 1916 | Ga0070664_100159031 | |||
| 1917 | Ga0068857_100040672 | |||
| 1918 | Ga0068854_100081713 | |||
| 1919 | Ga0068854_100252579 | |||
| 1920 | Ga0068856_100003318 | |||
| 1921 | Ga0068856_100123599 | |||
| 1922 | Ga0070702_100028461 | |||
| 1923 | Ga0068852_100067246 | |||
| 1924 | Ga0068852_100241244 | |||
| 1925 | Ga0068859_100007794 | |||
| 1926 | Ga0068859_100008319 | |||
| 1927 | Ga0068859_100010316 | |||
| 1928 | Ga0068859_100025039 | |||
| 1929 | Ga0068859_100034185 | |||
| 1930 | Ga0068859_100049189 | |||
| 1931 | Ga0068859_100186637 | |||
| 1932 | Ga0068859_100206325 | |||
| 1933 | Ga0068864_100009127 | |||
| 1934 | Ga0068864_100016671 | |||
| 1935 | Ga0068864_100041875 | |||
| 1936 | Ga0068864_100124593 | |||
| 1937 | Ga0068864_100126263 | |||
| 1938 | Ga0068866_10001643 | |||
| 1939 | Ga0068866_10031174 | |||
| 1940 | Ga0068861_100073259 | |||
| 1941 | Ga0068851_10011220 | |||
| 1942 | Ga0068851_10022541 | |||
| 1943 | Ga0068870_10004098 | |||
| 1944 | Ga0068863_100009263 | |||
| 1945 | Ga0068863_100066183 | |||
| 1946 | Ga0068863_100103210 | |||
| 1947 | Ga0068858_100141957 | |||
| 1948 | Ga0068860_100000222 | |||
| 1949 | Ga0068860_100034889 | |||
| 1950 | Ga0068860_100327686 | |||
| 1951 | Ga0068862_100010279 | |||
| 1952 | Ga0068862_100010761 | |||
| 1953 | Ga0068862_100014159 | |||
| 1954 | Ga0068862_100021843 | |||
| 1955 | Ga0068862_100036902 | |||
| 1956 | Ga0081455_10000080 | |||
| 1957 | Ga0081455_10000161 | |||
| 1958 | Ga0081455_10001725 | |||
| 1959 | Ga0081455_10012953 | |||
| 1960 | Ga0081455_10015705 | |||
| 1961 | Ga0081455_10027867 | |||
| 1962 | Ga0081455_10031429 | |||
| 1963 | Ga0081455_10083294 | |||
| 1964 | Ga0081455_10106197 | |||
| 1965 | Ga0081455_10171138 | |||
| 1966 | Ga0081540_1000642 | |||
| 1967 | Ga0081540_1000914 | |||
| 1968 | Ga0081540_1004331 | |||
| 1969 | Ga0081540_1008099 | |||
| 1970 | Ga0081540_1008761 | |||
| 1971 | Ga0081540_1011538 | |||
| 1972 | Ga0081540_1012457 | |||
| 1973 | Ga0081540_1017354 | |||
| 1974 | Ga0081540_1049780 | |||
| 1975 | Ga0081539_10000845 | |||
| 1976 | Ga0081539_10004736 | |||
| 1977 | Ga0081539_10006536 | |||
| 1978 | Ga0081539_10028313 | |||
| 1979 | Ga0081539_10033166 | |||
| 1980 | Ga0081539_10062665 | |||
| 1981 | Ga0070717_10000445 | |||
| 1982 | Ga0070717_10007173 | |||
| 1983 | Ga0070717_10124122 | |||
| 1984 | Ga0070717_10279343 | |||
| 1985 | Ga0075365_10049929 | |||
| 1986 | Ga0075365_10100813 | |||
| 1987 | Ga0075368_10044171 | |||
| 1988 | Ga0075368_10065329 | |||
| 1989 | Ga0075364_10000678 | |||
| 1990 | Ga0075364_10000816 | |||
| 1991 | Ga0075432_10032841 | |||
| 1992 | Ga0070715_10021431 | |||
| 1993 | Ga0070716_100002383 | |||
| 1994 | Ga0070712_100015842 | |||
| 1995 | Ga0070712_100017478 | |||
| 1996 | Ga0070712_100042703 | |||
| 1997 | Ga0070712_100114820 | |||
| 1998 | Ga0075362_10026745 | |||
| 1999 | Ga0075367_10005020 | |||
| 2000 | Ga0075367_10044477 | |||
| 2001 | Ga0075367_10071421 | |||
| 2002 | Ga0075367_10075019 | |||
| 2003 | Ga0075367_10082264 | |||
| 2004 | Ga0075366_10000856 | |||
| 2005 | Ga0075366_10000905 | |||
| 2006 | Ga0075366_10005409 | |||
| 2007 | Ga0075366_10008580 | |||
| 2008 | Ga0075366_10060700 | |||
| 2009 | Ga0075366_10074682 | |||
| 2010 | Ga0097621_100007944 | |||
| 2011 | Ga0097621_100104846 | |||
| 2012 | Ga0075370_10001184 | |||
| 2013 | Ga0075370_10007505 | |||
| 2014 | Ga0075370_10011359 | |||
| 2015 | Ga0068871_100033975 | |||
| 2016 | Ga0068871_100092819 | |||
| 2017 | Ga0068871_100117974 | |||
| 2018 | Ga0075428_100003718 | |||
| 2019 | Ga0075428_100008208 | |||
| 2020 | Ga0075428_100012867 | |||
| 2021 | Ga0075428_100068546 | |||
| 2022 | Ga0075428_100074382 | |||
| 2023 | Ga0075428_100092259 | |||
| 2024 | Ga0075428_100106864 | |||
| 2025 | Ga0075428_100118702 | |||
| 2026 | Ga0075428_100293646 | |||
| 2027 | Ga0075430_100000088 | |||
| 2028 | Ga0075430_100009119 | |||
| 2029 | Ga0075430_100010610 | |||
| 2030 | Ga0075430_100028288 | |||
| 2031 | Ga0075431_100000986 | |||
| 2032 | Ga0075431_100009718 | |||
| 2033 | Ga0075431_100012421 | |||
| 2034 | Ga0075431_100028276 | |||
| 2035 | Ga0075431_100028624 | |||
| 2036 | Ga0075431_100040844 | |||
| 2037 | Ga0075431_100046479 | |||
| 2038 | Ga0075431_100046924 | |||
| 2039 | Ga0075431_100050940 | |||
| 2040 | Ga0075431_100097648 | |||
| 2041 | Ga0075431_100109569 | |||
| 2042 | Ga0075431_100120979 | |||
| 2043 | Ga0075431_100198033 | |||
| 2044 | Ga0075431_100204237 | |||
| 2045 | Ga0075431_100422764 | |||
| 2046 | Ga0075433_10002688 | |||
| 2047 | Ga0075433_10002891 | |||
| 2048 | Ga0075433_10002980 | |||
| 2049 | Ga0075433_10010671 | |||
| 2050 | Ga0075433_10010872 | |||
| 2051 | Ga0075433_10015682 | |||
| 2052 | Ga0075433_10016744 | |||
| 2053 | Ga0075433_10022800 | |||
| 2054 | Ga0075433_10045536 | |||
| 2055 | Ga0075433_10068601 | |||
| 2056 | Ga0075433_10127143 | |||
| 2057 | Ga0075433_10171175 | |||
| 2058 | Ga0075433_10302073 | |||
| 2059 | Ga0075434_100002381 | |||
| 2060 | Ga0075434_100003494 | |||
| 2061 | Ga0075434_100006184 | |||
| 2062 | Ga0075434_100008186 | |||
| 2063 | Ga0075434_100013374 | |||
| 2064 | Ga0075434_100021784 | |||
| 2065 | Ga0075434_100037146 | |||
| 2066 | Ga0075434_100052972 | |||
| 2067 | Ga0075434_100069170 | |||
| 2068 | Ga0075434_100094589 | |||
| 2069 | Ga0075434_100107253 | |||
| 2070 | Ga0075434_100157590 | |||
| 2071 | Ga0075434_100163226 | |||
| 2072 | Ga0075434_100183446 | |||
| 2073 | Ga0075434_100194172 | |||
| 2074 | Ga0075434_100369385 | |||
| 2075 | Ga0075429_100000555 | |||
| 2076 | Ga0075429_100005512 | |||
| 2077 | Ga0075429_100010439 | |||
| 2078 | Ga0075429_100013820 | |||
| 2079 | Ga0075429_100016895 | |||
| 2080 | Ga0075429_100026783 | |||
| 2081 | Ga0075429_100098834 | |||
| 2082 | Ga0075429_100142868 | |||
| 2083 | Ga0075429_100200814 | |||
| 2084 | Ga0075429_100268188 | |||
| 2085 | Ga0068865_100002565 | |||
| 2086 | Ga0068865_100004347 | |||
| 2087 | Ga0075436_100001553 | |||
| 2088 | Ga0075436_100059954 | |||
| 2089 | Ga0097620_100007793 | |||
| 2090 | Ga0097620_100008319 | |||
| 2091 | Ga0097620_100010316 | |||
| 2092 | Ga0097620_100025040 | |||
| 2093 | Ga0097620_100034186 | |||
| 2094 | Ga0097620_100049186 | |||
| 2095 | Ga0097620_100186638 | |||
| 2096 | Ga0097620_100206326 | |||
| 2097 | Ga0099824_1014445 | |||
| 2098 | Ga0075435_100005520 | |||
| 2099 | Ga0075435_100008483 | |||
| 2100 | Ga0075435_100013632 | |||
| 2101 | Ga0075435_100037343 | |||
| 2102 | Ga0075435_100043987 | |||
| 2103 | Ga0075435_100068695 | |||
| 2104 | Ga0075435_100094823 | |||
| 2105 | Ga0075435_100133225 | |||
| 2106 | Ga0075435_100233309 | |||
| 2107 | Ga0075435_100242314 | |||
| 2108 | Ga0099794_10040397 | |||
| 2109 | Ga0099794_10041554 | |||
| 2110 | Ga0099795_10031993 | |||
| 2111 | Ga0105240_10000427 | |||
| 2112 | Ga0105240_10233130 | |||
| 2113 | Ga0111539_10000205 | |||
| 2114 | Ga0111539_10002082 | |||
| 2115 | Ga0111539_10003143 | |||
| 2116 | Ga0111539_10004506 | |||
| 2117 | Ga0111539_10004845 | |||
| 2118 | Ga0111539_10005412 | |||
| 2119 | Ga0111539_10015192 | |||
| 2120 | Ga0111539_10053485 | |||
| 2121 | Ga0111539_10070021 | |||
| 2122 | Ga0111539_10077793 | |||
| 2123 | Ga0111539_10216065 | |||
| 2124 | Ga0111539_10264260 | |||
| 2125 | Ga0105245_10148881 | |||
| 2126 | Ga0105247_10034407 | |||
| 2127 | Ga0114129_10000722 | |||
| 2128 | Ga0114129_10001217 | |||
| 2129 | Ga0114129_10004791 | |||
| 2130 | Ga0114129_10006303 | |||
| 2131 | Ga0114129_10010000 | |||
| 2132 | Ga0114129_10011045 | |||
| 2133 | Ga0114129_10011216 | |||
| 2134 | Ga0114129_10011456 | |||
| 2135 | Ga0114129_10012186 | |||
| 2136 | Ga0114129_10026763 | |||
| 2137 | Ga0114129_10031611 | |||
| 2138 | Ga0114129_10041559 | |||
| 2139 | Ga0114129_10049194 | |||
| 2140 | Ga0114129_10059337 | |||
| 2141 | Ga0114129_10089245 | |||
| 2142 | Ga0114129_10092082 | |||
| 2143 | Ga0114129_10112040 | |||
| 2144 | Ga0114129_10112106 | |||
| 2145 | Ga0114129_10127269 | |||
| 2146 | Ga0114129_10158620 | |||
| 2147 | Ga0114129_10162870 | |||
| 2148 | Ga0114129_10165922 | |||
| 2149 | Ga0114129_10170137 | |||
| 2150 | Ga0114129_10192551 | |||
| 2151 | Ga0105243_10043894 | |||
| 2152 | Ga0105243_10078705 | |||
| 2153 | Ga0105241_10016909 | |||
| 2154 | Ga0105241_10254853 | |||
| 2155 | Ga0105242_10073243 | |||
| 2156 | Ga0105248_10005501 | |||
| 2157 | Ga0105248_10117609 | |||
| 2158 | Ga0105248_10133873 | |||
| 2159 | Ga0105248_10337789 | |||
| 2160 | Ga0105248_10378267 | |||
| 2161 | Ga0105237_10013789 | |||
| 2162 | Ga0105237_10014620 | |||
| 2163 | Ga0105237_10093214 | |||
| 2164 | Ga0105237_10100105 | |||
| 2165 | Ga0105238_10145339 | |||
| 2166 | Ga0105238_10384429 | |||
| 2167 | Ga0105249_10001777 | |||
| 2168 | Ga0105249_10135988 | |||
| 2169 | Ga0105239_10022197 | |||
| 2170 | Ga0105239_10034375 | |||
| 2171 | Ga0105239_10053529 | |||
| 2172 | Ga0105239_10058807 | |||
| 2173 | Ga0105239_10111312 | |||
| 2174 | Ga0105246_10040304 | |||
| 2175 | Ga0105246_10048875 | |||
| 2176 | Ga0157373_10000574 | |||
| 2177 | Ga0157373_10001127 | |||
| 2178 | Ga0157371_10177010 | |||
| 2179 | Ga0157369_10027066 | |||
| 2180 | Ga0157369_10047099 | |||
| 2181 | Ga0171462_1045 | |||
| 2182 | Ga0157374_10146707 | |||
| 2183 | Ga0157374_10278732 | |||
| 2184 | Ga0157378_10037713 | |||
| 2185 | Ga0157378_10042649 | |||
| 2186 | Ga0157378_10166762 | |||
| 2187 | Ga0157378_10210118 | |||
| 2188 | Ga0163162_10139268 | |||
| 2189 | Ga0163162_10485948 | |||
| 2190 | Ga0157372_10001263 | |||
| 2191 | Ga0157372_10191594 | |||
| 2192 | Ga0157372_10234545 | |||
| 2193 | Ga0157372_10457301 | |||
| 2194 | Ga0157375_10004827 | |||
| 2195 | Ga0157375_10038656 | |||
| 2196 | Ga0157375_10119824 | |||
| 2197 | Ga0163163_10031956 | |||
| 2198 | Ga0163163_10046564 | |||
| 2199 | Ga0163163_10059185 | |||
| 2200 | Ga0163163_10134022 | |||
| 2201 | Ga0163163_10260276 | |||
| 2202 | Ga0157380_10077400 | |||
| 2203 | Ga0157380_10168787 | |||
| 2204 | Ga0157380_10324186 | |||
| 2205 | Ga0182008_10058113 | |||
| 2206 | Ga0157379_10007148 | |||
| 2207 | Ga0157379_10059481 | |||
| 2208 | Ga0157379_10108235 | |||
| 2209 | Ga0157379_10116515 | |||
| 2210 | Ga0157376_10029890 | |||
| 2211 | Ga0157376_10050411 | |||
| 2212 | Ga0157376_10097527 | |||
| 2213 | Ga0157376_10137156 | |||
| 2214 | Ga0157376_10162524 | |||
| 2215 | Ga0182006_1003147 | |||
| 2216 | Ga0182006_1052718 | |||
| 2217 | Ga0163161_10007275 | |||
| 2218 | Ga0163161_10074373 | |||
| 2219 | Ga0206354_11288361 | |||
| 2220 | Ga0214544_1009253 | |||
| 2221 | Ga0214542_1000025 | |||
| 2222 | Ga0214545_1000014 | |||
| 2223 | Ga0214543_1000034 | |||
| 2224 | Ga0213874_10021454 | |||
| 2225 | Ga0213876_10000506 | |||
| 2226 | Ga0209148_1000773 | |||
| 2227 | Ga0209233_1016211 | |||
| 2228 | Ga0209455_1002825 | |||
| 2229 | Ga0209130_1000045 | |||
| 2230 | Ga0209675_1002625 | |||
| 2231 | Ga0209025_1000932 | |||
| 2232 | Ga0209564_1000075 | |||
| 2233 | Ga0209564_1015176 | |||
| 2234 | Ga0209758_1000008 | |||
| 2235 | Ga0209758_1000097 | |||
| 2236 | Ga0209758_1000141 | |||
| 2237 | Ga0209758_1000282 | |||
| 2238 | Ga0209758_1002234 | |||
| 2239 | Ga0209758_1008672 | |||
| 2240 | Ga0209758_1011027 | |||
| 2241 | Ga0209758_1011485 | |||
| 2242 | Ga0209758_1032875 | |||
| 2243 | Ga0209256_1002013 | |||
| 2244 | Ga0209256_1002896 | |||
| 2245 | Ga0207426_1000437 | |||
| 2246 | Ga0207426_1001098 | |||
| 2247 | Ga0207426_1007699 | |||
| 2248 | Ga0207426_1011889 | |||
| 2249 | Ga0209257_1005807 | |||
| 2250 | Ga0207656_10042682 | |||
| 2251 | Ga0207653_10011710 | |||
| 2252 | Ga0207682_10001931 | |||
| 2253 | Ga0207682_10075047 | |||
| 2254 | Ga0207682_10089740 | |||
| 2255 | Ga0207692_10002216 | |||
| 2256 | Ga0207692_10094978 | |||
| 2257 | Ga0207692_10150500 | |||
| 2258 | Ga0207642_10008904 | |||
| 2259 | Ga0207710_10006353 | |||
| 2260 | Ga0207710_10035654 | |||
| 2261 | Ga0207688_10050613 | |||
| 2262 | Ga0207688_10071745 | |||
| 2263 | Ga0207680_10176934 | |||
| 2264 | Ga0207647_10016240 | |||
| 2265 | Ga0207699_10003729 | |||
| 2266 | Ga0207699_10004469 | |||
| 2267 | Ga0207645_10001315 | |||
| 2268 | Ga0207645_10029667 | |||
| 2269 | Ga0207643_10000406 | |||
| 2270 | Ga0207643_10131529 | |||
| 2271 | Ga0207643_10147531 | |||
| 2272 | Ga0207684_10003897 | |||
| 2273 | Ga0207684_10013583 | |||
| 2274 | Ga0207684_10013914 | |||
| 2275 | Ga0207684_10014077 | |||
| 2276 | Ga0207684_10018456 | |||
| 2277 | Ga0207684_10206094 | |||
| 2278 | Ga0207654_10002995 | |||
| 2279 | Ga0207654_10015208 | |||
| 2280 | Ga0207654_10062338 | |||
| 2281 | Ga0207707_10000019 | |||
| 2282 | Ga0207707_10035607 | |||
| 2283 | Ga0207707_10153908 | |||
| 2284 | Ga0207695_10000062 | |||
| 2285 | Ga0207671_10000377 | |||
| 2286 | Ga0207671_10183332 | |||
| 2287 | Ga0207671_10190855 | |||
| 2288 | Ga0207693_10015868 | |||
| 2289 | Ga0207693_10021206 | |||
| 2290 | Ga0207693_10054379 | |||
| 2291 | Ga0207693_10107453 | |||
| 2292 | Ga0207693_10144864 | |||
| 2293 | Ga0207663_10013985 | |||
| 2294 | Ga0207663_10061402 | |||
| 2295 | Ga0207663_10074820 | |||
| 2296 | Ga0207663_10100153 | |||
| 2297 | Ga0207660_10015260 | |||
| 2298 | Ga0207660_10019690 | |||
| 2299 | Ga0207660_10129316 | |||
| 2300 | Ga0207660_10216768 | |||
| 2301 | Ga0207657_10000158 | |||
| 2302 | Ga0207657_10059953 | |||
| 2303 | Ga0207646_10002726 | |||
| 2304 | Ga0207646_10008458 | |||
| 2305 | Ga0207646_10010701 | |||
| 2306 | Ga0207646_10080974 | |||
| 2307 | Ga0207646_10082733 | |||
| 2308 | Ga0207646_10084375 | |||
| 2309 | Ga0207646_10212343 | |||
| 2310 | Ga0207681_10003707 | |||
| 2311 | Ga0207681_10015896 | |||
| 2312 | Ga0207681_10107478 | |||
| 2313 | Ga0207681_10212400 | |||
| 2314 | Ga0207650_10001113 | |||
| 2315 | Ga0207650_10002324 | |||
| 2316 | Ga0207650_10029534 | |||
| 2317 | Ga0207650_10031535 | |||
| 2318 | Ga0207650_10069187 | |||
| 2319 | Ga0207659_10000549 | |||
| 2320 | Ga0207659_10005606 | |||
| 2321 | Ga0207659_10030802 | |||
| 2322 | Ga0207659_10191549 | |||
| 2323 | Ga0207659_10210920 | |||
| 2324 | Ga0207687_10014320 | |||
| 2325 | Ga0207700_10014243 | |||
| 2326 | Ga0207700_10042768 | |||
| 2327 | Ga0207700_10065940 | |||
| 2328 | Ga0207700_10250871 | |||
| 2329 | Ga0207664_10044247 | |||
| 2330 | Ga0207664_10096840 | |||
| 2331 | Ga0207664_10191753 | |||
| 2332 | Ga0207644_10010696 | |||
| 2333 | Ga0207644_10013517 | |||
| 2334 | Ga0207644_10112314 | |||
| 2335 | Ga0207644_10164529 | |||
| 2336 | Ga0207690_10003241 | |||
| 2337 | Ga0207690_10200963 | |||
| 2338 | Ga0207706_10065945 | |||
| 2339 | Ga0207706_10085144 | |||
| 2340 | Ga0207706_10148443 | |||
| 2341 | Ga0207686_10031590 | |||
| 2342 | Ga0207709_10013330 | |||
| 2343 | Ga0207709_10016421 | |||
| 2344 | Ga0207709_10026693 | |||
| 2345 | Ga0207709_10099724 | |||
| 2346 | Ga0207670_10090939 | |||
| 2347 | Ga0207669_10002598 | |||
| 2348 | Ga0207669_10016318 | |||
| 2349 | Ga0207669_10050029 | |||
| 2350 | Ga0207704_10024707 | |||
| 2351 | Ga0207704_10101860 | |||
| 2352 | Ga0207704_10164905 | |||
| 2353 | Ga0207665_10001763 | |||
| 2354 | Ga0207691_10000754 | |||
| 2355 | Ga0207691_10002193 | |||
| 2356 | Ga0207691_10002935 | |||
| 2357 | Ga0207691_10004947 | |||
| 2358 | Ga0207691_10011314 | |||
| 2359 | Ga0207691_10013516 | |||
| 2360 | Ga0207691_10087034 | |||
| 2361 | Ga0207711_10020135 | |||
| 2362 | Ga0207711_10085982 | |||
| 2363 | Ga0207711_10096173 | |||
| 2364 | Ga0207711_10262211 | |||
| 2365 | Ga0207711_10302697 | |||
| 2366 | Ga0207689_10001549 | |||
| 2367 | Ga0207689_10008662 | |||
| 2368 | Ga0207689_10016340 | |||
| 2369 | Ga0207689_10025703 | |||
| 2370 | Ga0207689_10036764 | |||
| 2371 | Ga0207689_10126547 | |||
| 2372 | Ga0207661_10002131 | |||
| 2373 | Ga0207661_10024499 | |||
| 2374 | Ga0207661_10038507 | |||
| 2375 | Ga0207661_10066742 | |||
| 2376 | Ga0207679_10002969 | |||
| 2377 | Ga0207679_10006070 | |||
| 2378 | Ga0207679_10024614 | |||
| 2379 | Ga0207679_10059593 | |||
| 2380 | Ga0207679_10068402 | |||
| 2381 | Ga0207679_10080426 | |||
| 2382 | Ga0207667_10017801 | |||
| 2383 | Ga0207651_10000137 | |||
| 2384 | Ga0207651_10004004 | |||
| 2385 | Ga0207651_10004657 | |||
| 2386 | Ga0207651_10023383 | |||
| 2387 | Ga0207668_10188325 | |||
| 2388 | Ga0207640_10117890 | |||
| 2389 | Ga0207658_10099850 | |||
| 2390 | Ga0207658_10165305 | |||
| 2391 | Ga0207677_10043429 | |||
| 2392 | Ga0207677_10143685 | |||
| 2393 | Ga0207703_10007069 | |||
| 2394 | Ga0207703_10012711 | |||
| 2395 | Ga0207703_10069954 | |||
| 2396 | Ga0207703_10113714 | |||
| 2397 | Ga0207703_10214969 | |||
| 2398 | Ga0207639_10032270 | |||
| 2399 | Ga0207639_10045461 | |||
| 2400 | Ga0207639_10072221 | |||
| 2401 | Ga0207639_10188550 | |||
| 2402 | Ga0207678_10001746 | |||
| 2403 | Ga0207678_10002804 | |||
| 2404 | Ga0207678_10021209 | |||
| 2405 | Ga0207678_10037986 | |||
| 2406 | Ga0207678_10056027 | |||
| 2407 | Ga0207678_10074754 | |||
| 2408 | Ga0207708_10006345 | |||
| 2409 | Ga0207708_10043006 | |||
| 2410 | Ga0207708_10066326 | |||
| 2411 | Ga0207708_10167787 | |||
| 2412 | Ga0207702_10004617 | |||
| 2413 | Ga0207702_10050904 | |||
| 2414 | Ga0207702_10139495 | |||
| 2415 | Ga0207641_10037894 | |||
| 2416 | Ga0207641_10092305 | |||
| 2417 | Ga0207641_10346482 | |||
| 2418 | Ga0207648_10001985 | |||
| 2419 | Ga0207648_10008746 | |||
| 2420 | Ga0207648_10010726 | |||
| 2421 | Ga0207648_10020630 | |||
| 2422 | Ga0207648_10030334 | |||
| 2423 | Ga0207648_10042949 | |||
| 2424 | Ga0207648_10047260 | |||
| 2425 | Ga0207648_10066575 | |||
| 2426 | Ga0207648_10127698 | |||
| 2427 | Ga0207648_10232700 | |||
| 2428 | Ga0207676_10006758 | |||
| 2429 | Ga0207676_10063032 | |||
| 2430 | Ga0207676_10092985 | |||
| 2431 | Ga0207676_10104213 | |||
| 2432 | Ga0207674_10002036 | |||
| 2433 | Ga0207674_10004850 | |||
| 2434 | Ga0207675_100006420 | |||
| 2435 | Ga0207675_100022055 | |||
| 2436 | Ga0207683_10001853 | |||
| 2437 | Ga0207683_10004778 | |||
| 2438 | Ga0207683_10005724 | |||
| 2439 | Ga0207683_10007680 | |||
| 2440 | Ga0207683_10108631 | |||
| 2441 | Ga0207698_10019740 | |||
| 2442 | Ga0207698_10060913 | |||
| 2443 | Ga0207698_10084300 | |||
| 2444 | Ga0207698_10128163 | |||
| 2445 | Ga0209389_1000004 | |||
| 2446 | Ga0209589_1000002 | |||
| 2447 | Ga0209489_100002 | |||
| 2448 | Ga0209489_100777 | |||
| 2449 | Ga0209700_100002 | |||
| 2450 | Ga0209700_100013 | |||
| 2451 | Ga0209968_1001306 | |||
| 2452 | Ga0209999_1001517 | |||
| 2453 | Ga0209983_1000879 | |||
| 2454 | Ga0209588_1052615 | |||
| 2455 | Ga0209971_1000005 | |||
| 2456 | Ga0209966_1000010 | |||
| 2457 | Ga0209966_1022387 | |||
| 2458 | Ga0209998_10000729 | |||
| 2459 | Ga0209974_10019491 | |||
| 2460 | Ga0207428_10000503 | |||
| 2461 | Ga0207428_10000526 | |||
| 2462 | Ga0207428_10008432 | |||
| 2463 | Ga0207428_10009239 | |||
| 2464 | Ga0207428_10020041 | |||
| 2465 | Ga0207428_10028626 | |||
| 2466 | Ga0207428_10054947 | |||
| 2467 | Ga0268266_10004621 | |||
| 2468 | Ga0268266_10009307 | |||
| 2469 | Ga0268266_10009873 | |||
| 2470 | Ga0268266_10027379 | |||
| 2471 | Ga0268266_10035847 | |||
| 2472 | Ga0268266_10073968 | |||
| 2473 | Ga0268266_10142020 | |||
| 2474 | Ga0268266_10276123 | |||
| 2475 | Ga0268265_10006468 | |||
| 2476 | Ga0268265_10015922 | |||
| 2477 | Ga0268265_10030405 | |||
| 2478 | Ga0268265_10031131 | |||
| 2479 | Ga0268265_10032954 | |||
| 2480 | Ga0268265_10056453 | |||
| 2481 | Ga0268265_10142675 | |||
| 2482 | Ga0268265_10284337 | |||
| 2483 | Ga0268264_10000042 | |||
| 2484 | Ga0268264_10028575 | |||
| 2485 | Ga0268264_10083907 | |||
| 2486 | Ga0268264_10144047 | |||
| 2487 | Ga0268264_10146314 | |||
| 2488 | Ga0265319_1005086 | |||
| 2489 | Ga0265334_10053462 | |||
| 2490 | Ga0265318_10019017 | |||
| 2491 | Ga0307517_10061999 | |||
| 2492 | Ga0307515_10000034 | |||
| 2493 | Ga0307515_10000043 | |||
| 2494 | Ga0307515_10000658 | |||
| 2495 | Ga0307515_10003847 | |||
| 2496 | Ga0307515_10007630 | |||
| 2497 | Ga0307515_10007679 | |||
| 2498 | Ga0307515_10050509 | |||
| 2499 | Ga0307515_10148183 | |||
| 2500 | Ga0265338_10055019 | |||
| 2501 | Ga0307511_10101318 | |||
| 2502 | Ga0307512_10027620 | |||
| 2503 | Ga0316176_1196748 | |||
| 2504 | Ga0314311_1081389 | |||
| 2505 | Ga0316181_1168214 | |||
| 2506 | Ga0316182_1029803 | |||
| 2507 | Ga0316182_1254532 | |||
| 2508 | Ga0265330_10059230 | |||
| 2509 | Ga0265332_10049273 | |||
| 2510 | Ga0265325_10003069 | |||
| 2511 | Ga0265325_10028296 | |||
| 2512 | Ga0265325_10028299 | |||
| 2513 | Ga0265329_10016424 | |||
| 2514 | Ga0265339_10056436 | |||
| 2515 | Ga0265331_10025045 | |||
| 2516 | Ga0265316_10049711 | |||
| 2517 | Ga0307513_10009436 | |||
| 2518 | Ga0307513_10191686 | |||
| 2519 | Ga0307509_10024775 | |||
| 2520 | Ga0307408_100017573 | |||
| 2521 | Ga0307408_100076577 | |||
| 2522 | Ga0265313_10001744 | |||
| 2523 | Ga0265313_10019983 | |||
| 2524 | Ga0307508_10000029 | |||
| 2525 | Ga0307508_10000254 | |||
| 2526 | Ga0307508_10027341 | |||
| 2527 | Ga0307508_10036036 | |||
| 2528 | Ga0307514_10046015 | |||
| 2529 | Ga0265314_10019737 | |||
| 2530 | Ga0265342_10008945 | |||
| 2531 | Ga0265342_10065595 | |||
| 2532 | Ga0307516_10001248 | |||
| 2533 | Ga0307516_10011266 | |||
| 2534 | Ga0307516_10026325 | |||
| 2535 | Ga0307516_10032423 | |||
| 2536 | Ga0307516_10056391 | |||
| 2537 | Ga0307516_10061322 | |||
| 2538 | Ga0307516_10093389 | |||
| 2539 | Ga0307405_10024902 | |||
| 2540 | Ga0307410_10135643 | |||
| 2541 | Ga0307410_10200494 | |||
| 2542 | Ga0307406_10000237 | |||
| 2543 | Ga0307406_10178370 | |||
| 2544 | Ga0307416_100004867 | |||
| 2545 | Ga0307416_100056947 | |||
| 2546 | Ga0307416_100086696 | |||
| 2547 | Ga0307414_10035490 | |||
| 2548 | Ga0307415_100083837 | |||
| 2549 | Ga0307507_10024242 | |||
| 2550 | Ga0307507_10052067 | |||
| 2551 | Ga0307510_10016828 | |||
| 2552 | Ga0307510_10057391 | |||
| 2553 | Ga0307510_10076408 | |||
| 2554 | Ga0315911_1000004 | |||
| 2555 | Ga0316215_1000806 | |||
| 2556 | Ga0373958_0016674 | |||
| 2557 | Ga0373928_0002368 | |||
| 2558 | Ga0373940_0007439 | |||
| 2559 | Ga0373940_0015176 | |||
| 2560 | Ga0373944_0022195 | |||
| 2561 | Ga0373951_0023048 | |||
| 2562 | Ga0373951_0027357 | |||
| 2563 | Ga0373932_0003971 | |||
| 2564 | Ga0373936_0039328 | |||
| 2565 | Ga0373939_0016010 | |||
| 2566 | Ga0373941_0013234 | |||
| 2567 | Ga0373945_0044148 | |||
| 2568 | Ga0373954_0027979 | |||
| 2569 | Ga0373960_0008472 | |||
| 2570 | Ga0373943_0004760 | |||
| 2571 | Ga0373943_0029106 | |||
| 2572 | Ga0373943_0107525 | |||
| 2573 | Ga0373946_0012322 | |||
| 2574 | Ga0373946_0017680 | |||
| 2575 | Ga0373955_0008914 | |||
| 2576 | Ga0373955_0049971 | |||
| 2577 | Ga0373961_0002541 | |||
| 2578 | Ga0373961_0016865 | |||
| 2579 | Ga0373924_0021101 | |||
| 2580 | Ga0373924_0074369 | |||
| 2581 | Ga0373924_0080923 | |||
| 2582 | Ga0373931_0001091 | |||
| 2583 | Ga0373931_0092916 | |||
| 2584 | Ga0373935_0004029 | |||
| 2585 | Ga0373935_0028466 | |||
| 2586 | Ga0373935_0062673 | |||
| 2587 | Ga0373935_0160183 | |||
| 2588 | Ga0373927_0001617 | |||
| 2589 | Ga0373927_0009798 | |||
| 2590 | Ga0373927_0013714 | |||
| 2591 | Ga0373927_0017298 | |||
| 2592 | Ga0373927_0075038 | |||
| 2593 | Ga0373927_0113251 | |||
| 2594 | Ga0373927_0183081 | |||
| 2595 | Ga0373933_0042619 | |||
| 2596 | Ga0373947_0004404 | |||
| 2597 | Ga0373947_0041394 | |||
| 2598 | Ga0373947_0093017 | |||
| 2599 | Ga0373947_0111534 | |||
| 2600 | Ga0373947_0129524 | |||
| 2601 | Ga0373937_0081009 | |||
| 2602 | Ga0373937_0154375 | |||
| 2603 | Ga0373937_0197618 | |||
| 2604 | Ga0373937_0270565 | |||
| 2605 | Ga0373925_0002598 | |||
| 2606 | Ga0373925_0008312 | |||
| 2607 | Ga0373925_0011431 | |||
| 2608 | Ga0373925_0016597 | |||
| 2609 | Ga0373925_0022159 | |||
| 2610 | Ga0373925_0082144 | |||
| 2611 | Ga0395900_0001273 | |||
| 2612 | Ga0395900_0029419 | |||
| 2613 | Ga0395900_0078677 | |||
| 2614 | Ga0395898_0011222 | |||
| 2615 | Ga0395898_0122261 | |||
| 2616 | Ga0395905_0010802 | |||
| 2617 | Ga0395905_0011753 | |||
| 2618 | Ga0395901_0000813 | |||
| 2619 | Ga0395901_0002416 | |||
| 2620 | Ga0395901_0017486 | |||
| 2621 | Ga0436365_0399885 | |||
| 2622 | Ga0436365_0685473 | |||
| 2623 | Ga0436365_0966736 | |||
| 2624 | Ga0436365_1091064 | |||
| 2625 | Ga0436360_0603982 | |||
| 2626 | Ga0436361_0014467 | |||
| 2627 | Ga0436363_1558913 | |||
| 2628 | Ga0436362_0827926 | |||
| 2629 | Ga0439447_015027 | |||
| 2630 | Ga0439453_0013066 | |||
| 2631 | Ga0439465_0024030 | |||
| 2632 | Ga0451807_1880289 | |||
| 2633 | Ga0451853_4010219 | |||
| 2634 | Ga0439433_0007202 | |||
| 2635 | Ga0439448_0017984 | |||
| 2636 | Ga0439449_0005236 | |||
| 2637 | Ga0439457_018810 | |||
| 2638 | Ga0439458_0024943 | |||
| 2639 | Ga0439434_0003597 | |||
| 2640 | Ga0439435_0001533 | |||
| 2641 | Ga0439435_0022258 | |||
| 2642 | Ga0439459_0008511 | |||
| 2643 | Ga0439464_0002353 | |||
| 2644 | Ga0439460_0000381 | |||
| 2645 | Ga0451577_0001628 | |||
| 2646 | Ga0451577_0023399 | |||
| 2647 | Ga0451577_0034628 | |||
| 2648 | Ga0466972_0000079 | |||
| 2649 | Ga0466972_0004328 | |||
| 2650 | Ga0466972_0062953 | |||
| 2651 | Ga0453683_0006780 | |||
| 2652 | Ga0453683_0015117 | |||
| 2653 | Ga0453683_0091854 | |||
| 2654 | Ga0466966_0001208 | |||
| 2655 | Ga0466961_0000020 | |||
| 2656 | Ga0466963_0028383 | |||
| 2657 | Ga0466963_0047564 | |||
| 2658 | Ga0466964_0023432 | |||
| 2659 | Ga0453684_0117634 | |||
| 2660 | Ga0453684_0124488 | |||
| 2661 | Ga0466968_0001947 | |||
| 2662 | Ga0466957_0040886 | |||
| 2663 | Ga0466957_0118930 | |||
| 2664 | Ga0466960_0000424 | |||
| 2665 | Ga0451576_0042039 | |||
| 2666 | Ga0451576_0049108 | |||
| 2667 | Ga0451576_0053448 | |||
| 2668 | Ga0451576_0106958 | |||
| 2669 | Ga0451576_0120908 | |||
| 2670 | Ga0451576_0134449 | |||
| 2671 | Ga0451576_0198840 | |||
| 2672 | Ga0451576_0335142 | |||
| 2673 | Ga0466967_0053468 | |||
| 2674 | Ga0466967_0054863 | |||
| 2675 | Ga0466967_0118266 | |||
| 2676 | Ga0495603_0000660 | |||
| 2677 | Ga0495603_0033928 | |||
| 2678 | Ga0495603_0044317 | |||
| 2679 | Ga0495603_0063873 | |||
| 2680 | Ga0495629_0000467 | |||
| 2681 | Ga0495629_0006153 | |||
| 2682 | Ga0495629_0008755 | |||
| 2683 | Ga0495638_0007605 | |||
| 2684 | Ga0495650_0025999 | |||
| 2685 | Ga0495580_0001503 | |||
| 2686 | Ga0495580_0001799 | |||
| 2687 | Ga0495580_0003523 | |||
| 2688 | Ga0495580_0003995 | |||
| 2689 | Ga0495580_0148736 | |||
| 2690 | Ga0495582_0000163 | |||
| 2691 | Ga0495582_0087857 | |||
| 2692 | Ga0495639_0000640 | |||
| 2693 | Ga0495662_0000890 | |||
| 2694 | Ga0495664_0006716 | |||
| 2695 | Ga0495664_0008332 | |||
| 2696 | Ga0495664_0018995 | |||
| 2697 | Ga0495594_0001989 | |||
| 2698 | Ga0495594_0019812 | |||
| 2699 | Ga0495594_0052058 | |||
| 2700 | Ga0495606_0005210 | |||
| 2701 | Ga0495608_0023223 | |||
| 2702 | Ga0495610_0049618 | |||
| 2703 | Ga0495610_0049894 | |||
| 2704 | Ga0495616_0044813 | |||
| 2705 | Ga0495616_0102732 | |||
| 2706 | Ga0495618_0099480 | |||
| 2707 | Ga0495630_0002387 | |||
| 2708 | Ga0495630_0188276 | |||
| 2709 | Ga0495632_0061048 | |||
| 2710 | Ga0495666_0023818 | |||
| 2711 | Ga0495642_0026594 | |||
| 2712 | Ga0495652_0014517 | |||
| 2713 | Ga0495652_0017934 | |||
| 2714 | Ga0495652_0048165 | |||
| 2715 | Ga0495652_0146261 | |||
| 2716 | Ga0495665_0000853 | |||
| 2717 | Ga0495665_0032167 | |||
| 2718 | Ga0495665_0047667 | |||
| 2719 | Ga0495640_0046380 | |||
| 2720 | Ga0495640_0054761 | |||
| 2721 | Ga0495586_0023014 | |||
| 2722 | Ga0495586_0160395 | |||
| 2723 | Ga0495609_0020183 | |||
| 2724 | Ga0495621_0003684 | |||
| 2725 | Ga0495621_0025661 | |||
| 2726 | Ga0495597_0049260 | |||
| 2727 | Ga0495645_0084621 | |||
| 2728 | Ga0495645_0176430 | |||
| 2729 | Ga0495667_0015729 | |||
| 2730 | Ga0495668_0013473 | |||
| 2731 | Ga0495668_0038325 | |||
| 2732 | Ga0495668_0070317 | |||
| 2733 | Ga0495634_0001271 | |||
| 2734 | Ga0495634_0032253 | |||
| 2735 | Ga0495634_0056534 | |||
| 2736 | Ga0495634_0068190 | |||
| 2737 | Ga0495625_0001907 | |||
| 2738 | Ga0495625_0088915 | |||
| 2739 | Ga0495635_0001312 | |||
| 2740 | Ga0495635_0002205 | |||
| 2741 | Ga0495635_0044562 | |||
| 2742 | Ga0495659_0050651 | |||
| 2743 | Ga0495588_0033944 | |||
| 2744 | Ga0495588_0135776 | |||
| 2745 | Ga0495657_0005817 | |||
| 2746 | Ga0495599_0060189 | |||
| 2747 | Ga0495623_0010915 | |||
| 2748 | Ga0495646_0009169 | |||
| 2749 | Ga0495647_0000813 | |||
| 2750 | Ga0495647_0041185 | |||
| 2751 | Ga0495658_0000512 | |||
| 2752 | Ga0495658_0020852 | |||
| 2753 | Ga0495669_0009883 | |||
| 2754 | Ga0495669_0022731 | |||
| 2755 | Ga0495613_0002976 | |||
| 2756 | Ga0495613_0021834 | |||
| 2757 | Ga0495624_0118546 | |||
| 2758 | Ga0495649_0015433 | |||
| 2759 | Ga0495600_0011910 | |||
| 2760 | Ga0495581_0002361 | |||
| 2761 | Ga0495581_0104951 | |||
| 2762 | Ga0495604_0002858 | |||
| 2763 | Ga0495604_0007702 | |||
| 2764 | Ga0495636_0027112 | |||
| 2765 | Ga0495674_0013125 | |||
| 2766 | Ga0495674_0013620 | |||
| 2767 | Ga0495674_0032266 | |||
| 2768 | Ga0495674_0041754 | |||
| 2769 | Ga0495674_0098223 | |||
| 2770 | Ga0495674_0103022 | |||
| 2771 | Ga0495674_0141783 | |||
| 2772 | Ga0495672_0023022 | |||
| 2773 | Ga0495676_0015607 | |||
| 2774 | Ga0495676_0077796 | |||
| 2775 | Ga0495680_0040441 | |||
| 2776 | Ga0495683_0043664 | |||
| 2777 | Ga0495684_0004305 | |||
| 2778 | Ga0495684_0074199 | |||
| 2779 | Ga0495686_0051333 | |||
| 2780 | Ga0495593_0000331 | |||
| 2781 | Ga0495593_0005960 | |||
| 2782 | Ga0495593_0070872 | |||
| 2783 | Ga0495602_0021275 | |||
| 2784 | Ga0495602_0021985 | |||
| 2785 | Ga0495602_0156477 | |||
| 2786 | Ga0495626_0024063 | |||
| 2787 | Ga0496100_0055959 | |||
| 2788 | Ga0496101_0144295 | |||
| 2789 | Ga0496102_0086923 | |||
| 2790 | Ga0496103_0088336 | |||
| 2791 | Ga0496103_0109750 | |||
| 2792 | Ga0496104_0001245 | |||
| 2793 | Ga0496104_0011338 | |||
| 2794 | Ga0496106_0002916 | |||
| 2795 | Ga0496106_0015718 | |||
| 2796 | Ga0496106_0142894 | |||
| 2797 | Ga0496106_0261259 | |||
| 2798 | Ga0496107_0026368 | |||
| 2799 | Ga0496107_0211072 | |||
| 2800 | Ga0496108_0011169 | |||
| 2801 | Ga0496109_0002719 | |||
| 2802 | Ga0496109_0124506 | |||
| 2803 | Ga0496109_0124959 | |||
| 2804 | Ga0496109_0152092 | |||
| 2805 | Ga0496109_0398011 | |||
| 2806 | Ga0496111_0026614 | |||
| 2807 | Ga0496112_0010367 | |||
| 2808 | Ga0496112_0116852 | |||
| 2809 | Ga0496113_0046136 | |||
| 2810 | Ga0496113_0051116 | |||
| 2811 | Ga0496114_0025961 | |||
| 2812 | Ga0496114_0100711 | |||
| 2813 | Ga0496114_0312275 | |||
| 2814 | Ga0496116_0008689 | |||
| 2815 | Ga0496118_0008129 | |||
| 2816 | Ga0496118_0050306 | |||
| 2817 | Ga0496119_0003004 | |||
| 2818 | Ga0496119_0086514 | |||
| 2819 | Ga0496119_0107521 | |||
| 2820 | Ga0496120_0006997 | |||
| 2821 | Ga0496120_0032809 | |||
| 2822 | Ga0496121_0002114 | |||
| 2823 | Ga0496121_0017623 | |||
| 2824 | Ga0496121_0023103 | |||
| 2825 | Ga0496121_0064825 | |||
| 2826 | Ga0496121_0114622 | |||
| 2827 | Ga0496121_0155212 | |||
| 2828 | Ga0496124_0001351 | |||
| 2829 | Ga0496124_0224205 | |||
| 2830 | Ga0496124_0230414 | |||
| 2831 | Ga0496125_0022471 | |||
| 2832 | Ga0496125_0032671 | |||
| 2833 | Ga0496126_0006139 | |||
| 2834 | Ga0496126_0026642 | |||
| 2835 | Ga0496126_0034021 | |||
| 2836 | Ga0496126_0056000 | |||
| 2837 | Ga0496126_0067884 | |||
| 2838 | Ga0496126_0068667 | |||
| 2839 | Ga0496126_0088661 | |||
| 2840 | Ga0496126_0105057 | |||
| 2841 | Ga0496126_0195700 | |||
| 2842 | Ga0501031_0021719 | |||
| 2843 | Ga0501031_0047802 | |||
| 2844 | Ga0501033_0001553 | |||
| 2845 | Ga0501033_0006440 | |||
| 2846 | Ga0501033_0011030 | |||
| 2847 | Ga0501033_0171726 | |||
| 2848 | Ga0501033_0208141 | |||
| 2849 | Ga0501034_0022821 | |||
| 2850 | Ga0501034_0092220 | |||
| 2851 | Ga0501034_0206136 | |||
| 2852 | Ga0501034_0297099 | |||
| 2853 | Ga0501036_0001752 | |||
| 2854 | Ga0501036_0006667 | |||
| 2855 | Ga0501036_0067669 | |||
| 2856 | Ga0501036_0206690 | |||
| 2857 | Ga0501037_0002039 | |||
| 2858 | Ga0501037_0017188 | |||
| 2859 | Ga0501037_0107075 | |||
| 2860 | Ga0501037_0240970 | |||
| 2861 | Ga0501038_0003805 | |||
| 2862 | Ga0501038_0057046 | |||
| 2863 | Ga0501038_0191476 | |||
| 2864 | Ga0501039_0000865 | |||
| 2865 | Ga0501039_0059881 | |||
| 2866 | Ga0501039_0077555 | |||
| 2867 | Ga0501039_0120892 | |||
| 2868 | Ga0501039_0193644 | |||
| 2869 | Ga0501039_0234433 | |||
| 2870 | Ga0501039_0240206 | |||
| 2871 | Ga0501039_0254394 | |||
| 2872 | Ga0501040_0194235 | |||
| 2873 | Ga0501040_0195096 | |||
| 2874 | Ga0501041_0024906 | |||
| 2875 | Ga0501041_0051707 | |||
| 2876 | Ga0501041_0085190 | |||
| 2877 | Ga0501041_0167998 | |||
| 2878 | Ga0501042_0002120 | |||
| 2879 | Ga0501042_0040745 | |||
| 2880 | Ga0501042_0071724 | |||
| 2881 | Ga0501042_0265502 | |||
| 2882 | Ga0501043_0001418 | |||
| 2883 | Ga0501043_0002177 | |||
| 2884 | Ga0501043_0010294 | |||
| 2885 | Ga0501043_0024560 | |||
| 2886 | Ga0501043_0039758 | |||
| 2887 | Ga0501043_0150349 | |||
| 2888 | Ga0501043_0155034 | |||
| 2889 | Ga0501046_0001680 | |||
| 2890 | Ga0501046_0050607 | |||
| 2891 | Ga0501046_0080192 | |||
| 2892 | Ga0501046_0156835 | |||
| 2893 | Ga0501046_0179803 | |||
| 2894 | Ga0501047_0004987 | |||
| 2895 | Ga0501047_0045841 | |||
| 2896 | Ga0501047_0084339 | |||
| 2897 | Ga0501047_0116350 | |||
| 2898 | Ga0501047_0140943 | |||
| 2899 | Ga0501047_0176240 | |||
| 2900 | Ga0501048_0007273 | |||
| 2901 | Ga0501048_0010235 | |||
| 2902 | Ga0501048_0010642 | |||
| 2903 | Ga0501048_0011366 | |||
| 2904 | Ga0501048_0053281 | |||
| 2905 | Ga0501048_0089603 | |||
| 2906 | Ga0501048_0118500 | |||
| 2907 | Ga0501067_0002446 | |||
| 2908 | Ga0501067_0030866 | |||
| 2909 | Ga0501067_0045880 | |||
| 2910 | Ga0501068_0010598 | |||
| 2911 | Ga0501068_0021887 | |||
| 2912 | Ga0501068_0080345 | |||
| 2913 | Ga0501069_0002887 | |||
| 2914 | Ga0501069_0024820 | |||
| 2915 | Ga0501069_0053728 | |||
| 2916 | Ga0501070_0006386 | |||
| 2917 | Ga0501070_0021654 | |||
| 2918 | Ga0501070_0276554 | |||
| 2919 | Ga0501071_0001305 | |||
| 2920 | Ga0501071_0024877 | |||
| 2921 | Ga0501071_0052423 | |||
| 2922 | Ga0501072_0016027 | |||
| 2923 | Ga0501072_0077306 | |||
| 2924 | Ga0501072_0150528 | |||
| 2925 | Ga0501072_0163640 | |||
| 2926 | Ga0501073_0013232 | |||
| 2927 | Ga0501073_0084163 | |||
| 2928 | Ga0501073_0199375 | |||
| 2929 | Ga0501074_0001868 | |||
| 2930 | Ga0501074_0026753 | |||
| 2931 | Ga0501074_0032936 | |||
| 2932 | Ga0501074_0045794 | |||
| 2933 | Ga0501074_0065122 | |||
| 2934 | Ga0501075_0017473 | |||
| 2935 | Ga0501075_0031114 | |||
| 2936 | Ga0501075_0034069 | |||
| 2937 | Ga0501075_0132342 | |||
| 2938 | Ga0501076_0014051 | |||
| 2939 | Ga0501076_0017780 | |||
| 2940 | Ga0501076_0029417 | |||
| 2941 | Ga0501076_0043259 | |||
| 2942 | Ga0501076_0115580 | |||
| 2943 | Ga0501076_0132694 | |||
| 2944 | Ga0501076_0148802 | |||
| 2945 | Ga0501077_0015591 | |||
| 2946 | Ga0501077_0026027 | |||
| 2947 | Ga0501077_0031586 | |||
| 2948 | Ga0501077_0033064 | |||
| 2949 | Ga0501077_0097997 | |||
| 2950 | Ga0501077_0145134 | |||
| 2951 | Ga0501249_004137 | |||
| 2952 | Ga0501225_0010347 | |||
| 2953 | Ga0501079_0001542 | |||
| 2954 | Ga0501079_0003813 | |||
| 2955 | Ga0501079_0011309 | |||
| 2956 | Ga0501079_0020988 | |||
| 2957 | Ga0501079_0085214 | |||
| 2958 | Ga0501079_0145497 | |||
| 2959 | Ga0501080_0007581 | |||
| 2960 | Ga0501080_0017651 | |||
| 2961 | Ga0501080_0084578 | |||
| 2962 | Ga0501080_0114015 | |||
| 2963 | Ga0501080_0253186 | |||
| 2964 | Ga0501081_0005169 | |||
| 2965 | Ga0501081_0009148 | |||
| 2966 | Ga0501081_0022757 | |||
| 2967 | Ga0501081_0029605 | |||
| 2968 | Ga0501081_0035335 | |||
| 2969 | Ga0501081_0054447 | |||
| 2970 | Ga0501083_0007474 | |||
| 2971 | Ga0501083_0012144 | |||
| 2972 | Ga0501083_0020189 | |||
| 2973 | Ga0501083_0038161 | |||
| 2974 | Ga0501083_0160417 | |||
| 2975 | Ga0501262_000299 | |||
| 2976 | Ga0501035_0011638 | |||
| 2977 | Ga0501035_0018905 | |||
| 2978 | Ga0501035_0097326 | |||
| 2979 | Ga0501044_0036860 | |||
| 2980 | Ga0501044_0134533 | |||
| 2981 | Ga0501045_0005175 | |||
| 2982 | Ga0501045_0019952 | |||
| 2983 | Ga0501045_0022962 | |||
| 2984 | nmdc:mga03683_580_c1 | |||
| 2985 | nmdc:mga03n38_2842_c1 | |||
| 2986 | nmdc:mga00v17_15536_c1 | |||
| 2987 | nmdc:mga0yw44_52105_c1 | |||
| 2988 | nmdc:mga0yw44_8904_c1 | |||
| 2989 | nmdc:mga0k408_1112_c1 | |||
| 2990 | nmdc:mga0k408_19707_c1 | |||
| 2991 | nmdc:mga0k408_346_c1 | |||
| 2992 | nmdc:mga0k408_7919_c1 | |||
| 2993 | nmdc:mga0k408_9424_c2 | |||
| 2994 | nmdc:mga0k408_9464_c1 | |||
| 2995 | nmdc:mga06z11_15319_c1 | |||
| 2996 | nmdc:mga06z11_41330_c1 | |||
| 2997 | nmdc:mga07m45_14954_c1 | |||
| 2998 | nmdc:mga07m45_4134_c1 | |||
| 2999 | nmdc:mga07m45_55321_c1 | |||
| 3000 | nmdc:mga07m45_9845_c1 | |||
| 3001 | nmdc:mga05p37_101475_c1 | |||
| 3002 | nmdc:mga05p37_104823_c1 | |||
| 3003 | nmdc:mga05p37_11277_c1 | |||
| 3004 | nmdc:mga05p37_13987_c1 | |||
| 3005 | nmdc:mga05p37_14391_c1 | |||
| 3006 | nmdc:mga05p37_152277_c1 | |||
| 3007 | nmdc:mga05p37_180636_c1 | |||
| 3008 | nmdc:mga05p37_24403_c1 | |||
| 3009 | nmdc:mga05p37_24615_c1 | |||
| 3010 | nmdc:mga05p37_2488_c1 | |||
| 3011 | nmdc:mga05p37_3181_c1 | |||
| 3012 | nmdc:mga05p37_3321_c1 | |||
| 3013 | nmdc:mga05p37_340435_c1 | |||
| 3014 | nmdc:mga05p37_47749_c1 | |||
| 3015 | nmdc:mga05p37_54345_c1 | |||
| 3016 | nmdc:mga05p37_55103_c2 | |||
| 3017 | nmdc:mga05p37_579593_c1 | |||
| 3018 | nmdc:mga05p37_61882_c1 | |||
| 3019 | nmdc:mga05p37_64428_c1 | |||
| 3020 | nmdc:mga05p37_69165_c1 | |||
| 3021 | nmdc:mga05p37_7536_c1 | |||
| 3022 | nmdc:mga05p37_75434_c1 | |||
| 3023 | nmdc:mga05p37_90235_c1 | |||
| 3024 | nmdc:mga09592_132745_c1 | |||
| 3025 | nmdc:mga09592_133468_c1 | |||
| 3026 | nmdc:mga09592_30120_c1 | |||
| 3027 | nmdc:mga09592_37965_c1 | |||
| 3028 | nmdc:mga09592_4918_c1 | |||
| 3029 | nmdc:mga09592_55671_c1 | |||
| 3030 | nmdc:mga09592_83192_c1 | |||
| 3031 | nmdc:mga09592_8656_c1 | |||
| 3032 | nmdc:mga0qj67_207947_c1 | |||
| 3033 | nmdc:mga0qj67_21731_c1 | |||
| 3034 | nmdc:mga0qj67_31254_c1 | |||
| 3035 | nmdc:mga0qj67_39740_c1 | |||
| 3036 | nmdc:mga0qj67_5521_c1 | |||
| 3037 | nmdc:mga0qj67_58392_c1 | |||
| 3038 | nmdc:mga0qj67_64776_c1 | |||
| 3039 | nmdc:mga0qj67_85883_c1 | |||
| 3040 | nmdc:mga06r32_108008_c1 | |||
| 3041 | nmdc:mga06r32_142293_c1 | |||
| 3042 | nmdc:mga06r32_142_c1 | |||
| 3043 | nmdc:mga06r32_15351_c1 | |||
| 3044 | nmdc:mga06r32_155752_c1 | |||
| 3045 | nmdc:mga06r32_211788_c1 | |||
| 3046 | nmdc:mga06r32_302851_c1 | |||
| 3047 | nmdc:mga06r32_32305_c1 | |||
| 3048 | nmdc:mga06r32_383449_c1 | |||
| 3049 | nmdc:mga06r32_52270_c1 | |||
| 3050 | nmdc:mga06r32_58496_c1 | |||
| 3051 | nmdc:mga06r32_6124_c1 | |||
| 3052 | nmdc:mga06r32_9269_c1 | |||
| 3053 | nmdc:mga06r32_9276_c1 | |||
| 3054 | nmdc:mga06r32_93765_c1 | |||
| 3055 | nmdc:mga08y16_112136_c1 | |||
| 3056 | nmdc:mga08y16_155353_c1 | |||
| 3057 | nmdc:mga08y16_204_c3 | |||
| 3058 | nmdc:mga08y16_250_c1 | |||
| 3059 | nmdc:mga08y16_25309_c1 | |||
| 3060 | nmdc:mga08y16_2965_c1 | |||
| 3061 | nmdc:mga08y16_51069_c1 | |||
| 3062 | nmdc:mga08y16_6645_c1 | |||
| 3063 | nmdc:mga08y16_84543_c1 | |||
| 3064 | nmdc:mga08y16_95168_c1 | |||
| 3065 | nmdc:mga0n895_101627_c1 | |||
| 3066 | nmdc:mga0n895_10268_c1 | |||
| 3067 | nmdc:mga0n895_112705_c1 | |||
| 3068 | nmdc:mga0n895_12893_c1 | |||
| 3069 | nmdc:mga0n895_131382_c1 | |||
| 3070 | nmdc:mga0n895_160692_c1 | |||
| 3071 | nmdc:mga0n895_169523_c1 | |||
| 3072 | nmdc:mga0n895_20353_c1 | |||
| 3073 | nmdc:mga0n895_248652_c1 | |||
| 3074 | nmdc:mga0n895_25698_c1 | |||
| 3075 | nmdc:mga0n895_3178_c1 | |||
| 3076 | nmdc:mga0n895_419_c1 | |||
| 3077 | nmdc:mga0n895_60203_c1 | |||
| 3078 | nmdc:mga0n895_803_c1 | |||
| 3079 | nmdc:mga0n895_81600_c1 | |||
| 3080 | nmdc:mga0rr50_108557_c1 | |||
| 3081 | nmdc:mga0rr50_13755_c1 | |||
| 3082 | nmdc:mga0rr50_23455_c1 | |||
| 3083 | nmdc:mga0rr50_37460_c1 | |||
| 3084 | nmdc:mga08x19_1474_c1 | |||
| 3085 | nmdc:mga0a205_116472_c1 | |||
| 3086 | nmdc:mga0a205_144871_c1 | |||
| 3087 | nmdc:mga0a205_151348_c1 | |||
| 3088 | nmdc:mga0a205_1651_c1 | |||
| 3089 | nmdc:mga0a205_16932_c1 | |||
| 3090 | nmdc:mga0a205_17702_c1 | |||
| 3091 | nmdc:mga0a205_18222_c1 | |||
| 3092 | nmdc:mga0a205_20683_c1 | |||
| 3093 | nmdc:mga0a205_211118_c1 | |||
| 3094 | nmdc:mga0a205_3138_c2 | |||
| 3095 | nmdc:mga0a205_31482_c1 | |||
| 3096 | nmdc:mga0a205_334431_c1 | |||
| 3097 | nmdc:mga0a205_40438_c1 | |||
| 3098 | nmdc:mga0a205_756_c1 | |||
| 3099 | nmdc:mga0a205_7684_c2 | |||
| 3100 | Ga0495601_0141072 | |||
| 3101 | Ga0495612_0024110 | |||
| 3102 | Ga0495619_0048113 | |||
| 3103 | Ga0495619_0077485 | |||
| 3104 | Ga0500578_0035295 | |||
| 3105 | Ga0500643_000018 | |||
| 3106 | Ga0500651_0016981 | |||
| 3107 | Ga0500566_0000038 | |||
| 3108 | Ga0500566_0003392 | |||
| 3109 | Ga0500640_007905 | |||
| 3110 | Ga0500640_021426 | |||
| 3111 | Ga0500641_0003063 | |||
| 3112 | Ga0500641_0012847 | |||
| 3113 | Ga0500554_000388 | |||
| 3114 | Ga0500555_001110 | |||
| 3115 | Ga0500556_0032311 | |||
| 3116 | Ga0500557_000008 | |||
| 3117 | Ga0500562_011823 | |||
| 3118 | Ga0500572_000010 | |||
| 3119 | Ga0500572_009784 | |||
| 3120 | Ga0500595_000414 | |||
| 3121 | Ga0500595_003164 | |||
| 3122 | Ga0500595_014908 | |||
| 3123 | Ga0500595_023353 | |||
| 3124 | Ga0500614_000527 | |||
| 3125 | Ga0500642_0024247 | |||
| 3126 | Ga0500559_0001128 | |||
| 3127 | Ga0500559_0001831 | |||
| 3128 | Ga0500568_0041774 | |||
| 3129 | Ga0500573_0025983 | |||
| 3130 | Ga0500590_027576 | |||
| 3131 | Ga0500603_000506 | |||
| 3132 | Ga0500603_001672 | |||
| 3133 | Ga0500604_0018315 | |||
| 3134 | Ga0500616_0010066 | |||
| 3135 | Ga0500616_0067602 | |||
| 3136 | Ga0500620_011369 | |||
| 3137 | Ga0500622_0043388 | |||
| 3138 | Ga0500630_017682 | |||
| 3139 | Ga0500639_000034 | |||
| 3140 | Ga0500636_0000618 | |||
| 3141 | Ga0500636_0030876 | |||
| 3142 | Ga0500636_0063419 | |||
| 3143 | Ga0500636_0118470 | |||
| 3144 | Ga0500637_0001326 | |||
| 3145 | Ga0500637_0074915 | |||
| 3146 | Ga0500637_0100285 | |||
| 3147 | Ga0500625_004205 | |||
| 3148 | Ga0500645_002184 | |||
| 3149 | Ga0500645_019887 | |||
| 3150 | Ga0500609_002717 | |||
| 3151 | Ga0500552_001233 | |||
| 3152 | Ga0500596_001579 | |||
| 3153 | Ga0500601_001069 | |||
| 3154 | Ga0501084_0002479 | |||
| 3155 | Ga0501084_0002704 | |||
| 3156 | Ga0501084_0003774 | |||
| 3157 | Ga0501084_0010622 | |||
| 3158 | Ga0501084_0060361 | |||
| 3159 | Ga0501084_0072728 | |||
| 3160 | Ga0501084_0150206 | |||
| 3161 | Ga0501084_0362235 | |||
| 3162 | Ga0500661_001493 | |||
| 3163 | Ga0590071_008059 | |||
| 3164 | Ga0587077_010797 | |||
| 3165 | Ga0587082_008852 | |||
| 3166 | Ga0587111_0013118 | |||
| 3167 | Ga0587111_0016186 | |||
| 3168 | Ga0501082_0001991 | |||
| 3169 | Ga0501082_0003830 | |||
| 3170 | Ga0501082_0004398 | |||
| 3171 | Ga0501082_0012904 | |||
| 3172 | Ga0501082_0032420 | |||
| 3173 | Ga0501082_0050516 | |||
| 3174 | Ga0501082_0094844 | |||
| 3175 | Ga0501082_0120666 | |||
| 3176 | Ga0501082_0199776 | |||
| 3177 | Ga0530510_0018987 | |||
| 3178 | Ga0530510_0218526 | |||
| 3179 | 2507510851 | |||
| 3180 | 2508544668 | |||
| 3181 | 2508697116 | |||
| 3182 | 2511395630 | |||
| 3183 | 2513623858 | |||
| 3184 | 2513637639 | |||
| 3185 | 2513649508 | |||
| 3186 | 2513655816 | |||
| 3187 | 2513696483 | |||
| 3188 | 2513704248 | |||
| 3189 | 2513719326 | |||
| 3190 | 2513856688 | |||
| 3191 | 2513874504 | |||
| 3192 | 2513917271 | |||
| 3193 | 2515630720 | |||
| 3194 | 2517100423 | |||
| 3195 | 2517895445 | |||
| 3196 | 2524437284 | |||
| 3197 | 2528855277 | |||
| 3198 | 2587754296 | |||
| 3199 | 2617377971 | |||
| 3200 | 2644727632 | |||
| 3201 | 2644743777 | |||
| 3202 | 2671122121 | |||
| 3203 | 2723842989 | |||
| 3204 | 2745076753 | |||
| 3205 | 2793065128 | |||
| 3206 | 2793069424 | |||
| 3207 | 2793082456 | |||
| 3208 | 2805916499 | |||
| 3209 | 2818237978 | |||
| 3210 | 2824601530 | |||
| 3211 | 2824617198 | |||
| 3212 | 2824619009 | |||
| 3213 | 2824627471 | |||
| 3214 | 2824637855 | |||
| 3215 | 2824644637 | |||
| 3216 | 2824653661 | |||
| 3217 | 2824663033 | |||
| 3218 | 2824673183 | |||
| 3219 | 2824680524 | |||
| 3220 | 2824689903 | |||
| 3221 | 2824698032 | |||
| 3222 | 2824709867 | |||
| 3223 | 2824715833 | |||
| 3224 | 2824724223 | |||
| 3225 | 2824746241 | |||
| 3226 | 2824757000 | |||
| 3227 | 2824770128 | |||
| 3228 | 2824778528 | |||
| 3229 | 2838129781 | |||
| 3230 | 2841764903 | |||
| 3231 | 2841917038 | |||
| 3232 | 2841922659 | |||
| 3233 | 2841943043 | |||
| 3234 | 2841956720 | |||
| 3235 | 2841960377 | |||
| 3236 | 2841968323 | |||
| 3237 | 2841976471 | |||
| 3238 | 2841987838 | |||
| 3239 | 2842042848 | |||
| 3240 | 2842050889 | |||
| 3241 | 2842680379 | |||
| 3242 | 2844107649 | |||
| 3243 | 2844317089 | |||
| 3244 | 2847938421 | |||
| 3245 | 2847944386 | |||
| 3246 | 2849081381 | |||
| 3247 | 2851183600 | |||
| 3248 | 2851249755 | |||
| 3249 | 2857512038 | |||
| 3250 | 2874597566 | |||
| 3251 | 2874616623 | |||
| 3252 | 2874630477 | |||
| 3253 | 2874649129 | |||
| 3254 | 2876768048 | |||
| 3255 | 2876774961 | |||
| 3256 | 2876822287 | |||
| 3257 | 2879078049 | |||
| 3258 | 2879088657 | |||
| 3259 | 2879104000 | |||
| 3260 | 2879132400 | |||
| 3261 | 2879145301 | |||
| 3262 | 2885194550 | |||
| 3263 | 2885367067 | |||
| 3264 | 2885382179 | |||
| 3265 | 2885416486 | |||
| 3266 | 2888381704 | |||
| 3267 | 2888388935 | |||
| 3268 | 2888422088 | |||
| 3269 | 2894241291 | |||
| 3270 | 2903735056 | |||
| 3271 | 2903751326 | |||
| 3272 | 2904667627 | |||
| 3273 | 2904698790 | |||
| 3274 | 2904719036 | |||
| 3275 | 2906604172 | |||
| 3276 | 2906615935 | |||
| 3277 | 2906635156 | |||
| 3278 | 2906639031 | |||
| 3279 | 2906647983 | |||
| 3280 | 2906662079 | |||
| 3281 | 2908740949 | |||
| 3282 | 2908758041 | |||
| 3283 | 2917701040 | |||
| 3284 | 2919467419 | |||
| 3285 | 2922367073 | |||
| 3286 | 2922371389 | |||
| 3287 | 2922390148 | |||
| 3288 | 2922393725 | |||
| 3289 | 2929523925 | |||
| 3290 | 2929623238 | |||
| 3291 | 2929630918 | |||
| 3292 | 2932786094 | |||
| 3293 | 2932799142 | |||
| 3294 | 2932803935 | |||
| 3295 | 2932811964 | |||
| 3296 | 2932822550 | |||
| 3297 | 2932831137 | |||
| 3298 | 2933585142 | |||
| 3299 | 2935612927 | |||
| 3300 | 2935624077 | |||
| 3301 | 2935631030 | |||
| 3302 | 2935640277 | |||
| 3303 | 2935666885 | |||
| 3304 | 2935684351 | |||
| 3305 | 2935691343 | |||
| 3306 | 2935699902 | |||
| 3307 | 2935704640 | |||
| 3308 | 2935719177 | |||
| 3309 | 2935729223 | |||
| 3310 | 2935737536 | |||
| 3311 | 2935746912 | |||
| 3312 | 2935758289 | |||
| 3313 | 2935762460 | |||
| 3314 | 2935777288 | |||
| 3315 | 2935780393 | |||
| 3316 | 2935793208 | |||
| 3317 | 2935801196 | |||
| 3318 | 2935803957 | |||
| 3319 | 2935811876 | |||
| 3320 | 2935824415 | |||
| 3321 | 2935829760 | |||
| 3322 | 2935842883 | |||
| 3323 | 2935852440 | |||
| 3324 | 2935862423 | |||
| 3325 | 2935870558 | |||
| 3326 | 2935881140 | |||
| 3327 | 2935884259 | |||
| 3328 | 2935912413 | |||
| 3329 | 2935921754 | |||
| 3330 | 2935929698 | |||
| 3331 | 2935938930 | |||
| 3332 | 2935948235 | |||
| 3333 | 2935954959 | |||
| 3334 | 2935962227 | |||
| 3335 | 2935972007 | |||
| 3336 | 2935979345 | |||
| 3337 | 2935988080 | |||
| 3338 | 2935993637 | |||
| 3339 | 2936004533 | |||
| 3340 | 2936038459 | |||
| 3341 | 2936059369 | |||
| 3342 | 2940563801 | |||
| 3343 | 2941507682 | |||
| 3344 | 2941516109 | |||
| 3345 | 2941523183 | |||
| 3346 | 2941533861 | |||
| 3347 | 2941544132 | |||
| 3348 | 2945947880 | |||
| 3349 | 2954768171 | |||
| 3350 | 3005476884 | |||
| 3351 | 3005485353 | |||
| 3352 | 3005507277 | |||
| 3353 | 3005594637 | |||
| 3354 | 3005596721 | |||
| 3355 | 3005712790 | |||
| 3356 | 8006929068 | |||
| 3357 | 8006934533 | |||
| 3358 | 8006966611 | |||
| 3359 | 8006974503 | |||
| 3360 | 8006989457 | |||
| 3361 | 8006997924 | |||
| 3362 | 8016516240 | |||
| 3363 | 8016523636 | |||
| 3364 | 8016537155 | |||
| 3365 | 8016541414 | |||
| 3366 | 8016551838 | |||
| 3367 | 8016560220 | |||
| 3368 | 8016566807 | |||
| 3369 | 8016579540 | |||
| 3370 | 8016589315 | |||
| 3371 | 8016598138 | |||
| 3372 | 8016604278 | |||
| 3373 | 8016620863 | |||
| 3374 | 8016629125 | |||
| 3375 | 8016633662 | |||
| 3376 | 8017060292 | |||
| 3377 | 8019542682 | |||
| 3378 | 8019548057 | |||
| 3379 | 8019564144 | |||
| 3380 | 8019574220 | |||
| 3381 | 8019579819 | |||
| 3382 | 8019587525 | |||
| 3383 | 8019603813 | |||
| 3384 | 8019614725 | |||
| 3385 | 8019636846 | |||
| 3386 | 8019642759 | |||
| 3387 | 8019649832 | |||
| 3388 | 8019664669 | |||
| 3389 | 8019674258 | |||
| 3390 | 8019681862 | |||
| 3391 | 8019693925 | |||
| 3392 | 8055748974 | |||
| 3393 | 8056674952 | |||
| 3394 | 8056694584 | |||
| 3395 | 8056972012 | |||
| 3396 | 8057533070 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3e5z-assembly2.cif.gz_B | x-ray structure of the putative gluconolactonase in protein family pf08450. northeast structural genomics consortium target drr130. | 0.9035 | 60 | 388 |
| 3e5z-assembly2.cif.gz_B | x-ray structure of the putative gluconolactonase in protein family pf08450. northeast structural genomics consortium target drr130. | 0.8945 | 60 | 388 |
| 3dr2-assembly1.cif.gz_A | structural and functional analyses of xc5397 from xanthomonas campestris: a gluconolactonase important in glucose secondary metabolic pathways | 0.8721 | 60 | 382 |
| 3dr2-assembly1.cif.gz_B | structural and functional analyses of xc5397 from xanthomonas campestris: a gluconolactonase important in glucose secondary metabolic pathways | 0.831 | 47 | 382 |
| 3dr2-assembly1.cif.gz_B | structural and functional analyses of xc5397 from xanthomonas campestris: a gluconolactonase important in glucose secondary metabolic pathways | 0.8202 | 47 | 382 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3e5zB00 | Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain | 0.9025 | 60 | 388 | 2.120.10.30 |
| 3e5zB00 | Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain | 0.8935 | 60 | 388 | 2.120.10.30 |
| 3dr2A00 | Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain | 0.8721 | 60 | 382 | 2.120.10.30 |
| 3dr2A00 | Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain | 0.8184 | 60 | 382 | 2.120.10.30 |
| af_A0A1D6MZQ1_4_154_2.120.10.30 | Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain | 0.8033 | 87 | 187 | 2.120.10.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0S6UZS5-F1-model_v4 | Gluconolactonase | 0.9899 | 43 | 390 |
GO:0016787
|
| AF-A0A529X5G7-F1-model_v4 | SMP-30/gluconolactonase/LRE family protein | 0.9896 | 63 | 154 |
GO:0016787
|
| AF-A0A1Q7ZQ57-F1-model_v4 | Gluconolactonase | 0.9872 | 60 | 390 |
GO:0016787
|
| AF-A0A3S1QCC4-F1-model_v4 | deleted | 0.9868 | 63 | 199 |
|
| AF-A0A529MUM4-F1-model_v4 | SMP-30/gluconolactonase/LRE family protein | 0.9868 | 78 | 193 |
GO:0016787
|