F495442

General Info

Members Datasets Scaffolds Average Seq Length
1713 410 1712 236

Family's Representative Sequence

Representative Sequence 3300037418|Ga0395900_0060829|Ga0395900_0060829_1804_2553
Length 249
Sequence MSDLRSTIALVTGATGGLGDAICRRLAADGASVVATDLDGDACAELVAGLPEPGRHLALAQDVSSEPVWVDVVAAVRERYGRLDGLVNNAGIGGMAAVTEETRELWDRIVGVDQTGVWLGMKHAGALIEEQGGSIVNISSILGIGGGLGNSAAYAAAKGAVTNLTKNAALHWAQRGVRVNSVHPGFIGTRQLRERFEGSERHAAMLANTPMGRLGRAEEIAGVVAFLLSADASYMTGSEVRVDGGWSAR

Samples

Sample ID Description Type Environment
1 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
2 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
71 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
72 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
73 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
74 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
75 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
76 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
77 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
78 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
79 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
80 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
81 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
83 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
84 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
85 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
86 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
87 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
88 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
89 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
90 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
92 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
93 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
95 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
96 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
98 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
99 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
100 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
101 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
102 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
103 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
104 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
105 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
106 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
107 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
108 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
109 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
110 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
111 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
112 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
113 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
114 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
115 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
116 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
117 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
118 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
119 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
120 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
121 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
122 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
123 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
125 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
126 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
127 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
128 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
129 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
130 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
191 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
194 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
195 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
196 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
197 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
198 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
199 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
200 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
201 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
202 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
203 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
204 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
205 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
206 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
207 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
208 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
209 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
210 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
211 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
212 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
213 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
214 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
215 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
216 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
217 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
218 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
219 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
220 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
221 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
222 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
223 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
224 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
225 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
226 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
227 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
228 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
229 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
230 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
231 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
232 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
233 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
234 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
235 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
236 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
237 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
238 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
239 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
240 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
241 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
242 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
243 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
244 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
245 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
246 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
247 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
248 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
249 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
250 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
251 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
252 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
253 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
254 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
255 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
256 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
257 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
258 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
259 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
260 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
261 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
262 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
263 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
264 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
265 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
266 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
267 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
268 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
269 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
270 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
271 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
272 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
273 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
274 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
275 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
276 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
277 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
278 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
279 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
280 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
281 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
282 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
283 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
284 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
285 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
286 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
287 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
288 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
289 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
290 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
291 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
292 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
293 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
294 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
295 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
296 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
297 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
298 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
299 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
300 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
301 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
302 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
303 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
304 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
305 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
306 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
307 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
308 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
309 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
310 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
311 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
312 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
313 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
314 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
315 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
316 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
317 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
318 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
319 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
320 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
321 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
322 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
323 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
324 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
325 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
326 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
327 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
328 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
329 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
330 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
331 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
332 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
333 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
334 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
335 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
336 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
337 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
338 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
339 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
340 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
341 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
342 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
343 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
344 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
345 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
346 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
347 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
348 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
349 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
350 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
351 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
352 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
353 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
354 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
355 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
356 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
357 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
358 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
359 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
360 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
361 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
362 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
363 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
364 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
365 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
366 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
367 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
368 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
369 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
370 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
371 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
372 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
373 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
374 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
375 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
376 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
377 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
378 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
379 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
380 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
381 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
382 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
383 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
384 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
385 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
386 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
387 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
388 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
389 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
390 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
391 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
392 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
393 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
394 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
395 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
396 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
397 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
398 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
399 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
400 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
401 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
402 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
403 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
404 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
405 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
406 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
407 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
408 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
409 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
410 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.77
Metatranscriptomes 1.17
Isolates 0.06

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.29
Nodule 0
Rhizoplane 9.69
Rhizosphere 89.03
Stem 0
Stem Tuber 0
Unclassified 0.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24738J21930_10010732 3300002075 Bacteria 2031
2 JGI24751J29686_10013690 3300002459 Bacteria 1674
3 JGI24751J29686_10048937 3300002459 Bacteria 872
4 Ga0070658_10019227 3300005327 Bacteria 5472
5 Ga0070658_10020064 3300005327 Bacteria 5354
6 Ga0070658_10159068 3300005327 Bacteria 1895
7 Ga0070658_10421084 3300005327 Bacteria 1148
8 Ga0070683_100002072 3300005329 Bacteria 15836
9 Ga0070683_100007870 3300005329 Bacteria 9029
10 Ga0070683_100010140 3300005329 Bacteria 8088
11 Ga0070683_100045200 3300005329 Bacteria 4064
12 Ga0070683_100063331 3300005329 Bacteria 3440
13 Ga0070683_100081404 3300005329 Bacteria 3031
14 Ga0070683_100086566 3300005329 Bacteria 2937
15 Ga0070683_100089050 3300005329 Bacteria 2896
16 Ga0070683_100154293 3300005329 Bacteria 2178
17 Ga0070683_100289348 3300005329 Bacteria 1558
18 Ga0070683_100547255 3300005329 Bacteria 1107
19 Ga0070670_100001416 3300005331 Bacteria 19282
20 Ga0068869_100091468 3300005334 Bacteria 2289
21 Ga0068869_100172177 3300005334 Bacteria 1692
22 Ga0068869_100278082 3300005334 Bacteria 1345
23 Ga0070680_100006781 3300005336 Bacteria 8725
24 Ga0070680_100020164 3300005336 Bacteria 5290
25 Ga0070680_100048093 3300005336 Bacteria 3475
26 Ga0070680_100132175 3300005336 Bacteria 2089
27 Ga0070682_100063645 3300005337 Bacteria 2339
28 Ga0070682_100074407 3300005337 Bacteria 2181
29 Ga0070682_100151893 3300005337 Bacteria 1590
30 Ga0068868_100111670 3300005338 Bacteria 2222
31 Ga0068868_100631760 3300005338 Bacteria 952
32 Ga0070660_100002486 3300005339 Bacteria 12647
33 Ga0070660_100002517 3300005339 Bacteria 12559
34 Ga0070660_100005102 3300005339 Bacteria 9068
35 Ga0070660_100009052 3300005339 Bacteria 6987
36 Ga0070660_100012639 3300005339 Bacteria 6033
37 Ga0070660_100013951 3300005339 Bacteria 5781
38 Ga0070660_100104593 3300005339 Bacteria 2246
39 Ga0070660_100116289 3300005339 Bacteria 2133
40 Ga0070660_100266808 3300005339 Bacteria 1399
41 Ga0070689_100035158 3300005340 Bacteria 3827
42 Ga0070689_100299351 3300005340 Bacteria 1338
43 Ga0070687_100045336 3300005343 Bacteria 2245
44 Ga0070661_100021782 3300005344 Bacteria 4583
45 Ga0070661_100031225 3300005344 Bacteria 3850
46 Ga0070661_100069540 3300005344 Bacteria 2588
47 Ga0070661_100077423 3300005344 Bacteria 2452
48 Ga0070692_10435773 3300005345 Bacteria 835
49 Ga0070669_100221327 3300005353 Bacteria 1497
50 Ga0070675_100166623 3300005354 Bacteria 1898
51 Ga0070675_100264866 3300005354 Bacteria 1507
52 Ga0070671_100004752 3300005355 Bacteria 10790
53 Ga0070671_100127284 3300005355 Bacteria 2145
54 Ga0070671_100127740 3300005355 Bacteria 2141
55 Ga0070671_100146523 3300005355 Bacteria 1993
56 Ga0070671_100475108 3300005355 Bacteria 1074
57 Ga0070674_100069973 3300005356 Bacteria 2477
58 Ga0070673_100090034 3300005364 Bacteria 2506
59 Ga0070673_100123227 3300005364 Bacteria 2165
60 Ga0070673_100253437 3300005364 Bacteria 1535
61 Ga0070673_100433678 3300005364 Bacteria 1180
62 Ga0070688_100015217 3300005365 Bacteria 4370
63 Ga0070688_100269795 3300005365 Bacteria 1219
64 Ga0070659_100049468 3300005366 Bacteria 3306
65 Ga0070659_100057058 3300005366 Bacteria 3078
66 Ga0070659_100629230 3300005366 Bacteria 924
67 Ga0070667_100011855 3300005367 Bacteria 7209
68 Ga0070703_10007863 3300005406 Bacteria 3000
69 Ga0070709_10021663 3300005434 Bacteria 3746
70 Ga0070709_10074253 3300005434 Bacteria 2203
71 Ga0070709_10090640 3300005434 Bacteria 2016
72 Ga0070709_10278376 3300005434 Bacteria 1215
73 Ga0070709_10299336 3300005434 Bacteria 1174
74 Ga0070714_100001442 3300005435 Bacteria 17314
75 Ga0070714_100001730 3300005435 Bacteria 15912
76 Ga0070714_100008154 3300005435 Bacteria 8164
77 Ga0070714_100029368 3300005435 Bacteria 4571
78 Ga0070714_100046659 3300005435 Bacteria 3676
79 Ga0070714_100080782 3300005435 Bacteria 2829
80 Ga0070714_100087572 3300005435 Bacteria 2724
81 Ga0070714_100131290 3300005435 Bacteria 2239
82 Ga0070714_100257608 3300005435 Bacteria 1615
83 Ga0070714_100455454 3300005435 Bacteria 1216
84 Ga0070714_100793960 3300005435 Bacteria 916
85 Ga0070714_100909632 3300005435 Bacteria 854
86 Ga0070713_100027513 3300005436 Bacteria 4477
87 Ga0070713_100076003 3300005436 Bacteria 2851
88 Ga0070713_100150729 3300005436 Bacteria 2068
89 Ga0070713_100160306 3300005436 Bacteria 2007
90 Ga0070713_100879074 3300005436 Bacteria 861
91 Ga0070710_10004523 3300005437 Bacteria 6575
92 Ga0070710_10006096 3300005437 Bacteria 5768
93 Ga0070710_10009817 3300005437 Bacteria 4690
94 Ga0070710_10013834 3300005437 Bacteria 4049
95 Ga0070710_10016900 3300005437 Bacteria 3724
96 Ga0070701_10044671 3300005438 Bacteria 2270
97 Ga0070701_10109559 3300005438 Bacteria 1541
98 Ga0070711_100004075 3300005439 Bacteria 8592
99 Ga0070711_100046673 3300005439 Bacteria 2952
100 Ga0070705_100009442 3300005440 Bacteria 4850
101 Ga0070705_100256079 3300005440 Bacteria 1231
102 Ga0070705_100286785 3300005440 Bacteria 1173
103 Ga0070705_100759228 3300005440 Bacteria 767
104 Ga0070700_100533263 3300005441 Bacteria 909
105 Ga0070708_100030533 3300005445 Bacteria 4658
106 Ga0070708_100042939 3300005445 Bacteria 3972
107 Ga0070708_100136970 3300005445 Bacteria 2269
108 Ga0070708_100163863 3300005445 Bacteria 2073
109 Ga0070708_100436248 3300005445 Bacteria 1236
110 Ga0070663_100143782 3300005455 Bacteria 1823
111 Ga0070678_100010494 3300005456 Bacteria 5664
112 Ga0070678_100067680 3300005456 Bacteria 2659
113 Ga0070678_100112014 3300005456 Bacteria 2136
114 Ga0070678_100273528 3300005456 Bacteria 1425
115 Ga0070662_100066544 3300005457 Bacteria 2644
116 Ga0070681_10007863 3300005458 Bacteria 10431
117 Ga0070681_10010530 3300005458 Bacteria 9131
118 Ga0070681_10010706 3300005458 Bacteria 9062
119 Ga0070681_10013095 3300005458 Bacteria 8236
120 Ga0070681_10027297 3300005458 Bacteria 5739
121 Ga0070681_10051784 3300005458 Bacteria 4094
122 Ga0070681_10087262 3300005458 Bacteria 3073
123 Ga0070681_10106566 3300005458 Bacteria 2744
124 Ga0070681_10175059 3300005458 Bacteria 2067
125 Ga0070681_10245707 3300005458 Bacteria 1702
126 Ga0070681_10462153 3300005458 Bacteria 1181
127 Ga0068867_100041467 3300005459 Bacteria 3364
128 Ga0068867_100048517 3300005459 Bacteria 3124
129 Ga0068867_100079080 3300005459 Bacteria 2474
130 Ga0070685_10003914 3300005466 Bacteria 7525
131 Ga0070685_10005718 3300005466 Bacteria 6315
132 Ga0070685_10201953 3300005466 Bacteria 1293
133 Ga0070706_100349477 3300005467 Bacteria 1378
134 Ga0070706_100772799 3300005467 Bacteria 890
135 Ga0070707_100001128 3300005468 Bacteria 26352
136 Ga0070707_100001488 3300005468 Bacteria 22852
137 Ga0070707_100093714 3300005468 Bacteria 2908
138 Ga0070707_100178420 3300005468 Bacteria 2070
139 Ga0070698_100201783 3300005471 Bacteria 1924
140 Ga0070698_100235308 3300005471 Bacteria 1765
141 Ga0070698_100335878 3300005471 Bacteria 1442
142 Ga0070699_100058279 3300005518 Bacteria 3345
143 Ga0070699_100098930 3300005518 Bacteria 2556
144 Ga0070699_100187400 3300005518 Bacteria 1837
145 Ga0070699_100403789 3300005518 Bacteria 1235
146 Ga0070699_100621538 3300005518 Bacteria 985
147 Ga0070679_100002705 3300005530 Bacteria 16140
148 Ga0070679_100021643 3300005530 Bacteria 6278
149 Ga0070679_100021855 3300005530 Bacteria 6249
150 Ga0070679_100031014 3300005530 Bacteria 5282
151 Ga0070679_100074647 3300005530 Bacteria 3381
152 Ga0070679_100110244 3300005530 Bacteria 2738
153 Ga0070679_100113636 3300005530 Bacteria 2693
154 Ga0070679_100142615 3300005530 Bacteria 2374
155 Ga0070679_100191353 3300005530 Bacteria 2015
156 Ga0070679_100655792 3300005530 Bacteria 992
157 Ga0070684_100002119 3300005535 Bacteria 14629
158 Ga0070684_100004430 3300005535 Bacteria 10690
159 Ga0070684_100025726 3300005535 Bacteria 4950
160 Ga0070684_100039763 3300005535 Bacteria 4047
161 Ga0070684_100041617 3300005535 Bacteria 3962
162 Ga0070684_100048772 3300005535 Bacteria 3674
163 Ga0070684_100074132 3300005535 Bacteria 3000
164 Ga0070684_100079163 3300005535 Bacteria 2905
165 Ga0070684_100128285 3300005535 Bacteria 2286
166 Ga0070684_100152256 3300005535 Bacteria 2096
167 Ga0070684_100205666 3300005535 Bacteria 1794
168 Ga0070684_100267158 3300005535 Bacteria 1565
169 Ga0070684_100421800 3300005535 Bacteria 1232
170 Ga0070697_100157676 3300005536 Bacteria 1916
171 Ga0068853_100278210 3300005539 Bacteria 1542
172 Ga0068853_100315277 3300005539 Bacteria 1449
173 Ga0070672_100055209 3300005543 Bacteria 3111
174 Ga0070686_100010999 3300005544 Bacteria 5122
175 Ga0070686_100084964 3300005544 Bacteria 2104
176 Ga0070686_100461208 3300005544 Bacteria 979
177 Ga0070695_100000029 3300005545 Bacteria 53859
178 Ga0070696_100056408 3300005546 Bacteria 2740
179 Ga0070696_100067382 3300005546 Bacteria 2512
180 Ga0070696_100115999 3300005546 Bacteria 1933
181 Ga0070696_100328456 3300005546 Bacteria 1179
182 Ga0070693_100328139 3300005547 Bacteria 1040
183 Ga0070665_100017936 3300005548 Bacteria 7107
184 Ga0070665_100055070 3300005548 Bacteria 3989
185 Ga0070704_100063957 3300005549 Bacteria 2642
186 Ga0070704_100170920 3300005549 Bacteria 1729
187 Ga0068855_100012520 3300005563 Bacteria 10238
188 Ga0068855_100017296 3300005563 Bacteria 8676
189 Ga0068855_100026748 3300005563 Bacteria 6903
190 Ga0068855_100030862 3300005563 Bacteria 6406
191 Ga0068855_100100840 3300005563 Bacteria 3324
192 Ga0068855_100115242 3300005563 Bacteria 3081
193 Ga0068855_100127698 3300005563 Bacteria 2906
194 Ga0068855_100309957 3300005563 Bacteria 1746
195 Ga0068855_100410961 3300005563 Bacteria 1482
196 Ga0068855_100825550 3300005563 Bacteria 984
197 Ga0070664_100098595 3300005564 Bacteria 2539
198 Ga0070664_100151648 3300005564 Bacteria 2046
199 Ga0070664_100155385 3300005564 Bacteria 2021
200 Ga0070664_100198478 3300005564 Bacteria 1789
201 Ga0070664_100252842 3300005564 Bacteria 1584
202 Ga0070664_100372075 3300005564 Bacteria 1303
203 Ga0070664_100458577 3300005564 Bacteria 1171
204 Ga0068857_100001438 3300005577 Bacteria 18880
205 Ga0068857_100010392 3300005577 Bacteria 8089
206 Ga0068857_100013051 3300005577 Bacteria 7237
207 Ga0068857_100013113 3300005577 Bacteria 7222
208 Ga0068857_100038812 3300005577 Bacteria 4216
209 Ga0068857_100061197 3300005577 Bacteria 3345
210 Ga0068854_100072154 3300005578 Bacteria 2528
211 Ga0068856_100144507 3300005614 Bacteria 2386
212 Ga0068856_100188291 3300005614 Bacteria 2077
213 Ga0068856_100535172 3300005614 Bacteria 1193
214 Ga0070702_100145554 3300005615 Bacteria 1514
215 Ga0070702_100216589 3300005615 Bacteria 1278
216 Ga0068852_100022416 3300005616 Bacteria 5065
217 Ga0068852_100026262 3300005616 Bacteria 4731
218 Ga0068852_100115438 3300005616 Bacteria 2448
219 Ga0068852_100508095 3300005616 Bacteria 1201
220 Ga0068859_100223564 3300005617 Bacteria 1970
221 Ga0068859_100251216 3300005617 Bacteria 1859
222 Ga0068859_100787917 3300005617 Bacteria 1039
223 Ga0068864_100016474 3300005618 Bacteria 6152
224 Ga0068864_100095733 3300005618 Bacteria 2626
225 Ga0068864_100547943 3300005618 Bacteria 1118
226 Ga0068866_10025940 3300005718 Bacteria 2761
227 Ga0068861_100018180 3300005719 Bacteria 5002
228 Ga0068861_100049369 3300005719 Bacteria 3186
229 Ga0068861_100542345 3300005719 Bacteria 1058
230 Ga0068870_10094164 3300005840 Bacteria 1681
231 Ga0068863_100375105 3300005841 Bacteria 1388
232 Ga0068858_100034222 3300005842 Bacteria 4712
233 Ga0068858_100068309 3300005842 Bacteria 3293
234 Ga0068862_100081842 3300005844 Bacteria 2801
235 Ga0081455_10006302 3300005937 Bacteria 12750
236 Ga0081455_10030318 3300005937 Bacteria 4915
237 Ga0081538_10085724 3300005981 Bacteria 1653
238 Ga0081539_10001796 3300005985 Bacteria 33964
239 Ga0070717_10014448 3300006028 Bacteria 6077
240 Ga0070717_10039302 3300006028 Bacteria 3849
241 Ga0070717_10042288 3300006028 Bacteria 3716
242 Ga0070717_10053243 3300006028 Bacteria 3335
243 Ga0070717_10142907 3300006028 Bacteria 2065
244 Ga0070717_10789861 3300006028 Bacteria 863
245 Ga0075365_10151206 3300006038 Bacteria 1615
246 Ga0075364_10055922 3300006051 Bacteria 2583
247 Ga0075432_10000886 3300006058 Bacteria 9419
248 Ga0070715_10003646 3300006163 Bacteria 4945
249 Ga0070715_10005247 3300006163 Bacteria 4307
250 Ga0070715_10062711 3300006163 Bacteria 1636
251 Ga0070716_100000663 3300006173 Bacteria 14622
252 Ga0070716_100089977 3300006173 Bacteria 1855
253 Ga0070716_100165503 3300006173 Bacteria 1437
254 Ga0070712_100002758 3300006175 Bacteria 10854
255 Ga0070712_100088685 3300006175 Bacteria 2261
256 Ga0070712_100122132 3300006175 Bacteria 1961
257 Ga0070712_100152289 3300006175 Bacteria 1777
258 Ga0070712_100211393 3300006175 Bacteria 1530
259 Ga0070712_100253100 3300006175 Bacteria 1408
260 Ga0070712_100291302 3300006175 Bacteria 1318
261 Ga0075362_10034669 3300006177 Bacteria 2201
262 Ga0097621_100324368 3300006237 Bacteria 1365
263 Ga0068871_100237186 3300006358 Bacteria 1584
264 Ga0068871_100330740 3300006358 Bacteria 1344
265 Ga0075428_100104626 3300006844 Bacteria 3087
266 Ga0075428_100205173 3300006844 Bacteria 2130
267 Ga0075431_100244049 3300006847 Bacteria 1826
268 Ga0075431_100372632 3300006847 Bacteria 1433
269 Ga0075433_10000706 3300006852 Bacteria 22781
270 Ga0075433_10034850 3300006852 Bacteria 4325
271 Ga0075433_10178295 3300006852 Bacteria 1891
272 Ga0075433_10310585 3300006852 Bacteria 1395
273 Ga0075433_10395125 3300006852 Bacteria 1220
274 Ga0075434_100000347 3300006871 Bacteria 33417
275 Ga0075434_100002359 3300006871 Bacteria 16542
276 Ga0075434_100005449 3300006871 Bacteria 11591
277 Ga0075434_100223988 3300006871 Bacteria 1900
278 Ga0075434_100278314 3300006871 Bacteria 1693
279 Ga0075429_100154810 3300006880 Bacteria 2007
280 Ga0068865_100017702 3300006881 Bacteria 4586
281 Ga0068865_100023380 3300006881 Bacteria 4045
282 Ga0068865_100211756 3300006881 Bacteria 1511
283 Ga0068865_100250740 3300006881 Unclassified 1397
284 Ga0068865_100605085 3300006881 Bacteria 927
285 Ga0075436_100008839 3300006914 Bacteria 6888
286 Ga0075436_100053811 3300006914 Bacteria 2779
287 Ga0075436_100176179 3300006914 Bacteria 1510
288 Ga0075436_100198416 3300006914 Bacteria 1421
289 Ga0075436_100307189 3300006914 Bacteria 1137
290 Ga0097620_100223565 3300006931 Bacteria 1970
291 Ga0097620_100251247 3300006931 Bacteria 1859
292 Ga0097620_100787830 3300006931 Bacteria 1039
293 Ga0075435_100057767 3300007076 Bacteria 3139
294 Ga0075435_100069737 3300007076 Bacteria 2867
295 Ga0105240_10010108 3300009093 Bacteria 13279
296 Ga0105240_10023072 3300009093 Bacteria 8241
297 Ga0105240_10034729 3300009093 Bacteria 6501
298 Ga0105240_10036412 3300009093 Bacteria 6331
299 Ga0105240_10120457 3300009093 Bacteria 3160
300 Ga0105240_10280113 3300009093 Bacteria 1916
301 Ga0105240_10401939 3300009093 Bacteria 1543
302 Ga0111539_10009540 3300009094 Bacteria 12249
303 Ga0111539_10019125 3300009094 Bacteria 8465
304 Ga0111539_10021516 3300009094 Bacteria 7935
305 Ga0111539_10103909 3300009094 Bacteria 3334
306 Ga0111539_10194527 3300009094 Bacteria 2366
307 Ga0111539_10206510 3300009094 Bacteria 2289
308 Ga0105245_10046123 3300009098 Bacteria 3894
309 Ga0105245_10078440 3300009098 Bacteria 3013
310 Ga0105245_10085521 3300009098 Bacteria 2891
311 Ga0105245_10093737 3300009098 Bacteria 2767
312 Ga0105245_10108548 3300009098 Bacteria 2578
313 Ga0105245_10134494 3300009098 Bacteria 2322
314 Ga0105245_10403420 3300009098 Bacteria 1367
315 Ga0105245_10482566 3300009098 Bacteria 1253
316 Ga0105247_10025800 3300009101 Bacteria 3547
317 Ga0114129_10006218 3300009147 Bacteria 16932
318 Ga0114129_10061904 3300009147 Bacteria 5230
319 Ga0114129_10097334 3300009147 Bacteria 4074
320 Ga0114129_10137365 3300009147 Bacteria 3353
321 Ga0114129_10660695 3300009147 Bacteria 1348
322 Ga0114129_11184995 3300009147 Bacteria 952
323 Ga0114129_11223042 3300009147 Bacteria 934
324 Ga0105243_10018651 3300009148 Bacteria 5258
325 Ga0105243_10037738 3300009148 Bacteria 3758
326 Ga0105243_10045431 3300009148 Bacteria 3452
327 Ga0105243_10101844 3300009148 Bacteria 2385
328 Ga0105243_10225862 3300009148 Bacteria 1658
329 Ga0105241_10074563 3300009174 Bacteria 2642
330 Ga0105241_10093815 3300009174 Bacteria 2372
331 Ga0105242_10031122 3300009176 Bacteria 4260
332 Ga0105242_10207659 3300009176 Bacteria 1743
333 Ga0105242_10237700 3300009176 Bacteria 1636
334 Ga0105242_10371388 3300009176 Bacteria 1327
335 Ga0105248_10053284 3300009177 Bacteria 4540
336 Ga0105248_10182801 3300009177 Bacteria 2362
337 Ga0105248_10323201 3300009177 Bacteria 1738
338 Ga0105248_10391904 3300009177 Bacteria 1564
339 Ga0105248_10588752 3300009177 Bacteria 1255
340 Ga0105237_10064368 3300009545 Bacteria 3663
341 Ga0105237_10084024 3300009545 Bacteria 3174
342 Ga0105237_10155043 3300009545 Bacteria 2287
343 Ga0105237_10219516 3300009545 Bacteria 1901
344 Ga0105237_11093948 3300009545 Bacteria 804
345 Ga0105238_10025932 3300009551 Bacteria 5975
346 Ga0105238_10257465 3300009551 Bacteria 1724
347 Ga0105238_10317837 3300009551 Bacteria 1543
348 Ga0105238_11058988 3300009551 Bacteria 833
349 Ga0105249_10133130 3300009553 Bacteria 2376
350 Ga0105239_10087965 3300010375 Bacteria 3425
351 Ga0105239_10117920 3300010375 Bacteria 2946
352 Ga0105239_10820171 3300010375 Bacteria 1066
353 Ga0105239_11266560 3300010375 Bacteria 850
354 Ga0105246_10043393 3300011119 Bacteria 3051
355 Ga0105246_10060019 3300011119 Bacteria 2641
356 Ga0105246_10064171 3300011119 Bacteria 2565
357 Ga0105246_10163571 3300011119 Bacteria 1698
358 Ga0157373_10044336 3300013100 Bacteria 3175
359 Ga0157373_10233225 3300013100 Bacteria 1300
360 Ga0157371_10005984 3300013102 Bacteria 10146
361 Ga0157371_10019119 3300013102 Bacteria 5058
362 Ga0157371_10163874 3300013102 Bacteria 1588
363 Ga0157371_10225448 3300013102 Bacteria 1346
364 Ga0157370_10002516 3300013104 Bacteria 22041
365 Ga0157370_10013425 3300013104 Bacteria 8439
366 Ga0157370_10042395 3300013104 Bacteria 4386
367 Ga0157370_10051763 3300013104 Bacteria 3922
368 Ga0157370_10085648 3300013104 Bacteria 2961
369 Ga0157370_10131329 3300013104 Bacteria 2336
370 Ga0157370_10180717 3300013104 Bacteria 1960
371 Ga0157370_10396715 3300013104 Bacteria 1270
372 Ga0157370_10545528 3300013104 Bacteria 1063
373 Ga0157369_10002737 3300013105 Bacteria 21049
374 Ga0157369_10005843 3300013105 Bacteria 14298
375 Ga0157369_10013174 3300013105 Bacteria 9357
376 Ga0157369_10033465 3300013105 Bacteria 5648
377 Ga0157369_10054695 3300013105 Bacteria 4309
378 Ga0157369_10092778 3300013105 Bacteria 3223
379 Ga0157369_10136200 3300013105 Bacteria 2600
380 Ga0157369_10168670 3300013105 Bacteria 2307
381 Ga0157369_10312108 3300013105 Bacteria 1635
382 Ga0157369_10752433 3300013105 Bacteria 1002
383 Ga0157374_10205734 3300013296 Bacteria 1929
384 Ga0157374_10861020 3300013296 Bacteria 923
385 Ga0157374_10972375 3300013296 Bacteria 868
386 Ga0157378_10177049 3300013297 Bacteria 2004
387 Ga0157378_10412588 3300013297 Bacteria 1333
388 Ga0157378_10666045 3300013297 Bacteria 1058
389 Ga0163162_10026542 3300013306 Bacteria 5725
390 Ga0163162_10035764 3300013306 Bacteria 4948
391 Ga0163162_10504445 3300013306 Bacteria 1340
392 Ga0157372_10087445 3300013307 Bacteria 3536
393 Ga0157372_10098069 3300013307 Bacteria 3343
394 Ga0157372_10179460 3300013307 Bacteria 2451
395 Ga0157372_10203659 3300013307 Bacteria 2293
396 Ga0157372_10246472 3300013307 Bacteria 2073
397 Ga0157372_10394811 3300013307 Bacteria 1612
398 Ga0157372_10904550 3300013307 Bacteria 1024
399 Ga0157375_10063317 3300013308 Bacteria 3679
400 Ga0157375_10105729 3300013308 Bacteria 2906
401 Ga0157375_10705633 3300013308 Bacteria 1162
402 Ga0157375_11203296 3300013308 Bacteria 889
403 Ga0157375_11275840 3300013308 Bacteria 863
404 Ga0163163_10020509 3300014325 Bacteria 6225
405 Ga0163163_10344646 3300014325 Bacteria 1545
406 Ga0163163_10481656 3300014325 Bacteria 1302
407 Ga0163163_11106313 3300014325 Bacteria 855
408 Ga0157380_10009782 3300014326 Bacteria 6884
409 Ga0157380_10238856 3300014326 Bacteria 1637
410 Ga0157380_10601969 3300014326 Bacteria 1088
411 Ga0182008_10003425 3300014497 Bacteria 9576
412 Ga0182008_10017041 3300014497 Bacteria 3770
413 Ga0182008_10067532 3300014497 Bacteria 1759
414 Ga0182008_10072313 3300014497 Bacteria 1696
415 Ga0157377_10015044 3300014745 Bacteria 3947
416 Ga0157377_10207381 3300014745 Bacteria 1248
417 Ga0157377_10225917 3300014745 Bacteria 1201
418 Ga0157377_10320702 3300014745 Bacteria 1029
419 Ga0157379_10023154 3300014968 Bacteria 5508
420 Ga0157379_10187303 3300014968 Bacteria 1870
421 Ga0157376_10031446 3300014969 Bacteria 4250
422 Ga0157376_10052765 3300014969 Bacteria 3382
423 Ga0157376_10108687 3300014969 Bacteria 2437
424 Ga0163161_10139881 3300017792 Bacteria 1832
425 Ga0197907_10400800 3300020069 Bacteria 1381
426 Ga0197907_10581481 3300020069 Bacteria 2587
427 Ga0197907_11415801 3300020069 Bacteria 2189
428 Ga0206356_10008609 3300020070 Bacteria 2522
429 Ga0206356_10112424 3300020070 Bacteria 1796
430 Ga0206356_10279172 3300020070 Bacteria 4175
431 Ga0206356_10320930 3300020070 Bacteria 949
432 Ga0206354_10549865 3300020081 Bacteria 1624
433 Ga0206354_10789475 3300020081 Bacteria 2311
434 Ga0206354_11674741 3300020081 Bacteria 1304
435 Ga0206354_11695459 3300020081 Bacteria 1056
436 Ga0206353_10157270 3300020082 Bacteria 8978
437 Ga0206353_10445049 3300020082 Bacteria 1890
438 Ga0206353_10511590 3300020082 Bacteria 3039
439 Ga0206353_10731752 3300020082 Bacteria 1939
440 Ga0206353_10738018 3300020082 Bacteria 6433
441 Ga0206353_10740026 3300020082 Bacteria 3952
442 Ga0206353_11657420 3300020082 Bacteria 1879
443 Ga0206353_11935210 3300020082 Bacteria 4043
444 Ga0213874_10028601 3300021377 Bacteria 1594
445 Ga0213876_10133358 3300021384 Bacteria 1321
446 Ga0213871_10011017 3300021441 Bacteria 2066
447 Ga0213871_10030600 3300021441 Bacteria 1401
448 Ga0224712_10060057 3300022467 Bacteria 1512
449 Ga0207697_10108556 3300025315 Bacteria 1187
450 Ga0207653_10007351 3300025885 Bacteria 3432
451 Ga0207653_10063591 3300025885 Bacteria 1249
452 Ga0207692_10016277 3300025898 Bacteria 3288
453 Ga0207692_10018395 3300025898 Bacteria 3136
454 Ga0207692_10047783 3300025898 Bacteria 2151
455 Ga0207692_10141845 3300025898 Bacteria 1367
456 Ga0207642_10039094 3300025899 Bacteria 2058
457 Ga0207642_10188429 3300025899 Bacteria 1130
458 Ga0207710_10011970 3300025900 Bacteria 3649
459 Ga0207688_10003665 3300025901 Bacteria 8390
460 Ga0207688_10024399 3300025901 Bacteria 3316
461 Ga0207680_10440925 3300025903 Bacteria 924
462 Ga0207647_10113346 3300025904 Bacteria 1602
463 Ga0207699_10005456 3300025906 Bacteria 6086
464 Ga0207699_10056968 3300025906 Bacteria 2332
465 Ga0207699_10152969 3300025906 Bacteria 1528
466 Ga0207643_10021733 3300025908 Bacteria 3529
467 Ga0207705_10009302 3300025909 Bacteria 7146
468 Ga0207705_10022027 3300025909 Bacteria 4547
469 Ga0207705_10023580 3300025909 Bacteria 4389
470 Ga0207705_10048308 3300025909 Bacteria 3061
471 Ga0207705_10056446 3300025909 Bacteria 2831
472 Ga0207705_10057314 3300025909 Bacteria 2810
473 Ga0207705_10180670 3300025909 Bacteria 1592
474 Ga0207705_10334931 3300025909 Bacteria 1164
475 Ga0207684_10235383 3300025910 Bacteria 1580
476 Ga0207654_10034496 3300025911 Bacteria 2812
477 Ga0207707_10011362 3300025912 Bacteria 7753
478 Ga0207707_10013404 3300025912 Bacteria 7147
479 Ga0207707_10024618 3300025912 Bacteria 5269
480 Ga0207707_10047285 3300025912 Bacteria 3747
481 Ga0207707_10056591 3300025912 Bacteria 3412
482 Ga0207707_10064999 3300025912 Bacteria 3177
483 Ga0207707_10099167 3300025912 Bacteria 2546
484 Ga0207707_10101083 3300025912 Bacteria 2520
485 Ga0207707_10156113 3300025912 Bacteria 1996
486 Ga0207707_10264837 3300025912 Bacteria 1490
487 Ga0207707_10303936 3300025912 Bacteria 1379
488 Ga0207707_10341027 3300025912 Bacteria 1292
489 Ga0207707_10433586 3300025912 Bacteria 1125
490 Ga0207707_10463691 3300025912 Bacteria 1083
491 Ga0207695_10070222 3300025913 Bacteria 3582
492 Ga0207695_10081776 3300025913 Bacteria 3268
493 Ga0207695_10107810 3300025913 Bacteria 2770
494 Ga0207695_10259259 3300025913 Bacteria 1636
495 Ga0207671_10044313 3300025914 Bacteria 3290
496 Ga0207671_10098650 3300025914 Bacteria 2210
497 Ga0207671_10108603 3300025914 Bacteria 2109
498 Ga0207693_10009459 3300025915 Bacteria 7939
499 Ga0207693_10015144 3300025915 Bacteria 6190
500 Ga0207693_10020189 3300025915 Bacteria 5300
501 Ga0207693_10020457 3300025915 Bacteria 5264
502 Ga0207693_10029250 3300025915 Bacteria 4353
503 Ga0207693_10041419 3300025915 Bacteria 3626
504 Ga0207693_10052925 3300025915 Bacteria 3185
505 Ga0207693_10079805 3300025915 Bacteria 2562
506 Ga0207693_10138397 3300025915 Bacteria 1914
507 Ga0207663_10009397 3300025916 Bacteria 5161
508 Ga0207663_10010889 3300025916 Bacteria 4858
509 Ga0207663_10129517 3300025916 Bacteria 1741
510 Ga0207663_10219803 3300025916 Bacteria 1382
511 Ga0207663_10602771 3300025916 Bacteria 863
512 Ga0207660_10055215 3300025917 Bacteria 2837
513 Ga0207660_10115835 3300025917 Bacteria 2023
514 Ga0207660_10136571 3300025917 Bacteria 1871
515 Ga0207662_10075932 3300025918 Bacteria 2042
516 Ga0207657_10000388 3300025919 Bacteria 46370
517 Ga0207657_10001654 3300025919 Bacteria 24052
518 Ga0207657_10007555 3300025919 Bacteria 11142
519 Ga0207657_10013743 3300025919 Bacteria 7926
520 Ga0207657_10014668 3300025919 Bacteria 7636
521 Ga0207657_10060602 3300025919 Bacteria 3247
522 Ga0207657_10107502 3300025919 Bacteria 2308
523 Ga0207657_10141376 3300025919 Bacteria 1966
524 Ga0207657_10146831 3300025919 Bacteria 1923
525 Ga0207657_10231457 3300025919 Bacteria 1478
526 Ga0207657_10309341 3300025919 Bacteria 1251
527 Ga0207649_10010012 3300025920 Bacteria 5199
528 Ga0207649_10016978 3300025920 Bacteria 4118
529 Ga0207652_10020251 3300025921 Bacteria 5477
530 Ga0207652_10044674 3300025921 Bacteria 3775
531 Ga0207652_10069328 3300025921 Bacteria 3061
532 Ga0207652_10107665 3300025921 Bacteria 2469
533 Ga0207652_10180375 3300025921 Bacteria 1897
534 Ga0207652_10215949 3300025921 Bacteria 1728
535 Ga0207652_10259303 3300025921 Bacteria 1568
536 Ga0207652_10364787 3300025921 Bacteria 1304
537 Ga0207652_10370253 3300025921 Bacteria 1293
538 Ga0207652_10724682 3300025921 Bacteria 886
539 Ga0207652_10781409 3300025921 Bacteria 849
540 Ga0207646_10003943 3300025922 Bacteria 16459
541 Ga0207646_10027088 3300025922 Bacteria 5227
542 Ga0207646_10211668 3300025922 Bacteria 1751
543 Ga0207681_10293058 3300025923 Bacteria 1285
544 Ga0207694_10247701 3300025924 Bacteria 1457
545 Ga0207650_10001970 3300025925 Bacteria 14402
546 Ga0207650_10020697 3300025925 Bacteria 4643
547 Ga0207650_10315180 3300025925 Bacteria 1280
548 Ga0207659_10046116 3300025926 Bacteria 3076
549 Ga0207659_10209601 3300025926 Bacteria 1561
550 Ga0207687_10028523 3300025927 Bacteria 3750
551 Ga0207687_10082557 3300025927 Bacteria 2325
552 Ga0207687_10236903 3300025927 Bacteria 1444
553 Ga0207687_10268684 3300025927 Bacteria 1362
554 Ga0207687_10280786 3300025927 Bacteria 1335
555 Ga0207700_10080589 3300025928 Bacteria 2539
556 Ga0207700_10226609 3300025928 Bacteria 1587
557 Ga0207700_10374252 3300025928 Bacteria 1244
558 Ga0207664_10003351 3300025929 Bacteria 10650
559 Ga0207664_10007454 3300025929 Bacteria 7588
560 Ga0207664_10011840 3300025929 Bacteria 6221
561 Ga0207664_10034599 3300025929 Bacteria 3891
562 Ga0207664_10138382 3300025929 Bacteria 2057
563 Ga0207664_10203899 3300025929 Bacteria 1708
564 Ga0207664_10266470 3300025929 Bacteria 1499
565 Ga0207664_10345413 3300025929 Bacteria 1316
566 Ga0207664_10470683 3300025929 Bacteria 1123
567 Ga0207644_10026838 3300025931 Bacteria 3975
568 Ga0207644_10087707 3300025931 Bacteria 2313
569 Ga0207644_10108010 3300025931 Bacteria 2100
570 Ga0207690_10032204 3300025932 Bacteria 3362
571 Ga0207690_10084385 3300025932 Bacteria 2226
572 Ga0207690_10145671 3300025932 Bacteria 1751
573 Ga0207690_10213651 3300025932 Bacteria 1472
574 Ga0207690_10253043 3300025932 Bacteria 1361
575 Ga0207706_10013222 3300025933 Bacteria 7509
576 Ga0207706_10018314 3300025933 Bacteria 6302
577 Ga0207706_10028538 3300025933 Bacteria 4983
578 Ga0207686_10057442 3300025934 Bacteria 2450
579 Ga0207709_10151493 3300025935 Bacteria 1607
580 Ga0207709_10175010 3300025935 Bacteria 1510
581 Ga0207709_10209132 3300025935 Bacteria 1399
582 Ga0207709_10248629 3300025935 Bacteria 1297
583 Ga0207669_10013120 3300025937 Bacteria 4103
584 Ga0207669_10038794 3300025937 Bacteria 2746
585 Ga0207704_10021760 3300025938 Bacteria 3422
586 Ga0207704_10124922 3300025938 Bacteria 1769
587 Ga0207704_10151090 3300025938 Bacteria 1639
588 Ga0207704_10215338 3300025938 Bacteria 1417
589 Ga0207704_10243281 3300025938 Bacteria 1346
590 Ga0207665_10001348 3300025939 Bacteria 16557
591 Ga0207665_10008472 3300025939 Bacteria 6774
592 Ga0207665_10043724 3300025939 Bacteria 2995
593 Ga0207665_10148433 3300025939 Bacteria 1677
594 Ga0207691_10015833 3300025940 Bacteria 7167
595 Ga0207691_10019906 3300025940 Bacteria 6348
596 Ga0207691_10122840 3300025940 Bacteria 2299
597 Ga0207711_10096959 3300025941 Bacteria 2603
598 Ga0207711_10203515 3300025941 Bacteria 1807
599 Ga0207711_10305241 3300025941 Bacteria 1469
600 Ga0207689_10069727 3300025942 Bacteria 2889
601 Ga0207661_10023312 3300025944 Bacteria 4675
602 Ga0207661_10030896 3300025944 Bacteria 4130
603 Ga0207661_10052015 3300025944 Bacteria 3271
604 Ga0207661_10087987 3300025944 Bacteria 2581
605 Ga0207661_10181587 3300025944 Bacteria 1838
606 Ga0207661_10190737 3300025944 Bacteria 1796
607 Ga0207661_10317377 3300025944 Bacteria 1400
608 Ga0207661_10336619 3300025944 Bacteria 1359
609 Ga0207661_10566224 3300025944 Bacteria 1041
610 Ga0207679_10113632 3300025945 Bacteria 2142
611 Ga0207679_10846929 3300025945 Bacteria 835
612 Ga0207667_10014549 3300025949 Bacteria 8964
613 Ga0207667_10022297 3300025949 Bacteria 6999
614 Ga0207667_10035925 3300025949 Bacteria 5314
615 Ga0207667_10099015 3300025949 Bacteria 3008
616 Ga0207667_10109994 3300025949 Bacteria 2842
617 Ga0207667_10184639 3300025949 Bacteria 2141
618 Ga0207667_10222959 3300025949 Bacteria 1931
619 Ga0207667_10478493 3300025949 Bacteria 1264
620 Ga0207712_10429189 3300025961 Bacteria 1117
621 Ga0207712_10526539 3300025961 Bacteria 1014
622 Ga0207668_10230411 3300025972 Bacteria 1493
623 Ga0207668_10429092 3300025972 Bacteria 1123
624 Ga0207658_10010190 3300025986 Bacteria 6388
625 Ga0207677_10188507 3300026023 Bacteria 1629
626 Ga0207677_10865128 3300026023 Bacteria 813
627 Ga0207639_10211090 3300026041 Bacteria 1671
628 Ga0207639_10324048 3300026041 Bacteria 1369
629 Ga0207639_10351417 3300026041 Bacteria 1317
630 Ga0207678_10098011 3300026067 Bacteria 2505
631 Ga0207708_10002236 3300026075 Bacteria 14263
632 Ga0207708_10018487 3300026075 Bacteria 5249
633 Ga0207708_10606529 3300026075 Bacteria 928
634 Ga0207702_10185483 3300026078 Bacteria 1918
635 Ga0207702_10326292 3300026078 Bacteria 1463
636 Ga0207702_10339273 3300026078 Bacteria 1435
637 Ga0207641_10305026 3300026088 Bacteria 1505
638 Ga0207641_10547809 3300026088 Bacteria 1128
639 Ga0207648_10030244 3300026089 Bacteria 4797
640 Ga0207648_10046987 3300026089 Bacteria 3784
641 Ga0207648_10162273 3300026089 Bacteria 1974
642 Ga0207648_10306536 3300026089 Bacteria 1425
643 Ga0207648_10541567 3300026089 Bacteria 1068
644 Ga0207648_10591722 3300026089 Bacteria 1022
645 Ga0207676_10088209 3300026095 Bacteria 2539
646 Ga0207676_10158939 3300026095 Bacteria 1956
647 Ga0207676_10167077 3300026095 Bacteria 1913
648 Ga0207674_10019286 3300026116 Bacteria 7390
649 Ga0207674_10022877 3300026116 Bacteria 6706
650 Ga0207674_10188664 3300026116 Bacteria 2011
651 Ga0207674_10191141 3300026116 Bacteria 1997
652 Ga0207674_10521240 3300026116 Bacteria 1148
653 Ga0207675_100008428 3300026118 Bacteria 9717
654 Ga0207675_100383608 3300026118 Bacteria 1382
655 Ga0207683_10001939 3300026121 Bacteria 18313
656 Ga0207683_10011071 3300026121 Bacteria 7685
657 Ga0207683_10045164 3300026121 Bacteria 3852
658 Ga0207683_10057863 3300026121 Bacteria 3403
659 Ga0207683_10069985 3300026121 Bacteria 3099
660 Ga0207683_10121290 3300026121 Bacteria 2347
661 Ga0207683_10270539 3300026121 Bacteria 1552
662 Ga0207698_10133691 3300026142 Bacteria 2124
663 Ga0207698_10245661 3300026142 Bacteria 1634
664 Ga0207698_10349424 3300026142 Bacteria 1396
665 Ga0207698_10367346 3300026142 Bacteria 1365
666 Ga0207698_10517571 3300026142 Bacteria 1164
667 Ga0207698_10561244 3300026142 Bacteria 1121
668 Ga0207698_10620153 3300026142 Bacteria 1068
669 Ga0207428_10026915 3300027907 Bacteria 4792
670 Ga0207428_10066635 3300027907 Bacteria 2836
671 Ga0207428_10069939 3300027907 Bacteria 2760
672 Ga0207428_10098873 3300027907 Bacteria 2257
673 Ga0207428_10118269 3300027907 Bacteria 2034
674 Ga0207428_10546455 3300027907 Bacteria 838
675 Ga0268266_10092378 3300028379 Bacteria 2655
676 Ga0268266_10236739 3300028379 Bacteria 1683
677 Ga0268264_10064761 3300028381 Bacteria 3077
678 Ga0265319_1003898 3300028563 Bacteria 7600
679 Ga0265319_1053666 3300028563 Bacteria 1323
680 Ga0265334_10037170 3300028573 Bacteria 1920
681 Ga0265318_10000691 3300028577 Bacteria 22716
682 Ga0265318_10006201 3300028577 Bacteria 5530
683 Ga0265318_10009064 3300028577 Bacteria 4397
684 Ga0265322_10010182 3300028654 Bacteria 2726
685 Ga0265322_10020881 3300028654 Bacteria 1876
686 Ga0265336_10004283 3300028666 Bacteria 5424
687 Ga0265338_10001048 3300028800 Bacteria 46186
688 Ga0265338_10003605 3300028800 Bacteria 21613
689 Ga0265338_10007115 3300028800 Bacteria 14011
690 Ga0265338_10015169 3300028800 Bacteria 8494
691 Ga0265338_10016447 3300028800 Bacteria 8049
692 Ga0265338_10022563 3300028800 Bacteria 6510
693 Ga0265338_10066966 3300028800 Bacteria 3104
694 Ga0265338_10076433 3300028800 Bacteria 2836
695 Ga0265338_10095271 3300028800 Bacteria 2446
696 Ga0265338_10122775 3300028800 Bacteria 2066
697 Ga0265338_10155339 3300028800 Bacteria 1773
698 Ga0265338_10175387 3300028800 Bacteria 1639
699 Ga0265324_10015707 3300029957 Bacteria 2781
700 Ga0265332_10019646 3300031238 Bacteria 2982
701 Ga0265332_10033456 3300031238 Bacteria 2237
702 Ga0265328_10026577 3300031239 Bacteria 2175
703 Ga0265320_10009672 3300031240 Bacteria 5794
704 Ga0265320_10016093 3300031240 Bacteria 4201
705 Ga0265325_10000102 3300031241 Bacteria 59998
706 Ga0265325_10164849 3300031241 Bacteria 1040
707 Ga0265329_10021254 3300031242 Bacteria 2181
708 Ga0265340_10009900 3300031247 Bacteria 5108
709 Ga0265340_10022629 3300031247 Bacteria 3213
710 Ga0265340_10070824 3300031247 Bacteria 1653
711 Ga0265339_10011172 3300031249 Bacteria 5541
712 Ga0265339_10026680 3300031249 Bacteria 3307
713 Ga0265327_10010910 3300031251 Bacteria 6324
714 Ga0265327_10025194 3300031251 Bacteria 3474
715 Ga0265327_10030198 3300031251 Bacteria 3067
716 Ga0265327_10037423 3300031251 Bacteria 2656
717 Ga0265316_10014401 3300031344 Bacteria 6963
718 Ga0265316_10021633 3300031344 Bacteria 5441
719 Ga0265316_10164015 3300031344 Bacteria 1660
720 Ga0265316_10251266 3300031344 Bacteria 1298
721 Ga0265313_10002188 3300031595 Bacteria 17292
722 Ga0265313_10006148 3300031595 Bacteria 8619
723 Ga0265313_10012796 3300031595 Bacteria 5092
724 Ga0265313_10121017 3300031595 Bacteria 1142
725 Ga0265314_10003427 3300031711 Bacteria 15325
726 Ga0265314_10003467 3300031711 Bacteria 15234
727 Ga0265314_10005023 3300031711 Bacteria 12056
728 Ga0265342_10012497 3300031712 Bacteria 5748
729 Ga0265342_10024587 3300031712 Bacteria 3800
730 Ga0307405_10026826 3300031731 Bacteria 3330
731 Ga0307410_10029639 3300031852 Bacteria 3487
732 Ga0307407_10081327 3300031903 Bacteria 1960
733 Ga0307409_100018198 3300031995 Bacteria 4713
734 Ga0307409_100110151 3300031995 Bacteria 2307
735 Ga0307409_100198531 3300031995 Bacteria 1792
736 Ga0307409_100339874 3300031995 Bacteria 1412
737 Ga0307416_100064389 3300032002 Bacteria 3007
738 Ga0307416_100086822 3300032002 Bacteria 2668
739 Ga0307414_10196945 3300032004 Bacteria 1635
740 Ga0307415_100045877 3300032126 Bacteria 2933
741 Ga0373930_0014063 3300034816 Bacteria 1485
742 Ga0373958_0011087 3300034819 Bacteria 1517
743 Ga0373959_0005093 3300034820 Bacteria 2148
744 Ga0373926_0106291 3300035083 Bacteria 1052
745 Ga0373928_0002991 3300035084 Bacteria 3251
746 Ga0373928_0055134 3300035084 Bacteria 948
747 Ga0373940_0023787 3300035088 Bacteria 1584
748 Ga0373949_0007840 3300035090 Bacteria 2340
749 Ga0373949_0054461 3300035090 Bacteria 1015
750 Ga0373951_0001681 3300035091 Bacteria 5781
751 Ga0373936_0024860 3300035113 Bacteria 2341
752 Ga0373939_0022079 3300035114 Bacteria 1750
753 Ga0373939_0079056 3300035114 Bacteria 1088
754 Ga0373941_0014770 3300035115 Bacteria 2094
755 Ga0373941_0020354 3300035115 Bacteria 1859
756 Ga0373945_0009452 3300035116 Bacteria 3195
757 Ga0373945_0034882 3300035116 Bacteria 1795
758 Ga0373956_0118027 3300035119 Bacteria 1238
759 Ga0373960_0005206 3300035121 Bacteria 3004
760 Ga0373943_0001097 3300035170 Bacteria 12064
761 Ga0373943_0002704 3300035170 Bacteria 8056
762 Ga0373943_0011966 3300035170 Bacteria 3906
763 Ga0373943_0023932 3300035170 Bacteria 2844
764 Ga0373946_0011840 3300035171 Bacteria 3261
765 Ga0373946_0088776 3300035171 Bacteria 1366
766 Ga0373946_0188977 3300035171 Bacteria 981
767 Ga0373955_0263615 3300035172 Bacteria 1035
768 Ga0373942_0036629 3300035207 Bacteria 1322
769 Ga0373961_0001432 3300035241 Bacteria 7067
770 Ga0373961_0009209 3300035241 Bacteria 2413
771 Ga0373961_0031129 3300035241 Bacteria 1488
772 Ga0373962_0009335 3300035242 Bacteria 2429
773 Ga0373962_0013706 3300035242 Bacteria 2056
774 Ga0373962_0030638 3300035242 Bacteria 1472
775 Ga0373931_0012005 3300035691 Bacteria 4192
776 Ga0373931_0050190 3300035691 Bacteria 2219
777 Ga0373935_0080649 3300035692 Bacteria 2114
778 Ga0373935_0105334 3300035692 Bacteria 1865
779 Ga0373927_0018529 3300035695 Bacteria 4572
780 Ga0373927_0023799 3300035695 Bacteria 4009
781 Ga0373927_0091870 3300035695 Bacteria 1972
782 Ga0373933_0331820 3300035724 Bacteria 987
783 Ga0373947_0000716 3300035725 Bacteria 19733
784 Ga0373947_0003034 3300035725 Bacteria 9988
785 Ga0373947_0013729 3300035725 Bacteria 4641
786 Ga0373947_0026518 3300035725 Bacteria 3388
787 Ga0373947_0159927 3300035725 Bacteria 1456
788 Ga0373937_0003562 3300036401 Bacteria 13119
789 Ga0373937_0643548 3300036401 Bacteria 1005
790 Ga0373925_0001320 3300037068 Bacteria 21707
791 Ga0373925_0004218 3300037068 Bacteria 10914
792 Ga0373925_0029069 3300037068 Bacteria 4054
793 Ga0373925_0031164 3300037068 Bacteria 3917
794 Ga0395899_0008449 3300037312 Bacteria 7931
795 Ga0395899_0009866 3300037312 Bacteria 7323
796 Ga0395899_0022354 3300037312 Bacteria 4796
797 Ga0395899_0031096 3300037312 Bacteria 4014
798 Ga0395899_0042546 3300037312 Bacteria 3391
799 Ga0395899_0150803 3300037312 Bacteria 1648
800 Ga0395899_0350461 3300037312 Bacteria 988
801 Ga0395900_0001009 3300037418 Bacteria 36426
802 Ga0395900_0059518 3300037418 Bacteria 3932
803 Ga0395900_0060829 3300037418 Bacteria 3885
804 Ga0395900_0060885 3300037418 Bacteria 3883
805 Ga0395900_0066024 3300037418 Bacteria 3718
806 Ga0395900_0067531 3300037418 Bacteria 3673
807 Ga0395900_0082225 3300037418 Bacteria 3309
808 Ga0395900_0107045 3300037418 Bacteria 2872
809 Ga0395900_0107833 3300037418 Bacteria 2861
810 Ga0395900_0174330 3300037418 Bacteria 2188
811 Ga0395900_0174726 3300037418 Bacteria 2185
812 Ga0395900_0230291 3300037418 Bacteria 1864
813 Ga0395900_0553900 3300037418 Bacteria 1094
814 Ga0395900_0623724 3300037418 Bacteria 1017
815 Ga0395900_0736735 3300037418 Bacteria 917
816 Ga0395898_0000824 3300037466 Bacteria 51781
817 Ga0395898_0001088 3300037466 Bacteria 41937
818 Ga0395898_0009164 3300037466 Bacteria 10426
819 Ga0395898_0016056 3300037466 Bacteria 7670
820 Ga0395898_0018968 3300037466 Bacteria 7008
821 Ga0395898_0020688 3300037466 Bacteria 6678
822 Ga0395898_0041872 3300037466 Bacteria 4521
823 Ga0395898_0074109 3300037466 Bacteria 3289
824 Ga0395898_0142584 3300037466 Bacteria 2294
825 Ga0395898_0156339 3300037466 Bacteria 2181
826 Ga0395898_0166753 3300037466 Bacteria 2106
827 Ga0395898_0208139 3300037466 Bacteria 1866
828 Ga0395898_0219659 3300037466 Bacteria 1813
829 Ga0395898_0228591 3300037466 Bacteria 1774
830 Ga0395898_0247848 3300037466 Bacteria 1699
831 Ga0395898_0298109 3300037466 Bacteria 1538
832 Ga0395898_0359897 3300037466 Bacteria 1387
833 Ga0395898_0456642 3300037466 Bacteria 1216
834 Ga0395898_0508772 3300037466 Bacteria 1145
835 Ga0395905_0001033 3300037471 Bacteria 35408
836 Ga0395905_0001800 3300037471 Bacteria 24833
837 Ga0395905_0012823 3300037471 Bacteria 8059
838 Ga0395905_0016484 3300037471 Bacteria 7025
839 Ga0395905_0016912 3300037471 Bacteria 6928
840 Ga0395905_0050692 3300037471 Bacteria 3888
841 Ga0395905_0057743 3300037471 Bacteria 3630
842 Ga0395905_0066119 3300037471 Bacteria 3385
843 Ga0395905_0158885 3300037471 Bacteria 2125
844 Ga0395905_0165184 3300037471 Bacteria 2080
845 Ga0395905_0172216 3300037471 Bacteria 2033
846 Ga0395905_0202050 3300037471 Bacteria 1863
847 Ga0395905_0206154 3300037471 Bacteria 1843
848 Ga0395905_0234833 3300037471 Bacteria 1714
849 Ga0395905_0367171 3300037471 Bacteria 1332
850 Ga0395905_0385831 3300037471 Bacteria 1295
851 Ga0436364_0438981 3300037853 Bacteria 2547
852 Ga0395901_0000244 3300038443 Bacteria 67684
853 Ga0395901_0001584 3300038443 Bacteria 23533
854 Ga0395901_0002285 3300038443 Bacteria 19538
855 Ga0395901_0012090 3300038443 Bacteria 8757
856 Ga0395901_0012213 3300038443 Bacteria 8716
857 Ga0395901_0012503 3300038443 Bacteria 8614
858 Ga0395901_0015637 3300038443 Bacteria 7730
859 Ga0395901_0023269 3300038443 Bacteria 6351
860 Ga0395901_0039586 3300038443 Bacteria 4879
861 Ga0395901_0078452 3300038443 Bacteria 3448
862 Ga0395901_0089319 3300038443 Bacteria 3225
863 Ga0395901_0099650 3300038443 Bacteria 3047
864 Ga0395901_0104498 3300038443 Bacteria 2972
865 Ga0395901_0114078 3300038443 Bacteria 2838
866 Ga0395901_0161124 3300038443 Bacteria 2356
867 Ga0395901_0174257 3300038443 Bacteria 2256
868 Ga0395901_0211578 3300038443 Bacteria 2029
869 Ga0395901_0215141 3300038443 Bacteria 2010
870 Ga0395901_0226113 3300038443 Bacteria 1954
871 Ga0395901_0256139 3300038443 Bacteria 1822
872 Ga0395901_0373586 3300038443 Bacteria 1468
873 Ga0395901_0453783 3300038443 Bacteria 1311
874 Ga0395901_1012011 3300038443 Bacteria 806
875 Ga0436365_0415531 3300039437 Bacteria 4308
876 Ga0436365_0821005 3300039437 Bacteria 1126
877 Ga0436360_0702617 3300039438 Bacteria 7289
878 Ga0436363_0369769 3300039450 Bacteria 2022
879 Ga0436363_0641800 3300039450 Bacteria 1660
880 Ga0436363_1099334 3300039450 Bacteria 1900
881 Ga0436362_0522746 3300039453 Bacteria 1203
882 Ga0439447_048963 3300041407 Bacteria 1013
883 Ga0451793_0705657 3300041452 Bacteria 6404
884 Ga0451802_0169865 3300041460 Bacteria 2653
885 Ga0451835_0662786 3300041492 Bacteria 3388
886 Ga0451841_1223045 3300041498 Bacteria 2089
887 Ga0451853_0450063 3300041512 Bacteria 2019
888 Ga0451853_0955806 3300041512 Bacteria 4482
889 Ga0451853_1381542 3300041512 Bacteria 980
890 Ga0439445_0036080 3300042004 Bacteria 1300
891 Ga0450920_005797 3300042122 Bacteria 2206
892 Ga0450907_020325 3300042146 Bacteria 1114
893 Ga0439446_0001718 3300042156 Bacteria 5085
894 Ga0439446_0004542 3300042156 Bacteria 3518
895 Ga0439458_0007600 3300042157 Bacteria 2415
896 Ga0439434_0006095 3300042435 Bacteria 3518
897 Ga0450918_024694 3300042531 Bacteria 1051
898 Ga0466969_0004821 3300044656 Bacteria 7183
899 Ga0466972_0153558 3300044658 Bacteria 1082
900 Ga0466965_0003656 3300044683 Bacteria 6784
901 Ga0466965_0028665 3300044683 Bacteria 2706
902 Ga0466965_0125391 3300044683 Bacteria 1328
903 Ga0466966_0003176 3300044684 Bacteria 10817
904 Ga0466966_0013313 3300044684 Bacteria 5445
905 Ga0466966_0014162 3300044684 Bacteria 5279
906 Ga0466966_0019689 3300044684 Bacteria 4440
907 Ga0466966_0043565 3300044684 Bacteria 2876
908 Ga0466966_0100608 3300044684 Bacteria 1788
909 Ga0466966_0237820 3300044684 Bacteria 1098
910 Ga0466961_0000819 3300044693 Bacteria 19417
911 Ga0466961_0001160 3300044693 Bacteria 16206
912 Ga0466961_0005119 3300044693 Bacteria 8251
913 Ga0466961_0012817 3300044693 Bacteria 5366
914 Ga0466961_0017705 3300044693 Bacteria 4578
915 Ga0466961_0050259 3300044693 Bacteria 2663
916 Ga0466961_0061225 3300044693 Bacteria 2392
917 Ga0466961_0089301 3300044693 Bacteria 1946
918 Ga0466961_0167921 3300044693 Bacteria 1365
919 Ga0466961_0306710 3300044693 Unclassified 969
920 Ga0466963_0001175 3300044694 Bacteria 13743
921 Ga0466963_0001433 3300044694 Bacteria 12841
922 Ga0466963_0002189 3300044694 Bacteria 10808
923 Ga0466963_0002246 3300044694 Bacteria 10721
924 Ga0466963_0003641 3300044694 Bacteria 8854
925 Ga0466963_0005777 3300044694 Bacteria 7278
926 Ga0466963_0007093 3300044694 Bacteria 6673
927 Ga0466963_0008418 3300044694 Bacteria 6181
928 Ga0466963_0010262 3300044694 Bacteria 5667
929 Ga0466963_0012284 3300044694 Bacteria 5237
930 Ga0466963_0013063 3300044694 Bacteria 5092
931 Ga0466963_0016356 3300044694 Bacteria 4612
932 Ga0466963_0025997 3300044694 Bacteria 3740
933 Ga0466963_0030537 3300044694 Bacteria 3478
934 Ga0466963_0032261 3300044694 Bacteria 3391
935 Ga0466963_0034419 3300044694 Bacteria 3295
936 Ga0466963_0039820 3300044694 Bacteria 3079
937 Ga0466963_0047743 3300044694 Bacteria 2826
938 Ga0466963_0055574 3300044694 Bacteria 2633
939 Ga0466963_0058188 3300044694 Bacteria 2576
940 Ga0466963_0075658 3300044694 Bacteria 2272
941 Ga0466963_0109466 3300044694 Bacteria 1895
942 Ga0466963_0118967 3300044694 Bacteria 1817
943 Ga0466963_0187344 3300044694 Bacteria 1445
944 Ga0466963_0291710 3300044694 Bacteria 1147
945 Ga0466963_0296275 3300044694 Bacteria 1137
946 Ga0466963_0462424 3300044694 Bacteria 895
947 Ga0466963_0619049 3300044694 Bacteria 764
948 Ga0466964_0000345 3300044706 Bacteria 13898
949 Ga0466964_0003451 3300044706 Bacteria 5767
950 Ga0466964_0030678 3300044706 Bacteria 2128
951 Ga0466964_0033418 3300044706 Bacteria 2049
952 Ga0466964_0051953 3300044706 Bacteria 1684
953 Ga0466964_0083127 3300044706 Bacteria 1378
954 Ga0466964_0128206 3300044706 Bacteria 1152
955 Ga0466964_0189756 3300044706 Bacteria 980
956 Ga0466971_0000170 3300044719 Bacteria 24398
957 Ga0466971_0000719 3300044719 Bacteria 13240
958 Ga0466971_0018992 3300044719 Bacteria 3050
959 Ga0466971_0131894 3300044719 Bacteria 1160
960 Ga0466968_0005368 3300044735 Bacteria 4797
961 Ga0466968_0006759 3300044735 Bacteria 4337
962 Ga0466968_0018352 3300044735 Bacteria 2806
963 Ga0466968_0024794 3300044735 Bacteria 2453
964 Ga0466968_0039568 3300044735 Bacteria 1985
965 Ga0466968_0060438 3300044735 Bacteria 1634
966 Ga0466968_0095035 3300044735 Bacteria 1325
967 Ga0466968_0216001 3300044735 Bacteria 902
968 Ga0466970_0000806 3300044765 Bacteria 15112
969 Ga0466970_0015951 3300044765 Bacteria 3868
970 Ga0466970_0063100 3300044765 Bacteria 1987
971 Ga0466970_0067753 3300044765 Bacteria 1917
972 Ga0466970_0088222 3300044765 Bacteria 1682
973 Ga0466970_0103861 3300044765 Bacteria 1549
974 Ga0466957_0000671 3300044842 Bacteria 17426
975 Ga0466957_0002461 3300044842 Bacteria 9945
976 Ga0466957_0003280 3300044842 Bacteria 8862
977 Ga0466957_0006828 3300044842 Bacteria 6449
978 Ga0466957_0009740 3300044842 Bacteria 5488
979 Ga0466957_0011646 3300044842 Bacteria 5082
980 Ga0466957_0021985 3300044842 Bacteria 3762
981 Ga0466957_0030916 3300044842 Bacteria 3198
982 Ga0466957_0037648 3300044842 Bacteria 2913
983 Ga0466957_0042757 3300044842 Bacteria 2742
984 Ga0466957_0045236 3300044842 Bacteria 2670
985 Ga0466957_0051270 3300044842 Bacteria 2512
986 Ga0466957_0102763 3300044842 Bacteria 1803
987 Ga0466957_0140451 3300044842 Bacteria 1556
988 Ga0466960_0005693 3300044901 Bacteria 4949
989 Ga0466960_0010734 3300044901 Bacteria 3812
990 Ga0466960_0029067 3300044901 Bacteria 2534
991 Ga0466959_0000274 3300045049 Bacteria 31486
992 Ga0466959_0001752 3300045049 Bacteria 13523
993 Ga0466959_0013333 3300045049 Bacteria 5957
994 Ga0466959_0016325 3300045049 Bacteria 5424
995 Ga0466959_0082029 3300045049 Bacteria 2323
996 Ga0466959_0084170 3300045049 Bacteria 2289
997 Ga0466958_0000300 3300045836 Bacteria 19385
998 Ga0466958_0001062 3300045836 Bacteria 12591
999 Ga0466958_0006066 3300045836 Bacteria 6552
1000 Ga0466958_0010999 3300045836 Bacteria 5086
1001 Ga0466958_0013252 3300045836 Bacteria 4691
1002 Ga0466958_0013473 3300045836 Bacteria 4655
1003 Ga0466958_0016559 3300045836 Bacteria 4246
1004 Ga0466958_0017529 3300045836 Bacteria 4143
1005 Ga0466958_0025898 3300045836 Bacteria 3462
1006 Ga0466958_0032141 3300045836 Bacteria 3121
1007 Ga0466958_0037182 3300045836 Bacteria 2916
1008 Ga0466958_0039825 3300045836 Bacteria 2824
1009 Ga0466958_0047757 3300045836 Bacteria 2584
1010 Ga0466958_0048461 3300045836 Bacteria 2568
1011 Ga0466958_0167481 3300045836 Bacteria 1390
1012 Ga0466958_0202180 3300045836 Bacteria 1264
1013 Ga0466958_0270731 3300045836 Bacteria 1088
1014 Ga0466958_0292407 3300045836 Bacteria 1045
1015 Ga0466958_0343148 3300045836 Bacteria 961
1016 Ga0466967_0000828 3300045976 Bacteria 16293
1017 Ga0466967_0002908 3300045976 Bacteria 10915
1018 Ga0466967_0003311 3300045976 Bacteria 10465
1019 Ga0466967_0007181 3300045976 Bacteria 8002
1020 Ga0466967_0010698 3300045976 Bacteria 6897
1021 Ga0466967_0012395 3300045976 Bacteria 6517
1022 Ga0466967_0019107 3300045976 Bacteria 5501
1023 Ga0466967_0021803 3300045976 Bacteria 5212
1024 Ga0466967_0023141 3300045976 Bacteria 5087
1025 Ga0466967_0023429 3300045976 Bacteria 5058
1026 Ga0466967_0029561 3300045976 Bacteria 4588
1027 Ga0466967_0029636 3300045976 Bacteria 4583
1028 Ga0466967_0030291 3300045976 Bacteria 4539
1029 Ga0466967_0032687 3300045976 Bacteria 4396
1030 Ga0466967_0032800 3300045976 Bacteria 4390
1031 Ga0466967_0033074 3300045976 Bacteria 4375
1032 Ga0466967_0033811 3300045976 Bacteria 4332
1033 Ga0466967_0034431 3300045976 Bacteria 4299
1034 Ga0466967_0034791 3300045976 Bacteria 4280
1035 Ga0466967_0036549 3300045976 Bacteria 4194
1036 Ga0466967_0065402 3300045976 Bacteria 3236
1037 Ga0466967_0076836 3300045976 Bacteria 3004
1038 Ga0466967_0089532 3300045976 Bacteria 2794
1039 Ga0466967_0104096 3300045976 Bacteria 2598
1040 Ga0466967_0104316 3300045976 Bacteria 2595
1041 Ga0466967_0124731 3300045976 Bacteria 2384
1042 Ga0466967_0131763 3300045976 Bacteria 2321
1043 Ga0466967_0142521 3300045976 Bacteria 2233
1044 Ga0466967_0148437 3300045976 Bacteria 2189
1045 Ga0466967_0153732 3300045976 Bacteria 2153
1046 Ga0466967_0160814 3300045976 Bacteria 2107
1047 Ga0466967_0164784 3300045976 Bacteria 2082
1048 Ga0466967_0182802 3300045976 Bacteria 1978
1049 Ga0466967_0196677 3300045976 Bacteria 1908
1050 Ga0466967_0203397 3300045976 Bacteria 1876
1051 Ga0466967_0232884 3300045976 Bacteria 1754
1052 Ga0466967_0246185 3300045976 Bacteria 1706
1053 Ga0466967_0254278 3300045976 Bacteria 1679
1054 Ga0466967_0261592 3300045976 Bacteria 1655
1055 Ga0495592_0007818 3300046454 Bacteria 8013
1056 Ga0495592_0014141 3300046454 Bacteria 6063
1057 Ga0495592_0163178 3300046454 Bacteria 1531
1058 Ga0495592_0251053 3300046454 Bacteria 1169
1059 Ga0495603_0049915 3300046455 Bacteria 2490
1060 Ga0495603_0065453 3300046455 Bacteria 2142
1061 Ga0495603_0097911 3300046455 Bacteria 1713
1062 Ga0495603_0256715 3300046455 Bacteria 1006
1063 Ga0495629_0001816 3300046459 Bacteria 16725
1064 Ga0495629_0037482 3300046459 Bacteria 3417
1065 Ga0495629_0056710 3300046459 Bacteria 2739
1066 Ga0495629_0332935 3300046459 Bacteria 1037
1067 Ga0495629_0345707 3300046459 Bacteria 1015
1068 Ga0495641_0004541 3300046461 Bacteria 9752
1069 Ga0495641_0007480 3300046461 Bacteria 6809
1070 Ga0495641_0017039 3300046461 Bacteria 3801
1071 Ga0495641_0034700 3300046461 Bacteria 2383
1072 Ga0495641_0049467 3300046461 Bacteria 1924
1073 Ga0495641_0060179 3300046461 Bacteria 1716
1074 Ga0495651_0000028 3300046462 Bacteria 105473
1075 Ga0495651_0011734 3300046462 Bacteria 6733
1076 Ga0495651_0084146 3300046462 Bacteria 2397
1077 Ga0495651_0086503 3300046462 Bacteria 2358
1078 Ga0495651_0161366 3300046462 Bacteria 1605
1079 Ga0495653_0000965 3300046463 Bacteria 22058
1080 Ga0495653_0023889 3300046463 Bacteria 4933
1081 Ga0495653_0037432 3300046463 Bacteria 3812
1082 Ga0495653_0046191 3300046463 Bacteria 3373
1083 Ga0495653_0064205 3300046463 Bacteria 2767
1084 Ga0495653_0175652 3300046463 Bacteria 1474
1085 Ga0495653_0194414 3300046463 Bacteria 1382
1086 Ga0495653_0281747 3300046463 Bacteria 1091
1087 Ga0495580_0042963 3300046472 Bacteria 3217
1088 Ga0495582_0000276 3300046473 Bacteria 28706
1089 Ga0495582_0012985 3300046473 Bacteria 4588
1090 Ga0495582_0016268 3300046473 Bacteria 4074
1091 Ga0495582_0162768 3300046473 Bacteria 1269
1092 Ga0495582_0223838 3300046473 Bacteria 1077
1093 Ga0495639_0000416 3300046475 Bacteria 20358
1094 Ga0495639_0000630 3300046475 Bacteria 16276
1095 Ga0495662_0001339 3300046476 Bacteria 12171
1096 Ga0495662_0013466 3300046476 Bacteria 3980
1097 Ga0495662_0031324 3300046476 Bacteria 2569
1098 Ga0495664_0009107 3300046477 Bacteria 5548
1099 Ga0495584_0020811 3300046491 Bacteria 3331
1100 Ga0495584_0145181 3300046491 Bacteria 1205
1101 Ga0495584_0318729 3300046491 Bacteria 789
1102 Ga0495596_0049718 3300046500 Bacteria 1644
1103 Ga0495607_0120618 3300046501 Bacteria 1377
1104 Ga0495608_0008137 3300046511 Bacteria 7364
1105 Ga0495608_0008892 3300046511 Bacteria 7021
1106 Ga0495608_0026241 3300046511 Bacteria 3973
1107 Ga0495608_0070475 3300046511 Bacteria 2281
1108 Ga0495608_0124942 3300046511 Bacteria 1648
1109 Ga0495608_0183520 3300046511 Bacteria 1323
1110 Ga0495608_0355922 3300046511 Bacteria 900
1111 Ga0495618_0012985 3300046514 Bacteria 5063
1112 Ga0495618_0041839 3300046514 Bacteria 2886
1113 Ga0495618_0072816 3300046514 Bacteria 2187
1114 Ga0495618_0164764 3300046514 Bacteria 1412
1115 Ga0495618_0459112 3300046514 Bacteria 772
1116 Ga0495628_0000069 3300046516 Bacteria 82366
1117 Ga0495628_0243168 3300046516 Bacteria 1346
1118 Ga0495630_0005233 3300046517 Bacteria 9144
1119 Ga0495630_0015336 3300046517 Bacteria 5595
1120 Ga0495630_0037449 3300046517 Bacteria 3627
1121 Ga0495630_0040323 3300046517 Bacteria 3490
1122 Ga0495630_0061904 3300046517 Bacteria 2811
1123 Ga0495630_0076033 3300046517 Bacteria 2530
1124 Ga0495630_0139707 3300046517 Bacteria 1841
1125 Ga0495630_0210545 3300046517 Bacteria 1484
1126 Ga0495630_0216920 3300046517 Bacteria 1460
1127 Ga0495631_0111599 3300046518 Unclassified 1176
1128 Ga0495637_0023307 3300046520 Bacteria 2816
1129 Ga0495644_0010118 3300046523 Bacteria 3634
1130 Ga0495644_0087853 3300046523 Bacteria 1172
1131 Ga0495666_0000145 3300046526 Bacteria 29818
1132 Ga0495666_0011008 3300046526 Bacteria 4513
1133 Ga0495642_0071603 3300046528 Bacteria 1451
1134 Ga0495652_0010813 3300046529 Bacteria 8270
1135 Ga0495652_0039151 3300046529 Bacteria 4100
1136 Ga0495652_0040844 3300046529 Bacteria 4009
1137 Ga0495652_0195050 3300046529 Bacteria 1542
1138 Ga0495652_0206403 3300046529 Bacteria 1487
1139 Ga0495652_0365941 3300046529 Bacteria 1029
1140 Ga0495665_0005590 3300046531 Bacteria 6775
1141 Ga0495665_0006870 3300046531 Bacteria 6141
1142 Ga0495665_0292535 3300046531 Bacteria 835
1143 Ga0495640_0004359 3300046533 Bacteria 11296
1144 Ga0495640_0009273 3300046533 Bacteria 7670
1145 Ga0495640_0142659 3300046533 Bacteria 1543
1146 Ga0495586_0009245 3300046535 Bacteria 5240
1147 Ga0495586_0016292 3300046535 Bacteria 3952
1148 Ga0495586_0023214 3300046535 Bacteria 3312
1149 Ga0495586_0190351 3300046535 Bacteria 1162
1150 Ga0495586_0220345 3300046535 Bacteria 1078
1151 Ga0495587_0000062 3300046536 Bacteria 91862
1152 Ga0495587_0060752 3300046536 Bacteria 2215
1153 Ga0495587_0170525 3300046536 Bacteria 1236
1154 Ga0495598_0006644 3300046537 Bacteria 2620
1155 Ga0495645_0000418 3300046543 Bacteria 29334
1156 Ga0495645_0010986 3300046543 Bacteria 6360
1157 Ga0495645_0039003 3300046543 Bacteria 3465
1158 Ga0495645_0232809 3300046543 Bacteria 1233
1159 Ga0495667_0001711 3300046559 Bacteria 14566
1160 Ga0495667_0006358 3300046559 Bacteria 8013
1161 Ga0495667_0039629 3300046559 Bacteria 3132
1162 Ga0495667_0044883 3300046559 Bacteria 2927
1163 Ga0495667_0045491 3300046559 Bacteria 2906
1164 Ga0495667_0070579 3300046559 Bacteria 2278
1165 Ga0495667_0076382 3300046559 Bacteria 2179
1166 Ga0495667_0078027 3300046559 Bacteria 2153
1167 Ga0495667_0132199 3300046559 Bacteria 1609
1168 Ga0495667_0223275 3300046559 Bacteria 1202
1169 Ga0495634_0023186 3300046642 Bacteria 4365
1170 Ga0495634_0029909 3300046642 Bacteria 3766
1171 Ga0495634_0044363 3300046642 Bacteria 3009
1172 Ga0495634_0049216 3300046642 Bacteria 2835
1173 Ga0495634_0217124 3300046642 Bacteria 1182
1174 Ga0495634_0231035 3300046642 Bacteria 1138
1175 Ga0495634_0241112 3300046642 Bacteria 1109
1176 Ga0495635_0003672 3300046663 Bacteria 10640
1177 Ga0495635_0029747 3300046663 Bacteria 3799
1178 Ga0495635_0054825 3300046663 Bacteria 2745
1179 Ga0495635_0076691 3300046663 Bacteria 2290
1180 Ga0495635_0329798 3300046663 Bacteria 1020
1181 Ga0495635_0409806 3300046663 Bacteria 899
1182 Ga0495635_0486378 3300046663 Bacteria 813
1183 Ga0495659_0008766 3300046664 Bacteria 3219
1184 Ga0495659_0024623 3300046664 Bacteria 2054
1185 Ga0495659_0215277 3300046664 Bacteria 792
1186 Ga0495657_0011853 3300046675 Bacteria 6499
1187 Ga0495657_0023566 3300046675 Bacteria 4396
1188 Ga0495657_0041940 3300046675 Bacteria 3128
1189 Ga0495657_0054159 3300046675 Bacteria 2681
1190 Ga0495657_0148594 3300046675 Bacteria 1456
1191 Ga0495657_0287695 3300046675 Bacteria 982
1192 Ga0495599_0000542 3300046678 Bacteria 21674
1193 Ga0495599_0055231 3300046678 Bacteria 2487
1194 Ga0495599_0058655 3300046678 Bacteria 2408
1195 Ga0495623_0000435 3300046679 Bacteria 27481
1196 Ga0495623_0015038 3300046679 Bacteria 5002
1197 Ga0495623_0047697 3300046679 Bacteria 2719
1198 Ga0495623_0111577 3300046679 Bacteria 1657
1199 Ga0495623_0114452 3300046679 Bacteria 1631
1200 Ga0495646_0007673 3300046680 Bacteria 6857
1201 Ga0495646_0218780 3300046680 Bacteria 1031
1202 Ga0495647_0000560 3300046681 Bacteria 10950
1203 Ga0495658_0001373 3300046683 Bacteria 12760
1204 Ga0495658_0003249 3300046683 Bacteria 8081
1205 Ga0495658_0017661 3300046683 Bacteria 3691
1206 Ga0495658_0055375 3300046683 Bacteria 2259
1207 Ga0495658_0189997 3300046683 Bacteria 1276
1208 Ga0495613_0041694 3300046689 Bacteria 3398
1209 Ga0495613_0062951 3300046689 Bacteria 2714
1210 Ga0495613_0068917 3300046689 Bacteria 2580
1211 Ga0495613_0089694 3300046689 Bacteria 2227
1212 Ga0495624_0000753 3300046690 Bacteria 25488
1213 Ga0495624_0004610 3300046690 Bacteria 10051
1214 Ga0495624_0058554 3300046690 Bacteria 2419
1215 Ga0495624_0059503 3300046690 Bacteria 2397
1216 Ga0495624_0059981 3300046690 Bacteria 2386
1217 Ga0495589_0022215 3300046794 Bacteria 3239
1218 Ga0495600_0080294 3300046809 Bacteria 2129
1219 Ga0495600_0116147 3300046809 Bacteria 1742
1220 Ga0495600_0119122 3300046809 Bacteria 1717
1221 Ga0495600_0143827 3300046809 Bacteria 1546
1222 Ga0495581_0000299 3300047315 Bacteria 24150
1223 Ga0495581_0000407 3300047315 Bacteria 21707
1224 Ga0495581_0007334 3300047315 Bacteria 6379
1225 Ga0495581_0025376 3300047315 Bacteria 3436
1226 Ga0495604_0009317 3300047317 Bacteria 7773
1227 Ga0495604_0028425 3300047317 Bacteria 4449
1228 Ga0495604_0046014 3300047317 Bacteria 3403
1229 Ga0495604_0089327 3300047317 Bacteria 2290
1230 Ga0495604_0330921 3300047317 Bacteria 1016
1231 Ga0495604_0458038 3300047317 Bacteria 832
1232 Ga0495674_0002208 3300047319 Bacteria 19139
1233 Ga0495674_0019693 3300047319 Bacteria 6259
1234 Ga0495674_0036763 3300047319 Bacteria 4405
1235 Ga0495674_0065238 3300047319 Bacteria 3163
1236 Ga0495674_0076452 3300047319 Bacteria 2880
1237 Ga0495674_0101170 3300047319 Bacteria 2452
1238 Ga0495674_0156481 3300047319 Bacteria 1909
1239 Ga0495674_0511290 3300047319 Bacteria 960
1240 Ga0495674_0569027 3300047319 Bacteria 900
1241 Ga0495676_0002534 3300047321 Bacteria 16250
1242 Ga0495676_0011130 3300047321 Bacteria 8129
1243 Ga0495676_0081257 3300047321 Bacteria 2457
1244 Ga0495676_0109847 3300047321 Bacteria 2025
1245 Ga0495676_0119492 3300047321 Bacteria 1920
1246 Ga0495676_0132969 3300047321 Bacteria 1793
1247 Ga0495676_0309064 3300047321 Bacteria 1064
1248 Ga0495680_0004620 3300047322 Bacteria 13121
1249 Ga0495680_0009043 3300047322 Bacteria 8999
1250 Ga0495680_0016272 3300047322 Bacteria 6396
1251 Ga0495680_0016809 3300047322 Bacteria 6271
1252 Ga0495680_0022177 3300047322 Bacteria 5300
1253 Ga0495680_0025875 3300047322 Bacteria 4850
1254 Ga0495680_0040757 3300047322 Bacteria 3698
1255 Ga0495680_0041809 3300047322 Bacteria 3641
1256 Ga0495680_0134429 3300047322 Bacteria 1814
1257 Ga0495680_0204046 3300047322 Bacteria 1417
1258 Ga0495680_0240166 3300047322 Bacteria 1287
1259 Ga0495675_0004323 3300047444 Bacteria 8594
1260 Ga0495675_0083821 3300047444 Bacteria 2006
1261 Ga0495685_048549 3300047447 Bacteria 1443
1262 Ga0495684_0012597 3300047471 Bacteria 6522
1263 Ga0495684_0013231 3300047471 Bacteria 6368
1264 Ga0495684_0013780 3300047471 Bacteria 6222
1265 Ga0495684_0074878 3300047471 Bacteria 2572
1266 Ga0495684_0140101 3300047471 Bacteria 1813
1267 Ga0495593_0000807 3300047673 Bacteria 18118
1268 Ga0495593_0032247 3300047673 Bacteria 2857
1269 Ga0495602_0005881 3300048088 Bacteria 12881
1270 Ga0495602_0073742 3300048088 Bacteria 2903
1271 Ga0495602_0163165 3300048088 Bacteria 1737
1272 Ga0495602_0439844 3300048088 Bacteria 922
1273 Ga0495614_0000642 3300048089 Bacteria 14613
1274 Ga0495614_0027518 3300048089 Bacteria 2451
1275 Ga0496100_0000981 3300048903 Bacteria 13718
1276 Ga0496100_0014172 3300048903 Bacteria 4620
1277 Ga0496100_0024429 3300048903 Bacteria 3686
1278 Ga0496100_0027088 3300048903 Bacteria 3520
1279 Ga0496100_0032864 3300048903 Bacteria 3240
1280 Ga0496100_0042957 3300048903 Bacteria 2889
1281 Ga0496100_0045886 3300048903 Bacteria 2806
1282 Ga0496100_0077807 3300048903 Bacteria 2231
1283 Ga0496100_0359613 3300048903 Bacteria 1101
1284 Ga0496101_0000424 3300048904 Bacteria 27117
1285 Ga0496101_0006459 3300048904 Bacteria 7546
1286 Ga0496101_0039896 3300048904 Bacteria 3342
1287 Ga0496101_0053084 3300048904 Bacteria 2923
1288 Ga0496101_0086913 3300048904 Bacteria 2320
1289 Ga0496101_0091470 3300048904 Bacteria 2264
1290 Ga0496101_0264329 3300048904 Bacteria 1342
1291 Ga0496102_0003088 3300048905 Bacteria 14109
1292 Ga0496102_0008078 3300048905 Bacteria 9002
1293 Ga0496102_0041512 3300048905 Bacteria 4166
1294 Ga0496102_0075113 3300048905 Bacteria 3106
1295 Ga0496102_0105934 3300048905 Bacteria 2616
1296 Ga0496102_0342326 3300048905 Bacteria 1408
1297 Ga0496102_0382979 3300048905 Bacteria 1323
1298 Ga0496102_0569229 3300048905 Bacteria 1056
1299 Ga0496102_0603589 3300048905 Bacteria 1020
1300 Ga0496103_0006222 3300048906 Bacteria 7132
1301 Ga0496103_0023844 3300048906 Bacteria 3691
1302 Ga0496103_0053173 3300048906 Bacteria 2509
1303 Ga0496103_0066023 3300048906 Bacteria 2258
1304 Ga0496103_0101941 3300048906 Bacteria 1817
1305 Ga0496103_0145735 3300048906 Bacteria 1516
1306 Ga0496103_0161152 3300048906 Bacteria 1439
1307 Ga0496104_0002376 3300048907 Bacteria 16220
1308 Ga0496104_0002502 3300048907 Bacteria 15814
1309 Ga0496104_0006585 3300048907 Bacteria 10215
1310 Ga0496104_0011326 3300048907 Bacteria 7984
1311 Ga0496104_0014077 3300048907 Bacteria 7220
1312 Ga0496104_0025472 3300048907 Bacteria 5452
1313 Ga0496104_0112327 3300048907 Bacteria 2613
1314 Ga0496104_0144766 3300048907 Bacteria 2282
1315 Ga0496104_0308721 3300048907 Bacteria 1494
1316 Ga0496104_0331998 3300048907 Bacteria 1433
1317 Ga0496104_0424263 3300048907 Bacteria 1242
1318 Ga0496104_0427400 3300048907 Bacteria 1236
1319 Ga0496105_0000597 3300048908 Bacteria 24061
1320 Ga0496105_0025672 3300048908 Bacteria 4798
1321 Ga0496105_0025913 3300048908 Bacteria 4777
1322 Ga0496105_0072276 3300048908 Bacteria 2851
1323 Ga0496105_0089969 3300048908 Bacteria 2535
1324 Ga0496105_0105014 3300048908 Bacteria 2332
1325 Ga0496105_0109646 3300048908 Bacteria 2279
1326 Ga0496105_0136405 3300048908 Bacteria 2021
1327 Ga0496105_0165311 3300048908 Bacteria 1815
1328 Ga0496105_0230155 3300048908 Bacteria 1506
1329 Ga0496105_0283795 3300048908 Bacteria 1334
1330 Ga0496105_0310131 3300048908 Bacteria 1267
1331 Ga0496105_0430130 3300048908 Bacteria 1044
1332 Ga0496105_0472883 3300048908 Bacteria 987
1333 Ga0496106_0002787 3300048909 Bacteria 12952
1334 Ga0496106_0012693 3300048909 Bacteria 6223
1335 Ga0496106_0019642 3300048909 Bacteria 5012
1336 Ga0496106_0042154 3300048909 Bacteria 3422
1337 Ga0496106_0063597 3300048909 Bacteria 2805
1338 Ga0496106_0172521 3300048909 Bacteria 1715
1339 Ga0496106_0173022 3300048909 Bacteria 1712
1340 Ga0496106_0191196 3300048909 Bacteria 1627
1341 Ga0496106_0312704 3300048909 Bacteria 1260
1342 Ga0496107_0001925 3300048910 Bacteria 13179
1343 Ga0496107_0011878 3300048910 Bacteria 6083
1344 Ga0496107_0018377 3300048910 Bacteria 4922
1345 Ga0496107_0024576 3300048910 Bacteria 4262
1346 Ga0496107_0038281 3300048910 Bacteria 3442
1347 Ga0496107_0047814 3300048910 Bacteria 3081
1348 Ga0496107_0049211 3300048910 Bacteria 3037
1349 Ga0496107_0085091 3300048910 Bacteria 2307
1350 Ga0496107_0130134 3300048910 Bacteria 1858
1351 Ga0496107_0253063 3300048910 Bacteria 1310
1352 Ga0496108_0002438 3300048911 Bacteria 14862
1353 Ga0496108_0010971 3300048911 Bacteria 7358
1354 Ga0496108_0021721 3300048911 Bacteria 5277
1355 Ga0496108_0050831 3300048911 Bacteria 3471
1356 Ga0496108_0078040 3300048911 Bacteria 2802
1357 Ga0496108_0134998 3300048911 Bacteria 2122
1358 Ga0496108_0147401 3300048911 Bacteria 2029
1359 Ga0496108_0153562 3300048911 Bacteria 1987
1360 Ga0496108_0172288 3300048911 Bacteria 1873
1361 Ga0496108_0330469 3300048911 Bacteria 1329
1362 Ga0496108_0428737 3300048911 Bacteria 1155
1363 Ga0496109_0001453 3300048912 Bacteria 19631
1364 Ga0496109_0012739 3300048912 Bacteria 7266
1365 Ga0496109_0016594 3300048912 Bacteria 6439
1366 Ga0496109_0028593 3300048912 Bacteria 4987
1367 Ga0496109_0052938 3300048912 Bacteria 3701
1368 Ga0496109_0062921 3300048912 Bacteria 3393
1369 Ga0496109_0161360 3300048912 Bacteria 2100
1370 Ga0496109_0252692 3300048912 Bacteria 1660
1371 Ga0496109_0291133 3300048912 Bacteria 1539
1372 Ga0496109_0384433 3300048912 Bacteria 1326
1373 Ga0496109_0409137 3300048912 Bacteria 1282
1374 Ga0496109_0409429 3300048912 Bacteria 1281
1375 Ga0496110_0006795 3300048913 Bacteria 9099
1376 Ga0496110_0014622 3300048913 Bacteria 6521
1377 Ga0496110_0021211 3300048913 Bacteria 5495
1378 Ga0496110_0031288 3300048913 Bacteria 4591
1379 Ga0496110_0036605 3300048913 Bacteria 4262
1380 Ga0496110_0056676 3300048913 Bacteria 3449
1381 Ga0496110_0063066 3300048913 Bacteria 3274
1382 Ga0496110_0072774 3300048913 Bacteria 3050
1383 Ga0496110_0125594 3300048913 Bacteria 2315
1384 Ga0496111_0003363 3300048914 Bacteria 9885
1385 Ga0496111_0011695 3300048914 Bacteria 5924
1386 Ga0496111_0028019 3300048914 Bacteria 3990
1387 Ga0496111_0089491 3300048914 Bacteria 2255
1388 Ga0496111_0387106 3300048914 Bacteria 1034
1389 Ga0496112_0000598 3300048915 Bacteria 24854
1390 Ga0496112_0005576 3300048915 Bacteria 10912
1391 Ga0496112_0023919 3300048915 Bacteria 5844
1392 Ga0496112_0024171 3300048915 Bacteria 5815
1393 Ga0496112_0027644 3300048915 Bacteria 5470
1394 Ga0496112_0042134 3300048915 Bacteria 4467
1395 Ga0496112_0056022 3300048915 Bacteria 3879
1396 Ga0496112_0057928 3300048915 Bacteria 3814
1397 Ga0496112_0060561 3300048915 Bacteria 3730
1398 Ga0496112_0066386 3300048915 Bacteria 3559
1399 Ga0496112_0089419 3300048915 Bacteria 3048
1400 Ga0496112_0089851 3300048915 Bacteria 3040
1401 Ga0496112_0093338 3300048915 Bacteria 2980
1402 Ga0496112_0125724 3300048915 Bacteria 2535
1403 Ga0496112_0236436 3300048915 Bacteria 1780
1404 Ga0496112_0247293 3300048915 Bacteria 1735
1405 Ga0496112_0404381 3300048915 Bacteria 1305
1406 Ga0496112_0423801 3300048915 Bacteria 1269
1407 Ga0496112_0429662 3300048915 Bacteria 1259
1408 Ga0496112_0717419 3300048915 Bacteria 927
1409 Ga0496113_0014459 3300048916 Bacteria 5385
1410 Ga0496113_0022210 3300048916 Bacteria 4484
1411 Ga0496113_0074292 3300048916 Bacteria 2592
1412 Ga0496113_0152187 3300048916 Bacteria 1826
1413 Ga0496113_0170486 3300048916 Bacteria 1723
1414 Ga0496113_0179409 3300048916 Bacteria 1679
1415 Ga0496113_0187525 3300048916 Bacteria 1641
1416 Ga0496113_0226515 3300048916 Bacteria 1490
1417 Ga0496114_0000392 3300048917 Bacteria 32304
1418 Ga0496114_0001985 3300048917 Bacteria 15563
1419 Ga0496114_0002716 3300048917 Bacteria 13516
1420 Ga0496114_0003682 3300048917 Bacteria 11789
1421 Ga0496114_0015753 3300048917 Bacteria 6083
1422 Ga0496114_0025558 3300048917 Bacteria 4827
1423 Ga0496114_0034643 3300048917 Bacteria 4166
1424 Ga0496114_0089111 3300048917 Bacteria 2618
1425 Ga0496114_0282909 3300048917 Bacteria 1462
1426 Ga0496114_0356294 3300048917 Bacteria 1294
1427 Ga0496115_0001999 3300048918 Bacteria 14573
1428 Ga0496115_0003805 3300048918 Bacteria 10865
1429 Ga0496115_0017651 3300048918 Bacteria 5463
1430 Ga0496115_0029647 3300048918 Bacteria 4298
1431 Ga0496115_0040117 3300048918 Bacteria 3720
1432 Ga0496115_0050660 3300048918 Bacteria 3328
1433 Ga0496115_0057685 3300048918 Bacteria 3123
1434 Ga0496115_0067749 3300048918 Bacteria 2888
1435 Ga0496115_0141690 3300048918 Bacteria 1983
1436 Ga0496115_0166590 3300048918 Bacteria 1822
1437 Ga0496115_0214219 3300048918 Bacteria 1591
1438 Ga0496115_0253983 3300048918 Bacteria 1447
1439 Ga0496122_0034898 3300048925 Bacteria 4106
1440 Ga0496123_0017534 3300048926 Bacteria 5754
1441 Ga0496124_0029460 3300048927 Bacteria 4890
1442 Ga0501031_0000581 3300049568 Bacteria 21450
1443 Ga0501031_0009175 3300049568 Bacteria 6430
1444 Ga0501031_0016309 3300049568 Bacteria 4823
1445 Ga0501031_0037945 3300049568 Bacteria 3145
1446 Ga0501031_0095206 3300049568 Bacteria 1943
1447 Ga0501031_0180123 3300049568 Bacteria 1380
1448 Ga0501032_0006986 3300049569 Bacteria 8275
1449 Ga0501032_0048575 3300049569 Bacteria 2865
1450 Ga0501033_0010616 3300049570 Bacteria 7063
1451 Ga0501033_0031758 3300049570 Bacteria 3965
1452 Ga0501033_0093811 3300049570 Bacteria 2195
1453 Ga0501034_0007715 3300049571 Bacteria 11447
1454 Ga0501034_0215131 3300049571 Bacteria 1876
1455 Ga0501034_0345165 3300049571 Bacteria 1418
1456 Ga0501036_0002934 3300049572 Bacteria 13537
1457 Ga0501036_0015823 3300049572 Bacteria 6298
1458 Ga0501036_0018913 3300049572 Bacteria 5779
1459 Ga0501036_0027279 3300049572 Bacteria 4825
1460 Ga0501036_0202010 3300049572 Bacteria 1671
1461 Ga0501036_0266130 3300049572 Bacteria 1436
1462 Ga0501037_0039891 3300049573 Bacteria 3455
1463 Ga0501037_0107095 3300049573 Bacteria 2014
1464 Ga0501037_0297418 3300049573 Bacteria 1122
1465 Ga0501037_0403336 3300049573 Bacteria 937
1466 Ga0501038_0022582 3300049574 Bacteria 5634
1467 Ga0501038_0045583 3300049574 Bacteria 3806
1468 Ga0501038_0156898 3300049574 Bacteria 1852
1469 Ga0501039_0002187 3300049575 Bacteria 14445
1470 Ga0501039_0011508 3300049575 Bacteria 6734
1471 Ga0501039_0012109 3300049575 Bacteria 6575
1472 Ga0501039_0013548 3300049575 Bacteria 6235
1473 Ga0501040_0005967 3300049576 Bacteria 7883
1474 Ga0501040_0017436 3300049576 Bacteria 4766
1475 Ga0501040_0024153 3300049576 Bacteria 4078
1476 Ga0501040_0046005 3300049576 Bacteria 2978
1477 Ga0501040_0162835 3300049576 Bacteria 1577
1478 Ga0501041_0001889 3300049577 Bacteria 11746
1479 Ga0501041_0017471 3300049577 Bacteria 4269
1480 Ga0501041_0111812 3300049577 Bacteria 1694
1481 Ga0501041_0176030 3300049577 Bacteria 1339
1482 Ga0501042_0003057 3300049578 Bacteria 10412
1483 Ga0501042_0011107 3300049578 Bacteria 6066
1484 Ga0501042_0013766 3300049578 Bacteria 5510
1485 Ga0501042_0014457 3300049578 Bacteria 5389
1486 Ga0501042_0300135 3300049578 Bacteria 1160
1487 Ga0501043_0014807 3300049579 Bacteria 6106
1488 Ga0501043_0117668 3300049579 Bacteria 2085
1489 Ga0501043_0172365 3300049579 Bacteria 1688
1490 Ga0501046_0004564 3300049580 Bacteria 12535
1491 Ga0501046_0004587 3300049580 Bacteria 12478
1492 Ga0501046_0021684 3300049580 Bacteria 5298
1493 Ga0501046_0052078 3300049580 Bacteria 3227
1494 Ga0501046_0150751 3300049580 Bacteria 1754
1495 Ga0501047_0020349 3300049581 Bacteria 6373
1496 Ga0501047_0082319 3300049581 Bacteria 3094
1497 Ga0501048_0001602 3300049582 Bacteria 17195
1498 Ga0501048_0023459 3300049582 Bacteria 4507
1499 Ga0501048_0229384 3300049582 Bacteria 1317
1500 Ga0501048_0369841 3300049582 Bacteria 1023
1501 Ga0501067_0001274 3300049583 Bacteria 13704
1502 Ga0501067_0010138 3300049583 Bacteria 5211
1503 Ga0501067_0025692 3300049583 Bacteria 3264
1504 Ga0501067_0065258 3300049583 Bacteria 2015
1505 Ga0501067_0074101 3300049583 Bacteria 1886
1506 Ga0501067_0075431 3300049583 Bacteria 1868
1507 Ga0501067_0078772 3300049583 Bacteria 1826
1508 Ga0501067_0097139 3300049583 Bacteria 1636
1509 Ga0501068_0007806 3300049584 Bacteria 5927
1510 Ga0501068_0022471 3300049584 Bacteria 3688
1511 Ga0501068_0027704 3300049584 Bacteria 3347
1512 Ga0501068_0098209 3300049584 Bacteria 1813
1513 Ga0501068_0136783 3300049584 Bacteria 1534
1514 Ga0501069_0016318 3300049585 Bacteria 3987
1515 Ga0501069_0024070 3300049585 Bacteria 3322
1516 Ga0501069_0029925 3300049585 Bacteria 2989
1517 Ga0501069_0038080 3300049585 Bacteria 2654
1518 Ga0501069_0071873 3300049585 Bacteria 1939
1519 Ga0501069_0076289 3300049585 Bacteria 1884
1520 Ga0501070_0000256 3300049586 Bacteria 50155
1521 Ga0501070_0012770 3300049586 Bacteria 7081
1522 Ga0501070_0015295 3300049586 Bacteria 6457
1523 Ga0501070_0016126 3300049586 Bacteria 6280
1524 Ga0501070_0022780 3300049586 Bacteria 5243
1525 Ga0501070_0044089 3300049586 Bacteria 3711
1526 Ga0501070_0044111 3300049586 Bacteria 3711
1527 Ga0501070_0046779 3300049586 Bacteria 3598
1528 Ga0501070_0082592 3300049586 Bacteria 2659
1529 Ga0501070_0279562 3300049586 Bacteria 1362
1530 Ga0501070_0306425 3300049586 Bacteria 1293
1531 Ga0501071_0003474 3300049587 Bacteria 9845
1532 Ga0501071_0004560 3300049587 Bacteria 8784
1533 Ga0501071_0016464 3300049587 Bacteria 5084
1534 Ga0501071_0019776 3300049587 Bacteria 4675
1535 Ga0501071_0044450 3300049587 Bacteria 3185
1536 Ga0501071_0065910 3300049587 Bacteria 2630
1537 Ga0501071_0107242 3300049587 Bacteria 2063
1538 Ga0501071_0255929 3300049587 Bacteria 1322
1539 Ga0501071_0311048 3300049587 Bacteria 1195
1540 Ga0501072_0001516 3300049588 Bacteria 17393
1541 Ga0501072_0040065 3300049588 Bacteria 3678
1542 Ga0501072_0046218 3300049588 Bacteria 3426
1543 Ga0501072_0090311 3300049588 Bacteria 2432
1544 Ga0501072_0116884 3300049588 Bacteria 2124
1545 Ga0501072_0123859 3300049588 Bacteria 2059
1546 Ga0501072_0195146 3300049588 Bacteria 1614
1547 Ga0501072_0379349 3300049588 Bacteria 1122
1548 Ga0501073_0022513 3300049589 Bacteria 4537
1549 Ga0501073_0078845 3300049589 Bacteria 2292
1550 Ga0501073_0283007 3300049589 Bacteria 1144
1551 Ga0501074_0004428 3300049590 Bacteria 10045
1552 Ga0501074_0010448 3300049590 Bacteria 6737
1553 Ga0501074_0011726 3300049590 Bacteria 6370
1554 Ga0501074_0104569 3300049590 Bacteria 2027
1555 Ga0501074_0121186 3300049590 Bacteria 1870
1556 Ga0501074_0135186 3300049590 Bacteria 1764
1557 Ga0501074_0151874 3300049590 Bacteria 1655
1558 Ga0501074_0185296 3300049590 Bacteria 1484
1559 Ga0501074_0224550 3300049590 Bacteria 1337
1560 Ga0501074_0499786 3300049590 Bacteria 861
1561 Ga0501075_0002256 3300049591 Bacteria 12770
1562 Ga0501075_0005070 3300049591 Bacteria 8996
1563 Ga0501075_0045885 3300049591 Bacteria 3281
1564 Ga0501075_0064559 3300049591 Bacteria 2762
1565 Ga0501075_0235113 3300049591 Bacteria 1397
1566 Ga0501075_0296253 3300049591 Bacteria 1232
1567 Ga0501075_0331108 3300049591 Bacteria 1160
1568 Ga0501076_0001348 3300049592 Bacteria 16417
1569 Ga0501076_0001879 3300049592 Bacteria 14316
1570 Ga0501076_0002712 3300049592 Bacteria 12243
1571 Ga0501076_0016448 3300049592 Bacteria 5608
1572 Ga0501076_0054863 3300049592 Bacteria 3159
1573 Ga0501076_0057215 3300049592 Bacteria 3096
1574 Ga0501076_0189729 3300049592 Bacteria 1677
1575 Ga0501077_0003001 3300049593 Bacteria 10118
1576 Ga0501077_0007210 3300049593 Bacteria 6858
1577 Ga0501077_0019935 3300049593 Bacteria 4242
1578 Ga0501077_0040148 3300049593 Bacteria 2981
1579 Ga0501079_0003106 3300049741 Bacteria 12166
1580 Ga0501079_0010628 3300049741 Bacteria 7005
1581 Ga0501079_0014553 3300049741 Bacteria 5999
1582 Ga0501079_0023191 3300049741 Bacteria 4764
1583 Ga0501079_0052027 3300049741 Bacteria 3162
1584 Ga0501079_0260786 3300049741 Bacteria 1354
1585 Ga0501080_0002078 3300049742 Bacteria 17369
1586 Ga0501080_0010758 3300049742 Bacteria 8371
1587 Ga0501080_0013935 3300049742 Bacteria 7399
1588 Ga0501080_0121389 3300049742 Bacteria 2421
1589 Ga0501080_0123675 3300049742 Bacteria 2397
1590 Ga0501080_0278959 3300049742 Bacteria 1520
1591 Ga0501081_0005966 3300049743 Bacteria 7887
1592 Ga0501081_0035147 3300049743 Bacteria 3411
1593 Ga0501081_0228155 3300049743 Bacteria 1356
1594 Ga0501081_0283786 3300049743 Bacteria 1212
1595 Ga0501081_0368668 3300049743 Bacteria 1060
1596 Ga0501081_0388108 3300049743 Bacteria 1032
1597 Ga0501083_0006162 3300049744 Bacteria 8508
1598 Ga0501083_0007689 3300049744 Bacteria 7644
1599 Ga0501083_0032356 3300049744 Bacteria 3587
1600 Ga0501083_0134680 3300049744 Bacteria 1619
1601 Ga0501035_0007594 3300049822 Bacteria 10130
1602 Ga0501035_0036231 3300049822 Bacteria 4472
1603 Ga0501035_0044278 3300049822 Bacteria 4008
1604 Ga0501035_0278527 3300049822 Bacteria 1414
1605 Ga0501035_0296384 3300049822 Bacteria 1364
1606 Ga0501044_0126799 3300049823 Bacteria 2549
1607 Ga0501044_0130245 3300049823 Bacteria 2510
1608 Ga0501044_0166054 3300049823 Bacteria 2182
1609 Ga0501044_0420161 3300049823 Bacteria 1247
1610 Ga0501044_0440589 3300049823 Bacteria 1211
1611 Ga0501045_0000629 3300049824 Bacteria 22250
1612 Ga0501045_0034207 3300049824 Bacteria 3687
1613 Ga0501045_0035868 3300049824 Bacteria 3601
1614 Ga0501045_0109471 3300049824 Bacteria 2048
1615 Ga0501045_0110655 3300049824 Bacteria 2037
1616 Ga0501045_0136090 3300049824 Bacteria 1826
1617 nmdc:mga03683_59891_c1 3300050489 Bacteria 1607
1618 nmdc:mga00v17_96415_c1 3300050491 Bacteria 1863
1619 nmdc:mga05p37_321380_c1 3300050507 Bacteria 1832
1620 nmdc:mga05p37_372346_c1 3300050507 Bacteria 1676
1621 nmdc:mga05p37_42560_c1 3300050507 Bacteria 5581
1622 nmdc:mga05p37_588584_c1 3300050507 Bacteria 1258
1623 nmdc:mga05p37_613740_c1 3300050507 Bacteria 1225
1624 nmdc:mga09592_128954_c1 3300050508 Bacteria 2175
1625 nmdc:mga06r32_60497_c1 3300050510 Bacteria 3645
1626 nmdc:mga06r32_86295_c1 3300050510 Bacteria 3061
1627 nmdc:mga08y16_131155_c1 3300050511 Bacteria 2606
1628 nmdc:mga08y16_216471_c1 3300050511 Bacteria 1983
1629 nmdc:mga08y16_227319_c1 3300050511 Bacteria 1930
1630 nmdc:mga08y16_23093_c1 3300050511 Bacteria 6568
1631 nmdc:mga08y16_28150_c1 3300050511 Bacteria 5924
1632 nmdc:mga08y16_88960_c1 3300050511 Bacteria 3218
1633 nmdc:mga08y16_90333_c1 3300050511 Bacteria 3193
1634 nmdc:mga0n895_145415_c1 3300050512 Bacteria 2400
1635 nmdc:mga0n895_277791_c1 3300050512 Bacteria 1699
1636 nmdc:mga0n895_37865_c1 3300050512 Bacteria 4669
1637 nmdc:mga0n895_469_c1 3300050512 Bacteria 27118
1638 nmdc:mga0n895_76342_c1 3300050512 Bacteria 3332
1639 nmdc:mga0rr50_13606_c1 3300050513 Bacteria 5305
1640 nmdc:mga0rr50_17831_c1 3300050513 Bacteria 4753
1641 nmdc:mga0rr50_186146_c1 3300050513 Bacteria 1700
1642 nmdc:mga0rr50_264268_c1 3300050513 Bacteria 1432
1643 nmdc:mga0rr50_32855_c1 3300050513 Bacteria 3702
1644 nmdc:mga0rr50_389132_c1 3300050513 Bacteria 1177
1645 nmdc:mga08x19_12677_c1 3300050514 Bacteria 5082
1646 nmdc:mga08x19_264211_c1 3300050514 Bacteria 1190
1647 nmdc:mga08x19_52078_c1 3300050514 Bacteria 2631
1648 nmdc:mga0a205_310314_c1 3300050515 Unclassified 1449
1649 nmdc:mga0a205_442298_c1 3300050515 Bacteria 1161
1650 nmdc:mga0a205_5392_c1 3300050515 Bacteria 11536
1651 nmdc:mga0a205_54562_c1 3300050515 Bacteria 3859
1652 nmdc:mga0a205_66960_c1 3300050515 Bacteria 3469
1653 Ga0495601_0004004 3300053077 Bacteria 8484
1654 Ga0495601_0027217 3300053077 Bacteria 3534
1655 Ga0495601_0081440 3300053077 Bacteria 2077
1656 Ga0495601_0117712 3300053077 Bacteria 1724
1657 Ga0495601_0136195 3300053077 Bacteria 1601
1658 Ga0495601_0162717 3300053077 Bacteria 1458
1659 Ga0495601_0479407 3300053077 Bacteria 803
1660 Ga0495612_0015793 3300053078 Bacteria 3027
1661 Ga0495612_0016112 3300053078 Bacteria 2995
1662 Ga0495612_0029879 3300053078 Bacteria 2195
1663 Ga0495612_0031423 3300053078 Bacteria 2141
1664 Ga0495655_0010180 3300053083 Bacteria 1848
1665 Ga0495595_0007604 3300053084 Bacteria 4437
1666 Ga0495595_0012048 3300053084 Bacteria 3626
1667 Ga0495595_0076499 3300053084 Bacteria 1589
1668 Ga0495595_0080301 3300053084 Bacteria 1552
1669 Ga0495595_0089103 3300053084 Bacteria 1478
1670 Ga0495595_0136278 3300053084 Bacteria 1202
1671 Ga0495595_0193710 3300053084 Bacteria 1010
1672 Ga0495619_0000123 3300053085 Bacteria 57052
1673 Ga0495619_0001783 3300053085 Bacteria 14316
1674 Ga0495619_0003843 3300053085 Bacteria 9668
1675 Ga0495619_0005855 3300053085 Bacteria 7790
1676 Ga0495619_0012949 3300053085 Bacteria 5254
1677 Ga0495619_0020873 3300053085 Bacteria 4177
1678 Ga0495619_0040119 3300053085 Bacteria 3059
1679 Ga0495619_0064357 3300053085 Bacteria 2444
1680 Ga0495619_0085274 3300053085 Bacteria 2133
1681 Ga0495619_0085728 3300053085 Bacteria 2128
1682 Ga0495619_0127316 3300053085 Bacteria 1749
1683 Ga0501084_0011940 3300054114 Bacteria 7192
1684 Ga0501084_0022033 3300054114 Bacteria 5314
1685 Ga0501084_0072532 3300054114 Bacteria 2883
1686 Ga0501084_0415201 3300054114 Bacteria 1138
1687 Ga0590077_030393 3300059426 Bacteria 1178
1688 Ga0501082_0003737 3300060353 Bacteria 13299
1689 Ga0501082_0023637 3300060353 Bacteria 5301
1690 Ga0501082_0072141 3300060353 Bacteria 2974
1691 Ga0501082_0076561 3300060353 Bacteria 2884
1692 Ga0501082_0136698 3300060353 Bacteria 2127
1693 Ga0501082_0232463 3300060353 Bacteria 1604
1694 Ga0501082_0568458 3300060353 Bacteria 992
1695 Ga0466962_0000254 3300061719 Bacteria 22544
1696 Ga0466962_0000436 3300061719 Bacteria 18149
1697 Ga0466962_0011961 3300061719 Bacteria 4174
1698 Ga0466962_0011984 3300061719 Bacteria 4170
1699 Ga0466962_0014588 3300061719 Bacteria 3787
1700 Ga0466962_0034689 3300061719 Bacteria 2415
1701 Ga0466962_0055728 3300061719 Bacteria 1889
1702 Ga0530510_0005034 3300061734 Bacteria 9127
1703 Ga0530510_0022085 3300061734 Bacteria 4531
1704 Ga0530510_0041925 3300061734 Bacteria 3305
1705 Ga0530510_0054188 3300061734 Bacteria 2898
1706 Ga0530510_0065324 3300061734 Bacteria 2636
1707 Ga0530510_0073211 3300061734 Bacteria 2487
1708 Ga0530510_0099797 3300061734 Bacteria 2123
1709 Ga0530510_0125369 3300061734 Bacteria 1887
1710 Ga0530510_0146623 3300061734 Bacteria 1741
1711 Ga0530510_0274192 3300061734 Bacteria 1259
1712 Ga0530510_0390700 3300061734 Bacteria 1048

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005334 Ga0068869_100172177 Ga0068869_1001721772 198
2 3300005459 Ga0068867_100048517 Ga0068867_1000485173 198
3 3300005535 Ga0070684_100004430 Ga0070684_1000044306 198
4 3300005544 Ga0070686_100084964 Ga0070686_1000849642 198
5 3300005549 Ga0070704_100063957 Ga0070704_1000639573 198
6 3300005563 Ga0068855_100410961 Ga0068855_1004109612 198
7 3300005564 Ga0070664_100155385 Ga0070664_1001553853 198
8 3300005564 Ga0070664_100372075 Ga0070664_1003720752 198
9 3300005577 Ga0068857_100001438 Ga0068857_1000014382 198
10 3300005577 Ga0068857_100013051 Ga0068857_1000130517 198
11 3300005578 Ga0068854_100072154 Ga0068854_1000721542 198
12 3300005615 Ga0070702_100145554 Ga0070702_1001455542 198
13 3300005615 Ga0070702_100216589 Ga0070702_1002165892 198
14 3300006847 Ga0075431_100244049 Ga0075431_1002440492 198
15 3300006880 Ga0075429_100154810 Ga0075429_1001548102 198
16 3300006881 Ga0068865_100250740 Ga0068865_1002507402 198
17 3300009098 Ga0105245_10085521 Ga0105245_100855211 198
18 3300009147 Ga0114129_10006218 Ga0114129_1000621810 198
19 3300009148 Ga0105243_10018651 Ga0105243_100186516 198
20 3300009148 Ga0105243_10037738 Ga0105243_100377382 198
21 3300009174 Ga0105241_10074563 Ga0105241_100745633 198
22 3300009176 Ga0105242_10237700 Ga0105242_102377002 198
23 3300013297 Ga0157378_10412588 Ga0157378_104125882 198
24 3300013306 Ga0163162_10035764 Ga0163162_100357643 198
25 3300014326 Ga0157380_10238856 Ga0157380_102388562 198
26 3300014497 Ga0182008_10072313 Ga0182008_100723132 198
27 3300005437 Ga0070710_10009817 Ga0070710_100098177 199
28 3300005457 Ga0070662_100066544 Ga0070662_1000665442 199
29 3300005719 Ga0068861_100018180 Ga0068861_1000181802 199
30 3300005719 Ga0068861_100049369 Ga0068861_1000493693 199
31 3300005937 Ga0081455_10006302 Ga0081455_100063027 199
32 3300006175 Ga0070712_100253100 Ga0070712_1002531002 199
33 3300006844 Ga0075428_100205173 Ga0075428_1002051732 199
34 3300006847 Ga0075431_100372632 Ga0075431_1003726322 199
35 3300006852 Ga0075433_10178295 Ga0075433_101782951 199
36 3300006852 Ga0075433_10310585 Ga0075433_103105852 199
37 3300006914 Ga0075436_100008839 Ga0075436_1000088392 199
38 3300009094 Ga0111539_10194527 Ga0111539_101945272 199
39 3300009098 Ga0105245_10078440 Ga0105245_100784403 199
40 3300009147 Ga0114129_10137365 Ga0114129_101373652 199
41 3300009553 Ga0105249_10133130 Ga0105249_101331302 199
42 3300010375 Ga0105239_10117920 Ga0105239_101179203 199
43 3300013306 Ga0163162_10026542 Ga0163162_100265425 199
44 3300013307 Ga0157372_10087445 Ga0157372_100874453 199
45 3300025898 Ga0207692_10047783 Ga0207692_100477833 199
46 3300025915 Ga0207693_10020189 Ga0207693_100201897 199
47 3300025916 Ga0207663_10129517 Ga0207663_101295172 199
48 3300025929 Ga0207664_10034599 Ga0207664_100345995 199
49 3300025933 Ga0207706_10018314 Ga0207706_100183144 199
50 3300026118 Ga0207675_100008428 Ga0207675_1000084287 199
51 3300027907 Ga0207428_10026915 Ga0207428_100269152 199
52 3300027907 Ga0207428_10098873 Ga0207428_100988732 199
53 3300031995 Ga0307409_100018198 Ga0307409_1000181983 199
54 3300035115 Ga0373941_0020354 Ga0373941_0020354_935_1558 199
55 3300035242 Ga0373962_0013706 Ga0373962_0013706_544_1167 199
56 3300037471 Ga0395905_0202050 Ga0395905_0202050_850_1473 199
57 3300038443 Ga0395901_0215141 Ga0395901_0215141_924_1547 199
58 3300041512 Ga0451853_0450063 Ga0451853_0450063_437_1060 199
59 3300046461 Ga0495641_0060179 Ga0495641_0060179_448_1071 199
60 3300046491 Ga0495584_0145181 Ga0495584_0145181_137_760 199
61 3300046529 Ga0495652_0365941 Ga0495652_0365941_162_785 199
62 3300046559 Ga0495667_0078027 Ga0495667_0078027_843_1466 199
63 3300046675 Ga0495657_0148594 Ga0495657_0148594_524_1147 199
64 3300046675 Ga0495657_0287695 Ga0495657_0287695_345_968 199
65 3300046679 Ga0495623_0114452 Ga0495623_0114452_417_1040 199
66 3300046683 Ga0495658_0017661 Ga0495658_0017661_1982_2605 199
67 3300047321 Ga0495676_0132969 Ga0495676_0132969_279_902 199
68 3300047322 Ga0495680_0204046 Ga0495680_0204046_29_652 199
69 3300048088 Ga0495602_0163165 Ga0495602_0163165_668_1291 199
70 3300048913 Ga0496110_0036605 Ga0496110_0036605_2641_3264 199
71 3300048913 Ga0496110_0056676 Ga0496110_0056676_1759_2382 199
72 3300048914 Ga0496111_0028019 Ga0496111_0028019_1238_1861 199
73 3300048915 Ga0496112_0429662 Ga0496112_0429662_573_1196 199
74 3300048916 Ga0496113_0152187 Ga0496113_0152187_754_1377 199
75 3300048918 Ga0496115_0017651 Ga0496115_0017651_1532_2155 199
76 3300049824 Ga0501045_0136090 Ga0501045_0136090_1181_1804 199
77 3300050507 nmdc:mga05p37_321380_c1 nmdc:mga05p37_321380_c1_1150_1773 199
78 3300050508 nmdc:mga09592_128954_c1 nmdc:mga09592_128954_c1_1148_1771 199
79 3300050510 nmdc:mga06r32_86295_c1 nmdc:mga06r32_86295_c1_442_1065 199
80 3300050511 nmdc:mga08y16_23093_c1 nmdc:mga08y16_23093_c1_3050_3673 199
81 3300050513 nmdc:mga0rr50_13606_c1 nmdc:mga0rr50_13606_c1_4650_5273 199
82 3300050514 nmdc:mga08x19_12677_c1 nmdc:mga08x19_12677_c1_2961_3584 199
83 3300050515 nmdc:mga0a205_442298_c1 nmdc:mga0a205_442298_c1_368_991 199
84 3300053084 Ga0495595_0076499 Ga0495595_0076499_645_1268 199
85 3300053085 Ga0495619_0085274 Ga0495619_0085274_327_950 199
86 3300041512 Ga0451853_1381542 Ga0451853_1381542_278_904 200
87 3300005618 Ga0068864_100547943 Ga0068864_1005479432 204
88 3300025931 Ga0207644_10087707 Ga0207644_100877072 204
89 3300026095 Ga0207676_10167077 Ga0207676_101670772 204
90 3300020070 Ga0206356_10008609 Ga0206356_100086092 205
91 3300006871 Ga0075434_100005449 Ga0075434_10000544913 206
92 3300007076 Ga0075435_100057767 Ga0075435_1000577672 206
93 3300009176 Ga0105242_10207659 Ga0105242_102076592 206
94 3300009545 Ga0105237_11093948 Ga0105237_110939481 206
95 3300026121 Ga0207683_10069985 Ga0207683_100699854 206
96 3300028800 Ga0265338_10095271 Ga0265338_100952711 206
97 3300037312 Ga0395899_0008449 Ga0395899_0008449_3423_4151 206
98 3300037418 Ga0395900_0107045 Ga0395900_0107045_942_1670 206
99 3300037466 Ga0395898_0041872 Ga0395898_0041872_2057_2785 206
100 3300037466 Ga0395898_0166753 Ga0395898_0166753_1438_2082 206
101 3300037471 Ga0395905_0016912 Ga0395905_0016912_5556_6284 206
102 3300037471 Ga0395905_0158885 Ga0395905_0158885_1297_2073 206
103 3300038443 Ga0395901_0015637 Ga0395901_0015637_1440_2084 206
104 3300038443 Ga0395901_0161124 Ga0395901_0161124_18_794 206
105 3300038443 Ga0395901_0226113 Ga0395901_0226113_454_1182 206
106 3300041452 Ga0451793_0705657 Ga0451793_0705657_3976_4704 206
107 3300041460 Ga0451802_0169865 Ga0451802_0169865_1424_2152 206
108 3300041492 Ga0451835_0662786 Ga0451835_0662786_1695_2423 206
109 3300041498 Ga0451841_1223045 Ga0451841_1223045_815_1543 206
110 3300042157 Ga0439458_0007600 Ga0439458_0007600_735_1379 206
111 3300048903 Ga0496100_0024429 Ga0496100_0024429_764_1492 206
112 3300048904 Ga0496101_0053084 Ga0496101_0053084_1095_1823 206
113 3300048905 Ga0496102_0105934 Ga0496102_0105934_1518_2246 206
114 3300048910 Ga0496107_0024576 Ga0496107_0024576_92_820 206
115 3300048915 Ga0496112_0717419 Ga0496112_0717419_171_905 206
116 3300050512 nmdc:mga0n895_76342_c1 nmdc:mga0n895_76342_c1_2284_3021 206
117 3300050513 nmdc:mga0rr50_32855_c1 nmdc:mga0rr50_32855_c1_1056_1793 206
118 3300050515 nmdc:mga0a205_54562_c1 nmdc:mga0a205_54562_c1_1024_1761 206
119 3300059426 Ga0590077_030393 Ga0590077_030393_143_868 206
120 3300005355 Ga0070671_100127740 Ga0070671_1001277402 207
121 3300005435 Ga0070714_100131290 Ga0070714_1001312902 207
122 3300005468 Ga0070707_100093714 Ga0070707_1000937142 207
123 3300009093 Ga0105240_10036412 Ga0105240_100364127 207
124 3300026121 Ga0207683_10121290 Ga0207683_101212903 207
125 3300028800 Ga0265338_10175387 Ga0265338_101753872 207
126 3300045836 Ga0466958_0343148 Ga0466958_0343148_203_937 207
127 3300005518 Ga0070699_100403789 Ga0070699_1004037892 208
128 3300013307 Ga0157372_10394811 Ga0157372_103948111 208
129 3300046517 Ga0495630_0040323 Ga0495630_0040323_1044_1694 208
130 3300048909 Ga0496106_0019642 Ga0496106_0019642_1640_2368 208
131 3300005329 Ga0070683_100007870 Ga0070683_1000078705 209
132 3300005339 Ga0070660_100002486 Ga0070660_10000248610 209
133 3300005344 Ga0070661_100069540 Ga0070661_1000695402 209
134 3300005445 Ga0070708_100436248 Ga0070708_1004362481 209
135 3300005458 Ga0070681_10007863 Ga0070681_100078638 209
136 3300005468 Ga0070707_100001488 Ga0070707_1000014884 209
137 3300005530 Ga0070679_100002705 Ga0070679_1000027055 209
138 3300005535 Ga0070684_100002119 Ga0070684_1000021198 209
139 3300005577 Ga0068857_100038812 Ga0068857_1000388125 209
140 3300005616 Ga0068852_100022416 Ga0068852_1000224167 209
141 3300006038 Ga0075365_10151206 Ga0075365_101512062 209
142 3300009093 Ga0105240_10280113 Ga0105240_102801132 209
143 3300013104 Ga0157370_10002516 Ga0157370_1000251610 209
144 3300013105 Ga0157369_10312108 Ga0157369_103121082 209
145 3300020070 Ga0206356_10112424 Ga0206356_101124242 209
146 3300020082 Ga0206353_10738018 Ga0206353_107380183 209
147 3300025909 Ga0207705_10048308 Ga0207705_100483082 209
148 3300025912 Ga0207707_10024618 Ga0207707_100246182 209
149 3300025913 Ga0207695_10259259 Ga0207695_102592592 209
150 3300025919 Ga0207657_10001654 Ga0207657_1000165413 209
151 3300025920 Ga0207649_10010012 Ga0207649_100100126 209
152 3300025921 Ga0207652_10044674 Ga0207652_100446742 209
153 3300025922 Ga0207646_10027088 Ga0207646_100270883 209
154 3300025932 Ga0207690_10213651 Ga0207690_102136512 209
155 3300025944 Ga0207661_10030896 Ga0207661_100308965 209
156 3300025949 Ga0207667_10022297 Ga0207667_100222977 209
157 3300026116 Ga0207674_10191141 Ga0207674_101911412 209
158 3300026142 Ga0207698_10245661 Ga0207698_102456612 209
159 3300037312 Ga0395899_0150803 Ga0395899_0150803_710_1438 209
160 3300044693 Ga0466961_0306710 Ga0466961_0306710_33_758 209
161 3300044694 Ga0466963_0055574 Ga0466963_0055574_1532_2257 209
162 3300045976 Ga0466967_0032800 Ga0466967_0032800_128_853 209
163 3300046531 Ga0495665_0292535 Ga0495665_0292535_11_664 209
164 3300047322 Ga0495680_0040757 Ga0495680_0040757_1668_2393 209
165 3300048903 Ga0496100_0027088 Ga0496100_0027088_1319_2056 209
166 3300048909 Ga0496106_0063597 Ga0496106_0063597_1233_1970 209
167 3300048918 Ga0496115_0050660 Ga0496115_0050660_1444_2181 209
168 3300049586 Ga0501070_0044111 Ga0501070_0044111_2664_3392 209
169 3300049590 Ga0501074_0104569 Ga0501074_0104569_11_739 209
170 3300049592 Ga0501076_0002712 Ga0501076_0002712_11096_11824 209
171 3300049743 Ga0501081_0283786 Ga0501081_0283786_184_912 209
172 3300049824 Ga0501045_0034207 Ga0501045_0034207_975_1703 209
173 3300054114 Ga0501084_0022033 Ga0501084_0022033_4278_5006 209
174 3300005329 Ga0070683_100002072 Ga0070683_1000020724 210
175 3300005339 Ga0070660_100266808 Ga0070660_1002668082 210
176 3300005535 Ga0070684_100152256 Ga0070684_1001522562 210
177 3300013102 Ga0157371_10225448 Ga0157371_102254482 210
178 3300020081 Ga0206354_11674741 Ga0206354_116747412 210
179 3300020082 Ga0206353_10740026 Ga0206353_107400265 210
180 3300025917 Ga0207660_10115835 Ga0207660_101158352 210
181 3300025919 Ga0207657_10309341 Ga0207657_103093412 210
182 3300025921 Ga0207652_10364787 Ga0207652_103647872 210
183 3300025927 Ga0207687_10236903 Ga0207687_102369032 210
184 3300025944 Ga0207661_10023312 Ga0207661_100233123 210
185 3300026089 Ga0207648_10541567 Ga0207648_105415671 210
186 3300037466 Ga0395898_0074109 Ga0395898_0074109_975_1703 210
187 3300037471 Ga0395905_0057743 Ga0395905_0057743_1367_2095 210
188 3300038443 Ga0395901_0099650 Ga0395901_0099650_508_1236 210
189 3300048903 Ga0496100_0042957 Ga0496100_0042957_166_894 210
190 3300048904 Ga0496101_0039896 Ga0496101_0039896_220_948 210
191 3300048906 Ga0496103_0066023 Ga0496103_0066023_848_1576 210
192 3300048907 Ga0496104_0002376 Ga0496104_0002376_6159_6887 210
193 3300048908 Ga0496105_0025672 Ga0496105_0025672_2759_3487 210
194 3300048910 Ga0496107_0018377 Ga0496107_0018377_1748_2476 210
195 3300048911 Ga0496108_0002438 Ga0496108_0002438_10169_10897 210
196 3300048912 Ga0496109_0016594 Ga0496109_0016594_5208_5936 210
197 3300048913 Ga0496110_0063066 Ga0496110_0063066_656_1384 210
198 3300048914 Ga0496111_0003363 Ga0496111_0003363_5768_6496 210
199 3300048915 Ga0496112_0060561 Ga0496112_0060561_1296_2024 210
200 3300048916 Ga0496113_0022210 Ga0496113_0022210_228_956 210
201 3300049568 Ga0501031_0000581 Ga0501031_0000581_20468_21199 210
202 3300049569 Ga0501032_0006986 Ga0501032_0006986_5019_5750 210
203 3300049570 Ga0501033_0010616 Ga0501033_0010616_1747_2478 210
204 3300049572 Ga0501036_0018913 Ga0501036_0018913_843_1574 210
205 3300049573 Ga0501037_0039891 Ga0501037_0039891_764_1495 210
206 3300049574 Ga0501038_0022582 Ga0501038_0022582_698_1429 210
207 3300049575 Ga0501039_0013548 Ga0501039_0013548_3416_4147 210
208 3300049576 Ga0501040_0017436 Ga0501040_0017436_3656_4387 210
209 3300049578 Ga0501042_0300135 Ga0501042_0300135_380_1111 210
210 3300049579 Ga0501043_0014807 Ga0501043_0014807_3415_4146 210
211 3300049580 Ga0501046_0052078 Ga0501046_0052078_751_1482 210
212 3300049582 Ga0501048_0229384 Ga0501048_0229384_50_781 210
213 3300049584 Ga0501068_0022471 Ga0501068_0022471_2508_3239 210
214 3300049586 Ga0501070_0016126 Ga0501070_0016126_3244_3975 210
215 3300049587 Ga0501071_0016464 Ga0501071_0016464_698_1429 210
216 3300049588 Ga0501072_0195146 Ga0501072_0195146_434_1165 210
217 3300049590 Ga0501074_0011726 Ga0501074_0011726_5158_5889 210
218 3300049591 Ga0501075_0331108 Ga0501075_0331108_380_1111 210
219 3300049593 Ga0501077_0040148 Ga0501077_0040148_701_1432 210
220 3300049741 Ga0501079_0260786 Ga0501079_0260786_174_905 210
221 3300049742 Ga0501080_0013935 Ga0501080_0013935_5157_5888 210
222 3300049743 Ga0501081_0388108 Ga0501081_0388108_50_781 210
223 3300049744 Ga0501083_0006162 Ga0501083_0006162_4190_4921 210
224 3300049823 Ga0501044_0126799 Ga0501044_0126799_477_1208 210
225 3300054114 Ga0501084_0072532 Ga0501084_0072532_49_780 210
226 3300060353 Ga0501082_0232463 Ga0501082_0232463_301_1032 210
227 3300005435 Ga0070714_100793960 Ga0070714_1007939601 212
228 3300025903 Ga0207680_10440925 Ga0207680_104409251 212
229 3300037466 Ga0395898_0228591 Ga0395898_0228591_135_797 212
230 3300037471 Ga0395905_0165184 Ga0395905_0165184_1316_1978 212
231 3300038443 Ga0395901_0174257 Ga0395901_0174257_1231_1893 212
232 3300044684 Ga0466966_0043565 Ga0466966_0043565_555_1289 212
233 3300044693 Ga0466961_0005119 Ga0466961_0005119_7473_8207 212
234 3300044719 Ga0466971_0018992 Ga0466971_0018992_1801_2535 212
235 3300044765 Ga0466970_0067753 Ga0466970_0067753_449_1183 212
236 3300045049 Ga0466959_0016325 Ga0466959_0016325_1298_2032 212
237 3300045836 Ga0466958_0006066 Ga0466958_0006066_1798_2532 212
238 3300048915 Ga0496112_0404381 Ga0496112_0404381_550_1275 212
239 3300044694 Ga0466963_0001433 Ga0466963_0001433_8516_9241 213
240 3300045836 Ga0466958_0032141 Ga0466958_0032141_187_912 213
241 3300045976 Ga0466967_0033811 Ga0466967_0033811_927_1652 213
242 3300005329 Ga0070683_100289348 Ga0070683_1002893482 214
243 3300005535 Ga0070684_100039763 Ga0070684_1000397635 214
244 3300005544 Ga0070686_100461208 Ga0070686_1004612082 214
245 3300005564 Ga0070664_100198478 Ga0070664_1001984781 214
246 3300011119 Ga0105246_10064171 Ga0105246_100641712 214
247 3300014745 Ga0157377_10225917 Ga0157377_102259172 214
248 3300025919 Ga0207657_10060602 Ga0207657_100606024 214
249 3300025944 Ga0207661_10181587 Ga0207661_101815872 214
250 3300025945 Ga0207679_10846929 Ga0207679_108469291 214
251 3300049583 Ga0501067_0025692 Ga0501067_0025692_896_1621 214
252 3300005336 Ga0070680_100132175 Ga0070680_1001321752 215
253 3300005563 Ga0068855_100017296 Ga0068855_1000172966 215
254 3300005563 Ga0068855_100127698 Ga0068855_1001276982 215
255 3300006175 Ga0070712_100291302 Ga0070712_1002913022 215
256 3300009177 Ga0105248_10053284 Ga0105248_100532844 215
257 3300011119 Ga0105246_10060019 Ga0105246_100600193 215
258 3300025912 Ga0207707_10064999 Ga0207707_100649994 215
259 3300025921 Ga0207652_10069328 Ga0207652_100693283 215
260 3300025944 Ga0207661_10336619 Ga0207661_103366192 215
261 3300025949 Ga0207667_10184639 Ga0207667_101846393 215
262 3300044658 Ga0466972_0153558 Ga0466972_0153558_50_787 215
263 3300044694 Ga0466963_0187344 Ga0466963_0187344_483_1217 215
264 3300046455 Ga0495603_0065453 Ga0495603_0065453_936_1664 215
265 3300048908 Ga0496105_0310131 Ga0496105_0310131_419_1147 215
266 3300048910 Ga0496107_0130134 Ga0496107_0130134_894_1619 215
267 3300048912 Ga0496109_0409429 Ga0496109_0409429_24_752 215
268 3300048918 Ga0496115_0253983 Ga0496115_0253983_444_1172 215
269 3300050513 nmdc:mga0rr50_264268_c1 nmdc:mga0rr50_264268_c1_88_822 215
270 3300005981 Ga0081538_10085724 Ga0081538_100857242 216
271 3300044694 Ga0466963_0013063 Ga0466963_0013063_1488_2213 216
272 3300049583 Ga0501067_0078772 Ga0501067_0078772_520_1251 216
273 3300005530 Ga0070679_100074647 Ga0070679_1000746473 217
274 3300013307 Ga0157372_10246472 Ga0157372_102464722 217
275 3300025912 Ga0207707_10303936 Ga0207707_103039362 217
276 3300025921 Ga0207652_10107665 Ga0207652_101076652 217
277 3300031731 Ga0307405_10026826 Ga0307405_100268262 218
278 3300031852 Ga0307410_10029639 Ga0307410_100296392 218
279 3300031903 Ga0307407_10081327 Ga0307407_100813272 218
280 3300032002 Ga0307416_100086822 Ga0307416_1000868223 218
281 3300032004 Ga0307414_10196945 Ga0307414_101969452 218
282 3300046663 Ga0495635_0486378 Ga0495635_0486378_103_783 218
283 3300049583 Ga0501067_0075431 Ga0501067_0075431_797_1525 218
284 3300049587 Ga0501071_0255929 Ga0501071_0255929_394_1125 218
285 3300049592 Ga0501076_0054863 Ga0501076_0054863_2413_3147 218
286 3300005435 Ga0070714_100046659 Ga0070714_1000466594 219
287 3300005518 Ga0070699_100098930 Ga0070699_1000989302 219
288 3300006175 Ga0070712_100211393 Ga0070712_1002113932 219
289 3300009551 Ga0105238_10317837 Ga0105238_103178372 219
290 3300013105 Ga0157369_10005843 Ga0157369_100058434 219
291 3300020070 Ga0206356_10320930 Ga0206356_103209302 219
292 3300025909 Ga0207705_10334931 Ga0207705_103349312 219
293 3300025915 Ga0207693_10138397 Ga0207693_101383972 219
294 3300041512 Ga0451853_0955806 Ga0451853_0955806_284_1021 219
295 3300048915 Ga0496112_0027644 Ga0496112_0027644_3858_4583 219
296 3300049584 Ga0501068_0098209 Ga0501068_0098209_803_1528 219
297 3300049586 Ga0501070_0015295 Ga0501070_0015295_1554_2279 219
298 3300049741 Ga0501079_0010628 Ga0501079_0010628_3170_3895 219
299 3300049744 Ga0501083_0007689 Ga0501083_0007689_5619_6344 219
300 3300060353 Ga0501082_0072141 Ga0501082_0072141_435_1160 219
301 3300013296 Ga0157374_10205734 Ga0157374_102057342 220
302 3300026088 Ga0207641_10547809 Ga0207641_105478092 220
303 3300037466 Ga0395898_0298109 Ga0395898_0298109_400_1128 220
304 3300045976 Ga0466967_0032687 Ga0466967_0032687_1318_2043 220
305 3300045976 Ga0466967_0182802 Ga0466967_0182802_596_1321 220
306 3300002459 JGI24751J29686_10048937 JGI24751J29686_100489371 221
307 3300005340 Ga0070689_100299351 Ga0070689_1002993511 221
308 3300005345 Ga0070692_10435773 Ga0070692_104357731 221
309 3300005364 Ga0070673_100123227 Ga0070673_1001232273 221
310 3300005365 Ga0070688_100269795 Ga0070688_1002697951 221
311 3300005406 Ga0070703_10007863 Ga0070703_100078632 221
312 3300005438 Ga0070701_10044671 Ga0070701_100446713 221
313 3300005440 Ga0070705_100009442 Ga0070705_1000094423 221
314 3300005455 Ga0070663_100143782 Ga0070663_1001437822 221
315 3300005459 Ga0068867_100079080 Ga0068867_1000790802 221
316 3300005466 Ga0070685_10005718 Ga0070685_100057182 221
317 3300005466 Ga0070685_10201953 Ga0070685_102019532 221
318 3300005535 Ga0070684_100079163 Ga0070684_1000791632 221
319 3300005547 Ga0070693_100328139 Ga0070693_1003281391 221
320 3300005548 Ga0070665_100055070 Ga0070665_1000550705 221
321 3300005564 Ga0070664_100252842 Ga0070664_1002528422 221
322 3300005617 Ga0068859_100223564 Ga0068859_1002235642 221
323 3300005617 Ga0068859_100787917 Ga0068859_1007879172 221
324 3300005618 Ga0068864_100095733 Ga0068864_1000957331 221
325 3300005841 Ga0068863_100375105 Ga0068863_1003751052 221
326 3300005842 Ga0068858_100034222 Ga0068858_1000342225 221
327 3300005844 Ga0068862_100081842 Ga0068862_1000818422 221
328 3300006358 Ga0068871_100237186 Ga0068871_1002371862 221
329 3300006881 Ga0068865_100023380 Ga0068865_1000233802 221
330 3300006931 Ga0097620_100223565 Ga0097620_1002235652 221
331 3300006931 Ga0097620_100787830 Ga0097620_1007878302 221
332 3300009098 Ga0105245_10093737 Ga0105245_100937373 221
333 3300009176 Ga0105242_10371388 Ga0105242_103713882 221
334 3300013308 Ga0157375_11275840 Ga0157375_112758401 221
335 3300014325 Ga0163163_10344646 Ga0163163_103446462 221
336 3300014326 Ga0157380_10009782 Ga0157380_100097823 221
337 3300014968 Ga0157379_10023154 Ga0157379_100231545 221
338 3300014969 Ga0157376_10052765 Ga0157376_100527652 221
339 3300017792 Ga0163161_10139881 Ga0163161_101398812 221
340 3300020082 Ga0206353_10445049 Ga0206353_104450492 221
341 3300025315 Ga0207697_10108556 Ga0207697_101085562 221
342 3300025885 Ga0207653_10007351 Ga0207653_100073513 221
343 3300025904 Ga0207647_10113346 Ga0207647_101133462 221
344 3300025912 Ga0207707_10433586 Ga0207707_104335862 221
345 3300025922 Ga0207646_10211668 Ga0207646_102116682 221
346 3300025927 Ga0207687_10280786 Ga0207687_102807862 221
347 3300025935 Ga0207709_10151493 Ga0207709_101514932 221
348 3300025938 Ga0207704_10243281 Ga0207704_102432812 221
349 3300025940 Ga0207691_10019906 Ga0207691_100199062 221
350 3300025944 Ga0207661_10317377 Ga0207661_103173772 221
351 3300025944 Ga0207661_10566224 Ga0207661_105662241 221
352 3300025961 Ga0207712_10429189 Ga0207712_104291892 221
353 3300025972 Ga0207668_10230411 Ga0207668_102304112 221
354 3300026041 Ga0207639_10211090 Ga0207639_102110902 221
355 3300026067 Ga0207678_10098011 Ga0207678_100980113 221
356 3300026075 Ga0207708_10018487 Ga0207708_100184872 221
357 3300026088 Ga0207641_10305026 Ga0207641_103050262 221
358 3300026089 Ga0207648_10046987 Ga0207648_100469872 221
359 3300026089 Ga0207648_10162273 Ga0207648_101622733 221
360 3300026095 Ga0207676_10088209 Ga0207676_100882095 221
361 3300026116 Ga0207674_10521240 Ga0207674_105212401 221
362 3300026121 Ga0207683_10270539 Ga0207683_102705392 221
363 3300026142 Ga0207698_10349424 Ga0207698_103494242 221
364 3300027907 Ga0207428_10066635 Ga0207428_100666353 221
365 3300028379 Ga0268266_10236739 Ga0268266_102367392 221
366 3300028381 Ga0268264_10064761 Ga0268264_100647614 221
367 3300028666 Ga0265336_10004283 Ga0265336_100042833 221
368 3300035084 Ga0373928_0055134 Ga0373928_0055134_114_842 221
369 3300035090 Ga0373949_0007840 Ga0373949_0007840_1177_1905 221
370 3300035114 Ga0373939_0079056 Ga0373939_0079056_294_1022 221
371 3300035121 Ga0373960_0005206 Ga0373960_0005206_230_958 221
372 3300035241 Ga0373961_0031129 Ga0373961_0031129_324_1052 221
373 3300046520 Ga0495637_0023307 Ga0495637_0023307_824_1552 221
374 3300046690 Ga0495624_0059981 Ga0495624_0059981_31_720 221
375 3300047319 Ga0495674_0569027 Ga0495674_0569027_27_752 221
376 3300047321 Ga0495676_0309064 Ga0495676_0309064_124_813 221
377 3300048903 Ga0496100_0077807 Ga0496100_0077807_256_984 221
378 3300048905 Ga0496102_0342326 Ga0496102_0342326_494_1222 221
379 3300048907 Ga0496104_0427400 Ga0496104_0427400_137_865 221
380 3300048909 Ga0496106_0312704 Ga0496106_0312704_421_1149 221
381 3300048917 Ga0496114_0003682 Ga0496114_0003682_3357_4085 221
382 3300049585 Ga0501069_0071873 Ga0501069_0071873_20_709 221
383 3300050511 nmdc:mga08y16_28150_c1 nmdc:mga08y16_28150_c1_2187_2915 221
384 3300005337 Ga0070682_100151893 Ga0070682_1001518932 222
385 3300005339 Ga0070660_100116289 Ga0070660_1001162892 222
386 3300005458 Ga0070681_10051784 Ga0070681_100517844 222
387 3300025912 Ga0207707_10099167 Ga0207707_100991673 222
388 3300025919 Ga0207657_10014668 Ga0207657_100146686 222
389 3300035171 Ga0373946_0188977 Ga0373946_0188977_150_881 222
390 3300035725 Ga0373947_0013729 Ga0373947_0013729_3662_4393 222
391 3300045976 Ga0466967_0153732 Ga0466967_0153732_537_1262 222
392 3300047321 Ga0495676_0081257 Ga0495676_0081257_177_908 222
393 3300048905 Ga0496102_0041512 Ga0496102_0041512_1919_2653 222
394 3300048915 Ga0496112_0005576 Ga0496112_0005576_6447_7181 222
395 3300048915 Ga0496112_0066386 Ga0496112_0066386_906_1640 222
396 3300048917 Ga0496114_0089111 Ga0496114_0089111_147_875 222
397 3300049591 Ga0501075_0064559 Ga0501075_0064559_707_1435 222
398 3300060353 Ga0501082_0076561 Ga0501082_0076561_1960_2688 222
399 3300006358 Ga0068871_100330740 Ga0068871_1003307402 223
400 3300009098 Ga0105245_10108548 Ga0105245_101085483 223
401 3300009148 Ga0105243_10045431 Ga0105243_100454315 223
402 3300013104 Ga0157370_10180717 Ga0157370_101807172 223
403 3300025899 Ga0207642_10188429 Ga0207642_101884292 223
404 3300025937 Ga0207669_10013120 Ga0207669_100131203 223
405 3300025938 Ga0207704_10215338 Ga0207704_102153381 223
406 3300026121 Ga0207683_10057863 Ga0207683_100578633 223
407 3300031995 Ga0307409_100198531 Ga0307409_1001985312 223
408 3300036401 Ga0373937_0643548 Ga0373937_0643548_48_785 223
409 3300045836 Ga0466958_0270731 Ga0466958_0270731_336_1061 223
410 3300046664 Ga0495659_0215277 Ga0495659_0215277_23_736 223
411 3300046675 Ga0495657_0023566 Ga0495657_0023566_883_1620 223
412 3300061719 Ga0466962_0034689 Ga0466962_0034689_1148_1873 223
413 3300005458 Ga0070681_10175059 Ga0070681_101750593 224
414 3300005563 Ga0068855_100825550 Ga0068855_1008255501 224
415 3300006028 Ga0070717_10039302 Ga0070717_100393022 224
416 3300006163 Ga0070715_10062711 Ga0070715_100627112 224
417 3300009093 Ga0105240_10010108 Ga0105240_100101089 224
418 3300009174 Ga0105241_10093815 Ga0105241_100938152 224
419 3300009545 Ga0105237_10064368 Ga0105237_100643681 224
420 3300013307 Ga0157372_10179460 Ga0157372_101794603 224
421 3300025911 Ga0207654_10034496 Ga0207654_100344962 224
422 3300025912 Ga0207707_10463691 Ga0207707_104636912 224
423 3300025913 Ga0207695_10070222 Ga0207695_100702222 224
424 3300025914 Ga0207671_10044313 Ga0207671_100443133 224
425 3300025915 Ga0207693_10015144 Ga0207693_100151442 224
426 3300025915 Ga0207693_10079805 Ga0207693_100798051 224
427 3300025916 Ga0207663_10010889 Ga0207663_100108895 224
428 3300025921 Ga0207652_10180375 Ga0207652_101803752 224
429 3300025928 Ga0207700_10374252 Ga0207700_103742522 224
430 3300025929 Ga0207664_10203899 Ga0207664_102038991 224
431 3300035241 Ga0373961_0009209 Ga0373961_0009209_394_1122 224
432 3300035691 Ga0373931_0050190 Ga0373931_0050190_617_1345 224
433 3300047317 Ga0495604_0046014 Ga0495604_0046014_542_1279 224
434 3300048905 Ga0496102_0008078 Ga0496102_0008078_4324_5049 224
435 3300048906 Ga0496103_0006222 Ga0496103_0006222_1991_2716 224
436 iso_pu_bacteria 2738543034 2739362842 224
437 3300005343 Ga0070687_100045336 Ga0070687_1000453362 225
438 3300009101 Ga0105247_10025800 Ga0105247_100258002 225
439 3300014745 Ga0157377_10207381 Ga0157377_102073812 225
440 3300025900 Ga0207710_10011970 Ga0207710_100119703 225
441 3300025918 Ga0207662_10075932 Ga0207662_100759323 225
442 3300028800 Ga0265338_10076433 Ga0265338_100764332 225
443 3300046514 Ga0495618_0459112 Ga0495618_0459112_16_753 225
444 3300046529 Ga0495652_0195050 Ga0495652_0195050_324_1061 225
445 3300046543 Ga0495645_0039003 Ga0495645_0039003_893_1630 225
446 3300047319 Ga0495674_0019693 Ga0495674_0019693_5349_6086 225
447 3300048908 Ga0496105_0165311 Ga0496105_0165311_422_1150 225
448 3300053077 Ga0495601_0117712 Ga0495601_0117712_298_1035 225
449 3300053083 Ga0495655_0010180 Ga0495655_0010180_529_1257 225
450 3300013105 Ga0157369_10752433 Ga0157369_107524332 226
451 3300045976 Ga0466967_0076836 Ga0466967_0076836_1266_2003 226
452 3300050515 nmdc:mga0a205_310314_c1 nmdc:mga0a205_310314_c1_86_820 226
453 3300005435 Ga0070714_100087572 Ga0070714_1000875722 227
454 3300035695 Ga0373927_0091870 Ga0373927_0091870_109_831 227
455 3300047317 Ga0495604_0330921 Ga0495604_0330921_42_749 227
456 3300049573 Ga0501037_0297418 Ga0501037_0297418_82_825 227
457 3300037312 Ga0395899_0350461 Ga0395899_0350461_219_929 228
458 3300044694 Ga0466963_0296275 Ga0466963_0296275_391_1101 228
459 3300045836 Ga0466958_0037182 Ga0466958_0037182_1516_2226 228
460 3300045976 Ga0466967_0164784 Ga0466967_0164784_1268_1978 228
461 3300046462 Ga0495651_0161366 Ga0495651_0161366_249_986 228
462 3300046463 Ga0495653_0064205 Ga0495653_0064205_1821_2507 228
463 3300046543 Ga0495645_0232809 Ga0495645_0232809_276_1013 228
464 3300046559 Ga0495667_0132199 Ga0495667_0132199_48_785 228
465 3300046642 Ga0495634_0231035 Ga0495634_0231035_248_985 228
466 3300046663 Ga0495635_0076691 Ga0495635_0076691_917_1654 228
467 3300046678 Ga0495599_0055231 Ga0495599_0055231_1736_2473 228
468 3300046679 Ga0495623_0015038 Ga0495623_0015038_2477_3214 228
469 3300046809 Ga0495600_0080294 Ga0495600_0080294_720_1457 228
470 3300047317 Ga0495604_0089327 Ga0495604_0089327_1455_2192 228
471 3300047319 Ga0495674_0076452 Ga0495674_0076452_1746_2483 228
472 3300047322 Ga0495680_0022177 Ga0495680_0022177_2600_3337 228
473 3300047444 Ga0495675_0083821 Ga0495675_0083821_318_1055 228
474 3300048088 Ga0495602_0073742 Ga0495602_0073742_851_1588 228
475 3300050489 nmdc:mga03683_59891_c1 nmdc:mga03683_59891_c1_109_828 228
476 3300050491 nmdc:mga00v17_96415_c1 nmdc:mga00v17_96415_c1_1118_1837 228
477 3300053077 Ga0495601_0136195 Ga0495601_0136195_845_1582 228
478 3300053085 Ga0495619_0012949 Ga0495619_0012949_1296_2033 228
479 3300026089 Ga0207648_10591722 Ga0207648_105917222 229
480 3300037418 Ga0395900_0060829 Ga0395900_0060829_1804_2553 229
481 3300037466 Ga0395898_0219659 Ga0395898_0219659_647_1396 229
482 3300037471 Ga0395905_0206154 Ga0395905_0206154_306_1055 229
483 3300048915 Ga0496112_0423801 Ga0496112_0423801_280_993 229
484 3300048925 Ga0496122_0034898 Ga0496122_0034898_1751_2500 229
485 3300048926 Ga0496123_0017534 Ga0496123_0017534_2885_3634 229
486 3300048927 Ga0496124_0029460 Ga0496124_0029460_1301_2050 229
487 3300006051 Ga0075364_10055922 Ga0075364_100559223 231
488 3300006177 Ga0075362_10034669 Ga0075362_100346692 231
489 3300060353 Ga0501082_0136698 Ga0501082_0136698_782_1501 231
490 3300005327 Ga0070658_10421084 Ga0070658_104210842 232
491 3300005329 Ga0070683_100045200 Ga0070683_1000452002 232
492 3300005329 Ga0070683_100086566 Ga0070683_1000865662 232
493 3300005329 Ga0070683_100154293 Ga0070683_1001542931 232
494 3300005336 Ga0070680_100006781 Ga0070680_1000067817 232
495 3300005339 Ga0070660_100002517 Ga0070660_1000025177 232
496 3300005339 Ga0070660_100104593 Ga0070660_1001045931 232
497 3300005344 Ga0070661_100031225 Ga0070661_1000312252 232
498 3300005366 Ga0070659_100049468 Ga0070659_1000494682 232
499 3300005445 Ga0070708_100042939 Ga0070708_1000429395 232
500 3300005458 Ga0070681_10010530 Ga0070681_100105308 232
501 3300005458 Ga0070681_10010706 Ga0070681_1001070610 232
502 3300005458 Ga0070681_10013095 Ga0070681_100130955 232
503 3300005530 Ga0070679_100021643 Ga0070679_1000216432 232
504 3300005530 Ga0070679_100142615 Ga0070679_1001426153 232
505 3300005535 Ga0070684_100048772 Ga0070684_1000487724 232
506 3300005535 Ga0070684_100074132 Ga0070684_1000741323 232
507 3300005535 Ga0070684_100128285 Ga0070684_1001282853 232
508 3300005535 Ga0070684_100205666 Ga0070684_1002056662 232
509 3300005539 Ga0068853_100278210 Ga0068853_1002782102 232
510 3300005546 Ga0070696_100056408 Ga0070696_1000564082 232
511 3300005548 Ga0070665_100017936 Ga0070665_1000179362 232
512 3300005563 Ga0068855_100026748 Ga0068855_1000267482 232
513 3300005563 Ga0068855_100030862 Ga0068855_1000308623 232
514 3300005577 Ga0068857_100013113 Ga0068857_1000131139 232
515 3300005577 Ga0068857_100061197 Ga0068857_1000611972 232
516 3300009093 Ga0105240_10034729 Ga0105240_100347293 232
517 3300009093 Ga0105240_10120457 Ga0105240_101204573 232
518 3300009098 Ga0105245_10482566 Ga0105245_104825662 232
519 3300009545 Ga0105237_10155043 Ga0105237_101550431 232
520 3300009551 Ga0105238_10025932 Ga0105238_100259326 232
521 3300009551 Ga0105238_11058988 Ga0105238_110589882 232
522 3300010375 Ga0105239_10087965 Ga0105239_100879653 232
523 3300013100 Ga0157373_10044336 Ga0157373_100443363 232
524 3300013104 Ga0157370_10042395 Ga0157370_100423953 232
525 3300013104 Ga0157370_10131329 Ga0157370_101313292 232
526 3300013105 Ga0157369_10002737 Ga0157369_1000273719 232
527 3300013105 Ga0157369_10054695 Ga0157369_100546953 232
528 3300013105 Ga0157369_10136200 Ga0157369_101362003 232
529 3300013307 Ga0157372_10203659 Ga0157372_102036592 232
530 3300020069 Ga0197907_11415801 Ga0197907_114158013 232
531 3300020082 Ga0206353_10157270 Ga0206353_101572702 232
532 3300020082 Ga0206353_10511590 Ga0206353_105115902 232
533 3300020082 Ga0206353_11657420 Ga0206353_116574202 232
534 3300025909 Ga0207705_10023580 Ga0207705_100235802 232
535 3300025909 Ga0207705_10056446 Ga0207705_100564462 232
536 3300025910 Ga0207684_10235383 Ga0207684_102353832 232
537 3300025912 Ga0207707_10011362 Ga0207707_100113624 232
538 3300025912 Ga0207707_10047285 Ga0207707_100472852 232
539 3300025912 Ga0207707_10056591 Ga0207707_100565912 232
540 3300025913 Ga0207695_10107810 Ga0207695_101078103 232
541 3300025914 Ga0207671_10108603 Ga0207671_101086031 232
542 3300025919 Ga0207657_10007555 Ga0207657_100075557 232
543 3300025919 Ga0207657_10146831 Ga0207657_101468312 232
544 3300025919 Ga0207657_10231457 Ga0207657_102314572 232
545 3300025924 Ga0207694_10247701 Ga0207694_102477012 232
546 3300025927 Ga0207687_10268684 Ga0207687_102686842 232
547 3300025929 Ga0207664_10138382 Ga0207664_101383822 232
548 3300025932 Ga0207690_10032204 Ga0207690_100322043 232
549 3300025932 Ga0207690_10145671 Ga0207690_101456711 232
550 3300025944 Ga0207661_10052015 Ga0207661_100520153 232
551 3300025944 Ga0207661_10087987 Ga0207661_100879872 232
552 3300025949 Ga0207667_10014549 Ga0207667_100145499 232
553 3300025949 Ga0207667_10099015 Ga0207667_100990151 232
554 3300025949 Ga0207667_10478493 Ga0207667_104784931 232
555 3300026116 Ga0207674_10019286 Ga0207674_100192863 232
556 3300026116 Ga0207674_10022877 Ga0207674_100228773 232
557 3300026142 Ga0207698_10367346 Ga0207698_103673461 232
558 3300028379 Ga0268266_10092378 Ga0268266_100923783 232
559 3300037312 Ga0395899_0031096 Ga0395899_0031096_1916_2644 232
560 3300037418 Ga0395900_0060885 Ga0395900_0060885_224_955 232
561 3300037418 Ga0395900_0082225 Ga0395900_0082225_1955_2683 232
562 3300037418 Ga0395900_0174330 Ga0395900_0174330_1234_1968 232
563 3300037418 Ga0395900_0230291 Ga0395900_0230291_443_1177 232
564 3300037418 Ga0395900_0623724 Ga0395900_0623724_151_879 232
565 3300037466 Ga0395898_0142584 Ga0395898_0142584_381_1115 232
566 3300037466 Ga0395898_0508772 Ga0395898_0508772_222_953 232
567 3300038443 Ga0395901_0012503 Ga0395901_0012503_559_1293 232
568 3300038443 Ga0395901_0023269 Ga0395901_0023269_3550_4278 232
569 3300038443 Ga0395901_0256139 Ga0395901_0256139_987_1718 232
570 3300042531 Ga0450918_024694 Ga0450918_024694_92_820 232
571 3300044683 Ga0466965_0028665 Ga0466965_0028665_1147_1875 232
572 3300044693 Ga0466961_0001160 Ga0466961_0001160_4506_5234 232
573 3300044693 Ga0466961_0061225 Ga0466961_0061225_1596_2324 232
574 3300044694 Ga0466963_0001175 Ga0466963_0001175_3792_4526 232
575 3300044694 Ga0466963_0002246 Ga0466963_0002246_8697_9425 232
576 3300044694 Ga0466963_0032261 Ga0466963_0032261_2459_3187 232
577 3300044694 Ga0466963_0039820 Ga0466963_0039820_2208_2936 232
578 3300044694 Ga0466963_0118967 Ga0466963_0118967_92_823 232
579 3300044694 Ga0466963_0462424 Ga0466963_0462424_93_824 232
580 3300044719 Ga0466971_0000719 Ga0466971_0000719_10134_10862 232
581 3300044735 Ga0466968_0005368 Ga0466968_0005368_2170_2898 232
582 3300044735 Ga0466968_0060438 Ga0466968_0060438_338_1063 232
583 3300044765 Ga0466970_0088222 Ga0466970_0088222_743_1471 232
584 3300044842 Ga0466957_0002461 Ga0466957_0002461_1015_1743 232
585 3300045049 Ga0466959_0001752 Ga0466959_0001752_586_1314 232
586 3300045049 Ga0466959_0013333 Ga0466959_0013333_3634_4362 232
587 3300045836 Ga0466958_0013252 Ga0466958_0013252_874_1602 232
588 3300045976 Ga0466967_0007181 Ga0466967_0007181_3023_3751 232
589 3300045976 Ga0466967_0019107 Ga0466967_0019107_4689_5417 232
590 3300045976 Ga0466967_0021803 Ga0466967_0021803_930_1661 232
591 3300045976 Ga0466967_0196677 Ga0466967_0196677_1126_1854 232
592 3300046463 Ga0495653_0023889 Ga0495653_0023889_154_876 232
593 3300046535 Ga0495586_0023214 Ga0495586_0023214_2257_2979 232
594 3300046683 Ga0495658_0055375 Ga0495658_0055375_1326_2048 232
595 3300047315 Ga0495581_0000299 Ga0495581_0000299_1007_1729 232
596 3300047321 Ga0495676_0109847 Ga0495676_0109847_692_1414 232
597 3300048911 Ga0496108_0172288 Ga0496108_0172288_1039_1767 232
598 3300048912 Ga0496109_0409137 Ga0496109_0409137_182_913 232
599 3300048915 Ga0496112_0023919 Ga0496112_0023919_4434_5165 232
600 3300048915 Ga0496112_0056022 Ga0496112_0056022_2538_3269 232
601 3300048918 Ga0496115_0166590 Ga0496115_0166590_613_1341 232
602 3300049581 Ga0501047_0082319 Ga0501047_0082319_2148_2879 232
603 3300049583 Ga0501067_0001274 Ga0501067_0001274_11773_12501 232
604 3300049586 Ga0501070_0000256 Ga0501070_0000256_14606_15337 232
605 3300049586 Ga0501070_0279562 Ga0501070_0279562_606_1334 232
606 3300049590 Ga0501074_0135186 Ga0501074_0135186_251_982 232
607 3300049743 Ga0501081_0228155 Ga0501081_0228155_302_1024 232
608 3300049823 Ga0501044_0420161 Ga0501044_0420161_239_970 232
609 3300061719 Ga0466962_0000254 Ga0466962_0000254_16699_17427 232
610 3300061734 Ga0530510_0022085 Ga0530510_0022085_623_1351 232
611 3300005327 Ga0070658_10019227 Ga0070658_100192272 233
612 3300005327 Ga0070658_10020064 Ga0070658_100200644 233
613 3300005327 Ga0070658_10159068 Ga0070658_101590683 233
614 3300005329 Ga0070683_100089050 Ga0070683_1000890502 233
615 3300005336 Ga0070680_100048093 Ga0070680_1000480932 233
616 3300005337 Ga0070682_100063645 Ga0070682_1000636451 233
617 3300005337 Ga0070682_100074407 Ga0070682_1000744072 233
618 3300005338 Ga0068868_100111670 Ga0068868_1001116703 233
619 3300005339 Ga0070660_100005102 Ga0070660_10000510210 233
620 3300005339 Ga0070660_100009052 Ga0070660_1000090529 233
621 3300005339 Ga0070660_100012639 Ga0070660_1000126396 233
622 3300005339 Ga0070660_100013951 Ga0070660_1000139515 233
623 3300005344 Ga0070661_100077423 Ga0070661_1000774232 233
624 3300005354 Ga0070675_100264866 Ga0070675_1002648662 233
625 3300005355 Ga0070671_100127284 Ga0070671_1001272842 233
626 3300005355 Ga0070671_100146523 Ga0070671_1001465232 233
627 3300005366 Ga0070659_100057058 Ga0070659_1000570584 233
628 3300005434 Ga0070709_10021663 Ga0070709_100216633 233
629 3300005434 Ga0070709_10090640 Ga0070709_100906401 233
630 3300005434 Ga0070709_10278376 Ga0070709_102783762 233
631 3300005435 Ga0070714_100001442 Ga0070714_10000144214 233
632 3300005435 Ga0070714_100001730 Ga0070714_10000173012 233
633 3300005435 Ga0070714_100008154 Ga0070714_1000081548 233
634 3300005435 Ga0070714_100029368 Ga0070714_1000293683 233
635 3300005435 Ga0070714_100080782 Ga0070714_1000807822 233
636 3300005435 Ga0070714_100257608 Ga0070714_1002576081 233
637 3300005435 Ga0070714_100455454 Ga0070714_1004554542 233
638 3300005436 Ga0070713_100027513 Ga0070713_1000275132 233
639 3300005436 Ga0070713_100076003 Ga0070713_1000760032 233
640 3300005436 Ga0070713_100879074 Ga0070713_1008790741 233
641 3300005437 Ga0070710_10004523 Ga0070710_100045234 233
642 3300005437 Ga0070710_10006096 Ga0070710_100060964 233
643 3300005439 Ga0070711_100004075 Ga0070711_1000040753 233
644 3300005440 Ga0070705_100286785 Ga0070705_1002867852 233
645 3300005445 Ga0070708_100163863 Ga0070708_1001638633 233
646 3300005456 Ga0070678_100273528 Ga0070678_1002735281 233
647 3300005458 Ga0070681_10027297 Ga0070681_100272977 233
648 3300005458 Ga0070681_10087262 Ga0070681_100872622 233
649 3300005458 Ga0070681_10106566 Ga0070681_101065662 233
650 3300005458 Ga0070681_10462153 Ga0070681_104621532 233
651 3300005467 Ga0070706_100349477 Ga0070706_1003494771 233
652 3300005468 Ga0070707_100001128 Ga0070707_10000112821 233
653 3300005471 Ga0070698_100235308 Ga0070698_1002353082 233
654 3300005530 Ga0070679_100031014 Ga0070679_1000310143 233
655 3300005530 Ga0070679_100110244 Ga0070679_1001102443 233
656 3300005530 Ga0070679_100191353 Ga0070679_1001913531 233
657 3300005535 Ga0070684_100421800 Ga0070684_1004218002 233
658 3300005539 Ga0068853_100315277 Ga0068853_1003152772 233
659 3300005545 Ga0070695_100000029 Ga0070695_10000002955 233
660 3300005546 Ga0070696_100328456 Ga0070696_1003284562 233
661 3300005563 Ga0068855_100012520 Ga0068855_1000125204 233
662 3300005563 Ga0068855_100309957 Ga0068855_1003099572 233
663 3300005564 Ga0070664_100098595 Ga0070664_1000985953 233
664 3300005614 Ga0068856_100144507 Ga0068856_1001445072 233
665 3300005614 Ga0068856_100188291 Ga0068856_1001882913 233
666 3300005616 Ga0068852_100115438 Ga0068852_1001154383 233
667 3300006028 Ga0070717_10014448 Ga0070717_100144483 233
668 3300006028 Ga0070717_10042288 Ga0070717_100422882 233
669 3300006028 Ga0070717_10053243 Ga0070717_100532433 233
670 3300006028 Ga0070717_10142907 Ga0070717_101429072 233
671 3300006028 Ga0070717_10789861 Ga0070717_107898611 233
672 3300006163 Ga0070715_10003646 Ga0070715_100036464 233
673 3300006173 Ga0070716_100000663 Ga0070716_1000006632 233
674 3300006173 Ga0070716_100089977 Ga0070716_1000899772 233
675 3300006175 Ga0070712_100088685 Ga0070712_1000886853 233
676 3300006175 Ga0070712_100122132 Ga0070712_1001221323 233
677 3300006175 Ga0070712_100152289 Ga0070712_1001522892 233
678 3300006237 Ga0097621_100324368 Ga0097621_1003243682 233
679 3300006852 Ga0075433_10000706 Ga0075433_100007066 233
680 3300006871 Ga0075434_100000347 Ga0075434_10000034725 233
681 3300006871 Ga0075434_100002359 Ga0075434_1000023599 233
682 3300006914 Ga0075436_100198416 Ga0075436_1001984162 233
683 3300007076 Ga0075435_100069737 Ga0075435_1000697373 233
684 3300009093 Ga0105240_10023072 Ga0105240_100230727 233
685 3300009094 Ga0111539_10019125 Ga0111539_100191258 233
686 3300009147 Ga0114129_11184995 Ga0114129_111849951 233
687 3300009177 Ga0105248_10182801 Ga0105248_101828012 233
688 3300009177 Ga0105248_10323201 Ga0105248_103232012 233
689 3300009177 Ga0105248_10391904 Ga0105248_103919042 233
690 3300009545 Ga0105237_10084024 Ga0105237_100840242 233
691 3300009551 Ga0105238_10257465 Ga0105238_102574652 233
692 3300010375 Ga0105239_10820171 Ga0105239_108201711 233
693 3300013100 Ga0157373_10233225 Ga0157373_102332252 233
694 3300013102 Ga0157371_10019119 Ga0157371_100191197 233
695 3300013102 Ga0157371_10163874 Ga0157371_101638742 233
696 3300013104 Ga0157370_10013425 Ga0157370_100134257 233
697 3300013104 Ga0157370_10051763 Ga0157370_100517632 233
698 3300013104 Ga0157370_10396715 Ga0157370_103967152 233
699 3300013105 Ga0157369_10013174 Ga0157369_100131744 233
700 3300013105 Ga0157369_10033465 Ga0157369_100334656 233
701 3300013105 Ga0157369_10092778 Ga0157369_100927783 233
702 3300013297 Ga0157378_10177049 Ga0157378_101770492 233
703 3300013307 Ga0157372_10904550 Ga0157372_109045502 233
704 3300013308 Ga0157375_10063317 Ga0157375_100633174 233
705 3300013308 Ga0157375_10705633 Ga0157375_107056332 233
706 3300014497 Ga0182008_10003425 Ga0182008_100034253 233
707 3300014497 Ga0182008_10067532 Ga0182008_100675322 233
708 3300014968 Ga0157379_10187303 Ga0157379_101873032 233
709 3300014969 Ga0157376_10031446 Ga0157376_100314462 233
710 3300020069 Ga0197907_10400800 Ga0197907_104008002 233
711 3300020069 Ga0197907_10581481 Ga0197907_105814812 233
712 3300020070 Ga0206356_10279172 Ga0206356_102791724 233
713 3300020081 Ga0206354_10549865 Ga0206354_105498652 233
714 3300020081 Ga0206354_10789475 Ga0206354_107894752 233
715 3300020081 Ga0206354_11695459 Ga0206354_116954592 233
716 3300020082 Ga0206353_10731752 Ga0206353_107317522 233
717 3300021377 Ga0213874_10028601 Ga0213874_100286012 233
718 3300021384 Ga0213876_10133358 Ga0213876_101333582 233
719 3300021441 Ga0213871_10011017 Ga0213871_100110172 233
720 3300021441 Ga0213871_10030600 Ga0213871_100306002 233
721 3300022467 Ga0224712_10060057 Ga0224712_100600572 233
722 3300025898 Ga0207692_10016277 Ga0207692_100162773 233
723 3300025898 Ga0207692_10141845 Ga0207692_101418452 233
724 3300025906 Ga0207699_10005456 Ga0207699_100054566 233
725 3300025906 Ga0207699_10056968 Ga0207699_100569683 233
726 3300025906 Ga0207699_10152969 Ga0207699_101529692 233
727 3300025909 Ga0207705_10009302 Ga0207705_100093029 233
728 3300025909 Ga0207705_10022027 Ga0207705_100220274 233
729 3300025909 Ga0207705_10057314 Ga0207705_100573143 233
730 3300025909 Ga0207705_10180670 Ga0207705_101806702 233
731 3300025912 Ga0207707_10013404 Ga0207707_100134046 233
732 3300025912 Ga0207707_10101083 Ga0207707_101010832 233
733 3300025912 Ga0207707_10156113 Ga0207707_101561133 233
734 3300025912 Ga0207707_10264837 Ga0207707_102648372 233
735 3300025912 Ga0207707_10341027 Ga0207707_103410272 233
736 3300025913 Ga0207695_10081776 Ga0207695_100817762 233
737 3300025915 Ga0207693_10020457 Ga0207693_100204577 233
738 3300025915 Ga0207693_10041419 Ga0207693_100414192 233
739 3300025915 Ga0207693_10052925 Ga0207693_100529252 233
740 3300025916 Ga0207663_10009397 Ga0207663_100093974 233
741 3300025916 Ga0207663_10602771 Ga0207663_106027711 233
742 3300025917 Ga0207660_10055215 Ga0207660_100552152 233
743 3300025919 Ga0207657_10000388 Ga0207657_1000038847 233
744 3300025919 Ga0207657_10013743 Ga0207657_100137436 233
745 3300025919 Ga0207657_10107502 Ga0207657_101075023 233
746 3300025919 Ga0207657_10141376 Ga0207657_101413762 233
747 3300025920 Ga0207649_10016978 Ga0207649_100169783 233
748 3300025921 Ga0207652_10020251 Ga0207652_100202512 233
749 3300025921 Ga0207652_10259303 Ga0207652_102593032 233
750 3300025921 Ga0207652_10370253 Ga0207652_103702532 233
751 3300025922 Ga0207646_10003943 Ga0207646_100039438 233
752 3300025928 Ga0207700_10080589 Ga0207700_100805893 233
753 3300025928 Ga0207700_10226609 Ga0207700_102266092 233
754 3300025929 Ga0207664_10003351 Ga0207664_100033519 233
755 3300025929 Ga0207664_10007454 Ga0207664_100074548 233
756 3300025929 Ga0207664_10011840 Ga0207664_100118405 233
757 3300025929 Ga0207664_10266470 Ga0207664_102664702 233
758 3300025929 Ga0207664_10345413 Ga0207664_103454132 233
759 3300025931 Ga0207644_10108010 Ga0207644_101080103 233
760 3300025932 Ga0207690_10084385 Ga0207690_100843852 233
761 3300025932 Ga0207690_10253043 Ga0207690_102530432 233
762 3300025939 Ga0207665_10001348 Ga0207665_100013485 233
763 3300025939 Ga0207665_10148433 Ga0207665_101484332 233
764 3300025941 Ga0207711_10096959 Ga0207711_100969593 233
765 3300025941 Ga0207711_10203515 Ga0207711_102035152 233
766 3300025941 Ga0207711_10305241 Ga0207711_103052412 233
767 3300025944 Ga0207661_10190737 Ga0207661_101907372 233
768 3300025945 Ga0207679_10113632 Ga0207679_101136322 233
769 3300025949 Ga0207667_10035925 Ga0207667_100359254 233
770 3300026023 Ga0207677_10865128 Ga0207677_108651281 233
771 3300026041 Ga0207639_10351417 Ga0207639_103514172 233
772 3300026078 Ga0207702_10185483 Ga0207702_101854832 233
773 3300026078 Ga0207702_10326292 Ga0207702_103262921 233
774 3300026095 Ga0207676_10158939 Ga0207676_101589392 233
775 3300026116 Ga0207674_10188664 Ga0207674_101886642 233
776 3300026142 Ga0207698_10620153 Ga0207698_106201532 233
777 3300028563 Ga0265319_1003898 Ga0265319_10038988 233
778 3300028563 Ga0265319_1053666 Ga0265319_10536662 233
779 3300028577 Ga0265318_10000691 Ga0265318_100006919 233
780 3300028577 Ga0265318_10009064 Ga0265318_100090642 233
781 3300028654 Ga0265322_10010182 Ga0265322_100101822 233
782 3300028800 Ga0265338_10001048 Ga0265338_1000104843 233
783 3300028800 Ga0265338_10003605 Ga0265338_1000360514 233
784 3300028800 Ga0265338_10007115 Ga0265338_1000711511 233
785 3300028800 Ga0265338_10016447 Ga0265338_100164475 233
786 3300028800 Ga0265338_10022563 Ga0265338_100225632 233
787 3300028800 Ga0265338_10066966 Ga0265338_100669662 233
788 3300028800 Ga0265338_10122775 Ga0265338_101227753 233
789 3300029957 Ga0265324_10015707 Ga0265324_100157072 233
790 3300031238 Ga0265332_10019646 Ga0265332_100196462 233
791 3300031238 Ga0265332_10033456 Ga0265332_100334562 233
792 3300031239 Ga0265328_10026577 Ga0265328_100265772 233
793 3300031240 Ga0265320_10009672 Ga0265320_100096727 233
794 3300031241 Ga0265325_10000102 Ga0265325_100001025 233
795 3300031241 Ga0265325_10164849 Ga0265325_101648492 233
796 3300031242 Ga0265329_10021254 Ga0265329_100212541 233
797 3300031247 Ga0265340_10009900 Ga0265340_100099007 233
798 3300031247 Ga0265340_10070824 Ga0265340_100708242 233
799 3300031249 Ga0265339_10011172 Ga0265339_100111722 233
800 3300031251 Ga0265327_10025194 Ga0265327_100251942 233
801 3300031251 Ga0265327_10037423 Ga0265327_100374232 233
802 3300031344 Ga0265316_10021633 Ga0265316_100216336 233
803 3300031344 Ga0265316_10164015 Ga0265316_101640152 233
804 3300031595 Ga0265313_10006148 Ga0265313_100061483 233
805 3300031595 Ga0265313_10012796 Ga0265313_100127962 233
806 3300031711 Ga0265314_10003427 Ga0265314_100034279 233
807 3300031711 Ga0265314_10005023 Ga0265314_1000502311 233
808 3300031712 Ga0265342_10012497 Ga0265342_100124973 233
809 3300031995 Ga0307409_100110151 Ga0307409_1001101512 233
810 3300032002 Ga0307416_100064389 Ga0307416_1000643892 233
811 3300032126 Ga0307415_100045877 Ga0307415_1000458772 233
812 3300035083 Ga0373926_0106291 Ga0373926_0106291_179_907 233
813 3300035113 Ga0373936_0024860 Ga0373936_0024860_1096_1833 233
814 3300035116 Ga0373945_0009452 Ga0373945_0009452_1210_1947 233
815 3300035116 Ga0373945_0034882 Ga0373945_0034882_467_1195 233
816 3300035119 Ga0373956_0118027 Ga0373956_0118027_324_1049 233
817 3300035170 Ga0373943_0001097 Ga0373943_0001097_2389_3126 233
818 3300035170 Ga0373943_0002704 Ga0373943_0002704_4435_5160 233
819 3300035170 Ga0373943_0011966 Ga0373943_0011966_2074_2805 233
820 3300035170 Ga0373943_0023932 Ga0373943_0023932_1624_2352 233
821 3300035171 Ga0373946_0011840 Ga0373946_0011840_549_1274 233
822 3300035171 Ga0373946_0088776 Ga0373946_0088776_567_1295 233
823 3300035172 Ga0373955_0263615 Ga0373955_0263615_146_871 233
824 3300035692 Ga0373935_0080649 Ga0373935_0080649_13_738 233
825 3300035692 Ga0373935_0105334 Ga0373935_0105334_845_1570 233
826 3300035695 Ga0373927_0018529 Ga0373927_0018529_2149_2886 233
827 3300035695 Ga0373927_0023799 Ga0373927_0023799_1511_2236 233
828 3300035724 Ga0373933_0331820 Ga0373933_0331820_34_759 233
829 3300035725 Ga0373947_0000716 Ga0373947_0000716_18300_19037 233
830 3300035725 Ga0373947_0003034 Ga0373947_0003034_8014_8739 233
831 3300035725 Ga0373947_0026518 Ga0373947_0026518_1079_1807 233
832 3300035725 Ga0373947_0159927 Ga0373947_0159927_460_1185 233
833 3300036401 Ga0373937_0003562 Ga0373937_0003562_1399_2124 233
834 3300037068 Ga0373925_0001320 Ga0373925_0001320_12969_13694 233
835 3300037068 Ga0373925_0004218 Ga0373925_0004218_405_1142 233
836 3300037068 Ga0373925_0029069 Ga0373925_0029069_1559_2287 233
837 3300037068 Ga0373925_0031164 Ga0373925_0031164_1652_2383 233
838 3300037312 Ga0395899_0022354 Ga0395899_0022354_3638_4366 233
839 3300037312 Ga0395899_0042546 Ga0395899_0042546_2099_2824 233
840 3300037418 Ga0395900_0001009 Ga0395900_0001009_11934_12662 233
841 3300037418 Ga0395900_0059518 Ga0395900_0059518_2970_3701 233
842 3300037418 Ga0395900_0067531 Ga0395900_0067531_1028_1753 233
843 3300037418 Ga0395900_0107833 Ga0395900_0107833_450_1175 233
844 3300037418 Ga0395900_0174726 Ga0395900_0174726_1438_2163 233
845 3300037418 Ga0395900_0553900 Ga0395900_0553900_352_1077 233
846 3300037418 Ga0395900_0736735 Ga0395900_0736735_10_744 233
847 3300037466 Ga0395898_0000824 Ga0395898_0000824_12382_13116 233
848 3300037466 Ga0395898_0009164 Ga0395898_0009164_6600_7328 233
849 3300037466 Ga0395898_0016056 Ga0395898_0016056_3909_4640 233
850 3300037466 Ga0395898_0018968 Ga0395898_0018968_3742_4467 233
851 3300037466 Ga0395898_0208139 Ga0395898_0208139_518_1243 233
852 3300037466 Ga0395898_0247848 Ga0395898_0247848_691_1416 233
853 3300037466 Ga0395898_0359897 Ga0395898_0359897_72_797 233
854 3300037471 Ga0395905_0001033 Ga0395905_0001033_24215_24943 233
855 3300037471 Ga0395905_0012823 Ga0395905_0012823_3293_4024 233
856 3300037471 Ga0395905_0016484 Ga0395905_0016484_5772_6509 233
857 3300037471 Ga0395905_0172216 Ga0395905_0172216_1240_1965 233
858 3300037471 Ga0395905_0234833 Ga0395905_0234833_518_1243 233
859 3300037471 Ga0395905_0367171 Ga0395905_0367171_483_1214 233
860 3300037471 Ga0395905_0385831 Ga0395905_0385831_60_785 233
861 3300037853 Ga0436364_0438981 Ga0436364_0438981_167_901 233
862 3300038443 Ga0395901_0000244 Ga0395901_0000244_10954_11685 233
863 3300038443 Ga0395901_0001584 Ga0395901_0001584_16026_16760 233
864 3300038443 Ga0395901_0012090 Ga0395901_0012090_4280_5008 233
865 3300038443 Ga0395901_0012213 Ga0395901_0012213_2185_2922 233
866 3300038443 Ga0395901_0039586 Ga0395901_0039586_2565_3299 233
867 3300038443 Ga0395901_0078452 Ga0395901_0078452_2329_3054 233
868 3300038443 Ga0395901_0453783 Ga0395901_0453783_86_811 233
869 3300039437 Ga0436365_0415531 Ga0436365_0415531_146_880 233
870 3300039438 Ga0436360_0702617 Ga0436360_0702617_2811_3542 233
871 3300039450 Ga0436363_0369769 Ga0436363_0369769_71_796 233
872 3300039450 Ga0436363_0641800 Ga0436363_0641800_665_1399 233
873 3300039450 Ga0436363_1099334 Ga0436363_1099334_286_1026 233
874 3300039453 Ga0436362_0522746 Ga0436362_0522746_334_1068 233
875 3300041407 Ga0439447_048963 Ga0439447_048963_180_908 233
876 3300042004 Ga0439445_0036080 Ga0439445_0036080_503_1231 233
877 3300042122 Ga0450920_005797 Ga0450920_005797_1030_1755 233
878 3300042146 Ga0450907_020325 Ga0450907_020325_344_1069 233
879 3300042156 Ga0439446_0004542 Ga0439446_0004542_2337_3065 233
880 3300044656 Ga0466969_0004821 Ga0466969_0004821_4514_5239 233
881 3300044683 Ga0466965_0003656 Ga0466965_0003656_3775_4500 233
882 3300044683 Ga0466965_0125391 Ga0466965_0125391_49_774 233
883 3300044684 Ga0466966_0003176 Ga0466966_0003176_6079_6804 233
884 3300044684 Ga0466966_0013313 Ga0466966_0013313_3433_4164 233
885 3300044684 Ga0466966_0014162 Ga0466966_0014162_3256_3981 233
886 3300044684 Ga0466966_0019689 Ga0466966_0019689_2422_3153 233
887 3300044684 Ga0466966_0100608 Ga0466966_0100608_1000_1725 233
888 3300044693 Ga0466961_0000819 Ga0466961_0000819_17385_18110 233
889 3300044693 Ga0466961_0012817 Ga0466961_0012817_622_1347 233
890 3300044693 Ga0466961_0017705 Ga0466961_0017705_1484_2209 233
891 3300044693 Ga0466961_0050259 Ga0466961_0050259_1124_1849 233
892 3300044693 Ga0466961_0089301 Ga0466961_0089301_244_975 233
893 3300044693 Ga0466961_0167921 Ga0466961_0167921_52_777 233
894 3300044694 Ga0466963_0002189 Ga0466963_0002189_6538_7263 233
895 3300044694 Ga0466963_0003641 Ga0466963_0003641_3403_4128 233
896 3300044694 Ga0466963_0005777 Ga0466963_0005777_4796_5521 233
897 3300044694 Ga0466963_0007093 Ga0466963_0007093_344_1069 233
898 3300044694 Ga0466963_0008418 Ga0466963_0008418_2883_3608 233
899 3300044694 Ga0466963_0010262 Ga0466963_0010262_2682_3407 233
900 3300044694 Ga0466963_0012284 Ga0466963_0012284_4279_5004 233
901 3300044694 Ga0466963_0016356 Ga0466963_0016356_3689_4414 233
902 3300044694 Ga0466963_0030537 Ga0466963_0030537_795_1520 233
903 3300044694 Ga0466963_0034419 Ga0466963_0034419_1537_2262 233
904 3300044694 Ga0466963_0047743 Ga0466963_0047743_1253_1978 233
905 3300044694 Ga0466963_0058188 Ga0466963_0058188_22_747 233
906 3300044694 Ga0466963_0075658 Ga0466963_0075658_1095_1820 233
907 3300044694 Ga0466963_0291710 Ga0466963_0291710_149_874 233
908 3300044694 Ga0466963_0619049 Ga0466963_0619049_19_744 233
909 3300044706 Ga0466964_0003451 Ga0466964_0003451_1867_2592 233
910 3300044706 Ga0466964_0030678 Ga0466964_0030678_512_1237 233
911 3300044706 Ga0466964_0033418 Ga0466964_0033418_518_1243 233
912 3300044706 Ga0466964_0051953 Ga0466964_0051953_178_903 233
913 3300044706 Ga0466964_0083127 Ga0466964_0083127_480_1214 233
914 3300044706 Ga0466964_0128206 Ga0466964_0128206_409_1134 233
915 3300044706 Ga0466964_0189756 Ga0466964_0189756_109_834 233
916 3300044719 Ga0466971_0000170 Ga0466971_0000170_13902_14627 233
917 3300044719 Ga0466971_0131894 Ga0466971_0131894_148_879 233
918 3300044735 Ga0466968_0006759 Ga0466968_0006759_935_1660 233
919 3300044735 Ga0466968_0018352 Ga0466968_0018352_649_1374 233
920 3300044735 Ga0466968_0024794 Ga0466968_0024794_1520_2245 233
921 3300044735 Ga0466968_0039568 Ga0466968_0039568_1073_1798 233
922 3300044765 Ga0466970_0000806 Ga0466970_0000806_6204_6929 233
923 3300044765 Ga0466970_0015951 Ga0466970_0015951_439_1164 233
924 3300044765 Ga0466970_0063100 Ga0466970_0063100_356_1081 233
925 3300044765 Ga0466970_0103861 Ga0466970_0103861_473_1198 233
926 3300044842 Ga0466957_0000671 Ga0466957_0000671_12959_13684 233
927 3300044842 Ga0466957_0003280 Ga0466957_0003280_7475_8200 233
928 3300044842 Ga0466957_0006828 Ga0466957_0006828_1185_1910 233
929 3300044842 Ga0466957_0009740 Ga0466957_0009740_981_1706 233
930 3300044842 Ga0466957_0021985 Ga0466957_0021985_733_1458 233
931 3300044842 Ga0466957_0030916 Ga0466957_0030916_2089_2814 233
932 3300044842 Ga0466957_0042757 Ga0466957_0042757_1543_2268 233
933 3300044842 Ga0466957_0045236 Ga0466957_0045236_1315_2040 233
934 3300044842 Ga0466957_0102763 Ga0466957_0102763_869_1594 233
935 3300044901 Ga0466960_0005693 Ga0466960_0005693_2744_3469 233
936 3300044901 Ga0466960_0010734 Ga0466960_0010734_133_858 233
937 3300044901 Ga0466960_0029067 Ga0466960_0029067_203_928 233
938 3300045049 Ga0466959_0000274 Ga0466959_0000274_28185_28910 233
939 3300045049 Ga0466959_0082029 Ga0466959_0082029_664_1389 233
940 3300045049 Ga0466959_0084170 Ga0466959_0084170_683_1408 233
941 3300045836 Ga0466958_0001062 Ga0466958_0001062_9153_9878 233
942 3300045836 Ga0466958_0010999 Ga0466958_0010999_1326_2051 233
943 3300045836 Ga0466958_0013473 Ga0466958_0013473_726_1451 233
944 3300045836 Ga0466958_0016559 Ga0466958_0016559_2634_3359 233
945 3300045836 Ga0466958_0017529 Ga0466958_0017529_202_927 233
946 3300045836 Ga0466958_0025898 Ga0466958_0025898_2294_3019 233
947 3300045836 Ga0466958_0039825 Ga0466958_0039825_1297_2022 233
948 3300045836 Ga0466958_0047757 Ga0466958_0047757_1760_2485 233
949 3300045836 Ga0466958_0048461 Ga0466958_0048461_1011_1736 233
950 3300045836 Ga0466958_0167481 Ga0466958_0167481_60_785 233
951 3300045836 Ga0466958_0202180 Ga0466958_0202180_338_1063 233
952 3300045836 Ga0466958_0292407 Ga0466958_0292407_210_944 233
953 3300045976 Ga0466967_0000828 Ga0466967_0000828_7458_8183 233
954 3300045976 Ga0466967_0002908 Ga0466967_0002908_535_1260 233
955 3300045976 Ga0466967_0003311 Ga0466967_0003311_6676_7401 233
956 3300045976 Ga0466967_0010698 Ga0466967_0010698_2432_3157 233
957 3300045976 Ga0466967_0012395 Ga0466967_0012395_1089_1814 233
958 3300045976 Ga0466967_0023141 Ga0466967_0023141_2705_3430 233
959 3300045976 Ga0466967_0023429 Ga0466967_0023429_2288_3022 233
960 3300045976 Ga0466967_0029561 Ga0466967_0029561_3684_4415 233
961 3300045976 Ga0466967_0029636 Ga0466967_0029636_2957_3682 233
962 3300045976 Ga0466967_0030291 Ga0466967_0030291_98_823 233
963 3300045976 Ga0466967_0033074 Ga0466967_0033074_374_1099 233
964 3300045976 Ga0466967_0034431 Ga0466967_0034431_2036_2770 233
965 3300045976 Ga0466967_0034791 Ga0466967_0034791_541_1266 233
966 3300045976 Ga0466967_0104096 Ga0466967_0104096_1362_2090 233
967 3300045976 Ga0466967_0104316 Ga0466967_0104316_1350_2075 233
968 3300045976 Ga0466967_0124731 Ga0466967_0124731_1125_1862 233
969 3300045976 Ga0466967_0131763 Ga0466967_0131763_188_913 233
970 3300045976 Ga0466967_0142521 Ga0466967_0142521_1246_1971 233
971 3300045976 Ga0466967_0148437 Ga0466967_0148437_709_1434 233
972 3300045976 Ga0466967_0160814 Ga0466967_0160814_912_1637 233
973 3300045976 Ga0466967_0203397 Ga0466967_0203397_307_1041 233
974 3300045976 Ga0466967_0232884 Ga0466967_0232884_820_1545 233
975 3300045976 Ga0466967_0246185 Ga0466967_0246185_893_1618 233
976 3300045976 Ga0466967_0254278 Ga0466967_0254278_767_1492 233
977 3300045976 Ga0466967_0261592 Ga0466967_0261592_10_735 233
978 3300046454 Ga0495592_0007818 Ga0495592_0007818_7050_7775 233
979 3300046454 Ga0495592_0014141 Ga0495592_0014141_16_741 233
980 3300046454 Ga0495592_0163178 Ga0495592_0163178_221_946 233
981 3300046454 Ga0495592_0251053 Ga0495592_0251053_291_1016 233
982 3300046455 Ga0495603_0049915 Ga0495603_0049915_354_1085 233
983 3300046455 Ga0495603_0097911 Ga0495603_0097911_877_1614 233
984 3300046459 Ga0495629_0001816 Ga0495629_0001816_7987_8712 233
985 3300046459 Ga0495629_0037482 Ga0495629_0037482_1472_2209 233
986 3300046459 Ga0495629_0332935 Ga0495629_0332935_86_811 233
987 3300046459 Ga0495629_0345707 Ga0495629_0345707_269_994 233
988 3300046461 Ga0495641_0004541 Ga0495641_0004541_4340_5077 233
989 3300046461 Ga0495641_0007480 Ga0495641_0007480_3831_4556 233
990 3300046461 Ga0495641_0017039 Ga0495641_0017039_2000_2725 233
991 3300046461 Ga0495641_0034700 Ga0495641_0034700_98_826 233
992 3300046462 Ga0495651_0000028 Ga0495651_0000028_103347_104072 233
993 3300046462 Ga0495651_0011734 Ga0495651_0011734_1982_2707 233
994 3300046462 Ga0495651_0084146 Ga0495651_0084146_79_804 233
995 3300046462 Ga0495651_0086503 Ga0495651_0086503_1105_1830 233
996 3300046463 Ga0495653_0000965 Ga0495653_0000965_14341_15066 233
997 3300046463 Ga0495653_0037432 Ga0495653_0037432_1320_2057 233
998 3300046463 Ga0495653_0175652 Ga0495653_0175652_10_735 233
999 3300046463 Ga0495653_0194414 Ga0495653_0194414_612_1337 233
1000 3300046463 Ga0495653_0281747 Ga0495653_0281747_53_790 233
1001 3300046472 Ga0495580_0042963 Ga0495580_0042963_2452_3177 233
1002 3300046473 Ga0495582_0000276 Ga0495582_0000276_9567_10304 233
1003 3300046473 Ga0495582_0012985 Ga0495582_0012985_2608_3333 233
1004 3300046473 Ga0495582_0016268 Ga0495582_0016268_90_815 233
1005 3300046473 Ga0495582_0162768 Ga0495582_0162768_35_760 233
1006 3300046473 Ga0495582_0223838 Ga0495582_0223838_318_1043 233
1007 3300046475 Ga0495639_0000416 Ga0495639_0000416_13757_14494 233
1008 3300046475 Ga0495639_0000630 Ga0495639_0000630_12653_13378 233
1009 3300046476 Ga0495662_0001339 Ga0495662_0001339_3433_4158 233
1010 3300046476 Ga0495662_0013466 Ga0495662_0013466_1875_2612 233
1011 3300046476 Ga0495662_0031324 Ga0495662_0031324_1719_2444 233
1012 3300046477 Ga0495664_0009107 Ga0495664_0009107_3656_4381 233
1013 3300046491 Ga0495584_0020811 Ga0495584_0020811_1045_1770 233
1014 3300046500 Ga0495596_0049718 Ga0495596_0049718_138_863 233
1015 3300046501 Ga0495607_0120618 Ga0495607_0120618_479_1204 233
1016 3300046511 Ga0495608_0008137 Ga0495608_0008137_1699_2424 233
1017 3300046511 Ga0495608_0008892 Ga0495608_0008892_1504_2229 233
1018 3300046511 Ga0495608_0026241 Ga0495608_0026241_1234_1959 233
1019 3300046511 Ga0495608_0070475 Ga0495608_0070475_129_854 233
1020 3300046511 Ga0495608_0124942 Ga0495608_0124942_776_1513 233
1021 3300046511 Ga0495608_0183520 Ga0495608_0183520_138_863 233
1022 3300046511 Ga0495608_0355922 Ga0495608_0355922_13_738 233
1023 3300046514 Ga0495618_0012985 Ga0495618_0012985_1351_2076 233
1024 3300046514 Ga0495618_0041839 Ga0495618_0041839_1869_2594 233
1025 3300046514 Ga0495618_0072816 Ga0495618_0072816_1033_1758 233
1026 3300046514 Ga0495618_0164764 Ga0495618_0164764_247_972 233
1027 3300046516 Ga0495628_0000069 Ga0495628_0000069_73097_73822 233
1028 3300046516 Ga0495628_0243168 Ga0495628_0243168_360_1085 233
1029 3300046517 Ga0495630_0005233 Ga0495630_0005233_7987_8712 233
1030 3300046517 Ga0495630_0015336 Ga0495630_0015336_4309_5034 233
1031 3300046517 Ga0495630_0061904 Ga0495630_0061904_1777_2508 233
1032 3300046517 Ga0495630_0076033 Ga0495630_0076033_717_1445 233
1033 3300046517 Ga0495630_0139707 Ga0495630_0139707_280_1017 233
1034 3300046517 Ga0495630_0210545 Ga0495630_0210545_505_1230 233
1035 3300046517 Ga0495630_0216920 Ga0495630_0216920_138_863 233
1036 3300046523 Ga0495644_0010118 Ga0495644_0010118_2558_3283 233
1037 3300046526 Ga0495666_0000145 Ga0495666_0000145_27014_27739 233
1038 3300046526 Ga0495666_0011008 Ga0495666_0011008_642_1379 233
1039 3300046529 Ga0495652_0010813 Ga0495652_0010813_1401_2126 233
1040 3300046529 Ga0495652_0039151 Ga0495652_0039151_343_1068 233
1041 3300046529 Ga0495652_0206403 Ga0495652_0206403_441_1166 233
1042 3300046531 Ga0495665_0005590 Ga0495665_0005590_3269_3994 233
1043 3300046531 Ga0495665_0006870 Ga0495665_0006870_1082_1819 233
1044 3300046533 Ga0495640_0009273 Ga0495640_0009273_293_1018 233
1045 3300046533 Ga0495640_0142659 Ga0495640_0142659_645_1382 233
1046 3300046535 Ga0495586_0016292 Ga0495586_0016292_1850_2575 233
1047 3300046535 Ga0495586_0190351 Ga0495586_0190351_412_1137 233
1048 3300046535 Ga0495586_0220345 Ga0495586_0220345_49_786 233
1049 3300046536 Ga0495587_0000062 Ga0495587_0000062_89737_90462 233
1050 3300046536 Ga0495587_0060752 Ga0495587_0060752_861_1598 233
1051 3300046536 Ga0495587_0170525 Ga0495587_0170525_109_834 233
1052 3300046537 Ga0495598_0006644 Ga0495598_0006644_870_1595 233
1053 3300046543 Ga0495645_0000418 Ga0495645_0000418_1391_2116 233
1054 3300046543 Ga0495645_0010986 Ga0495645_0010986_5525_6250 233
1055 3300046559 Ga0495667_0006358 Ga0495667_0006358_2874_3599 233
1056 3300046559 Ga0495667_0039629 Ga0495667_0039629_1331_2056 233
1057 3300046559 Ga0495667_0044883 Ga0495667_0044883_1336_2061 233
1058 3300046559 Ga0495667_0045491 Ga0495667_0045491_708_1445 233
1059 3300046559 Ga0495667_0070579 Ga0495667_0070579_168_905 233
1060 3300046559 Ga0495667_0076382 Ga0495667_0076382_238_963 233
1061 3300046559 Ga0495667_0223275 Ga0495667_0223275_175_900 233
1062 3300046642 Ga0495634_0029909 Ga0495634_0029909_1007_1732 233
1063 3300046642 Ga0495634_0044363 Ga0495634_0044363_1104_1829 233
1064 3300046642 Ga0495634_0217124 Ga0495634_0217124_317_1042 233
1065 3300046642 Ga0495634_0241112 Ga0495634_0241112_128_853 233
1066 3300046663 Ga0495635_0003672 Ga0495635_0003672_4709_5446 233
1067 3300046663 Ga0495635_0029747 Ga0495635_0029747_2539_3264 233
1068 3300046663 Ga0495635_0054825 Ga0495635_0054825_765_1490 233
1069 3300046663 Ga0495635_0409806 Ga0495635_0409806_34_771 233
1070 3300046664 Ga0495659_0024623 Ga0495659_0024623_693_1418 233
1071 3300046675 Ga0495657_0011853 Ga0495657_0011853_1276_2001 233
1072 3300046675 Ga0495657_0054159 Ga0495657_0054159_23_748 233
1073 3300046678 Ga0495599_0000542 Ga0495599_0000542_1401_2126 233
1074 3300046678 Ga0495599_0058655 Ga0495599_0058655_157_882 233
1075 3300046679 Ga0495623_0000435 Ga0495623_0000435_1379_2104 233
1076 3300046679 Ga0495623_0047697 Ga0495623_0047697_1496_2221 233
1077 3300046679 Ga0495623_0111577 Ga0495623_0111577_546_1271 233
1078 3300046680 Ga0495646_0007673 Ga0495646_0007673_4739_5464 233
1079 3300046680 Ga0495646_0218780 Ga0495646_0218780_41_766 233
1080 3300046681 Ga0495647_0000560 Ga0495647_0000560_2387_3112 233
1081 3300046683 Ga0495658_0001373 Ga0495658_0001373_10780_11505 233
1082 3300046683 Ga0495658_0003249 Ga0495658_0003249_435_1172 233
1083 3300046683 Ga0495658_0189997 Ga0495658_0189997_127_855 233
1084 3300046689 Ga0495613_0041694 Ga0495613_0041694_2241_2966 233
1085 3300046689 Ga0495613_0062951 Ga0495613_0062951_1587_2312 233
1086 3300046689 Ga0495613_0068917 Ga0495613_0068917_634_1371 233
1087 3300046690 Ga0495624_0000753 Ga0495624_0000753_24226_24951 233
1088 3300046690 Ga0495624_0004610 Ga0495624_0004610_137_874 233
1089 3300046690 Ga0495624_0058554 Ga0495624_0058554_150_875 233
1090 3300046794 Ga0495589_0022215 Ga0495589_0022215_2197_2922 233
1091 3300046809 Ga0495600_0116147 Ga0495600_0116147_929_1654 233
1092 3300046809 Ga0495600_0119122 Ga0495600_0119122_595_1320 233
1093 3300046809 Ga0495600_0143827 Ga0495600_0143827_726_1463 233
1094 3300047315 Ga0495581_0000407 Ga0495581_0000407_8014_8739 233
1095 3300047315 Ga0495581_0007334 Ga0495581_0007334_4316_5053 233
1096 3300047315 Ga0495581_0025376 Ga0495581_0025376_364_1089 233
1097 3300047317 Ga0495604_0009317 Ga0495604_0009317_5648_6373 233
1098 3300047317 Ga0495604_0028425 Ga0495604_0028425_95_832 233
1099 3300047317 Ga0495604_0458038 Ga0495604_0458038_37_762 233
1100 3300047319 Ga0495674_0065238 Ga0495674_0065238_2279_3016 233
1101 3300047319 Ga0495674_0101170 Ga0495674_0101170_395_1120 233
1102 3300047321 Ga0495676_0002534 Ga0495676_0002534_1850_2575 233
1103 3300047321 Ga0495676_0011130 Ga0495676_0011130_7368_8105 233
1104 3300047321 Ga0495676_0119492 Ga0495676_0119492_1063_1791 233
1105 3300047322 Ga0495680_0004620 Ga0495680_0004620_311_1048 233
1106 3300047322 Ga0495680_0009043 Ga0495680_0009043_2117_2842 233
1107 3300047322 Ga0495680_0016809 Ga0495680_0016809_3368_4093 233
1108 3300047322 Ga0495680_0025875 Ga0495680_0025875_1805_2530 233
1109 3300047322 Ga0495680_0041809 Ga0495680_0041809_1190_1927 233
1110 3300047322 Ga0495680_0134429 Ga0495680_0134429_289_1014 233
1111 3300047444 Ga0495675_0004323 Ga0495675_0004323_1699_2424 233
1112 3300047447 Ga0495685_048549 Ga0495685_048549_484_1209 233
1113 3300047471 Ga0495684_0012597 Ga0495684_0012597_3549_4274 233
1114 3300047471 Ga0495684_0013231 Ga0495684_0013231_5594_6331 233
1115 3300047471 Ga0495684_0013780 Ga0495684_0013780_3504_4229 233
1116 3300047471 Ga0495684_0140101 Ga0495684_0140101_796_1521 233
1117 3300047673 Ga0495593_0000807 Ga0495593_0000807_3561_4286 233
1118 3300047673 Ga0495593_0032247 Ga0495593_0032247_184_921 233
1119 3300048088 Ga0495602_0005881 Ga0495602_0005881_10759_11484 233
1120 3300048088 Ga0495602_0439844 Ga0495602_0439844_114_851 233
1121 3300048089 Ga0495614_0000642 Ga0495614_0000642_13590_14315 233
1122 3300048089 Ga0495614_0027518 Ga0495614_0027518_1208_1945 233
1123 3300048903 Ga0496100_0000981 Ga0496100_0000981_2746_3477 233
1124 3300048903 Ga0496100_0014172 Ga0496100_0014172_2306_3031 233
1125 3300048903 Ga0496100_0045886 Ga0496100_0045886_1307_2041 233
1126 3300048903 Ga0496100_0359613 Ga0496100_0359613_105_830 233
1127 3300048904 Ga0496101_0000424 Ga0496101_0000424_23160_23891 233
1128 3300048904 Ga0496101_0006459 Ga0496101_0006459_654_1391 233
1129 3300048904 Ga0496101_0086913 Ga0496101_0086913_1008_1745 233
1130 3300048904 Ga0496101_0091470 Ga0496101_0091470_151_876 233
1131 3300048904 Ga0496101_0264329 Ga0496101_0264329_179_904 233
1132 3300048905 Ga0496102_0003088 Ga0496102_0003088_8667_9398 233
1133 3300048905 Ga0496102_0382979 Ga0496102_0382979_510_1235 233
1134 3300048905 Ga0496102_0569229 Ga0496102_0569229_256_984 233
1135 3300048906 Ga0496103_0023844 Ga0496103_0023844_2678_3409 233
1136 3300048906 Ga0496103_0101941 Ga0496103_0101941_618_1343 233
1137 3300048906 Ga0496103_0145735 Ga0496103_0145735_608_1342 233
1138 3300048906 Ga0496103_0161152 Ga0496103_0161152_41_766 233
1139 3300048907 Ga0496104_0002502 Ga0496104_0002502_13868_14593 233
1140 3300048907 Ga0496104_0006585 Ga0496104_0006585_8686_9417 233
1141 3300048907 Ga0496104_0011326 Ga0496104_0011326_5054_5788 233
1142 3300048907 Ga0496104_0014077 Ga0496104_0014077_2132_2857 233
1143 3300048907 Ga0496104_0112327 Ga0496104_0112327_168_905 233
1144 3300048907 Ga0496104_0144766 Ga0496104_0144766_996_1721 233
1145 3300048907 Ga0496104_0331998 Ga0496104_0331998_199_924 233
1146 3300048907 Ga0496104_0424263 Ga0496104_0424263_416_1141 233
1147 3300048908 Ga0496105_0000597 Ga0496105_0000597_11426_12157 233
1148 3300048908 Ga0496105_0025913 Ga0496105_0025913_1075_1800 233
1149 3300048908 Ga0496105_0072276 Ga0496105_0072276_1746_2480 233
1150 3300048908 Ga0496105_0109646 Ga0496105_0109646_979_1704 233
1151 3300048908 Ga0496105_0136405 Ga0496105_0136405_305_1030 233
1152 3300048908 Ga0496105_0230155 Ga0496105_0230155_331_1056 233
1153 3300048908 Ga0496105_0283795 Ga0496105_0283795_520_1254 233
1154 3300048908 Ga0496105_0472883 Ga0496105_0472883_165_902 233
1155 3300048909 Ga0496106_0002787 Ga0496106_0002787_10049_10774 233
1156 3300048909 Ga0496106_0012693 Ga0496106_0012693_2370_3095 233
1157 3300048909 Ga0496106_0042154 Ga0496106_0042154_414_1145 233
1158 3300048909 Ga0496106_0173022 Ga0496106_0173022_67_792 233
1159 3300048910 Ga0496107_0001925 Ga0496107_0001925_9137_9862 233
1160 3300048910 Ga0496107_0011878 Ga0496107_0011878_2647_3372 233
1161 3300048910 Ga0496107_0038281 Ga0496107_0038281_547_1272 233
1162 3300048910 Ga0496107_0047814 Ga0496107_0047814_1933_2658 233
1163 3300048910 Ga0496107_0049211 Ga0496107_0049211_413_1150 233
1164 3300048911 Ga0496108_0010971 Ga0496108_0010971_2251_2982 233
1165 3300048911 Ga0496108_0021721 Ga0496108_0021721_3340_4065 233
1166 3300048911 Ga0496108_0078040 Ga0496108_0078040_244_969 233
1167 3300048911 Ga0496108_0147401 Ga0496108_0147401_895_1620 233
1168 3300048911 Ga0496108_0330469 Ga0496108_0330469_530_1264 233
1169 3300048912 Ga0496109_0001453 Ga0496109_0001453_18614_19345 233
1170 3300048912 Ga0496109_0012739 Ga0496109_0012739_3154_3879 233
1171 3300048912 Ga0496109_0028593 Ga0496109_0028593_2081_2806 233
1172 3300048912 Ga0496109_0161360 Ga0496109_0161360_551_1276 233
1173 3300048912 Ga0496109_0291133 Ga0496109_0291133_510_1235 233
1174 3300048912 Ga0496109_0384433 Ga0496109_0384433_571_1296 233
1175 3300048913 Ga0496110_0006795 Ga0496110_0006795_5657_6388 233
1176 3300048913 Ga0496110_0014622 Ga0496110_0014622_2177_2902 233
1177 3300048913 Ga0496110_0021211 Ga0496110_0021211_1317_2042 233
1178 3300048914 Ga0496111_0011695 Ga0496111_0011695_4421_5146 233
1179 3300048914 Ga0496111_0089491 Ga0496111_0089491_1225_1959 233
1180 3300048915 Ga0496112_0000598 Ga0496112_0000598_19334_20059 233
1181 3300048915 Ga0496112_0024171 Ga0496112_0024171_2449_3174 233
1182 3300048915 Ga0496112_0042134 Ga0496112_0042134_683_1408 233
1183 3300048915 Ga0496112_0057928 Ga0496112_0057928_2286_3011 233
1184 3300048915 Ga0496112_0089419 Ga0496112_0089419_1581_2306 233
1185 3300048915 Ga0496112_0125724 Ga0496112_0125724_988_1719 233
1186 3300048915 Ga0496112_0236436 Ga0496112_0236436_305_1030 233
1187 3300048915 Ga0496112_0247293 Ga0496112_0247293_339_1064 233
1188 3300048916 Ga0496113_0014459 Ga0496113_0014459_3180_3905 233
1189 3300048916 Ga0496113_0074292 Ga0496113_0074292_649_1374 233
1190 3300048916 Ga0496113_0170486 Ga0496113_0170486_913_1638 233
1191 3300048916 Ga0496113_0179409 Ga0496113_0179409_410_1135 233
1192 3300048917 Ga0496114_0000392 Ga0496114_0000392_19669_20400 233
1193 3300048917 Ga0496114_0001985 Ga0496114_0001985_7090_7827 233
1194 3300048917 Ga0496114_0002716 Ga0496114_0002716_3454_4191 233
1195 3300048917 Ga0496114_0015753 Ga0496114_0015753_1935_2660 233
1196 3300048917 Ga0496114_0025558 Ga0496114_0025558_1585_2310 233
1197 3300048917 Ga0496114_0282909 Ga0496114_0282909_265_999 233
1198 3300048917 Ga0496114_0356294 Ga0496114_0356294_508_1233 233
1199 3300048918 Ga0496115_0001999 Ga0496115_0001999_8667_9398 233
1200 3300048918 Ga0496115_0003805 Ga0496115_0003805_3672_4409 233
1201 3300048918 Ga0496115_0029647 Ga0496115_0029647_638_1363 233
1202 3300048918 Ga0496115_0057685 Ga0496115_0057685_2214_2939 233
1203 3300048918 Ga0496115_0214219 Ga0496115_0214219_164_898 233
1204 3300049568 Ga0501031_0037945 Ga0501031_0037945_965_1690 233
1205 3300049571 Ga0501034_0007715 Ga0501034_0007715_7114_7839 233
1206 3300049572 Ga0501036_0027279 Ga0501036_0027279_3623_4348 233
1207 3300049572 Ga0501036_0266130 Ga0501036_0266130_134_862 233
1208 3300049574 Ga0501038_0045583 Ga0501038_0045583_409_1134 233
1209 3300049575 Ga0501039_0011508 Ga0501039_0011508_5883_6608 233
1210 3300049576 Ga0501040_0162835 Ga0501040_0162835_546_1271 233
1211 3300049577 Ga0501041_0017471 Ga0501041_0017471_518_1243 233
1212 3300049577 Ga0501041_0176030 Ga0501041_0176030_19_747 233
1213 3300049578 Ga0501042_0011107 Ga0501042_0011107_552_1277 233
1214 3300049579 Ga0501043_0172365 Ga0501043_0172365_521_1249 233
1215 3300049583 Ga0501067_0065258 Ga0501067_0065258_1237_1962 233
1216 3300049583 Ga0501067_0074101 Ga0501067_0074101_93_827 233
1217 3300049585 Ga0501069_0029925 Ga0501069_0029925_1399_2124 233
1218 3300049585 Ga0501069_0076289 Ga0501069_0076289_438_1163 233
1219 3300049586 Ga0501070_0022780 Ga0501070_0022780_456_1181 233
1220 3300049586 Ga0501070_0044089 Ga0501070_0044089_2229_2963 233
1221 3300049586 Ga0501070_0306425 Ga0501070_0306425_181_906 233
1222 3300049587 Ga0501071_0004560 Ga0501071_0004560_5869_6594 233
1223 3300049587 Ga0501071_0107242 Ga0501071_0107242_419_1150 233
1224 3300049589 Ga0501073_0022513 Ga0501073_0022513_99_824 233
1225 3300049589 Ga0501073_0283007 Ga0501073_0283007_330_1061 233
1226 3300049590 Ga0501074_0010448 Ga0501074_0010448_4777_5502 233
1227 3300049590 Ga0501074_0121186 Ga0501074_0121186_543_1277 233
1228 3300049590 Ga0501074_0499786 Ga0501074_0499786_123_848 233
1229 3300049591 Ga0501075_0235113 Ga0501075_0235113_264_989 233
1230 3300049591 Ga0501075_0296253 Ga0501075_0296253_203_934 233
1231 3300049741 Ga0501079_0003106 Ga0501079_0003106_2299_3024 233
1232 3300049742 Ga0501080_0002078 Ga0501080_0002078_11042_11767 233
1233 3300049743 Ga0501081_0368668 Ga0501081_0368668_201_932 233
1234 3300049822 Ga0501035_0278527 Ga0501035_0278527_46_771 233
1235 3300049823 Ga0501044_0440589 Ga0501044_0440589_253_978 233
1236 3300049824 Ga0501045_0109471 Ga0501045_0109471_784_1515 233
1237 3300050507 nmdc:mga05p37_588584_c1 nmdc:mga05p37_588584_c1_281_1009 233
1238 3300050511 nmdc:mga08y16_88960_c1 nmdc:mga08y16_88960_c1_1893_2618 233
1239 3300050512 nmdc:mga0n895_277791_c1 nmdc:mga0n895_277791_c1_525_1253 233
1240 3300050512 nmdc:mga0n895_469_c1 nmdc:mga0n895_469_c1_9173_9898 233
1241 3300050513 nmdc:mga0rr50_17831_c1 nmdc:mga0rr50_17831_c1_2664_3392 233
1242 3300050514 nmdc:mga08x19_264211_c1 nmdc:mga08x19_264211_c1_409_1134 233
1243 3300050515 nmdc:mga0a205_5392_c1 nmdc:mga0a205_5392_c1_7564_8292 233
1244 3300050515 nmdc:mga0a205_66960_c1 nmdc:mga0a205_66960_c1_2005_2730 233
1245 3300053077 Ga0495601_0004004 Ga0495601_0004004_1401_2126 233
1246 3300053077 Ga0495601_0027217 Ga0495601_0027217_2717_3442 233
1247 3300053077 Ga0495601_0081440 Ga0495601_0081440_313_1038 233
1248 3300053077 Ga0495601_0162717 Ga0495601_0162717_50_775 233
1249 3300053077 Ga0495601_0479407 Ga0495601_0479407_38_763 233
1250 3300053078 Ga0495612_0015793 Ga0495612_0015793_398_1123 233
1251 3300053078 Ga0495612_0029879 Ga0495612_0029879_1158_1883 233
1252 3300053078 Ga0495612_0031423 Ga0495612_0031423_12_737 233
1253 3300053084 Ga0495595_0007604 Ga0495595_0007604_2301_3026 233
1254 3300053084 Ga0495595_0012048 Ga0495595_0012048_716_1441 233
1255 3300053084 Ga0495595_0080301 Ga0495595_0080301_743_1468 233
1256 3300053084 Ga0495595_0089103 Ga0495595_0089103_370_1107 233
1257 3300053084 Ga0495595_0136278 Ga0495595_0136278_424_1161 233
1258 3300053085 Ga0495619_0000123 Ga0495619_0000123_8544_9269 233
1259 3300053085 Ga0495619_0001783 Ga0495619_0001783_1977_2702 233
1260 3300053085 Ga0495619_0003843 Ga0495619_0003843_7914_8651 233
1261 3300053085 Ga0495619_0005855 Ga0495619_0005855_4342_5079 233
1262 3300053085 Ga0495619_0020873 Ga0495619_0020873_1655_2380 233
1263 3300053085 Ga0495619_0040119 Ga0495619_0040119_838_1563 233
1264 3300053085 Ga0495619_0064357 Ga0495619_0064357_309_1034 233
1265 3300053085 Ga0495619_0127316 Ga0495619_0127316_978_1703 233
1266 3300061719 Ga0466962_0000436 Ga0466962_0000436_11230_11955 233
1267 3300061719 Ga0466962_0011961 Ga0466962_0011961_1947_2672 233
1268 3300061719 Ga0466962_0011984 Ga0466962_0011984_1583_2308 233
1269 3300061719 Ga0466962_0014588 Ga0466962_0014588_1381_2106 233
1270 3300061719 Ga0466962_0055728 Ga0466962_0055728_782_1507 233
1271 3300061734 Ga0530510_0041925 Ga0530510_0041925_304_1029 233
1272 3300061734 Ga0530510_0099797 Ga0530510_0099797_605_1330 233
1273 3300061734 Ga0530510_0125369 Ga0530510_0125369_589_1320 233
1274 3300002075 JGI24738J21930_10010732 JGI24738J21930_100107321 234
1275 3300002459 JGI24751J29686_10013690 JGI24751J29686_100136902 234
1276 3300005329 Ga0070683_100010140 Ga0070683_1000101408 234
1277 3300005329 Ga0070683_100063331 Ga0070683_1000633312 234
1278 3300005329 Ga0070683_100081404 Ga0070683_1000814042 234
1279 3300005329 Ga0070683_100547255 Ga0070683_1005472551 234
1280 3300005331 Ga0070670_100001416 Ga0070670_1000014168 234
1281 3300005334 Ga0068869_100091468 Ga0068869_1000914683 234
1282 3300005334 Ga0068869_100278082 Ga0068869_1002780822 234
1283 3300005336 Ga0070680_100020164 Ga0070680_1000201646 234
1284 3300005338 Ga0068868_100631760 Ga0068868_1006317602 234
1285 3300005340 Ga0070689_100035158 Ga0070689_1000351584 234
1286 3300005344 Ga0070661_100021782 Ga0070661_1000217824 234
1287 3300005353 Ga0070669_100221327 Ga0070669_1002213272 234
1288 3300005354 Ga0070675_100166623 Ga0070675_1001666232 234
1289 3300005355 Ga0070671_100004752 Ga0070671_1000047526 234
1290 3300005355 Ga0070671_100475108 Ga0070671_1004751081 234
1291 3300005356 Ga0070674_100069973 Ga0070674_1000699732 234
1292 3300005364 Ga0070673_100090034 Ga0070673_1000900341 234
1293 3300005364 Ga0070673_100253437 Ga0070673_1002534371 234
1294 3300005364 Ga0070673_100433678 Ga0070673_1004336782 234
1295 3300005365 Ga0070688_100015217 Ga0070688_1000152172 234
1296 3300005366 Ga0070659_100629230 Ga0070659_1006292301 234
1297 3300005367 Ga0070667_100011855 Ga0070667_1000118555 234
1298 3300005434 Ga0070709_10074253 Ga0070709_100742532 234
1299 3300005434 Ga0070709_10299336 Ga0070709_102993362 234
1300 3300005435 Ga0070714_100909632 Ga0070714_1009096321 234
1301 3300005436 Ga0070713_100150729 Ga0070713_1001507293 234
1302 3300005436 Ga0070713_100160306 Ga0070713_1001603062 234
1303 3300005437 Ga0070710_10013834 Ga0070710_100138345 234
1304 3300005437 Ga0070710_10016900 Ga0070710_100169003 234
1305 3300005438 Ga0070701_10109559 Ga0070701_101095592 234
1306 3300005439 Ga0070711_100046673 Ga0070711_1000466733 234
1307 3300005440 Ga0070705_100256079 Ga0070705_1002560792 234
1308 3300005440 Ga0070705_100759228 Ga0070705_1007592281 234
1309 3300005441 Ga0070700_100533263 Ga0070700_1005332631 234
1310 3300005445 Ga0070708_100030533 Ga0070708_1000305332 234
1311 3300005445 Ga0070708_100136970 Ga0070708_1001369702 234
1312 3300005456 Ga0070678_100010494 Ga0070678_1000104943 234
1313 3300005456 Ga0070678_100067680 Ga0070678_1000676802 234
1314 3300005456 Ga0070678_100112014 Ga0070678_1001120142 234
1315 3300005458 Ga0070681_10245707 Ga0070681_102457072 234
1316 3300005459 Ga0068867_100041467 Ga0068867_1000414674 234
1317 3300005466 Ga0070685_10003914 Ga0070685_100039145 234
1318 3300005467 Ga0070706_100772799 Ga0070706_1007727991 234
1319 3300005468 Ga0070707_100178420 Ga0070707_1001784203 234
1320 3300005471 Ga0070698_100201783 Ga0070698_1002017832 234
1321 3300005471 Ga0070698_100335878 Ga0070698_1003358782 234
1322 3300005518 Ga0070699_100058279 Ga0070699_1000582794 234
1323 3300005518 Ga0070699_100187400 Ga0070699_1001874002 234
1324 3300005518 Ga0070699_100621538 Ga0070699_1006215381 234
1325 3300005530 Ga0070679_100021855 Ga0070679_1000218557 234
1326 3300005530 Ga0070679_100113636 Ga0070679_1001136362 234
1327 3300005530 Ga0070679_100655792 Ga0070679_1006557922 234
1328 3300005535 Ga0070684_100025726 Ga0070684_1000257263 234
1329 3300005535 Ga0070684_100041617 Ga0070684_1000416173 234
1330 3300005535 Ga0070684_100267158 Ga0070684_1002671582 234
1331 3300005536 Ga0070697_100157676 Ga0070697_1001576762 234
1332 3300005543 Ga0070672_100055209 Ga0070672_1000552093 234
1333 3300005544 Ga0070686_100010999 Ga0070686_1000109995 234
1334 3300005546 Ga0070696_100067382 Ga0070696_1000673821 234
1335 3300005546 Ga0070696_100115999 Ga0070696_1001159992 234
1336 3300005549 Ga0070704_100170920 Ga0070704_1001709202 234
1337 3300005563 Ga0068855_100100840 Ga0068855_1001008403 234
1338 3300005563 Ga0068855_100115242 Ga0068855_1001152422 234
1339 3300005564 Ga0070664_100151648 Ga0070664_1001516482 234
1340 3300005564 Ga0070664_100458577 Ga0070664_1004585772 234
1341 3300005577 Ga0068857_100010392 Ga0068857_1000103925 234
1342 3300005614 Ga0068856_100535172 Ga0068856_1005351721 234
1343 3300005616 Ga0068852_100026262 Ga0068852_1000262623 234
1344 3300005616 Ga0068852_100508095 Ga0068852_1005080952 234
1345 3300005617 Ga0068859_100251216 Ga0068859_1002512161 234
1346 3300005618 Ga0068864_100016474 Ga0068864_1000164744 234
1347 3300005718 Ga0068866_10025940 Ga0068866_100259403 234
1348 3300005719 Ga0068861_100542345 Ga0068861_1005423452 234
1349 3300005840 Ga0068870_10094164 Ga0068870_100941642 234
1350 3300005842 Ga0068858_100068309 Ga0068858_1000683092 234
1351 3300005937 Ga0081455_10030318 Ga0081455_100303183 234
1352 3300005985 Ga0081539_10001796 Ga0081539_1000179630 234
1353 3300006058 Ga0075432_10000886 Ga0075432_100008868 234
1354 3300006163 Ga0070715_10005247 Ga0070715_100052474 234
1355 3300006173 Ga0070716_100165503 Ga0070716_1001655032 234
1356 3300006175 Ga0070712_100002758 Ga0070712_1000027582 234
1357 3300006844 Ga0075428_100104626 Ga0075428_1001046262 234
1358 3300006852 Ga0075433_10034850 Ga0075433_100348502 234
1359 3300006852 Ga0075433_10395125 Ga0075433_103951252 234
1360 3300006871 Ga0075434_100223988 Ga0075434_1002239882 234
1361 3300006871 Ga0075434_100278314 Ga0075434_1002783142 234
1362 3300006881 Ga0068865_100017702 Ga0068865_1000177025 234
1363 3300006881 Ga0068865_100211756 Ga0068865_1002117562 234
1364 3300006881 Ga0068865_100605085 Ga0068865_1006050851 234
1365 3300006914 Ga0075436_100053811 Ga0075436_1000538112 234
1366 3300006914 Ga0075436_100176179 Ga0075436_1001761792 234
1367 3300006914 Ga0075436_100307189 Ga0075436_1003071892 234
1368 3300006931 Ga0097620_100251247 Ga0097620_1002512471 234
1369 3300009093 Ga0105240_10401939 Ga0105240_104019392 234
1370 3300009094 Ga0111539_10009540 Ga0111539_100095404 234
1371 3300009094 Ga0111539_10021516 Ga0111539_100215165 234
1372 3300009094 Ga0111539_10103909 Ga0111539_101039092 234
1373 3300009094 Ga0111539_10206510 Ga0111539_102065102 234
1374 3300009098 Ga0105245_10046123 Ga0105245_100461234 234
1375 3300009098 Ga0105245_10134494 Ga0105245_101344942 234
1376 3300009098 Ga0105245_10403420 Ga0105245_104034201 234
1377 3300009147 Ga0114129_10061904 Ga0114129_100619042 234
1378 3300009147 Ga0114129_10097334 Ga0114129_100973346 234
1379 3300009147 Ga0114129_10660695 Ga0114129_106606952 234
1380 3300009147 Ga0114129_11223042 Ga0114129_112230421 234
1381 3300009148 Ga0105243_10101844 Ga0105243_101018442 234
1382 3300009148 Ga0105243_10225862 Ga0105243_102258622 234
1383 3300009176 Ga0105242_10031122 Ga0105242_100311222 234
1384 3300009177 Ga0105248_10588752 Ga0105248_105887522 234
1385 3300009545 Ga0105237_10219516 Ga0105237_102195162 234
1386 3300010375 Ga0105239_11266560 Ga0105239_112665601 234
1387 3300011119 Ga0105246_10043393 Ga0105246_100433934 234
1388 3300011119 Ga0105246_10163571 Ga0105246_101635712 234
1389 3300013102 Ga0157371_10005984 Ga0157371_100059847 234
1390 3300013104 Ga0157370_10085648 Ga0157370_100856483 234
1391 3300013104 Ga0157370_10545528 Ga0157370_105455281 234
1392 3300013105 Ga0157369_10168670 Ga0157369_101686702 234
1393 3300013296 Ga0157374_10861020 Ga0157374_108610201 234
1394 3300013296 Ga0157374_10972375 Ga0157374_109723752 234
1395 3300013297 Ga0157378_10666045 Ga0157378_106660451 234
1396 3300013306 Ga0163162_10504445 Ga0163162_105044452 234
1397 3300013307 Ga0157372_10098069 Ga0157372_100980694 234
1398 3300013308 Ga0157375_10105729 Ga0157375_101057293 234
1399 3300013308 Ga0157375_11203296 Ga0157375_112032962 234
1400 3300014325 Ga0163163_10020509 Ga0163163_100205094 234
1401 3300014325 Ga0163163_10481656 Ga0163163_104816562 234
1402 3300014325 Ga0163163_11106313 Ga0163163_111063131 234
1403 3300014326 Ga0157380_10601969 Ga0157380_106019692 234
1404 3300014497 Ga0182008_10017041 Ga0182008_100170412 234
1405 3300014745 Ga0157377_10015044 Ga0157377_100150443 234
1406 3300014745 Ga0157377_10320702 Ga0157377_103207021 234
1407 3300014969 Ga0157376_10108687 Ga0157376_101086872 234
1408 3300020082 Ga0206353_11935210 Ga0206353_119352103 234
1409 3300025885 Ga0207653_10063591 Ga0207653_100635912 234
1410 3300025898 Ga0207692_10018395 Ga0207692_100183952 234
1411 3300025899 Ga0207642_10039094 Ga0207642_100390942 234
1412 3300025901 Ga0207688_10003665 Ga0207688_100036658 234
1413 3300025901 Ga0207688_10024399 Ga0207688_100243992 234
1414 3300025908 Ga0207643_10021733 Ga0207643_100217331 234
1415 3300025914 Ga0207671_10098650 Ga0207671_100986502 234
1416 3300025915 Ga0207693_10009459 Ga0207693_100094591 234
1417 3300025915 Ga0207693_10029250 Ga0207693_100292505 234
1418 3300025916 Ga0207663_10219803 Ga0207663_102198032 234
1419 3300025917 Ga0207660_10136571 Ga0207660_101365712 234
1420 3300025921 Ga0207652_10215949 Ga0207652_102159492 234
1421 3300025921 Ga0207652_10724682 Ga0207652_107246821 234
1422 3300025921 Ga0207652_10781409 Ga0207652_107814092 234
1423 3300025923 Ga0207681_10293058 Ga0207681_102930582 234
1424 3300025925 Ga0207650_10001970 Ga0207650_1000197010 234
1425 3300025925 Ga0207650_10020697 Ga0207650_100206974 234
1426 3300025925 Ga0207650_10315180 Ga0207650_103151802 234
1427 3300025926 Ga0207659_10046116 Ga0207659_100461164 234
1428 3300025926 Ga0207659_10209601 Ga0207659_102096011 234
1429 3300025927 Ga0207687_10028523 Ga0207687_100285232 234
1430 3300025927 Ga0207687_10082557 Ga0207687_100825572 234
1431 3300025929 Ga0207664_10470683 Ga0207664_104706832 234
1432 3300025931 Ga0207644_10026838 Ga0207644_100268382 234
1433 3300025933 Ga0207706_10013222 Ga0207706_100132223 234
1434 3300025933 Ga0207706_10028538 Ga0207706_100285386 234
1435 3300025934 Ga0207686_10057442 Ga0207686_100574422 234
1436 3300025935 Ga0207709_10175010 Ga0207709_101750102 234
1437 3300025935 Ga0207709_10209132 Ga0207709_102091321 234
1438 3300025935 Ga0207709_10248629 Ga0207709_102486292 234
1439 3300025937 Ga0207669_10038794 Ga0207669_100387942 234
1440 3300025938 Ga0207704_10021760 Ga0207704_100217603 234
1441 3300025938 Ga0207704_10124922 Ga0207704_101249222 234
1442 3300025938 Ga0207704_10151090 Ga0207704_101510902 234
1443 3300025939 Ga0207665_10008472 Ga0207665_100084722 234
1444 3300025939 Ga0207665_10043724 Ga0207665_100437243 234
1445 3300025940 Ga0207691_10015833 Ga0207691_100158335 234
1446 3300025940 Ga0207691_10122840 Ga0207691_101228402 234
1447 3300025942 Ga0207689_10069727 Ga0207689_100697272 234
1448 3300025949 Ga0207667_10109994 Ga0207667_101099942 234
1449 3300025949 Ga0207667_10222959 Ga0207667_102229592 234
1450 3300025961 Ga0207712_10526539 Ga0207712_105265392 234
1451 3300025972 Ga0207668_10429092 Ga0207668_104290922 234
1452 3300025986 Ga0207658_10010190 Ga0207658_100101905 234
1453 3300026023 Ga0207677_10188507 Ga0207677_101885071 234
1454 3300026041 Ga0207639_10324048 Ga0207639_103240481 234
1455 3300026075 Ga0207708_10002236 Ga0207708_100022363 234
1456 3300026075 Ga0207708_10606529 Ga0207708_106065291 234
1457 3300026078 Ga0207702_10339273 Ga0207702_103392732 234
1458 3300026089 Ga0207648_10030244 Ga0207648_100302443 234
1459 3300026089 Ga0207648_10306536 Ga0207648_103065362 234
1460 3300026118 Ga0207675_100383608 Ga0207675_1003836082 234
1461 3300026121 Ga0207683_10001939 Ga0207683_100019395 234
1462 3300026121 Ga0207683_10011071 Ga0207683_100110716 234
1463 3300026121 Ga0207683_10045164 Ga0207683_100451642 234
1464 3300026142 Ga0207698_10133691 Ga0207698_101336912 234
1465 3300026142 Ga0207698_10517571 Ga0207698_105175712 234
1466 3300026142 Ga0207698_10561244 Ga0207698_105612442 234
1467 3300027907 Ga0207428_10069939 Ga0207428_100699394 234
1468 3300027907 Ga0207428_10118269 Ga0207428_101182692 234
1469 3300027907 Ga0207428_10546455 Ga0207428_105464551 234
1470 3300028573 Ga0265334_10037170 Ga0265334_100371703 234
1471 3300028577 Ga0265318_10006201 Ga0265318_100062013 234
1472 3300028654 Ga0265322_10020881 Ga0265322_100208812 234
1473 3300028800 Ga0265338_10015169 Ga0265338_100151693 234
1474 3300028800 Ga0265338_10155339 Ga0265338_101553392 234
1475 3300031240 Ga0265320_10016093 Ga0265320_100160936 234
1476 3300031247 Ga0265340_10022629 Ga0265340_100226293 234
1477 3300031249 Ga0265339_10026680 Ga0265339_100266803 234
1478 3300031251 Ga0265327_10010910 Ga0265327_100109102 234
1479 3300031251 Ga0265327_10030198 Ga0265327_100301982 234
1480 3300031344 Ga0265316_10014401 Ga0265316_100144012 234
1481 3300031344 Ga0265316_10251266 Ga0265316_102512662 234
1482 3300031595 Ga0265313_10002188 Ga0265313_1000218815 234
1483 3300031595 Ga0265313_10121017 Ga0265313_101210172 234
1484 3300031711 Ga0265314_10003467 Ga0265314_1000346712 234
1485 3300031712 Ga0265342_10024587 Ga0265342_100245872 234
1486 3300031995 Ga0307409_100339874 Ga0307409_1003398742 234
1487 3300034816 Ga0373930_0014063 Ga0373930_0014063_40_768 234
1488 3300034819 Ga0373958_0011087 Ga0373958_0011087_43_771 234
1489 3300034820 Ga0373959_0005093 Ga0373959_0005093_1261_1989 234
1490 3300035084 Ga0373928_0002991 Ga0373928_0002991_391_1119 234
1491 3300035088 Ga0373940_0023787 Ga0373940_0023787_816_1544 234
1492 3300035090 Ga0373949_0054461 Ga0373949_0054461_84_812 234
1493 3300035091 Ga0373951_0001681 Ga0373951_0001681_443_1171 234
1494 3300035114 Ga0373939_0022079 Ga0373939_0022079_177_905 234
1495 3300035115 Ga0373941_0014770 Ga0373941_0014770_953_1681 234
1496 3300035207 Ga0373942_0036629 Ga0373942_0036629_41_769 234
1497 3300035241 Ga0373961_0001432 Ga0373961_0001432_2815_3543 234
1498 3300035242 Ga0373962_0009335 Ga0373962_0009335_581_1309 234
1499 3300035242 Ga0373962_0030638 Ga0373962_0030638_343_1071 234
1500 3300035691 Ga0373931_0012005 Ga0373931_0012005_393_1121 234
1501 3300037312 Ga0395899_0009866 Ga0395899_0009866_5184_5912 234
1502 3300037418 Ga0395900_0066024 Ga0395900_0066024_2494_3222 234
1503 3300037466 Ga0395898_0001088 Ga0395898_0001088_30786_31514 234
1504 3300037466 Ga0395898_0020688 Ga0395898_0020688_1292_2020 234
1505 3300037466 Ga0395898_0156339 Ga0395898_0156339_609_1349 234
1506 3300037466 Ga0395898_0456642 Ga0395898_0456642_125_853 234
1507 3300037471 Ga0395905_0001800 Ga0395905_0001800_426_1154 234
1508 3300037471 Ga0395905_0050692 Ga0395905_0050692_1281_2012 234
1509 3300037471 Ga0395905_0066119 Ga0395905_0066119_498_1226 234
1510 3300038443 Ga0395901_0002285 Ga0395901_0002285_13559_14287 234
1511 3300038443 Ga0395901_0089319 Ga0395901_0089319_931_1662 234
1512 3300038443 Ga0395901_0104498 Ga0395901_0104498_1518_2246 234
1513 3300038443 Ga0395901_0114078 Ga0395901_0114078_137_865 234
1514 3300038443 Ga0395901_0211578 Ga0395901_0211578_433_1173 234
1515 3300038443 Ga0395901_0373586 Ga0395901_0373586_711_1448 234
1516 3300038443 Ga0395901_1012011 Ga0395901_1012011_11_739 234
1517 3300039437 Ga0436365_0821005 Ga0436365_0821005_78_809 234
1518 3300042156 Ga0439446_0001718 Ga0439446_0001718_422_1156 234
1519 3300042435 Ga0439434_0006095 Ga0439434_0006095_197_931 234
1520 3300044684 Ga0466966_0237820 Ga0466966_0237820_313_1050 234
1521 3300044694 Ga0466963_0025997 Ga0466963_0025997_443_1183 234
1522 3300044694 Ga0466963_0109466 Ga0466963_0109466_943_1680 234
1523 3300044706 Ga0466964_0000345 Ga0466964_0000345_3393_4127 234
1524 3300044735 Ga0466968_0095035 Ga0466968_0095035_102_833 234
1525 3300044735 Ga0466968_0216001 Ga0466968_0216001_18_755 234
1526 3300044842 Ga0466957_0011646 Ga0466957_0011646_3890_4627 234
1527 3300044842 Ga0466957_0037648 Ga0466957_0037648_1402_2142 234
1528 3300044842 Ga0466957_0051270 Ga0466957_0051270_725_1462 234
1529 3300044842 Ga0466957_0140451 Ga0466957_0140451_10_771 234
1530 3300045836 Ga0466958_0000300 Ga0466958_0000300_9865_10614 234
1531 3300045976 Ga0466967_0036549 Ga0466967_0036549_1837_2577 234
1532 3300045976 Ga0466967_0065402 Ga0466967_0065402_353_1087 234
1533 3300045976 Ga0466967_0089532 Ga0466967_0089532_1717_2454 234
1534 3300046455 Ga0495603_0256715 Ga0495603_0256715_192_920 234
1535 3300046459 Ga0495629_0056710 Ga0495629_0056710_1346_2077 234
1536 3300046461 Ga0495641_0049467 Ga0495641_0049467_755_1492 234
1537 3300046463 Ga0495653_0046191 Ga0495653_0046191_759_1496 234
1538 3300046491 Ga0495584_0318729 Ga0495584_0318729_39_770 234
1539 3300046517 Ga0495630_0037449 Ga0495630_0037449_2771_3502 234
1540 3300046518 Ga0495631_0111599 Ga0495631_0111599_283_1011 234
1541 3300046523 Ga0495644_0087853 Ga0495644_0087853_120_851 234
1542 3300046528 Ga0495642_0071603 Ga0495642_0071603_576_1307 234
1543 3300046529 Ga0495652_0040844 Ga0495652_0040844_1799_2536 234
1544 3300046533 Ga0495640_0004359 Ga0495640_0004359_8798_9535 234
1545 3300046535 Ga0495586_0009245 Ga0495586_0009245_2025_2756 234
1546 3300046559 Ga0495667_0001711 Ga0495667_0001711_6506_7243 234
1547 3300046642 Ga0495634_0023186 Ga0495634_0023186_1789_2520 234
1548 3300046642 Ga0495634_0049216 Ga0495634_0049216_109_846 234
1549 3300046663 Ga0495635_0329798 Ga0495635_0329798_198_932 234
1550 3300046664 Ga0495659_0008766 Ga0495659_0008766_2109_2840 234
1551 3300046675 Ga0495657_0041940 Ga0495657_0041940_2308_3045 234
1552 3300046689 Ga0495613_0089694 Ga0495613_0089694_73_810 234
1553 3300046690 Ga0495624_0059503 Ga0495624_0059503_31_768 234
1554 3300047319 Ga0495674_0002208 Ga0495674_0002208_13483_14220 234
1555 3300047319 Ga0495674_0036763 Ga0495674_0036763_1986_2720 234
1556 3300047319 Ga0495674_0156481 Ga0495674_0156481_453_1181 234
1557 3300047319 Ga0495674_0511290 Ga0495674_0511290_77_814 234
1558 3300047322 Ga0495680_0016272 Ga0495680_0016272_1932_2666 234
1559 3300047322 Ga0495680_0240166 Ga0495680_0240166_156_884 234
1560 3300047471 Ga0495684_0074878 Ga0495684_0074878_1069_1806 234
1561 3300048903 Ga0496100_0032864 Ga0496100_0032864_1337_2065 234
1562 3300048905 Ga0496102_0075113 Ga0496102_0075113_72_800 234
1563 3300048905 Ga0496102_0603589 Ga0496102_0603589_67_795 234
1564 3300048906 Ga0496103_0053173 Ga0496103_0053173_167_895 234
1565 3300048907 Ga0496104_0025472 Ga0496104_0025472_2258_2986 234
1566 3300048907 Ga0496104_0308721 Ga0496104_0308721_226_954 234
1567 3300048908 Ga0496105_0089969 Ga0496105_0089969_1397_2125 234
1568 3300048908 Ga0496105_0105014 Ga0496105_0105014_131_868 234
1569 3300048908 Ga0496105_0430130 Ga0496105_0430130_115_843 234
1570 3300048909 Ga0496106_0172521 Ga0496106_0172521_608_1336 234
1571 3300048909 Ga0496106_0191196 Ga0496106_0191196_274_1002 234
1572 3300048910 Ga0496107_0085091 Ga0496107_0085091_1091_1819 234
1573 3300048910 Ga0496107_0253063 Ga0496107_0253063_195_923 234
1574 3300048911 Ga0496108_0050831 Ga0496108_0050831_2021_2749 234
1575 3300048911 Ga0496108_0134998 Ga0496108_0134998_734_1462 234
1576 3300048911 Ga0496108_0153562 Ga0496108_0153562_928_1659 234
1577 3300048911 Ga0496108_0428737 Ga0496108_0428737_319_1047 234
1578 3300048912 Ga0496109_0052938 Ga0496109_0052938_235_963 234
1579 3300048912 Ga0496109_0062921 Ga0496109_0062921_2392_3120 234
1580 3300048912 Ga0496109_0252692 Ga0496109_0252692_668_1396 234
1581 3300048913 Ga0496110_0031288 Ga0496110_0031288_2421_3149 234
1582 3300048913 Ga0496110_0072774 Ga0496110_0072774_410_1138 234
1583 3300048913 Ga0496110_0125594 Ga0496110_0125594_47_778 234
1584 3300048914 Ga0496111_0387106 Ga0496111_0387106_63_800 234
1585 3300048915 Ga0496112_0089851 Ga0496112_0089851_1754_2482 234
1586 3300048915 Ga0496112_0093338 Ga0496112_0093338_930_1661 234
1587 3300048916 Ga0496113_0187525 Ga0496113_0187525_423_1154 234
1588 3300048916 Ga0496113_0226515 Ga0496113_0226515_489_1217 234
1589 3300048917 Ga0496114_0034643 Ga0496114_0034643_2988_3716 234
1590 3300048918 Ga0496115_0040117 Ga0496115_0040117_680_1408 234
1591 3300048918 Ga0496115_0067749 Ga0496115_0067749_890_1627 234
1592 3300048918 Ga0496115_0141690 Ga0496115_0141690_898_1626 234
1593 3300049568 Ga0501031_0009175 Ga0501031_0009175_4563_5291 234
1594 3300049568 Ga0501031_0016309 Ga0501031_0016309_2612_3343 234
1595 3300049568 Ga0501031_0095206 Ga0501031_0095206_734_1468 234
1596 3300049568 Ga0501031_0180123 Ga0501031_0180123_408_1142 234
1597 3300049569 Ga0501032_0048575 Ga0501032_0048575_393_1127 234
1598 3300049570 Ga0501033_0031758 Ga0501033_0031758_1177_1905 234
1599 3300049570 Ga0501033_0093811 Ga0501033_0093811_790_1524 234
1600 3300049571 Ga0501034_0215131 Ga0501034_0215131_455_1192 234
1601 3300049571 Ga0501034_0345165 Ga0501034_0345165_129_857 234
1602 3300049572 Ga0501036_0002934 Ga0501036_0002934_4690_5418 234
1603 3300049572 Ga0501036_0015823 Ga0501036_0015823_4601_5335 234
1604 3300049572 Ga0501036_0202010 Ga0501036_0202010_88_819 234
1605 3300049573 Ga0501037_0107095 Ga0501037_0107095_498_1232 234
1606 3300049573 Ga0501037_0403336 Ga0501037_0403336_53_784 234
1607 3300049574 Ga0501038_0156898 Ga0501038_0156898_408_1142 234
1608 3300049575 Ga0501039_0002187 Ga0501039_0002187_5352_6086 234
1609 3300049575 Ga0501039_0012109 Ga0501039_0012109_1285_2013 234
1610 3300049576 Ga0501040_0005967 Ga0501040_0005967_6214_6948 234
1611 3300049576 Ga0501040_0024153 Ga0501040_0024153_3290_4021 234
1612 3300049576 Ga0501040_0046005 Ga0501040_0046005_1322_2050 234
1613 3300049577 Ga0501041_0001889 Ga0501041_0001889_10814_11542 234
1614 3300049577 Ga0501041_0111812 Ga0501041_0111812_766_1500 234
1615 3300049578 Ga0501042_0003057 Ga0501042_0003057_1235_1966 234
1616 3300049578 Ga0501042_0013766 Ga0501042_0013766_2484_3212 234
1617 3300049578 Ga0501042_0014457 Ga0501042_0014457_3407_4141 234
1618 3300049579 Ga0501043_0117668 Ga0501043_0117668_308_1039 234
1619 3300049580 Ga0501046_0004564 Ga0501046_0004564_3925_4656 234
1620 3300049580 Ga0501046_0004587 Ga0501046_0004587_7771_8499 234
1621 3300049580 Ga0501046_0021684 Ga0501046_0021684_797_1531 234
1622 3300049580 Ga0501046_0150751 Ga0501046_0150751_20_757 234
1623 3300049581 Ga0501047_0020349 Ga0501047_0020349_1133_1870 234
1624 3300049582 Ga0501048_0001602 Ga0501048_0001602_8897_9631 234
1625 3300049582 Ga0501048_0023459 Ga0501048_0023459_691_1422 234
1626 3300049582 Ga0501048_0369841 Ga0501048_0369841_117_854 234
1627 3300049583 Ga0501067_0010138 Ga0501067_0010138_2631_3362 234
1628 3300049583 Ga0501067_0097139 Ga0501067_0097139_868_1599 234
1629 3300049584 Ga0501068_0007806 Ga0501068_0007806_4677_5408 234
1630 3300049584 Ga0501068_0027704 Ga0501068_0027704_267_1001 234
1631 3300049584 Ga0501068_0136783 Ga0501068_0136783_353_1087 234
1632 3300049585 Ga0501069_0016318 Ga0501069_0016318_1261_1989 234
1633 3300049585 Ga0501069_0024070 Ga0501069_0024070_217_948 234
1634 3300049585 Ga0501069_0038080 Ga0501069_0038080_1367_2098 234
1635 3300049586 Ga0501070_0012770 Ga0501070_0012770_5947_6678 234
1636 3300049586 Ga0501070_0046779 Ga0501070_0046779_101_835 234
1637 3300049586 Ga0501070_0082592 Ga0501070_0082592_1493_2221 234
1638 3300049587 Ga0501071_0003474 Ga0501071_0003474_8498_9232 234
1639 3300049587 Ga0501071_0019776 Ga0501071_0019776_802_1536 234
1640 3300049587 Ga0501071_0044450 Ga0501071_0044450_472_1200 234
1641 3300049587 Ga0501071_0065910 Ga0501071_0065910_522_1253 234
1642 3300049587 Ga0501071_0311048 Ga0501071_0311048_104_835 234
1643 3300049588 Ga0501072_0001516 Ga0501072_0001516_14054_14788 234
1644 3300049588 Ga0501072_0040065 Ga0501072_0040065_358_1086 234
1645 3300049588 Ga0501072_0046218 Ga0501072_0046218_1119_1853 234
1646 3300049588 Ga0501072_0090311 Ga0501072_0090311_1281_2009 234
1647 3300049588 Ga0501072_0116884 Ga0501072_0116884_1053_1787 234
1648 3300049588 Ga0501072_0123859 Ga0501072_0123859_1216_1947 234
1649 3300049588 Ga0501072_0379349 Ga0501072_0379349_345_1076 234
1650 3300049589 Ga0501073_0078845 Ga0501073_0078845_942_1670 234
1651 3300049590 Ga0501074_0004428 Ga0501074_0004428_1852_2586 234
1652 3300049590 Ga0501074_0151874 Ga0501074_0151874_330_1058 234
1653 3300049590 Ga0501074_0185296 Ga0501074_0185296_166_897 234
1654 3300049590 Ga0501074_0224550 Ga0501074_0224550_49_786 234
1655 3300049591 Ga0501075_0002256 Ga0501075_0002256_3245_3976 234
1656 3300049591 Ga0501075_0005070 Ga0501075_0005070_3775_4509 234
1657 3300049591 Ga0501075_0045885 Ga0501075_0045885_2176_2910 234
1658 3300049592 Ga0501076_0001348 Ga0501076_0001348_7772_8503 234
1659 3300049592 Ga0501076_0001879 Ga0501076_0001879_3848_4582 234
1660 3300049592 Ga0501076_0016448 Ga0501076_0016448_544_1272 234
1661 3300049592 Ga0501076_0057215 Ga0501076_0057215_1608_2336 234
1662 3300049592 Ga0501076_0189729 Ga0501076_0189729_847_1584 234
1663 3300049593 Ga0501077_0003001 Ga0501077_0003001_8744_9478 234
1664 3300049593 Ga0501077_0007210 Ga0501077_0007210_4579_5310 234
1665 3300049593 Ga0501077_0019935 Ga0501077_0019935_2593_3321 234
1666 3300049741 Ga0501079_0014553 Ga0501079_0014553_3267_3998 234
1667 3300049741 Ga0501079_0023191 Ga0501079_0023191_3365_4093 234
1668 3300049741 Ga0501079_0052027 Ga0501079_0052027_361_1095 234
1669 3300049742 Ga0501080_0010758 Ga0501080_0010758_7316_8050 234
1670 3300049742 Ga0501080_0121389 Ga0501080_0121389_64_795 234
1671 3300049742 Ga0501080_0123675 Ga0501080_0123675_1219_1953 234
1672 3300049742 Ga0501080_0278959 Ga0501080_0278959_467_1198 234
1673 3300049743 Ga0501081_0005966 Ga0501081_0005966_3737_4471 234
1674 3300049743 Ga0501081_0035147 Ga0501081_0035147_512_1240 234
1675 3300049744 Ga0501083_0032356 Ga0501083_0032356_2456_3187 234
1676 3300049744 Ga0501083_0134680 Ga0501083_0134680_866_1600 234
1677 3300049822 Ga0501035_0007594 Ga0501035_0007594_3852_4586 234
1678 3300049822 Ga0501035_0036231 Ga0501035_0036231_96_827 234
1679 3300049822 Ga0501035_0044278 Ga0501035_0044278_2613_3341 234
1680 3300049822 Ga0501035_0296384 Ga0501035_0296384_157_894 234
1681 3300049823 Ga0501044_0130245 Ga0501044_0130245_751_1479 234
1682 3300049823 Ga0501044_0166054 Ga0501044_0166054_138_875 234
1683 3300049824 Ga0501045_0000629 Ga0501045_0000629_9196_9930 234
1684 3300049824 Ga0501045_0035868 Ga0501045_0035868_2418_3149 234
1685 3300049824 Ga0501045_0110655 Ga0501045_0110655_973_1701 234
1686 3300050507 nmdc:mga05p37_372346_c1 nmdc:mga05p37_372346_c1_371_1102 234
1687 3300050507 nmdc:mga05p37_42560_c1 nmdc:mga05p37_42560_c1_2454_3185 234
1688 3300050507 nmdc:mga05p37_613740_c1 nmdc:mga05p37_613740_c1_79_810 234
1689 3300050510 nmdc:mga06r32_60497_c1 nmdc:mga06r32_60497_c1_1206_1934 234
1690 3300050511 nmdc:mga08y16_131155_c1 nmdc:mga08y16_131155_c1_1649_2377 234
1691 3300050511 nmdc:mga08y16_216471_c1 nmdc:mga08y16_216471_c1_676_1407 234
1692 3300050511 nmdc:mga08y16_227319_c1 nmdc:mga08y16_227319_c1_203_931 234
1693 3300050511 nmdc:mga08y16_90333_c1 nmdc:mga08y16_90333_c1_1050_1778 234
1694 3300050512 nmdc:mga0n895_145415_c1 nmdc:mga0n895_145415_c1_455_1195 234
1695 3300050512 nmdc:mga0n895_37865_c1 nmdc:mga0n895_37865_c1_1932_2663 234
1696 3300050513 nmdc:mga0rr50_186146_c1 nmdc:mga0rr50_186146_c1_950_1678 234
1697 3300050513 nmdc:mga0rr50_389132_c1 nmdc:mga0rr50_389132_c1_281_1009 234
1698 3300050514 nmdc:mga08x19_52078_c1 nmdc:mga08x19_52078_c1_615_1346 234
1699 3300053078 Ga0495612_0016112 Ga0495612_0016112_2208_2945 234
1700 3300053084 Ga0495595_0193710 Ga0495595_0193710_76_804 234
1701 3300053085 Ga0495619_0085728 Ga0495619_0085728_33_767 234
1702 3300054114 Ga0501084_0011940 Ga0501084_0011940_498_1232 234
1703 3300054114 Ga0501084_0415201 Ga0501084_0415201_211_945 234
1704 3300060353 Ga0501082_0003737 Ga0501082_0003737_2418_3149 234
1705 3300060353 Ga0501082_0023637 Ga0501082_0023637_2261_2995 234
1706 3300060353 Ga0501082_0568458 Ga0501082_0568458_121_852 234
1707 3300061734 Ga0530510_0005034 Ga0530510_0005034_1383_2114 234
1708 3300061734 Ga0530510_0054188 Ga0530510_0054188_1953_2687 234
1709 3300061734 Ga0530510_0065324 Ga0530510_0065324_734_1462 234
1710 3300061734 Ga0530510_0073211 Ga0530510_0073211_1602_2333 234
1711 3300061734 Ga0530510_0146623 Ga0530510_0146623_367_1104 234
1712 3300061734 Ga0530510_0274192 Ga0530510_0274192_218_949 234
1713 3300061734 Ga0530510_0390700 Ga0530510_0390700_157_888 234

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

7

200

0.94

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

13

247

0.94

PF08659

KR

KR domain

7

189

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
4m8s-assembly1.cif.gz_B crystal structure of 3-ketoacyl -(acyl carrier protein) reductase (fabg) from neisseria meningitidis 0.9542 5 234
3sj7-assembly1.cif.gz_B-2 structure of beta-ketoacetyl-coa reductase (fabg) from staphylococcus aureus complex with nadph 0.9542 10 234
4jro-assembly1.cif.gz_C crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg)from listeria monocytogenes in complex with nadp+ 0.9526 6 234
3osu-assembly1.cif.gz_A crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus 0.9501 8 234
4z9x-assembly1.cif.gz_A crystal structure of 2-keto-3-deoxy-d-gluconate dehydrogenase from streptococcus pyogenes 0.9458 3 232
ID Description Score Start End Superfamily
af_Q0JEC9_1_74_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9748 6 42 3.40.50.720
af_F4J128_251_373_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9704 79 178 3.40.50.720
af_Q54N15_5_159_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9607 51 166 3.40.50.720
af_P76633_10_261_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9506 4 232 3.40.50.720
4wecC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9486 7 232 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A538EFD5-F1-model_v4 3-oxoacyl-[acyl-carrier-protein] reductase (EC 1.1.1.100) 0.9686 1 234 GO:0004316
GO:0006633
GO:0051287
AF-A0A537WVP0-F1-model_v4 3-oxoacyl-[acyl-carrier-protein] reductase (EC 1.1.1.100) 0.968 1 234 GO:0004316
GO:0006633
GO:0048038
GO:0051287
AF-A0A832H8F2-F1-model_v4 SDR family oxidoreductase 0.9677 12 234 GO:0016616
AF-A0A538EFD5-F1-model_v4 3-oxoacyl-[acyl-carrier-protein] reductase (EC 1.1.1.100) 0.9646 1 234 GO:0004316
GO:0006633
GO:0051287
AF-A0A538MNS4-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9644 1 208 GO:0016616
GO:0030497

Feature Viewer

pLDDT pTM Quality
88.81 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map