metagRoot

F495447

General Info

Members	Datasets	Scaffolds	Average Seq Length
1715	633	1635	105

Family's Representative Sequence

Representative Sequence	3300009098\|Ga0105245_10268179\|Ga0105245_102681793
Length	122
Sequence	MGWFVEGVSDAGRDRWRMIRGFFRLIGLLLLAGGFIFMVYDGARWVADQNLRFTRFGQFWNDVHQSSQQAFRTSVESSVPWLWTNVVKVLLDQPVFAVMGVLGIVLLILFRPRKPLIGYSRD

Samples

	Sample ID	Description	Type	Environment
1	2513237092	Bradyrhizobium sp. WSM1743	Isolate	Nodule
2	2513237096	Bradyrhizobium pachyrhizi USDA 3259	Isolate	Nodule
3	2513237098	Bradyrhizobium elkanii WSM2783	Isolate	Nodule
4	2513237101	Bradyrhizobium murdochi WSM1741	Isolate	Nodule
5	2513237137	Bradyrhizobium elkanii USDA 94	Isolate	Nodule
6	2513237139	Bradyrhizobium ottawaense USDA 4	Isolate	Nodule
7	2513237145	Bradyrhizobium elkanii USDA 3254	Isolate	Nodule
8	2513237161	Bradyrhizobium sp. WSM2793	Isolate	Nodule
9	2517572143	Bradyrhizobium elkanii USDA 76	Isolate	Nodule
10	2524023210	Bradyrhizobium sp. Ai1a-2	Isolate	Nodule
11	2524023228	Bradyrhizobium sp. Th.b2	Isolate	Nodule
12	2617270735	Bradyrhizobium shewense ERR11	Isolate	Nodule
13	2617270741	Bradyrhizobium yuanmingense CCBAU 10071	Isolate	Nodule
14	2667528175	Rhizobium tropici NFR14	Isolate	Rhizoplane
15	2721755755	Bradyrhizobium icense LMTR 13	Isolate	Nodule
16	2728368998	Bradyrhizobium macuxiense BR 10303	Isolate	Nodule
17	2791355196	Bradyrhizobium sp. Y36	Isolate	Nodule
18	2791355197	Bradyrhizobium sp. C9	Isolate	Nodule
19	2791355199
20	2802429603	Bradyrhizobium ottawaense L2	Isolate	Nodule
21	2824671348	Bradyrhizobium sp. HAMBI 2125	Isolate	Unclassified
22	2824679649	Bradyrhizobium sp.HAMBI 2116	Isolate	Unclassified
23	2824687955	Bradyrhizobium sp. HAMBI 2126	Isolate	Unclassified
24	2824696289	Bradyrhizobium sp. HAMBI 2127	Isolate	Unclassified
25	2824732956	Bradyrhizobium sp. HAMBI 2153	Isolate	Unclassified
26	2824746037	Bradyrhizobium sp. HAMBI 2299	Isolate	Unclassified
27	2824773399	Bradyrhizobium sp. HAMBI 2130	Isolate	Unclassified
28	2838122688	Bradyrhizobium sp. CIR3A	Isolate	Nodule
29	2841941048	Bradyrhizobium sp. SBR1B	Isolate	Nodule
30	2841949485	Bradyrhizobium sp. ERR14	Isolate	Nodule
31	2841966195	Bradyrhizobium sp. CIR18	Isolate	Nodule
32	2841974524	Bradyrhizobium sp. CIR48	Isolate	Nodule
33	2841983080	Bradyrhizobium sp. IAR9	Isolate	Nodule
34	2842038055	Bradyrhizobium centrosematis SEMIA 424	Isolate	Nodule
35	2842045827	Bradyrhizobium centrosematis SEMIA 431	Isolate	Nodule
36	2847939898	Bradyrhizobium ottawaense OO99	Isolate	Unclassified
37	2849076700	Bradyrhizobium symbiodeficiens 85S1MB	Isolate	Nodule
38	2874604998	Bradyrhizobium sp. LMTR 3	Isolate	Nodule
39	2874612657	Bradyrhizobium forestalis INPA54B	Isolate	Nodule
40	2874620515	Bradyrhizobium nanningense CCBAU 53390	Isolate	Unclassified
41	2876808645	Bradyrhizobium algeriense RST89	Isolate	Unclassified
42	2879110137	Bradyrhizobium algeriense RST91	Isolate	Nodule
43	2885366525	Bradyrhizobium sp. LVM 105	Isolate	Unclassified
44	2885374607	Bradyrhizobium sp. NAS96.2	Isolate	Unclassified
45	2885383462	Bradyrhizobium sp. Leo170	Isolate	Unclassified
46	2889033259	Bradyrhizobium sp. CCBAU 051011	Isolate	Unclassified
47	2903748898	Bradyrhizobium uaiense UFLA 03-164	Isolate	Nodule
48	2903768456	Bradyrhizobium sp. Leo121	Isolate	Unclassified
49	2904666416	Bradyrhizobium nanningense CCBAU 51757	Isolate	Unclassified
50	2904690495	Bradyrhizobium ivorense CI-1B	Isolate	Nodule
51	2904699407
52	2906610324
53	2906635258	Bradyrhizobium sp. USDA 3458	Isolate	Unclassified
54	2906660503	Bradyrhizobium brasilense UFLA 03-321	Isolate	Unclassified
55	2908739725	Bradyrhizobium sp. UFLA03-84	Isolate	Nodule
56	2908756301	Bradyrhizobium ivorense CI-41S	Isolate	Nodule
57	2908775508	Bradyrhizobium sp. SUTN9-2	Isolate	Unclassified
58	2922361189	Bradyrhizobium australiense WSM 1791	Isolate	Nodule
59	2922386360	Bradyrhizobium archetypum WSM 1744	Isolate	Nodule
60	2922393267	Bradyrhizobium sp. WBAH10	Isolate	Nodule
61	2922425934
62	2935630451	Bradyrhizobium sp. I1.14.4	Isolate	Nodule
63	2941507105	Bradyrhizobium sp. i1.12.3	Isolate	Nodule
64	2941515067	Bradyrhizobium sp. i1.14.1	Isolate	Nodule
65	2941523033	Bradyrhizobium sp. i1.8.4	Isolate	Nodule
66	3005474847	Bradyrhizobium sp. CCBAU 53421	Isolate	Nodule
67	3005483717	Bradyrhizobium agreste CNPSo 4010	Isolate	Unclassified
68	3005506211	Bradyrhizobium diazoefficiens SZCCT0449	Isolate	Unclassified
69	3005587118	Bradyrhizobium glycinis CNPSo 4016	Isolate	Unclassified
70	3300001979	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6	Metagenome	Rhizosphere
71	3300002067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1	Metagenome	Rhizosphere
72	3300002075	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4	Metagenome	Rhizosphere
73	3300003215	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF	Metagenome	Endosphere
74	3300003322	Sugarcane root Sample L2	Metagenome	Unclassified
75	3300003659	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
76	3300003763	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2	Metagenome	Endosphere
77	3300003911	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
78	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
79	3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3)	Metagenome	Rhizosphere
80	3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
81	3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2)	Metagenome	Rhizosphere
82	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
83	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
84	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
85	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
86	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
87	3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Metagenome	Rhizosphere
88	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
89	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
90	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
91	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
92	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
93	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
94	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
95	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
96	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
97	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
98	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
99	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
100	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
101	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
102	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
103	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
104	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
105	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
106	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
107	3300005406	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG	Metagenome	Rhizosphere
108	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
109	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
110	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
111	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
112	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
113	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
114	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
115	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
116	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
117	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
118	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
119	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
120	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
121	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
122	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
123	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
124	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
125	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
126	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
127	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
128	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
129	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
130	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
131	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
132	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
133	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
134	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
135	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
136	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
137	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
138	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
139	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
140	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
141	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
142	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
143	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
144	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
145	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
146	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
147	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
148	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
149	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
150	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
151	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
152	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
153	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
154	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
155	3300005981	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1	Metagenome	Rhizosphere
156	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
157	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
158	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
159	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
160	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
161	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
162	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
163	3300006058	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Metagenome	Rhizosphere
164	3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Metagenome	Rhizosphere
165	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
166	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
167	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
168	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
169	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
170	3300006194	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1	Metagenome	Rhizosphere
171	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
172	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
173	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
174	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
175	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
176	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
177	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
178	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
179	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
180	3300006941	Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW	Metagenome	Nodule
181	3300006942	Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW	Metagenome	Nodule
182	3300006943	Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW	Metagenome	Nodule
183	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
184	3300007265	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1	Metagenome	Rhizosphere
185	3300007788	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2	Metagenome	Rhizosphere
186	3300009036	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG	Metagenome	Rhizosphere
187	3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Metagenome	Rhizosphere
188	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
189	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
190	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
191	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
192	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
193	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
194	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
195	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
196	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
197	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
198	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
199	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
200	3300010159	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3	Metagenome	Rhizosphere
201	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
202	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
203	3300012488	Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610	Metagenome	Rhizosphere
204	3300012513	Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510	Metagenome	Rhizosphere
205	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
206	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
207	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
208	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
209	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
210	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
211	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
212	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
213	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
214	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
215	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
216	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
217	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
218	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
219	3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Metagenome	Rhizosphere
220	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
221	3300021361	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2	Metagenome	Rhizosphere
222	3300021388	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8	Metagenome	Unclassified
223	3300024227	Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4	Metagenome	Rhizosphere
224	3300025254	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
225	3300025261	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2)	Metagenome	Endosphere
226	3300025272	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
227	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
228	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
229	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
230	3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
231	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
232	3300025711	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
233	3300025885	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
234	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
235	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
236	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
237	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
238	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
239	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
240	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
241	3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
242	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
243	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
244	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
245	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
246	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
247	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
248	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
249	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
250	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
251	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
252	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
253	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
254	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
255	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
256	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
257	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
258	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
259	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
260	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
261	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
262	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
263	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
264	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
265	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
266	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
267	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
268	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
269	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
270	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
271	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
272	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
273	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
274	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
275	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
276	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
277	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
278	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
279	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
280	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
281	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
282	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
283	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
284	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
285	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
286	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
287	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
288	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
289	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
290	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
291	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
292	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
293	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
294	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
295	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
296	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
297	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
298	3300027357	Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2)	Metagenome	Nodule
299	3300027361	Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2)	Metagenome	Nodule
300	3300027363	Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2)	Metagenome	Nodule
301	3300027512	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2)	Metagenome	Rhizosphere
302	3300027671	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2)	Metagenome	Rhizosphere
303	3300027866	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2)	Metagenome	Endosphere
304	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
305	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
306	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
307	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
308	3300028573	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG	Metagenome	Rhizosphere
309	3300028786	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM	Metagenome	Unclassified
310	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
311	3300030521	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM	Metagenome	Unclassified
312	3300030760	Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
313	3300031235	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG	Metagenome	Rhizosphere
314	3300031238	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG	Metagenome	Rhizosphere
315	3300031239	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG	Metagenome	Rhizosphere
316	3300031241	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG	Metagenome	Rhizosphere
317	3300031247	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG	Metagenome	Rhizosphere
318	3300031249	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG	Metagenome	Rhizosphere
319	3300031250	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG	Metagenome	Rhizosphere
320	3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Metagenome	Rhizosphere
321	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
322	3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Metagenome	Unclassified
323	3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Metagenome	Unclassified
324	3300031712	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG	Metagenome	Rhizosphere
325	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
326	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
327	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
328	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
329	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
330	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
331	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
332	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
333	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
334	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
335	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
336	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
337	3300033179	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM	Metagenome	Unclassified
338	3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Metagenome	Unclassified
339	3300033442	Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1	Metagenome	Nodule
340	3300033545	Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4	Metagenome	Unclassified
341	3300034816	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3	Metagenome	Rhizosphere
342	3300034817	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1	Metagenome	Rhizosphere
343	3300034819	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1	Metagenome	Rhizosphere
344	3300034957	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2	Metagenome	Rhizosphere
345	3300035085	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2	Metagenome	Rhizosphere
346	3300035086	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4	Metagenome	Rhizosphere
347	3300035088	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4	Metagenome	Rhizosphere
348	3300035089	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2	Metagenome	Rhizosphere
349	3300035090	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2	Metagenome	Rhizosphere
350	3300035092	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11	Metagenome	Rhizosphere
351	3300035111	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11	Metagenome	Rhizosphere
352	3300035113	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12	Metagenome	Rhizosphere
353	3300035114	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3	Metagenome	Rhizosphere
354	3300035115	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11	Metagenome	Rhizosphere
355	3300035116	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3	Metagenome	Rhizosphere
356	3300035117	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1	Metagenome	Rhizosphere
357	3300035118	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2	Metagenome	Rhizosphere
358	3300035119	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4	Metagenome	Rhizosphere
359	3300035120	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5	Metagenome	Rhizosphere
360	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
361	3300035171	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4	Metagenome	Rhizosphere
362	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
363	3300035207	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16	Metagenome	Rhizosphere
364	3300035241	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4	Metagenome	Rhizosphere
365	3300035242	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11	Metagenome	Rhizosphere
366	3300035410	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12	Metagenome	Rhizosphere
367	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
368	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
369	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
370	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
371	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
372	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
373	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
374	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
375	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
376	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
377	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
378	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
379	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
380	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
381	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
382	3300039450	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2	Metagenome	Unclassified
383	3300041410	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596	Metagenome	Rhizosphere
384	3300041413	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839	Metagenome	Rhizosphere
385	3300041441	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG	Metagenome	Rhizoplane
386	3300041443	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG	Metagenome	Rhizoplane
387	3300041451	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG	Metagenome	Rhizoplane
388	3300041452	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG	Metagenome	Rhizoplane
389	3300041453	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG	Metagenome	Rhizoplane
390	3300041456	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG	Metagenome	Rhizoplane
391	3300041460	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG	Metagenome	Rhizoplane
392	3300041486	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG	Metagenome	Rhizoplane
393	3300041505	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG	Metagenome	Unclassified
394	3300041507	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG	Metagenome	Unclassified
395	3300041509	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG	Metagenome	Unclassified
396	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
397	3300042157	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210	Metagenome	Rhizosphere
398	3300042438	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533	Metagenome	Rhizosphere
399	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
400	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
401	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
402	3300044901	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R	Metagenome	Rhizosphere
403	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
404	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
405	3300046452	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere	Metagenome	Rhizosphere
406	3300046453	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere	Metagenome	Rhizosphere
407	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
408	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
409	3300046457	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere	Metagenome	Rhizosphere
410	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
411	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
412	3300046461	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere	Metagenome	Rhizosphere
413	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
414	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
415	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
416	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
417	3300046474	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere	Metagenome	Rhizosphere
418	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
419	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
420	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
421	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
422	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
423	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
424	3300046500	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere	Metagenome	Rhizosphere
425	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
426	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
427	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
428	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
429	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
430	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
431	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
432	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
433	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
434	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
435	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
436	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
437	3300046520	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere	Metagenome	Rhizosphere
438	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
439	3300046523	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere	Metagenome	Rhizosphere
440	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
441	3300046525	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere	Metagenome	Rhizosphere
442	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
443	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
444	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
445	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
446	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
447	3300046537	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere	Metagenome	Rhizosphere
448	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
449	3300046539	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere	Metagenome	Rhizosphere
450	3300046542	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere	Metagenome	Rhizosphere
451	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
452	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
453	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
454	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
455	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
456	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
457	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
458	3300046648	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere	Metagenome	Rhizosphere
459	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
460	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
461	3300046664	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere	Metagenome	Rhizosphere
462	3300046665	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere	Metagenome	Rhizosphere
463	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
464	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
465	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
466	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
467	3300046681	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere	Metagenome	Rhizosphere
468	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
469	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
470	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
471	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
472	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
473	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
474	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
475	3300046794	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere	Metagenome	Rhizosphere
476	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
477	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
478	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
479	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
480	3300047318	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere	Metagenome	Rhizosphere
481	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
482	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
483	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
484	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
485	3300047323	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere	Metagenome	Rhizosphere
486	3300047443	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere	Metagenome	Rhizosphere
487	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
488	3300047445	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere	Metagenome	Rhizosphere
489	3300047446	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere	Metagenome	Rhizosphere
490	3300047447	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere	Metagenome	Rhizosphere
491	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
492	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
493	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
494	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
495	3300048091	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere	Metagenome	Rhizosphere
496	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
497	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
498	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
499	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
500	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
501	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
502	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
503	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
504	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
505	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
506	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
507	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
508	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
509	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
510	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
511	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
512	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
513	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
514	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
515	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
516	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
517	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
518	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
519	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
520	3300049459	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere	Metagenome	Rhizosphere
521	3300049460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere	Metagenome	Rhizosphere
522	3300049513	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control	Metagenome	Rhizosphere
523	3300049515	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought	Metagenome	Rhizosphere
524	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
525	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
526	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
527	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
528	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
529	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
530	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
531	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
532	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
533	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
534	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
535	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
536	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
537	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
538	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
539	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
540	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
541	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
542	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
543	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
544	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
545	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
546	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
547	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
548	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
549	3300049652	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought	Metagenome	Rhizosphere
550	3300049672	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought	Metagenome	Rhizosphere
551	3300049705	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought	Metagenome	Rhizosphere
552	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
553	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
554	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
555	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
556	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
557	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
558	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
559	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
560	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
561	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
562	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
563	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
564	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
565	3300050495	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation	Metagenome	Endosphere
566	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
567	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
568	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
569	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
570	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
571	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
572	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
573	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
574	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
575	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
576	3300053078	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere	Metagenome	Rhizosphere
577	3300053079	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere	Metagenome	Endosphere
578	3300053080	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere	Metagenome	Endosphere
579	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
580	3300053086	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere	Metagenome	Endosphere
581	3300053087	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere	Metagenome	Endosphere
582	3300053088	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere	Metagenome	Endosphere
583	3300053089	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere	Metagenome	Endosphere
584	3300053090	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere	Metagenome	Endosphere
585	3300053092	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere	Metagenome	Endosphere
586	3300053093	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere	Metagenome	Endosphere
587	3300053094	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere	Metagenome	Endosphere
588	3300053096	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere	Metagenome	Endosphere
589	3300053097	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere	Metagenome	Endosphere
590	3300053099	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere	Metagenome	Endosphere
591	3300053103	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere	Metagenome	Endosphere
592	3300053105	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere	Metagenome	Endosphere
593	3300053108	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere	Metagenome	Endosphere
594	3300053109	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere	Metagenome	Endosphere
595	3300053116	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere	Metagenome	Endosphere
596	3300053117	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere	Metagenome	Endosphere
597	3300053118	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere	Metagenome	Endosphere
598	3300053119	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere	Metagenome	Endosphere
599	3300053120	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere	Metagenome	Endosphere
600	3300053129	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere	Metagenome	Endosphere
601	3300053133	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere	Metagenome	Endosphere
602	3300053134	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere	Metagenome	Endosphere
603	3300053136	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere	Metagenome	Endosphere
604	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
605	3300053140	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere	Metagenome	Endosphere
606	3300053142	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere	Metagenome	Endosphere
607	3300053147	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere	Metagenome	Endosphere
608	3300053148	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere	Metagenome	Endosphere
609	3300053150	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere	Metagenome	Endosphere
610	3300053151	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere	Metagenome	Endosphere
611	3300053158	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere	Metagenome	Endosphere
612	3300053161	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere	Metagenome	Endosphere
613	3300053162	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere	Metagenome	Endosphere
614	3300053163	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere	Metagenome	Endosphere
615	3300053177	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere	Metagenome	Endosphere
616	3300053178	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere	Metagenome	Endosphere
617	3300053727	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere	Metagenome	Endosphere
618	3300053730	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere	Metagenome	Endosphere
619	3300053735	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere	Metagenome	Endosphere
620	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
621	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
622	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere
623	8006926726	Bradyrhizobium guangdongense SM32	Isolate	Unclassified
624	8006933436	Bradyrhizobium septentrionale 7(2017)	Isolate	Unclassified
625	8006964411	Bradyrhizobium sp. sBnM-33	Isolate	Nodule
626	8006973647	Bradyrhizobium septentrionale 162S2	Isolate	Nodule
627	8006984368	Bradyrhizobium sp. SRL28	Isolate	Unclassified
628	8006994254	Bradyrhizobium sp. sGM-13	Isolate	Nodule
629	8019555841	Bradyrhizobium sp. JR6.1	Isolate	Nodule
630	8019565922	Bradyrhizobium sp. JR3.5	Isolate	Nodule
631	8056673599	Bradyrhizobium hereditatis WSM 1738	Isolate	Nodule
632	8056681323	Bradyrhizobium cenepequi CNPSo 4026	Isolate	Nodule
633	8056689827	Bradyrhizobium semiaridum WSM 1704	Isolate	Nodule

Type Distribution

Type	Percentage (%)
Metagenomes	95.5
Metatranscriptomes	0.06
Isolates	4.44

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	9.04
Nodule	3.32
Rhizoplane	5.6
Rhizosphere	75.69
Stem	0
Stem Tuber	0
Unclassified	6.36

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24740J21852_10137553	3300001979	Bacteria	608
2	JGI24735J21928_10005614	3300002067	Bacteria	4153
3	JGI24738J21930_10017596	3300002075	Bacteria	1501
4	JGI25153J46596_10002083	3300003215	Bacteria	11762
5	rootL2_10158404	3300003322	Bacteria	2953
6	JGI25404J52841_10002608	3300003659	Bacteria	3439
7	JGI25404J52841_10020295	3300003659	Bacteria	1439
8	JGI25404J52841_10035632	3300003659	Bacteria	1059
9	JGI25404J52841_10091386	3300003659	Bacteria	637
10	Ga0055529_1007857	3300003763	Bacteria	1434
11	JGI25405J52794_10046342	3300003911	Bacteria	926
12	Ga0065165_1001383	3300005262	Bacteria	26627
13	Ga0065712_10576448	3300005290	Bacteria	603
14	Ga0065715_10307051	3300005293	Bacteria	1028
15	Ga0065707_11030870	3300005295	Bacteria	531
16	Ga0070658_10072580	3300005327	Bacteria	2821
17	Ga0070658_10159550	3300005327	Bacteria	1892
18	Ga0070658_10740572	3300005327	Bacteria	853
19	Ga0070676_11007463	3300005328	Bacteria	626
20	Ga0070683_100010686	3300005329	Bacteria	7893
21	Ga0070683_100633603	3300005329	Bacteria	1024
22	Ga0070690_100453172	3300005330	Bacteria	952
23	Ga0070690_100561920	3300005330	Bacteria	861
24	Ga0070670_100630459	3300005331	Bacteria	961
25	Ga0070670_101665225	3300005331	Bacteria	587
26	Ga0070677_10106175	3300005333	Bacteria	1247
27	Ga0068869_100205866	3300005334	Bacteria	1553
28	Ga0068869_100516052	3300005334	Bacteria	1000
29	Ga0068869_100548238	3300005334	Bacteria	971
30	Ga0068869_101279482	3300005334	Bacteria	646
31	Ga0068869_101619973	3300005334	Bacteria	577
32	Ga0070666_10630118	3300005335	Bacteria	783
33	Ga0070680_100014001	3300005336	Bacteria	6261
34	Ga0070680_100045493	3300005336	Bacteria	3568
35	Ga0070680_100193195	3300005336	Bacteria	1715
36	Ga0070680_100234569	3300005336	Bacteria	1550
37	Ga0070680_101655523	3300005336	Bacteria	554
38	Ga0070682_100164260	3300005337	Bacteria	1536
39	Ga0070682_100278286	3300005337	Bacteria	1219
40	Ga0070682_100569959	3300005337	Bacteria	889
41	Ga0068868_100032306	3300005338	Bacteria	4026
42	Ga0068868_100055510	3300005338	Bacteria	3125
43	Ga0068868_100375398	3300005338	Bacteria	1222
44	Ga0068868_100913314	3300005338	Bacteria	799
45	Ga0068868_101086310	3300005338	Bacteria	735
46	Ga0068868_101263443	3300005338	Bacteria	685
47	Ga0070660_100004691	3300005339	Bacteria	9464
48	Ga0070660_100116540	3300005339	Bacteria	2130
49	Ga0070660_100156847	3300005339	Bacteria	1832
50	Ga0070660_100233498	3300005339	Bacteria	1497
51	Ga0070660_100827875	3300005339	Bacteria	779
52	Ga0070691_10153332	3300005341	Bacteria	1183
53	Ga0070691_10373040	3300005341	Bacteria	798
54	Ga0070691_10476091	3300005341	Bacteria	717
55	Ga0070687_100130860	3300005343	Bacteria	1448
56	Ga0070687_100802882	3300005343	Bacteria	667
57	Ga0070661_100078090	3300005344	Bacteria	2442
58	Ga0070661_100152771	3300005344	Bacteria	1746
59	Ga0070661_100269106	3300005344	Bacteria	1319
60	Ga0070661_101468561	3300005344	Bacteria	575
61	Ga0070692_10257777	3300005345	Bacteria	1047
62	Ga0070692_10748486	3300005345	Bacteria	662
63	Ga0070668_100058218	3300005347	Bacteria	2989
64	Ga0070668_100139687	3300005347	Bacteria	1951
65	Ga0070668_100604795	3300005347	Bacteria	959
66	Ga0070668_100703328	3300005347	Bacteria	891
67	Ga0070668_100843012	3300005347	Bacteria	816
68	Ga0070668_102253042	3300005347	Bacteria	503
69	Ga0070669_100630247	3300005353	Bacteria	900
70	Ga0070669_101052425	3300005353	Bacteria	700
71	Ga0070675_100929551	3300005354	Bacteria	797
72	Ga0070671_100063199	3300005355	Bacteria	3082
73	Ga0070671_100276066	3300005355	Bacteria	1429
74	Ga0070671_100346905	3300005355	Bacteria	1267
75	Ga0070671_100798640	3300005355	Bacteria	822
76	Ga0070671_101604849	3300005355	Bacteria	577
77	Ga0070674_100049204	3300005356	Bacteria	2897
78	Ga0070674_100445345	3300005356	Bacteria	1068
79	Ga0070674_100592572	3300005356	Bacteria	935
80	Ga0070673_100279277	3300005364	Bacteria	1464
81	Ga0070673_100526569	3300005364	Bacteria	1072
82	Ga0070688_100175960	3300005365	Bacteria	1481
83	Ga0070688_100288020	3300005365	Bacteria	1183
84	Ga0070688_101045452	3300005365	Bacteria	651
85	Ga0070688_101143766	3300005365	Bacteria	624
86	Ga0070659_100058965	3300005366	Bacteria	3030
87	Ga0070659_100181158	3300005366	Bacteria	1729
88	Ga0070659_102152873	3300005366	Bacteria	501
89	Ga0070667_100676427	3300005367	Bacteria	954
90	Ga0070667_100873417	3300005367	Bacteria	836
91	Ga0070667_101545146	3300005367	Bacteria	623
92	Ga0070667_101841340	3300005367	Bacteria	570
93	Ga0070703_10064934	3300005406	Bacteria	1204
94	Ga0070709_10032883	3300005434	Bacteria	3132
95	Ga0070709_10121393	3300005434	Bacteria	1772
96	Ga0070709_10310026	3300005434	Bacteria	1155
97	Ga0070709_11077158	3300005434	Bacteria	642
98	Ga0070714_100651830	3300005435	Bacteria	1014
99	Ga0070714_101067354	3300005435	Bacteria	787
100	Ga0070714_101232304	3300005435	Bacteria	730
101	Ga0070713_100064982	3300005436	Bacteria	3063
102	Ga0070713_100160079	3300005436	Bacteria	2009
103	Ga0070713_100629600	3300005436	Bacteria	1021
104	Ga0070713_101170462	3300005436	Bacteria	744
105	Ga0070710_10424488	3300005437	Bacteria	896
106	Ga0070710_10462703	3300005437	Bacteria	862
107	Ga0070710_11324484	3300005437	Bacteria	536
108	Ga0070701_10114065	3300005438	Bacteria	1514
109	Ga0070701_10463486	3300005438	Bacteria	816
110	Ga0070711_100686963	3300005439	Bacteria	861
111	Ga0070700_100102084	3300005441	Bacteria	1891
112	Ga0070694_100835616	3300005444	Bacteria	757
113	Ga0070694_101249074	3300005444	Bacteria	623
114	Ga0070708_100152359	3300005445	Bacteria	2151
115	Ga0070708_101356995	3300005445	Bacteria	664
116	Ga0070663_100004964	3300005455	Bacteria	7855
117	Ga0070663_100016779	3300005455	Bacteria	4764
118	Ga0070663_100125036	3300005455	Bacteria	1947
119	Ga0070663_100134943	3300005455	Bacteria	1878
120	Ga0070663_100160887	3300005455	Bacteria	1728
121	Ga0070663_100179722	3300005455	Bacteria	1640
122	Ga0070663_100187918	3300005455	Bacteria	1606
123	Ga0070663_100234092	3300005455	Bacteria	1447
124	Ga0070663_100269379	3300005455	Bacteria	1353
125	Ga0070663_100312694	3300005455	Bacteria	1261
126	Ga0070663_100396450	3300005455	Bacteria	1127
127	Ga0070663_100752862	3300005455	Bacteria	832
128	Ga0070678_100038407	3300005456	Bacteria	3370
129	Ga0070678_100048318	3300005456	Bacteria	3063
130	Ga0070678_100480269	3300005456	Bacteria	1093
131	Ga0070678_100555619	3300005456	Bacteria	1020
132	Ga0070678_100829011	3300005456	Bacteria	841
133	Ga0070662_100125869	3300005457	Bacteria	1970
134	Ga0070662_100291563	3300005457	Bacteria	1323
135	Ga0070662_100377223	3300005457	Bacteria	1167
136	Ga0070662_100727786	3300005457	Bacteria	840
137	Ga0070662_101421863	3300005457	Bacteria	598
138	Ga0070681_10016653	3300005458	Bacteria	7338
139	Ga0070681_10022259	3300005458	Bacteria	6362
140	Ga0070681_10022991	3300005458	Bacteria	6266
141	Ga0070681_10076536	3300005458	Bacteria	3304
142	Ga0068867_100884622	3300005459	Bacteria	803
143	Ga0068867_101083262	3300005459	Bacteria	731
144	Ga0068867_102149515	3300005459	Bacteria	529
145	Ga0070685_10302827	3300005466	Bacteria	1078
146	Ga0070685_10614567	3300005466	Bacteria	784
147	Ga0070706_100500397	3300005467	Bacteria	1131
148	Ga0070706_100599389	3300005467	Bacteria	1024
149	Ga0070706_100682790	3300005467	Bacteria	953
150	Ga0070707_100121704	3300005468	Bacteria	2534
151	Ga0070707_100601604	3300005468	Bacteria	1062
152	Ga0070698_100070288	3300005471	Bacteria	3513
153	Ga0070698_100260153	3300005471	Bacteria	1667
154	Ga0070698_100513377	3300005471	Bacteria	1137
155	Ga0070699_100927777	3300005518	Bacteria	798
156	Ga0070699_101327752	3300005518	Bacteria	660
157	Ga0070699_101786987	3300005518	Bacteria	563
158	Ga0070679_100007145	3300005530	Bacteria	10422
159	Ga0070679_100034273	3300005530	Bacteria	5031
160	Ga0070679_100115707	3300005530	Bacteria	2667
161	Ga0070679_100188247	3300005530	Bacteria	2033
162	Ga0070679_100281899	3300005530	Bacteria	1614
163	Ga0070679_101046836	3300005530	Bacteria	760
164	Ga0070684_100011913	3300005535	Bacteria	6944
165	Ga0070684_100036427	3300005535	Bacteria	4215
166	Ga0070684_101033612	3300005535	Bacteria	771
167	Ga0070684_101403952	3300005535	Bacteria	658
168	Ga0070697_100035746	3300005536	Bacteria	4009
169	Ga0070697_100472005	3300005536	Bacteria	1095
170	Ga0068853_100004567	3300005539	Bacteria	10738
171	Ga0068853_100012846	3300005539	Bacteria	6822
172	Ga0068853_100157264	3300005539	Bacteria	2048
173	Ga0068853_100165929	3300005539	Bacteria	1996
174	Ga0068853_100431708	3300005539	Bacteria	1237
175	Ga0068853_100525823	3300005539	Bacteria	1119
176	Ga0068853_100665190	3300005539	Bacteria	992
177	Ga0068853_100826379	3300005539	Bacteria	888
178	Ga0068853_101514291	3300005539	Bacteria	649
179	Ga0070672_100262483	3300005543	Bacteria	1457
180	Ga0070672_100360585	3300005543	Bacteria	1241
181	Ga0070672_101135940	3300005543	Bacteria	695
182	Ga0070686_100025001	3300005544	Bacteria	3586
183	Ga0070695_100682144	3300005545	Bacteria	814
184	Ga0070696_100901475	3300005546	Bacteria	733
185	Ga0070693_100084503	3300005547	Bacteria	1900
186	Ga0070693_100210806	3300005547	Bacteria	1267
187	Ga0070693_100333912	3300005547	Bacteria	1032
188	Ga0070693_100842933	3300005547	Bacteria	683
189	Ga0070665_100053520	3300005548	Bacteria	4048
190	Ga0070665_100066902	3300005548	Bacteria	3604
191	Ga0070665_100105129	3300005548	Bacteria	2825
192	Ga0070665_100159449	3300005548	Bacteria	2258
193	Ga0070665_100348784	3300005548	Bacteria	1485
194	Ga0070665_100455910	3300005548	Bacteria	1288
195	Ga0070665_100548199	3300005548	Bacteria	1168
196	Ga0070665_100702149	3300005548	Bacteria	1025
197	Ga0070665_101282530	3300005548	Bacteria	743
198	Ga0070665_101511353	3300005548	Bacteria	680
199	Ga0070665_102001190	3300005548	Bacteria	584
200	Ga0068855_100061912	3300005563	Bacteria	4370
201	Ga0068855_100179625	3300005563	Bacteria	2393
202	Ga0068855_100218094	3300005563	Bacteria	2141
203	Ga0068855_100251479	3300005563	Bacteria	1971
204	Ga0068855_100263623	3300005563	Bacteria	1918
205	Ga0068855_100369198	3300005563	Bacteria	1578
206	Ga0068855_100421753	3300005563	Bacteria	1459
207	Ga0068855_100561985	3300005563	Bacteria	1234
208	Ga0068855_100765361	3300005563	Bacteria	1029
209	Ga0068855_101070266	3300005563	Bacteria	844
210	Ga0068855_101139451	3300005563	Bacteria	814
211	Ga0068855_101180999	3300005563	Bacteria	796
212	Ga0070664_100129213	3300005564	Bacteria	2218
213	Ga0070664_100225462	3300005564	Bacteria	1678
214	Ga0070664_100383266	3300005564	Bacteria	1284
215	Ga0070664_100527763	3300005564	Bacteria	1090
216	Ga0068857_100025975	3300005577	Bacteria	5158
217	Ga0068857_100098628	3300005577	Bacteria	2621
218	Ga0068857_100135122	3300005577	Bacteria	2226
219	Ga0068857_100418754	3300005577	Bacteria	1249
220	Ga0068857_100466167	3300005577	Bacteria	1182
221	Ga0068857_100479845	3300005577	Bacteria	1165
222	Ga0068854_100084836	3300005578	Bacteria	2344
223	Ga0068854_100168675	3300005578	Bacteria	1701
224	Ga0068854_100202641	3300005578	Bacteria	1561
225	Ga0068854_100344052	3300005578	Bacteria	1219
226	Ga0068854_100351846	3300005578	Bacteria	1206
227	Ga0068854_100381576	3300005578	Bacteria	1161
228	Ga0068854_101240491	3300005578	Bacteria	669
229	Ga0068854_102160257	3300005578	Bacteria	515
230	Ga0068856_100004535	3300005614	Bacteria	13807
231	Ga0068856_100099891	3300005614	Bacteria	2893
232	Ga0068856_100352866	3300005614	Bacteria	1489
233	Ga0068856_100375486	3300005614	Bacteria	1441
234	Ga0068856_100594410	3300005614	Bacteria	1128
235	Ga0068856_100961210	3300005614	Bacteria	873
236	Ga0068856_101910622	3300005614	Bacteria	605
237	Ga0068856_101975991	3300005614	Bacteria	594
238	Ga0068856_101982176	3300005614	Bacteria	593
239	Ga0070702_100081177	3300005615	Bacteria	1943
240	Ga0070702_101275140	3300005615	Bacteria	595
241	Ga0070702_101330554	3300005615	Bacteria	584
242	Ga0068852_100473508	3300005616	Bacteria	1243
243	Ga0068852_101139226	3300005616	Bacteria	801
244	Ga0068852_101601400	3300005616	Bacteria	674
245	Ga0068852_101808131	3300005616	Bacteria	633
246	Ga0068859_102087737	3300005617	Bacteria	626
247	Ga0068859_102670610	3300005617	Bacteria	549
248	Ga0068864_100497225	3300005618	Bacteria	1173
249	Ga0068864_100584355	3300005618	Bacteria	1082
250	Ga0068864_101016283	3300005618	Bacteria	823
251	Ga0068864_101224439	3300005618	Bacteria	750
252	Ga0068864_101393762	3300005618	Bacteria	703
253	Ga0068866_10042977	3300005718	Bacteria	2252
254	Ga0068866_10259854	3300005718	Bacteria	1066
255	Ga0068861_100033886	3300005719	Bacteria	3771
256	Ga0068861_100046280	3300005719	Bacteria	3279
257	Ga0068861_100116632	3300005719	Bacteria	2147
258	Ga0068861_100377436	3300005719	Bacteria	1251
259	Ga0068851_10016737	3300005834	Bacteria	3513
260	Ga0068851_10108107	3300005834	Bacteria	1482
261	Ga0068851_10136633	3300005834	Bacteria	1330
262	Ga0068851_10137591	3300005834	Bacteria	1326
263	Ga0068851_10669491	3300005834	Bacteria	637
264	Ga0068870_10011211	3300005840	Bacteria	4147
265	Ga0068863_100476813	3300005841	Bacteria	1226
266	Ga0068863_100481319	3300005841	Bacteria	1221
267	Ga0068863_100970353	3300005841	Bacteria	852
268	Ga0068858_100022209	3300005842	Bacteria	5925
269	Ga0068858_101015851	3300005842	Bacteria	813
270	Ga0068860_100000146	3300005843	Bacteria	115795
271	Ga0068860_100456772	3300005843	Bacteria	1270
272	Ga0068860_100480401	3300005843	Bacteria	1238
273	Ga0068860_101562543	3300005843	Bacteria	681
274	Ga0068860_101896480	3300005843	Bacteria	618
275	Ga0068862_100252609	3300005844	Bacteria	1607
276	Ga0068862_100395737	3300005844	Bacteria	1291
277	Ga0068862_100560098	3300005844	Bacteria	1092
278	Ga0068862_100661448	3300005844	Bacteria	1008
279	Ga0068862_100725937	3300005844	Bacteria	964
280	Ga0068862_100780659	3300005844	Bacteria	932
281	Ga0081455_10000529	3300005937	Bacteria	49513
282	Ga0081455_10013219	3300005937	Bacteria	8176
283	Ga0081455_10073523	3300005937	Bacteria	2826
284	Ga0081455_10075693	3300005937	Bacteria	2776
285	Ga0081455_10081501	3300005937	Bacteria	2650
286	Ga0081455_10130852	3300005937	Bacteria	1962
287	Ga0081455_10283166	3300005937	Bacteria	1197
288	Ga0081538_10045410	3300005981	Bacteria	2724
289	Ga0081540_1002942	3300005983	Bacteria	13695
290	Ga0081540_1002967	3300005983	Bacteria	13599
291	Ga0081540_1006156	3300005983	Bacteria	8801
292	Ga0081540_1007439	3300005983	Bacteria	7804
293	Ga0081540_1009058	3300005983	Bacteria	6879
294	Ga0081540_1022583	3300005983	Bacteria	3713
295	Ga0081540_1024736	3300005983	Bacteria	3477
296	Ga0081540_1038337	3300005983	Bacteria	2527
297	Ga0081540_1038576	3300005983	Bacteria	2517
298	Ga0081540_1074267	3300005983	Bacteria	1559
299	Ga0081540_1088474	3300005983	Bacteria	1369
300	Ga0081540_1112537	3300005983	Bacteria	1147
301	Ga0081539_10004031	3300005985	Bacteria	16866
302	Ga0081539_10015361	3300005985	Bacteria	5569
303	Ga0070717_10000921	3300006028	Bacteria	19578
304	Ga0070717_10276771	3300006028	Bacteria	1488
305	Ga0070717_11297202	3300006028	Bacteria	662
306	Ga0075365_10013833	3300006038	Bacteria	4841
307	Ga0075365_10065799	3300006038	Bacteria	2430
308	Ga0075365_10075726	3300006038	Bacteria	2272
309	Ga0075365_10104190	3300006038	Bacteria	1945
310	Ga0075365_10260258	3300006038	Bacteria	1220
311	Ga0075365_10514212	3300006038	Bacteria	846
312	Ga0075365_10693333	3300006038	Bacteria	719
313	Ga0075368_10025298	3300006042	Bacteria	2277
314	Ga0075368_10043426	3300006042	Bacteria	1771
315	Ga0075368_10241406	3300006042	Bacteria	770
316	Ga0075363_100080105	3300006048	Bacteria	1785
317	Ga0075363_100120395	3300006048	Bacteria	1465
318	Ga0075363_100303111	3300006048	Bacteria	927
319	Ga0075364_10082015	3300006051	Bacteria	2133
320	Ga0075364_10193897	3300006051	Bacteria	1376
321	Ga0075364_10482470	3300006051	Bacteria	847
322	Ga0075432_10056253	3300006058	Bacteria	1395
323	Ga0070715_10086346	3300006163	Bacteria	1434
324	Ga0070715_10279832	3300006163	Bacteria	884
325	Ga0070715_10658342	3300006163	Bacteria	621
326	Ga0070716_100126406	3300006173	Bacteria	1609
327	Ga0070716_100584041	3300006173	Bacteria	838
328	Ga0070716_101265472	3300006173	Bacteria	595
329	Ga0070712_100108184	3300006175	Bacteria	2070
330	Ga0070712_101182445	3300006175	Bacteria	665
331	Ga0070712_101475599	3300006175	Bacteria	594
332	Ga0070712_101854768	3300006175	Bacteria	528
333	Ga0070712_101859744	3300006175	Bacteria	527
334	Ga0075362_10058080	3300006177	Bacteria	1745
335	Ga0075362_10110902	3300006177	Bacteria	1291
336	Ga0075362_10478679	3300006177	Bacteria	635
337	Ga0075367_10009454	3300006178	Bacteria	5096
338	Ga0075367_10259138	3300006178	Bacteria	1091
339	Ga0075367_10266676	3300006178	Bacteria	1075
340	Ga0075367_10710167	3300006178	Bacteria	639
341	Ga0075369_10099206	3300006186	Bacteria	1305
342	Ga0075369_10355689	3300006186	Bacteria	687
343	Ga0075369_10395072	3300006186	Bacteria	651
344	Ga0075369_10431979	3300006186	Bacteria	623
345	Ga0075427_10016075	3300006194	Bacteria	1160
346	Ga0075366_10044842	3300006195	Bacteria	2621
347	Ga0075366_10055840	3300006195	Bacteria	2345
348	Ga0075366_10184265	3300006195	Bacteria	1268
349	Ga0075366_10221856	3300006195	Bacteria	1152
350	Ga0075366_10386656	3300006195	Bacteria	861
351	Ga0075366_10397054	3300006195	Bacteria	849
352	Ga0097621_100067295	3300006237	Bacteria	2952
353	Ga0097621_100311525	3300006237	Bacteria	1392
354	Ga0097621_100358425	3300006237	Bacteria	1298
355	Ga0097621_100686832	3300006237	Bacteria	941
356	Ga0097621_100746575	3300006237	Bacteria	904
357	Ga0097621_101375683	3300006237	Bacteria	668
358	Ga0075370_10022767	3300006353	Bacteria	3444
359	Ga0075370_10087891	3300006353	Bacteria	1791
360	Ga0075370_10179809	3300006353	Bacteria	1244
361	Ga0075370_10435306	3300006353	Bacteria	788
362	Ga0068871_100099400	3300006358	Bacteria	2435
363	Ga0068871_100568288	3300006358	Bacteria	1028
364	Ga0068871_100658259	3300006358	Bacteria	957
365	Ga0068871_100667875	3300006358	Bacteria	950
366	Ga0068871_100908200	3300006358	Bacteria	816
367	Ga0068871_101086175	3300006358	Bacteria	748
368	Ga0068871_102013661	3300006358	Bacteria	550
369	Ga0075428_101475349	3300006844	Bacteria	713
370	Ga0075428_102301280	3300006844	Bacteria	555
371	Ga0075434_100036748	3300006871	Bacteria	4845
372	Ga0075434_100110045	3300006871	Bacteria	2765
373	Ga0075434_100173018	3300006871	Bacteria	2179
374	Ga0075434_100624093	3300006871	Bacteria	1097
375	Ga0068865_100035229	3300006881	Bacteria	3364
376	Ga0068865_100125321	3300006881	Bacteria	1916
377	Ga0068865_101100856	3300006881	Bacteria	700
378	Ga0068865_101433524	3300006881	Bacteria	617
379	Ga0075436_100137780	3300006914	Bacteria	1714
380	Ga0075436_100723849	3300006914	Bacteria	738
381	Ga0075436_101537619	3300006914	Bacteria	506
382	Ga0097620_102087601	3300006931	Bacteria	626
383	Ga0097620_102671569	3300006931	Bacteria	549
384	Ga0099825_1060993	3300006941	Bacteria	645
385	Ga0099824_1005353	3300006942	Bacteria	18102
386	Ga0099822_1005965	3300006943	Bacteria	15904
387	Ga0075435_100070342	3300007076	Bacteria	2856
388	Ga0099794_10012126	3300007265	Bacteria	3708
389	Ga0099794_10012643	3300007265	Bacteria	3650
390	Ga0099795_10151098	3300007788	Bacteria	951
391	Ga0099795_10302781	3300007788	Bacteria	703
392	Ga0099795_10309636	3300007788	Bacteria	697
393	Ga0105244_10143608	3300009036	Bacteria	1146
394	Ga0105250_10044464	3300009092	Bacteria	1781
395	Ga0105240_10003165	3300009093	Bacteria	25878
396	Ga0105240_10018737	3300009093	Bacteria	9274
397	Ga0105240_10027144	3300009093	Bacteria	7501
398	Ga0105240_10305384	3300009093	Bacteria	1819
399	Ga0105240_10343866	3300009093	Bacteria	1694
400	Ga0105240_10346986	3300009093	Bacteria	1685
401	Ga0105240_10886902	3300009093	Bacteria	960
402	Ga0111539_10075408	3300009094	Bacteria	3973
403	Ga0111539_10463630	3300009094	Bacteria	1475
404	Ga0111539_10785760	3300009094	Bacteria	1108
405	Ga0111539_11276182	3300009094	Bacteria	852
406	Ga0105245_10018561	3300009098	Bacteria	6083
407	Ga0105245_10066825	3300009098	Bacteria	3255
408	Ga0105245_10125549	3300009098	Bacteria	2402
409	Ga0105245_10252785	3300009098	Bacteria	1713
410	Ga0105245_10268179	3300009098	Bacteria	1664
411	Ga0105245_10310050	3300009098	Bacteria	1551
412	Ga0105245_10588195	3300009098	Bacteria	1138
413	Ga0105245_12764411	3300009098	Bacteria	544
414	Ga0105247_10032579	3300009101	Bacteria	3166
415	Ga0105247_10079257	3300009101	Bacteria	2067
416	Ga0105247_10305606	3300009101	Bacteria	1105
417	Ga0105247_10542351	3300009101	Bacteria	854
418	Ga0105247_10898542	3300009101	Bacteria	684
419	Ga0105247_11005341	3300009101	Bacteria	651
420	Ga0105247_11241426	3300009101	Bacteria	595
421	Ga0105247_11675898	3300009101	Bacteria	525
422	Ga0114129_10169760	3300009147	Bacteria	2975
423	Ga0114129_10561499	3300009147	Bacteria	1483
424	Ga0105243_10199563	3300009148	Bacteria	1753
425	Ga0105243_10383577	3300009148	Bacteria	1301
426	Ga0105243_10529704	3300009148	Bacteria	1122
427	Ga0105243_11472117	3300009148	Bacteria	704
428	Ga0105241_10027977	3300009174	Bacteria	4198
429	Ga0105241_10060985	3300009174	Bacteria	2903
430	Ga0105241_10119038	3300009174	Bacteria	2124
431	Ga0105241_10132401	3300009174	Bacteria	2021
432	Ga0105241_10182560	3300009174	Bacteria	1741
433	Ga0105241_10632019	3300009174	Bacteria	970
434	Ga0105241_10751590	3300009174	Bacteria	894
435	Ga0105241_12159047	3300009174	Bacteria	551
436	Ga0105241_12539719	3300009174	Bacteria	514
437	Ga0105242_10111139	3300009176	Bacteria	2336
438	Ga0105242_10460772	3300009176	Bacteria	1200
439	Ga0105242_10627210	3300009176	Bacteria	1042
440	Ga0105242_12587130	3300009176	Bacteria	556
441	Ga0105242_12589534	3300009176	Bacteria	556
442	Ga0105242_13148728	3300009176	Bacteria	512
443	Ga0105248_10212071	3300009177	Bacteria	2182
444	Ga0105248_10422548	3300009177	Bacteria	1501
445	Ga0105248_10619948	3300009177	Bacteria	1220
446	Ga0105248_11069516	3300009177	Bacteria	912
447	Ga0105248_11199457	3300009177	Bacteria	858
448	Ga0105248_12608258	3300009177	Bacteria	576
449	Ga0105237_10009523	3300009545	Bacteria	10402
450	Ga0105237_10012128	3300009545	Bacteria	9092
451	Ga0105237_10048342	3300009545	Bacteria	4276
452	Ga0105237_10106312	3300009545	Bacteria	2798
453	Ga0105237_10122720	3300009545	Bacteria	2592
454	Ga0105237_10174523	3300009545	Bacteria	2150
455	Ga0105237_10308382	3300009545	Bacteria	1586
456	Ga0105237_10459581	3300009545	Bacteria	1279
457	Ga0105237_10567082	3300009545	Bacteria	1142
458	Ga0105237_10876524	3300009545	Bacteria	904
459	Ga0105237_11521222	3300009545	Bacteria	676
460	Ga0105238_10000447	3300009551	Bacteria	43279
461	Ga0105238_10035341	3300009551	Bacteria	5081
462	Ga0105238_10265590	3300009551	Bacteria	1696
463	Ga0105238_10298178	3300009551	Bacteria	1595
464	Ga0105238_10345513	3300009551	Bacteria	1476
465	Ga0105238_10390487	3300009551	Bacteria	1384
466	Ga0105238_10489318	3300009551	Bacteria	1230
467	Ga0105238_10683279	3300009551	Bacteria	1038
468	Ga0105238_12902910	3300009551	Bacteria	515
469	Ga0105238_12912137	3300009551	Bacteria	515
470	Ga0105249_10229348	3300009553	Bacteria	1831
471	Ga0105249_10364172	3300009553	Bacteria	1468
472	Ga0105249_10418611	3300009553	Bacteria	1373
473	Ga0105249_11476154	3300009553	Bacteria	752
474	Ga0105249_11652514	3300009553	Bacteria	713
475	Ga0105249_11911191	3300009553	Bacteria	666
476	Ga0105249_12971832	3300009553	Bacteria	544
477	Ga0099796_10105265	3300010159	Bacteria	1067
478	Ga0099796_10118145	3300010159	Bacteria	1016
479	Ga0105239_10050599	3300010375	Bacteria	4557
480	Ga0105239_10130442	3300010375	Bacteria	2795
481	Ga0105239_10149437	3300010375	Bacteria	2607
482	Ga0105239_10170738	3300010375	Bacteria	2432
483	Ga0105239_10217656	3300010375	Bacteria	2141
484	Ga0105239_10964807	3300010375	Bacteria	980
485	Ga0105239_11355814	3300010375	Bacteria	821
486	Ga0105239_11371643	3300010375	Bacteria	816
487	Ga0105239_12702724	3300010375	Bacteria	579
488	Ga0105239_12748230	3300010375	Bacteria	574
489	Ga0105246_10008520	3300011119	Bacteria	6306
490	Ga0105246_10018685	3300011119	Bacteria	4419
491	Ga0105246_10097570	3300011119	Bacteria	2133
492	Ga0105246_10133357	3300011119	Bacteria	1858
493	Ga0105246_10330042	3300011119	Bacteria	1243
494	Ga0105246_10452483	3300011119	Bacteria	1079
495	Ga0105246_10589879	3300011119	Bacteria	958
496	Ga0105246_10926253	3300011119	Bacteria	783
497	Ga0105246_11031000	3300011119	Bacteria	747
498	Ga0157343_1007325	3300012488	Bacteria	768
499	Ga0157326_1098571	3300012513	Bacteria	502
500	Ga0157373_10420053	3300013100	Bacteria	960
501	Ga0157373_10423855	3300013100	Bacteria	955
502	Ga0157371_10060775	3300013102	Bacteria	2679
503	Ga0157371_10350573	3300013102	Bacteria	1074
504	Ga0157371_10974399	3300013102	Bacteria	646
505	Ga0157371_11364815	3300013102	Bacteria	550
506	Ga0157370_10074879	3300013104	Bacteria	3193
507	Ga0157370_10100708	3300013104	Bacteria	2707
508	Ga0157370_10321501	3300013104	Bacteria	1427
509	Ga0157370_10392468	3300013104	Bacteria	1278
510	Ga0157370_11802462	3300013104	Bacteria	549
511	Ga0157369_10107769	3300013105	Bacteria	2963
512	Ga0157369_10145551	3300013105	Bacteria	2505
513	Ga0157369_10159564	3300013105	Bacteria	2380
514	Ga0157369_10279615	3300013105	Bacteria	1738
515	Ga0157369_10361197	3300013105	Bacteria	1508
516	Ga0157369_10466780	3300013105	Bacteria	1307
517	Ga0157369_11317386	3300013105	Bacteria	736
518	Ga0157374_10043515	3300013296	Bacteria	4149
519	Ga0157374_10219358	3300013296	Bacteria	1866
520	Ga0157374_10239206	3300013296	Bacteria	1785
521	Ga0157374_10414859	3300013296	Bacteria	1344
522	Ga0157374_11293161	3300013296	Bacteria	751
523	Ga0157374_11752113	3300013296	Bacteria	646
524	Ga0157374_11831842	3300013296	Bacteria	632
525	Ga0157378_10003984	3300013297	Bacteria	13051
526	Ga0157378_10370241	3300013297	Bacteria	1404
527	Ga0157378_10676448	3300013297	Bacteria	1050
528	Ga0157378_11013000	3300013297	Bacteria	865
529	Ga0157378_11119527	3300013297	Bacteria	825
530	Ga0157378_12106905	3300013297	Bacteria	615
531	Ga0157378_12820798	3300013297	Bacteria	538
532	Ga0157378_12883139	3300013297	Bacteria	533
533	Ga0163162_10147490	3300013306	Bacteria	2469
534	Ga0163162_10155123	3300013306	Bacteria	2409
535	Ga0163162_10201812	3300013306	Bacteria	2117
536	Ga0163162_10792556	3300013306	Bacteria	1065
537	Ga0163162_11086176	3300013306	Bacteria	906
538	Ga0163162_11477187	3300013306	Bacteria	774
539	Ga0163162_12172697	3300013306	Bacteria	637
540	Ga0163162_12417781	3300013306	Bacteria	604
541	Ga0157372_10336472	3300013307	Bacteria	1758
542	Ga0157372_10607595	3300013307	Bacteria	1275
543	Ga0157372_10643952	3300013307	Bacteria	1234
544	Ga0157372_10795056	3300013307	Bacteria	1099
545	Ga0157372_10932646	3300013307	Bacteria	1007
546	Ga0157372_11469974	3300013307	Bacteria	785
547	Ga0157372_11576285	3300013307	Bacteria	756
548	Ga0157372_11754711	3300013307	Bacteria	714
549	Ga0157375_10008110	3300013308	Bacteria	9190
550	Ga0157375_10312757	3300013308	Bacteria	1735
551	Ga0157375_10320726	3300013308	Bacteria	1714
552	Ga0157375_11241893	3300013308	Bacteria	875
553	Ga0157375_11285854	3300013308	Bacteria	860
554	Ga0157375_11504098	3300013308	Bacteria	795
555	Ga0163163_10021545	3300014325	Bacteria	6084
556	Ga0163163_10165902	3300014325	Bacteria	2254
557	Ga0163163_10270683	3300014325	Bacteria	1750
558	Ga0163163_10289990	3300014325	Bacteria	1688
559	Ga0163163_10378096	3300014325	Bacteria	1474
560	Ga0163163_11893374	3300014325	Bacteria	656
561	Ga0157380_10126730	3300014326	Bacteria	2171
562	Ga0157380_10813657	3300014326	Bacteria	952
563	Ga0157380_11102945	3300014326	Bacteria	833
564	Ga0157380_11317773	3300014326	Bacteria	770
565	Ga0157380_11697646	3300014326	Bacteria	689
566	Ga0157380_12794160	3300014326	Bacteria	555
567	Ga0157377_10095022	3300014745	Bacteria	1766
568	Ga0157377_11290203	3300014745	Bacteria	570
569	Ga0157379_10060017	3300014968	Bacteria	3400
570	Ga0157379_10345507	3300014968	Bacteria	1361
571	Ga0157379_10547555	3300014968	Bacteria	1076
572	Ga0157379_10603654	3300014968	Bacteria	1025
573	Ga0157379_10687514	3300014968	Bacteria	960
574	Ga0157376_10012433	3300014969	Bacteria	6319
575	Ga0157376_10517081	3300014969	Bacteria	1176
576	Ga0157376_10926506	3300014969	Bacteria	891
577	Ga0157376_11069929	3300014969	Bacteria	831
578	Ga0157376_11089240	3300014969	Bacteria	824
579	Ga0157376_11171651	3300014969	Bacteria	796
580	Ga0157376_11648658	3300014969	Bacteria	676
581	Ga0157376_11836384	3300014969	Bacteria	642
582	Ga0182007_10215541	3300015262	Bacteria	676
583	Ga0163161_10478050	3300017792	Bacteria	1011
584	Ga0163161_10778149	3300017792	Bacteria	803
585	Ga0163161_12007981	3300017792	Bacteria	514
586	Ga0213872_10469388	3300021361	Bacteria	504
587	Ga0213875_10035002	3300021388	Bacteria	2370
588	Ga0228598_1088149	3300024227	Bacteria	624
589	Ga0209148_1015873	3300025254	Bacteria	1306
590	Ga0209233_1001681	3300025261	Bacteria	8594
591	Ga0209455_1006173	3300025272	Bacteria	3579
592	Ga0209758_1001166	3300025297	Bacteria	33385
593	Ga0209758_1005243	3300025297	Bacteria	10150
594	Ga0209758_1032735	3300025297	Bacteria	2104
595	Ga0207426_1001672	3300025302	Bacteria	17176
596	Ga0209257_1009448	3300025304	Bacteria	5216
597	Ga0207697_10261974	3300025315	Bacteria	765
598	Ga0207656_10003095	3300025321	Bacteria	5694
599	Ga0207656_10003494	3300025321	Bacteria	5408
600	Ga0207656_10022668	3300025321	Bacteria	2522
601	Ga0207656_10728128	3300025321	Bacteria	508
602	Ga0207696_1141725	3300025711	Bacteria	644
603	Ga0207653_10076410	3300025885	Bacteria	1152
604	Ga0207682_10137169	3300025893	Bacteria	1096
605	Ga0207692_10308138	3300025898	Bacteria	966
606	Ga0207692_10584920	3300025898	Bacteria	716
607	Ga0207642_10093247	3300025899	Bacteria	1493
608	Ga0207642_10595401	3300025899	Bacteria	687
609	Ga0207710_10144305	3300025900	Bacteria	1151
610	Ga0207688_10057085	3300025901	Bacteria	2194
611	Ga0207688_10058990	3300025901	Bacteria	2160
612	Ga0207688_10318249	3300025901	Bacteria	954
613	Ga0207688_10338561	3300025901	Bacteria	925
614	Ga0207688_10539861	3300025901	Bacteria	732
615	Ga0207680_10595797	3300025903	Bacteria	790
616	Ga0207680_11072500	3300025903	Bacteria	576
617	Ga0207647_10016797	3300025904	Bacteria	4987
618	Ga0207647_10150706	3300025904	Bacteria	1359
619	Ga0207647_10181958	3300025904	Bacteria	1220
620	Ga0207647_10574995	3300025904	Unclassified	623
621	Ga0207647_10577391	3300025904	Bacteria	622
622	Ga0207685_10332980	3300025905	Bacteria	760
623	Ga0207685_10548030	3300025905	Bacteria	615
624	Ga0207699_10011077	3300025906	Bacteria	4544
625	Ga0207699_10024245	3300025906	Bacteria	3315
626	Ga0207699_10357201	3300025906	Bacteria	1032
627	Ga0207699_10404138	3300025906	Bacteria	973
628	Ga0207645_10119278	3300025907	Bacteria	1712
629	Ga0207645_10687172	3300025907	Bacteria	695
630	Ga0207643_10058441	3300025908	Bacteria	2198
631	Ga0207643_10361393	3300025908	Bacteria	913
632	Ga0207643_10497886	3300025908	Bacteria	779
633	Ga0207705_10056903	3300025909	Bacteria	2821
634	Ga0207705_10142649	3300025909	Bacteria	1790
635	Ga0207705_10182940	3300025909	Bacteria	1582
636	Ga0207705_10402408	3300025909	Bacteria	1059
637	Ga0207705_10460791	3300025909	Bacteria	986
638	Ga0207705_11375741	3300025909	Bacteria	537
639	Ga0207684_10154329	3300025910	Bacteria	1976
640	Ga0207684_10341231	3300025910	Bacteria	1290
641	Ga0207684_10492569	3300025910	Bacteria	1051
642	Ga0207684_10543042	3300025910	Bacteria	995
643	Ga0207654_10003520	3300025911	Bacteria	7922
644	Ga0207654_10118440	3300025911	Bacteria	1659
645	Ga0207654_10674735	3300025911	Bacteria	741
646	Ga0207707_10000866	3300025912	Bacteria	29597
647	Ga0207707_10002523	3300025912	Bacteria	16449
648	Ga0207707_10006058	3300025912	Bacteria	10580
649	Ga0207707_10059926	3300025912	Bacteria	3311
650	Ga0207707_10312276	3300025912	Bacteria	1358
651	Ga0207707_10401597	3300025912	Bacteria	1176
652	Ga0207695_10000479	3300025913	Bacteria	85874
653	Ga0207695_10028298	3300025913	Bacteria	6220
654	Ga0207695_10065818	3300025913	Bacteria	3725
655	Ga0207695_10338093	3300025913	Bacteria	1394
656	Ga0207671_10010105	3300025914	Bacteria	7823
657	Ga0207671_10041067	3300025914	Bacteria	3423
658	Ga0207671_10065596	3300025914	Bacteria	2701
659	Ga0207671_10091549	3300025914	Bacteria	2292
660	Ga0207671_10338048	3300025914	Bacteria	1193
661	Ga0207671_10472914	3300025914	Bacteria	999
662	Ga0207671_10687991	3300025914	Bacteria	814
663	Ga0207671_10745544	3300025914	Bacteria	778
664	Ga0207693_10064099	3300025915	Bacteria	2879
665	Ga0207693_10491067	3300025915	Bacteria	959
666	Ga0207660_10017571	3300025917	Bacteria	4755
667	Ga0207660_10059485	3300025917	Bacteria	2743
668	Ga0207660_10060401	3300025917	Bacteria	2725
669	Ga0207660_10091273	3300025917	Bacteria	2258
670	Ga0207660_10094774	3300025917	Bacteria	2219
671	Ga0207660_10134578	3300025917	Bacteria	1884
672	Ga0207660_11277078	3300025917	Bacteria	596
673	Ga0207662_10129552	3300025918	Bacteria	1589
674	Ga0207657_10002309	3300025919	Bacteria	20677
675	Ga0207657_10085616	3300025919	Bacteria	2640
676	Ga0207657_10115247	3300025919	Bacteria	2215
677	Ga0207657_10136778	3300025919	Bacteria	2004
678	Ga0207657_10153168	3300025919	Bacteria	1876
679	Ga0207657_10191190	3300025919	Bacteria	1651
680	Ga0207657_10665091	3300025919	Bacteria	810
681	Ga0207657_11168370	3300025919	Bacteria	586
682	Ga0207649_10153588	3300025920	Bacteria	1588
683	Ga0207649_10172568	3300025920	Bacteria	1507
684	Ga0207649_10744570	3300025920	Bacteria	762
685	Ga0207652_10004639	3300025921	Bacteria	11139
686	Ga0207652_10049471	3300025921	Bacteria	3598
687	Ga0207652_10095389	3300025921	Bacteria	2620
688	Ga0207652_10140459	3300025921	Bacteria	2159
689	Ga0207652_10274271	3300025921	Bacteria	1521
690	Ga0207652_11097949	3300025921	Bacteria	696
691	Ga0207646_10027132	3300025922	Bacteria	5223
692	Ga0207646_10711377	3300025922	Bacteria	898
693	Ga0207646_11037899	3300025922	Bacteria	723
694	Ga0207681_10189538	3300025923	Bacteria	1572
695	Ga0207681_10918620	3300025923	Bacteria	733
696	Ga0207681_11006462	3300025923	Bacteria	699
697	Ga0207694_10000972	3300025924	Bacteria	25181
698	Ga0207694_10026818	3300025924	Bacteria	4387
699	Ga0207694_10083118	3300025924	Bacteria	2518
700	Ga0207694_10215039	3300025924	Bacteria	1567
701	Ga0207694_10609594	3300025924	Bacteria	918
702	Ga0207694_11385481	3300025924	Bacteria	594
703	Ga0207650_10486084	3300025925	Bacteria	1030
704	Ga0207659_10117737	3300025926	Bacteria	2031
705	Ga0207687_10033918	3300025927	Bacteria	3464
706	Ga0207687_10224989	3300025927	Bacteria	1479
707	Ga0207687_10259581	3300025927	Bacteria	1385
708	Ga0207687_10396031	3300025927	Bacteria	1135
709	Ga0207700_10095435	3300025928	Bacteria	2359
710	Ga0207700_10742026	3300025928	Bacteria	877
711	Ga0207664_10251897	3300025929	Bacteria	1541
712	Ga0207664_10334980	3300025929	Bacteria	1337
713	Ga0207664_11008957	3300025929	Bacteria	746
714	Ga0207644_10451677	3300025931	Bacteria	1056
715	Ga0207644_10489432	3300025931	Bacteria	1014
716	Ga0207644_10610905	3300025931	Bacteria	906
717	Ga0207644_10845112	3300025931	Bacteria	766
718	Ga0207644_11267227	3300025931	Bacteria	620
719	Ga0207690_10363788	3300025932	Bacteria	1146
720	Ga0207690_10736649	3300025932	Bacteria	812
721	Ga0207690_10743672	3300025932	Bacteria	808
722	Ga0207690_11637937	3300025932	Bacteria	538
723	Ga0207690_11652298	3300025932	Bacteria	535
724	Ga0207706_10082423	3300025933	Bacteria	2827
725	Ga0207706_10120397	3300025933	Bacteria	2308
726	Ga0207706_10120620	3300025933	Bacteria	2305
727	Ga0207706_10649332	3300025933	Bacteria	904
728	Ga0207686_10309490	3300025934	Bacteria	1176
729	Ga0207686_10368117	3300025934	Bacteria	1087
730	Ga0207686_10666532	3300025934	Bacteria	824
731	Ga0207686_10997057	3300025934	Bacteria	680
732	Ga0207686_11040690	3300025934	Bacteria	666
733	Ga0207709_10165542	3300025935	Bacteria	1546
734	Ga0207709_10588571	3300025935	Bacteria	880
735	Ga0207709_11554097	3300025935	Bacteria	549
736	Ga0207670_11452574	3300025936	Bacteria	583
737	Ga0207669_10020620	3300025937	Bacteria	3461
738	Ga0207669_10354862	3300025937	Bacteria	1134
739	Ga0207669_10446178	3300025937	Bacteria	1024
740	Ga0207704_10450242	3300025938	Bacteria	1027
741	Ga0207704_10785012	3300025938	Bacteria	794
742	Ga0207704_11376677	3300025938	Bacteria	604
743	Ga0207665_10205233	3300025939	Bacteria	1437
744	Ga0207665_10996541	3300025939	Bacteria	666
745	Ga0207665_11602792	3300025939	Bacteria	516
746	Ga0207691_10188677	3300025940	Bacteria	1799
747	Ga0207691_10538846	3300025940	Bacteria	990
748	Ga0207691_11492534	3300025940	Bacteria	553
749	Ga0207711_10408973	3300025941	Bacteria	1261
750	Ga0207711_10543384	3300025941	Bacteria	1084
751	Ga0207711_10652628	3300025941	Bacteria	982
752	Ga0207711_11240090	3300025941	Bacteria	687
753	Ga0207689_10626724	3300025942	Bacteria	905
754	Ga0207689_10805006	3300025942	Bacteria	793
755	Ga0207661_10023539	3300025944	Bacteria	4655
756	Ga0207661_10490279	3300025944	Bacteria	1122
757	Ga0207661_11459596	3300025944	Bacteria	627
758	Ga0207661_11545995	3300025944	Bacteria	608
759	Ga0207679_10048943	3300025945	Bacteria	3080
760	Ga0207679_10296581	3300025945	Bacteria	1392
761	Ga0207679_10330832	3300025945	Bacteria	1322
762	Ga0207679_10371440	3300025945	Bacteria	1252
763	Ga0207679_10643392	3300025945	Bacteria	958
764	Ga0207667_10008731	3300025949	Bacteria	12011
765	Ga0207667_10018900	3300025949	Bacteria	7708
766	Ga0207667_10049911	3300025949	Bacteria	4416
767	Ga0207667_10100081	3300025949	Bacteria	2990
768	Ga0207667_10166889	3300025949	Bacteria	2263
769	Ga0207667_10181801	3300025949	Bacteria	2159
770	Ga0207667_10392909	3300025949	Bacteria	1412
771	Ga0207667_11262070	3300025949	Bacteria	716
772	Ga0207651_10047457	3300025960	Bacteria	2896
773	Ga0207651_10540347	3300025960	Bacteria	1012
774	Ga0207712_10384335	3300025961	Bacteria	1176
775	Ga0207712_11034311	3300025961	Bacteria	730
776	Ga0207712_11772923	3300025961	Bacteria	553
777	Ga0207668_10057151	3300025972	Bacteria	2720
778	Ga0207668_10918873	3300025972	Bacteria	779
779	Ga0207668_11044471	3300025972	Bacteria	731
780	Ga0207668_11266607	3300025972	Bacteria	663
781	Ga0207668_11696429	3300025972	Bacteria	570
782	Ga0207668_11812662	3300025972	Bacteria	550
783	Ga0207640_10021769	3300025981	Bacteria	3826
784	Ga0207640_10224821	3300025981	Bacteria	1439
785	Ga0207640_10290053	3300025981	Bacteria	1290
786	Ga0207640_10373215	3300025981	Bacteria	1153
787	Ga0207640_10460440	3300025981	Bacteria	1050
788	Ga0207640_12090405	3300025981	Bacteria	513
789	Ga0207658_10699096	3300025986	Bacteria	916
790	Ga0207658_11923288	3300025986	Bacteria	539
791	Ga0207677_10653496	3300026023	Bacteria	928
792	Ga0207677_10948449	3300026023	Bacteria	778
793	Ga0207677_11001425	3300026023	Bacteria	758
794	Ga0207677_11305181	3300026023	Bacteria	667
795	Ga0207677_11426968	3300026023	Bacteria	638
796	Ga0207703_10072874	3300026035	Bacteria	2840
797	Ga0207703_10123796	3300026035	Bacteria	2223
798	Ga0207703_10352301	3300026035	Bacteria	1356
799	Ga0207703_10775178	3300026035	Unclassified	914
800	Ga0207703_11653921	3300026035	Bacteria	616
801	Ga0207639_10023231	3300026041	Bacteria	4476
802	Ga0207639_10029890	3300026041	Bacteria	3993
803	Ga0207639_10098259	3300026041	Bacteria	2359
804	Ga0207639_10145854	3300026041	Bacteria	1977
805	Ga0207639_10265129	3300026041	Bacteria	1504
806	Ga0207639_10427153	3300026041	Bacteria	1199
807	Ga0207639_10608145	3300026041	Bacteria	1008
808	Ga0207639_10890560	3300026041	Bacteria	832
809	Ga0207639_10944865	3300026041	Bacteria	807
810	Ga0207678_10043944	3300026067	Bacteria	3866
811	Ga0207678_10058466	3300026067	Bacteria	3318
812	Ga0207678_10096456	3300026067	Bacteria	2527
813	Ga0207678_10110505	3300026067	Bacteria	2345
814	Ga0207678_10192034	3300026067	Bacteria	1745
815	Ga0207678_10274158	3300026067	Bacteria	1447
816	Ga0207678_10285171	3300026067	Bacteria	1418
817	Ga0207678_10324005	3300026067	Bacteria	1326
818	Ga0207678_10722619	3300026067	Bacteria	877
819	Ga0207678_11045223	3300026067	Bacteria	723
820	Ga0207678_11089571	3300026067	Bacteria	707
821	Ga0207678_11276580	3300026067	Bacteria	650
822	Ga0207678_11595670	3300026067	Bacteria	575
823	Ga0207708_10342079	3300026075	Bacteria	1225
824	Ga0207708_11269831	3300026075	Bacteria	645
825	Ga0207702_10000004	3300026078	Bacteria	422182
826	Ga0207702_10343421	3300026078	Bacteria	1426
827	Ga0207702_10761322	3300026078	Bacteria	956
828	Ga0207702_11032502	3300026078	Bacteria	816
829	Ga0207702_11461112	3300026078	Bacteria	677
830	Ga0207702_11865808	3300026078	Bacteria	592
831	Ga0207641_10128963	3300026088	Bacteria	2268
832	Ga0207641_11838433	3300026088	Bacteria	607
833	Ga0207648_10073823	3300026089	Bacteria	2972
834	Ga0207648_10253850	3300026089	Bacteria	1568
835	Ga0207648_10519163	3300026089	Bacteria	1091
836	Ga0207648_11524769	3300026089	Bacteria	628
837	Ga0207648_11549511	3300026089	Bacteria	623
838	Ga0207676_10132084	3300026095	Bacteria	2124
839	Ga0207676_11482888	3300026095	Bacteria	675
840	Ga0207674_10004148	3300026116	Bacteria	17521
841	Ga0207674_10038907	3300026116	Bacteria	4933
842	Ga0207674_10057093	3300026116	Bacteria	3958
843	Ga0207674_10062158	3300026116	Bacteria	3772
844	Ga0207674_10124947	3300026116	Bacteria	2539
845	Ga0207674_10269511	3300026116	Bacteria	1650
846	Ga0207674_12179883	3300026116	Bacteria	517
847	Ga0207675_100028704	3300026118	Bacteria	5182
848	Ga0207675_100092714	3300026118	Bacteria	2841
849	Ga0207675_100144490	3300026118	Bacteria	2261
850	Ga0207683_10049215	3300026121	Bacteria	3690
851	Ga0207683_10052988	3300026121	Bacteria	3556
852	Ga0207683_10378075	3300026121	Bacteria	1302
853	Ga0207683_10537718	3300026121	Bacteria	1080
854	Ga0207683_10655978	3300026121	Bacteria	972
855	Ga0207683_11046809	3300026121	Bacteria	757
856	Ga0207683_11479640	3300026121	Bacteria	627
857	Ga0207698_10223269	3300026142	Bacteria	1704
858	Ga0207698_11269844	3300026142	Bacteria	751
859	Ga0207698_11603407	3300026142	Bacteria	666
860	Ga0207698_12202340	3300026142	Bacteria	564
861	Ga0207698_12435864	3300026142	Bacteria	534
862	Ga0209589_1000631	3300027357	Bacteria	51103
863	Ga0209489_101293	3300027361	Bacteria	51103
864	Ga0209700_101306	3300027363	Bacteria	51103
865	Ga0209179_1013088	3300027512	Bacteria	1501
866	Ga0209588_1004454	3300027671	Bacteria	3949
867	Ga0209813_10343145	3300027866	Bacteria	590
868	Ga0209813_10458033	3300027866	Bacteria	523
869	Ga0207428_10125785	3300027907	Bacteria	1963
870	Ga0207428_10169435	3300027907	Bacteria	1654
871	Ga0207428_10490388	3300027907	Bacteria	893
872	Ga0268266_10004734	3300028379	Bacteria	12936
873	Ga0268266_10015035	3300028379	Bacteria	6644
874	Ga0268266_10042105	3300028379	Bacteria	3899
875	Ga0268266_10148457	3300028379	Bacteria	2110
876	Ga0268266_10183193	3300028379	Bacteria	1908
877	Ga0268266_10300790	3300028379	Bacteria	1496
878	Ga0268266_10489580	3300028379	Bacteria	1173
879	Ga0268266_10555303	3300028379	Bacteria	1100
880	Ga0268266_10615915	3300028379	Bacteria	1043
881	Ga0268266_11248602	3300028379	Bacteria	718
882	Ga0268266_12295989	3300028379	Bacteria	511
883	Ga0268265_10014189	3300028380	Bacteria	5427
884	Ga0268265_10023668	3300028380	Bacteria	4333
885	Ga0268265_10155908	3300028380	Bacteria	1932
886	Ga0268265_10496625	3300028380	Bacteria	1149
887	Ga0268265_10695778	3300028380	Bacteria	981
888	Ga0268265_11016429	3300028380	Bacteria	819
889	Ga0268264_10000227	3300028381	Bacteria	109454
890	Ga0268264_10393045	3300028381	Bacteria	1331
891	Ga0265334_10042837	3300028573	Bacteria	1763
892	Ga0307517_10000495	3300028786	Bacteria	67515
893	Ga0307517_10336332	3300028786	Bacteria	827
894	Ga0307515_10082194	3300028794	Bacteria	4171
895	Ga0307511_10030128	3300030521	Bacteria	4881
896	Ga0307511_10352791	3300030521	Bacteria	631
897	Ga0265762_1027850	3300030760	Bacteria	1062
898	Ga0265330_10025239	3300031235	Bacteria	2695
899	Ga0265330_10030261	3300031235	Bacteria	2432
900	Ga0265330_10052303	3300031235	Bacteria	1789
901	Ga0265330_10466288	3300031235	Bacteria	536
902	Ga0265332_10004631	3300031238	Bacteria	6431
903	Ga0265332_10047785	3300031238	Bacteria	1841
904	Ga0265328_10045444	3300031239	Bacteria	1615
905	Ga0265328_10063250	3300031239	Bacteria	1359
906	Ga0265325_10038995	3300031241	Bacteria	2504
907	Ga0265340_10011206	3300031247	Bacteria	4774
908	Ga0265340_10021523	3300031247	Bacteria	3307
909	Ga0265339_10004095	3300031249	Bacteria	10061
910	Ga0265331_10152165	3300031250	Bacteria	1050
911	Ga0265331_10266946	3300031250	Bacteria	767
912	Ga0265316_10402644	3300031344	Bacteria	985
913	Ga0307513_10137235	3300031456	Bacteria	2379
914	Ga0307513_10190833	3300031456	Bacteria	1901
915	Ga0307509_10127524	3300031507	Bacteria	2507
916	Ga0307509_10251596	3300031507	Bacteria	1550
917	Ga0307509_10288620	3300031507	Bacteria	1396
918	Ga0307508_10000002	3300031616	Bacteria	407635
919	Ga0307508_10064657	3300031616	Bacteria	3225
920	Ga0307508_10120789	3300031616	Bacteria	2222
921	Ga0307508_10237179	3300031616	Bacteria	1422
922	Ga0307508_10252550	3300031616	Bacteria	1359
923	Ga0307508_10288426	3300031616	Bacteria	1234
924	Ga0307508_10526949	3300031616	Bacteria	778
925	Ga0265342_10070799	3300031712	Bacteria	2033
926	Ga0265342_10095737	3300031712	Bacteria	1697
927	Ga0307516_10030917	3300031730	Bacteria	5401
928	Ga0307516_10064115	3300031730	Bacteria	3555
929	Ga0307516_10118064	3300031730	Bacteria	2446
930	Ga0307516_10226970	3300031730	Bacteria	1573
931	Ga0307516_10384156	3300031730	Bacteria	1065
932	Ga0307516_10544879	3300031730	Bacteria	814
933	Ga0307405_10434761	3300031731	Bacteria	1036
934	Ga0307413_10124892	3300031824	Bacteria	1750
935	Ga0307410_10187114	3300031852	Bacteria	1572
936	Ga0307410_11548083	3300031852	Bacteria	585
937	Ga0307406_10148780	3300031901	Bacteria	1668
938	Ga0307406_10232176	3300031901	Bacteria	1378
939	Ga0307406_10503625	3300031901	Bacteria	982
940	Ga0307407_10109197	3300031903	Bacteria	1734
941	Ga0307407_10637629	3300031903	Bacteria	797
942	Ga0307407_11186398	3300031903	Bacteria	596
943	Ga0307412_10175573	3300031911	Bacteria	1606
944	Ga0307412_10241563	3300031911	Bacteria	1397
945	Ga0307412_11208328	3300031911	Bacteria	677
946	Ga0307412_11624770	3300031911	Bacteria	591
947	Ga0307409_100051678	3300031995	Bacteria	3146
948	Ga0307409_100399770	3300031995	Bacteria	1312
949	Ga0307409_100424803	3300031995	Bacteria	1276
950	Ga0307409_101425487	3300031995	Bacteria	719
951	Ga0307409_102772614	3300031995	Bacteria	518
952	Ga0307416_100221775	3300032002	Bacteria	1814
953	Ga0307416_100339595	3300032002	Bacteria	1514
954	Ga0307416_100830206	3300032002	Bacteria	1021
955	Ga0307416_101036374	3300032002	Bacteria	924
956	Ga0307416_102168156	3300032002	Bacteria	657
957	Ga0307414_11010707	3300032004	Bacteria	766
958	Ga0307414_11569818	3300032004	Bacteria	613
959	Ga0307411_10558048	3300032005	Bacteria	978
960	Ga0307411_10793851	3300032005	Bacteria	833
961	Ga0307411_10862505	3300032005	Bacteria	802
962	Ga0307411_10943438	3300032005	Bacteria	769
963	Ga0307411_11636967	3300032005	Bacteria	595
964	Ga0307415_100126169	3300032126	Bacteria	1929
965	Ga0307415_100300121	3300032126	Bacteria	1330
966	Ga0307415_101135628	3300032126	Bacteria	733
967	Ga0307415_101266484	3300032126	Bacteria	697
968	Ga0307507_10501924	3300033179	Bacteria	653
969	Ga0307510_10018457	3300033180	Bacteria	8209
970	Ga0307510_10181217	3300033180	Bacteria	1669
971	Ga0307510_10443521	3300033180	Bacteria	739
972	Ga0315911_1000013	3300033442	Bacteria	239334
973	Ga0316214_1009606	3300033545	Bacteria	1307
974	Ga0373930_0043103	3300034816	Bacteria	967
975	Ga0373948_0165934	3300034817	Bacteria	559
976	Ga0373948_0197218	3300034817	Bacteria	524
977	Ga0373958_0076068	3300034819	Bacteria	753
978	Ga0373938_0033930	3300034957	Bacteria	1106
979	Ga0373929_0074921	3300035085	Bacteria	815
980	Ga0373934_0186896	3300035086	Bacteria	852
981	Ga0373940_0086316	3300035088	Bacteria	935
982	Ga0373944_0080172	3300035089	Bacteria	1077
983	Ga0373949_0278003	3300035090	Bacteria	525
984	Ga0373952_0027292	3300035092	Bacteria	1246
985	Ga0373923_0192421	3300035111	Bacteria	940
986	Ga0373936_0029418	3300035113	Bacteria	2163
987	Ga0373936_0055703	3300035113	Bacteria	1606
988	Ga0373936_0076809	3300035113	Bacteria	1385
989	Ga0373936_0079938	3300035113	Bacteria	1359
990	Ga0373939_0298228	3300035114	Bacteria	642
991	Ga0373941_0089676	3300035115	Bacteria	1053
992	Ga0373941_0475840	3300035115	Bacteria	528
993	Ga0373945_0018937	3300035116	Bacteria	2346
994	Ga0373945_0222045	3300035116	Bacteria	791
995	Ga0373953_0423571	3300035117	Bacteria	587
996	Ga0373954_0071365	3300035118	Bacteria	1650
997	Ga0373956_0020381	3300035119	Bacteria	2821
998	Ga0373957_0090569	3300035120	Bacteria	1215
999	Ga0373943_0237130	3300035170	Bacteria	1021
1000	Ga0373946_0022307	3300035171	Bacteria	2463
1001	Ga0373955_0799791	3300035172	Bacteria	580
1002	Ga0373955_0826677	3300035172	Bacteria	570
1003	Ga0373942_0015869	3300035207	Bacteria	1841
1004	Ga0373942_0196172	3300035207	Bacteria	668
1005	Ga0373961_0219725	3300035241	Bacteria	677
1006	Ga0373962_0163916	3300035242	Bacteria	735
1007	Ga0373962_0277391	3300035242	Bacteria	589
1008	Ga0373924_0026591	3300035410	Bacteria	2296
1009	Ga0373931_0016923	3300035691	Bacteria	3596
1010	Ga0373931_0297197	3300035691	Bacteria	996
1011	Ga0373931_0808892	3300035691	Bacteria	625
1012	Ga0373935_0011171	3300035692	Bacteria	5391
1013	Ga0373935_0096791	3300035692	Bacteria	1940
1014	Ga0373935_1082210	3300035692	Bacteria	596
1015	Ga0373927_0004430	3300035695	Bacteria	9837
1016	Ga0373927_0013875	3300035695	Bacteria	5347
1017	Ga0373927_0041306	3300035695	Bacteria	2991
1018	Ga0373927_0088579	3300035695	Bacteria	2009
1019	Ga0373927_0420285	3300035695	Bacteria	882
1020	Ga0373933_0000187	3300035724	Bacteria	41028
1021	Ga0373933_0343987	3300035724	Bacteria	968
1022	Ga0373947_0097178	3300035725	Bacteria	1845
1023	Ga0373947_0164633	3300035725	Bacteria	1436
1024	Ga0373947_0243671	3300035725	Bacteria	1187
1025	Ga0373947_0547275	3300035725	Bacteria	788
1026	Ga0373937_0565688	3300036401	Bacteria	1080
1027	Ga0373925_0062714	3300037068	Bacteria	2795
1028	Ga0373925_0132907	3300037068	Bacteria	1942
1029	Ga0373925_0178563	3300037068	Bacteria	1679
1030	Ga0373925_0238823	3300037068	Bacteria	1455
1031	Ga0373925_0312039	3300037068	Bacteria	1271
1032	Ga0373925_0713694	3300037068	Bacteria	827
1033	Ga0373925_0771455	3300037068	Bacteria	793
1034	Ga0395899_0605223	3300037312	Bacteria	697
1035	Ga0395900_0071705	3300037418	Bacteria	3561
1036	Ga0395900_0301324	3300037418	Bacteria	1589
1037	Ga0395900_0305526	3300037418	Bacteria	1576
1038	Ga0395898_0005930	3300037466	Bacteria	13128
1039	Ga0395898_0088296	3300037466	Bacteria	2985
1040	Ga0395898_0104536	3300037466	Bacteria	2716
1041	Ga0395898_0155758	3300037466	Bacteria	2185
1042	Ga0395898_0316904	3300037466	Bacteria	1488
1043	Ga0395905_0454645	3300037471	Bacteria	1179
1044	Ga0395905_1911286	3300037471	Bacteria	500
1045	Ga0436364_0327015	3300037853	Bacteria	6547
1046	Ga0395901_0180018	3300038443	Bacteria	2217
1047	Ga0395901_0410814	3300038443	Bacteria	1390
1048	Ga0395901_0454497	3300038443	Bacteria	1309
1049	Ga0395901_0497737	3300038443	Bacteria	1241
1050	Ga0395901_0702149	3300038443	Bacteria	1009
1051	Ga0436365_0736921	3300039437	Bacteria	1315
1052	Ga0436365_1881000	3300039437	Bacteria	871
1053	Ga0436361_0731164	3300039447	Bacteria	1228
1054	Ga0436363_0342599	3300039450	Bacteria	723
1055	Ga0436363_1313129	3300039450	Bacteria	662
1056	Ga0439461_0177761	3300041410	Bacteria	562
1057	Ga0439465_0256997	3300041413	Bacteria	647
1058	Ga0451787_333360	3300041441	Bacteria	618
1059	Ga0451789_0203289	3300041443	Bacteria	856
1060	Ga0451789_0849786	3300041443	Bacteria	652
1061	Ga0451791_0070016	3300041451	Bacteria	670
1062	Ga0451791_1305121	3300041451	Bacteria	710
1063	Ga0451793_1612221	3300041452	Bacteria	557
1064	Ga0451797_1434425	3300041453	Bacteria	829
1065	Ga0451795_1575551	3300041456	Bacteria	554
1066	Ga0451802_1873086	3300041460	Bacteria	868
1067	Ga0451802_2067954	3300041460	Bacteria	923
1068	Ga0451807_1063360	3300041486	Bacteria	640
1069	Ga0451807_1736873	3300041486	Bacteria	852
1070	Ga0451807_1955077	3300041486	Bacteria	552
1071	Ga0451849_1009538	3300041505	Bacteria	650
1072	Ga0451849_1444799	3300041505	Bacteria	792
1073	Ga0451851_0995136	3300041507	Bacteria	747
1074	Ga0451851_1020942	3300041507	Bacteria	1311
1075	Ga0451843_0384136	3300041509	Bacteria	601
1076	Ga0451843_0803775	3300041509	Bacteria	711
1077	Ga0451853_0448747	3300041512	Bacteria	736
1078	Ga0451853_0940289	3300041512	Bacteria	1853
1079	Ga0451853_2148146	3300041512	Bacteria	1023
1080	Ga0439458_0080648	3300042157	Bacteria	830
1081	Ga0439459_0011282	3300042438	Bacteria	1573
1082	Ga0439459_0049399	3300042438	Bacteria	919
1083	Ga0466965_0123027	3300044683	Bacteria	1341
1084	Ga0466963_0125535	3300044694	Bacteria	1769
1085	Ga0466963_0194225	3300044694	Bacteria	1418
1086	Ga0466957_0110586	3300044842	Bacteria	1742
1087	Ga0466957_0155491	3300044842	Bacteria	1482
1088	Ga0466957_0651471	3300044842	Bacteria	741
1089	Ga0466960_0557974	3300044901	Bacteria	676
1090	Ga0451576_0604508	3300045051	Bacteria	1153
1091	Ga0466967_0046726	3300045976	Bacteria	3771
1092	Ga0466967_0221257	3300045976	Bacteria	1799
1093	Ga0466967_0326166	3300045976	Bacteria	1482
1094	Ga0466967_1889146	3300045976	Bacteria	594
1095	Ga0495617_051302	3300046452	Bacteria	1371
1096	Ga0495627_152375	3300046453	Bacteria	645
1097	Ga0495592_0105028	3300046454	Bacteria	2007
1098	Ga0495592_0288456	3300046454	Bacteria	1071
1099	Ga0495603_0023575	3300046455	Bacteria	3722
1100	Ga0495603_0303892	3300046455	Bacteria	916
1101	Ga0495603_0430447	3300046455	Bacteria	756
1102	Ga0495590_0052736	3300046457	Bacteria	1420
1103	Ga0495590_0151475	3300046457	Bacteria	841
1104	Ga0495629_0045208	3300046459	Bacteria	3090
1105	Ga0495629_0401513	3300046459	Bacteria	931
1106	Ga0495629_0616822	3300046459	Bacteria	725
1107	Ga0495638_0110701	3300046460	Bacteria	1632
1108	Ga0495641_0054239	3300046461	Bacteria	1822
1109	Ga0495641_0123289	3300046461	Bacteria	1156
1110	Ga0495651_0295796	3300046462	Bacteria	1088
1111	Ga0495651_0363302	3300046462	Bacteria	953
1112	Ga0495651_0523334	3300046462	Bacteria	756
1113	Ga0495650_0060535	3300046471	Bacteria	1520
1114	Ga0495650_0212014	3300046471	Bacteria	670
1115	Ga0495580_0012426	3300046472	Bacteria	6527
1116	Ga0495580_0471810	3300046472	Bacteria	840
1117	Ga0495582_0325867	3300046473	Bacteria	884
1118	Ga0495605_0174675	3300046474	Bacteria	947
1119	Ga0495639_0015383	3300046475	Bacteria	3318
1120	Ga0495639_0043784	3300046475	Bacteria	2023
1121	Ga0495662_0242648	3300046476	Bacteria	888
1122	Ga0495664_0135238	3300046477	Bacteria	1493
1123	Ga0495584_0047573	3300046491	Bacteria	2163
1124	Ga0495584_0210399	3300046491	Bacteria	989
1125	Ga0495584_0210908	3300046491	Bacteria	987
1126	Ga0495585_0082014	3300046492	Bacteria	1746
1127	Ga0495585_0141340	3300046492	Bacteria	1260
1128	Ga0495585_0198371	3300046492	Bacteria	1023
1129	Ga0495585_0236026	3300046492	Bacteria	917
1130	Ga0495585_0300032	3300046492	Bacteria	790
1131	Ga0495594_0059610	3300046499	Bacteria	2111
1132	Ga0495594_0664456	3300046499	Bacteria	590
1133	Ga0495596_0053712	3300046500	Bacteria	1576
1134	Ga0495596_0283176	3300046500	Bacteria	644
1135	Ga0495596_0398690	3300046500	Bacteria	536
1136	Ga0495607_0559336	3300046501	Bacteria	501
1137	Ga0495583_0349594	3300046506	Bacteria	583
1138	Ga0495606_0289543	3300046507	Bacteria	892
1139	Ga0495608_0684195	3300046511	Bacteria	611
1140	Ga0495610_0024944	3300046512	Bacteria	3219
1141	Ga0495616_0056264	3300046513	Bacteria	1943
1142	Ga0495616_0267016	3300046513	Bacteria	730
1143	Ga0495618_0053902	3300046514	Bacteria	2543
1144	Ga0495620_0169473	3300046515	Bacteria	847
1145	Ga0495628_0069977	3300046516	Bacteria	2736
1146	Ga0495628_0285402	3300046516	Bacteria	1225
1147	Ga0495628_0450566	3300046516	Bacteria	935
1148	Ga0495628_0829974	3300046516	Bacteria	645
1149	Ga0495630_0017072	3300046517	Bacteria	5312
1150	Ga0495631_0043609	3300046518	Bacteria	1978
1151	Ga0495631_0097424	3300046518	Bacteria	1266
1152	Ga0495631_0244620	3300046518	Bacteria	765
1153	Ga0495631_0409407	3300046518	Bacteria	577
1154	Ga0495632_0064418	3300046519	Bacteria	1772
1155	Ga0495632_0098695	3300046519	Bacteria	1378
1156	Ga0495637_0365866	3300046520	Bacteria	504
1157	Ga0495643_0253859	3300046522	Bacteria	819
1158	Ga0495644_0117089	3300046523	Bacteria	1012
1159	Ga0495644_0277525	3300046523	Bacteria	653
1160	Ga0495648_0124410	3300046524	Bacteria	1380
1161	Ga0495663_0033143	3300046525	Bacteria	1541
1162	Ga0495663_0043397	3300046525	Bacteria	1373
1163	Ga0495663_0307411	3300046525	Bacteria	572
1164	Ga0495652_0186795	3300046529	Bacteria	1585
1165	Ga0495665_0078374	3300046531	Bacteria	1738
1166	Ga0495640_0031424	3300046533	Bacteria	3789
1167	Ga0495640_0412619	3300046533	Bacteria	828
1168	Ga0495586_0566479	3300046535	Bacteria	656
1169	Ga0495586_0797234	3300046535	Bacteria	545
1170	Ga0495587_0184565	3300046536	Bacteria	1182
1171	Ga0495587_0287493	3300046536	Bacteria	921
1172	Ga0495598_0015047	3300046537	Bacteria	1944
1173	Ga0495609_0070336	3300046538	Bacteria	1538
1174	Ga0495609_0191628	3300046538	Bacteria	857
1175	Ga0495621_0047130	3300046539	Bacteria	1531
1176	Ga0495621_0097191	3300046539	Bacteria	1116
1177	Ga0495597_0117851	3300046542	Bacteria	1108
1178	Ga0495645_0050875	3300046543	Bacteria	3015
1179	Ga0495645_0926129	3300046543	Bacteria	516
1180	Ga0495622_0054182	3300046557	Bacteria	1861
1181	Ga0495622_0144358	3300046557	Bacteria	1079
1182	Ga0495622_0295969	3300046557	Bacteria	706
1183	Ga0495633_0044172	3300046558	Bacteria	2112
1184	Ga0495633_0292334	3300046558	Bacteria	740
1185	Ga0495667_0294152	3300046559	Bacteria	1029
1186	Ga0495656_0025079	3300046615	Bacteria	2360
1187	Ga0495656_0113963	3300046615	Bacteria	1268
1188	Ga0495656_0138280	3300046615	Bacteria	1165
1189	Ga0495656_0204572	3300046615	Bacteria	981
1190	Ga0495656_0330621	3300046615	Bacteria	787
1191	Ga0495656_0769009	3300046615	Bacteria	520
1192	Ga0495668_0018181	3300046616	Bacteria	4065
1193	Ga0495668_0050331	3300046616	Bacteria	2309
1194	Ga0495668_0059031	3300046616	Bacteria	2117
1195	Ga0495668_0630874	3300046616	Bacteria	592
1196	Ga0495634_0076594	3300046642	Bacteria	2195
1197	Ga0495634_0432003	3300046642	Bacteria	779
1198	Ga0495611_0023229	3300046648	Bacteria	2689
1199	Ga0495611_0085383	3300046648	Bacteria	1455
1200	Ga0495611_0175151	3300046648	Bacteria	1002
1201	Ga0495625_0205181	3300046660	Bacteria	1298
1202	Ga0495625_0363904	3300046660	Bacteria	911
1203	Ga0495625_0401922	3300046660	Bacteria	855
1204	Ga0495625_0585196	3300046660	Bacteria	672
1205	Ga0495625_0648699	3300046660	Bacteria	629
1206	Ga0495635_0121251	3300046663	Bacteria	1783
1207	Ga0495659_0018579	3300046664	Bacteria	2318
1208	Ga0495659_0019954	3300046664	Bacteria	2246
1209	Ga0495659_0382301	3300046664	Bacteria	605
1210	Ga0495661_0125323	3300046665	Bacteria	1414
1211	Ga0495588_0007555	3300046674	Bacteria	4953
1212	Ga0495588_0401920	3300046674	Bacteria	719
1213	Ga0495588_0737589	3300046674	Bacteria	515
1214	Ga0495599_0278475	3300046678	Bacteria	1014
1215	Ga0495599_0344956	3300046678	Bacteria	893
1216	Ga0495599_0814177	3300046678	Bacteria	533
1217	Ga0495623_0062940	3300046679	Bacteria	2324
1218	Ga0495623_0125310	3300046679	Bacteria	1543
1219	Ga0495646_0124643	3300046680	Bacteria	1455
1220	Ga0495647_0047541	3300046681	Bacteria	1656
1221	Ga0495658_0294074	3300046683	Bacteria	1026
1222	Ga0495669_0011098	3300046684	Bacteria	3817
1223	Ga0495669_0105855	3300046684	Bacteria	1310
1224	Ga0495669_0201806	3300046684	Bacteria	950
1225	Ga0495669_0369224	3300046684	Bacteria	694
1226	Ga0495669_0598662	3300046684	Bacteria	536
1227	Ga0495613_0204724	3300046689	Bacteria	1390
1228	Ga0495624_0062936	3300046690	Bacteria	2320
1229	Ga0495670_0285819	3300046691	Bacteria	882
1230	Ga0495671_0263223	3300046692	Bacteria	831
1231	Ga0495671_0359668	3300046692	Bacteria	698
1232	Ga0495649_0136314	3300046694	Bacteria	1293
1233	Ga0495589_0045823	3300046794	Bacteria	2172
1234	Ga0495600_0225447	3300046809	Bacteria	1198
1235	Ga0495660_0169048	3300046810	Bacteria	1066
1236	Ga0495581_0014621	3300047315	Bacteria	4550
1237	Ga0495581_0023902	3300047315	Bacteria	3542
1238	Ga0495581_0251732	3300047315	Bacteria	1033
1239	Ga0495581_0349642	3300047315	Bacteria	863
1240	Ga0495604_0154393	3300047317	Bacteria	1628
1241	Ga0495604_0356448	3300047317	Bacteria	971
1242	Ga0495636_0048529	3300047318	Bacteria	1774
1243	Ga0495636_0096474	3300047318	Bacteria	1289
1244	Ga0495674_0228167	3300047319	Bacteria	1537
1245	Ga0495674_0278534	3300047319	Bacteria	1371
1246	Ga0495672_0021095	3300047320	Bacteria	4253
1247	Ga0495672_0346526	3300047320	Bacteria	691
1248	Ga0495676_0136425	3300047321	Bacteria	1764
1249	Ga0495676_0246965	3300047321	Bacteria	1219
1250	Ga0495680_0547551	3300047322	Bacteria	780
1251	Ga0495683_0061986	3300047323	Bacteria	1851
1252	Ga0495683_0191134	3300047323	Bacteria	928
1253	Ga0495687_114038	3300047443	Bacteria	988
1254	Ga0495675_0187261	3300047444	Bacteria	1265
1255	Ga0495677_0099886	3300047445	Bacteria	1098
1256	Ga0495677_0158237	3300047445	Bacteria	874
1257	Ga0495677_0241699	3300047445	Bacteria	705
1258	Ga0495679_059874	3300047446	Bacteria	1119
1259	Ga0495685_229790	3300047447	Bacteria	591
1260	Ga0495673_0043235	3300047469	Bacteria	2017
1261	Ga0495684_0011258	3300047471	Bacteria	6911
1262	Ga0495684_0810657	3300047471	Bacteria	611
1263	Ga0495686_0295536	3300047472	Bacteria	896
1264	Ga0495686_0347823	3300047472	Bacteria	807
1265	Ga0495686_0471606	3300047472	Bacteria	664
1266	Ga0495593_0016334	3300047673	Bacteria	4189
1267	Ga0495593_0120908	3300047673	Bacteria	1333
1268	Ga0495626_0102391	3300048091	Bacteria	1247
1269	Ga0496100_0018221	3300048903	Bacteria	4161
1270	Ga0496100_0048543	3300048903	Bacteria	2740
1271	Ga0496100_0818449	3300048903	Bacteria	730
1272	Ga0496100_1137818	3300048903	Bacteria	615
1273	Ga0496100_1230779	3300048903	Bacteria	591
1274	Ga0496101_0015046	3300048904	Bacteria	5207
1275	Ga0496101_0069870	3300048904	Bacteria	2570
1276	Ga0496101_0473795	3300048904	Bacteria	988
1277	Ga0496101_0486290	3300048904	Bacteria	975
1278	Ga0496101_0827426	3300048904	Bacteria	730
1279	Ga0496101_0853078	3300048904	Bacteria	718
1280	Ga0496101_0915680	3300048904	Bacteria	690
1281	Ga0496101_1555600	3300048904	Bacteria	514
1282	Ga0496102_0004540	3300048905	Bacteria	11737
1283	Ga0496102_0051691	3300048905	Bacteria	3743
1284	Ga0496102_0170771	3300048905	Bacteria	2047
1285	Ga0496102_0363567	3300048905	Bacteria	1362
1286	Ga0496102_0505020	3300048905	Bacteria	1131
1287	Ga0496102_0764047	3300048905	Bacteria	889
1288	Ga0496102_0918944	3300048905	Bacteria	797
1289	Ga0496102_0964030	3300048905	Bacteria	774
1290	Ga0496102_1571745	3300048905	Bacteria	576
1291	Ga0496103_0059946	3300048906	Bacteria	2365
1292	Ga0496103_0072927	3300048906	Bacteria	2151
1293	Ga0496103_0406964	3300048906	Bacteria	874
1294	Ga0496104_0017703	3300048907	Bacteria	6495
1295	Ga0496104_0357700	3300048907	Bacteria	1372
1296	Ga0496104_0383655	3300048907	Bacteria	1318
1297	Ga0496104_0489345	3300048907	Bacteria	1141
1298	Ga0496104_0625529	3300048907	Bacteria	986
1299	Ga0496104_0686409	3300048907	Bacteria	932
1300	Ga0496104_0879600	3300048907	Bacteria	801
1301	Ga0496105_0008057	3300048908	Bacteria	8189
1302	Ga0496105_0014022	3300048908	Bacteria	6376
1303	Ga0496105_1257835	3300048908	Bacteria	542
1304	Ga0496105_1294021	3300048908	Bacteria	533
1305	Ga0496106_0015715	3300048909	Bacteria	5600
1306	Ga0496106_0045300	3300048909	Bacteria	3304
1307	Ga0496106_0182289	3300048909	Bacteria	1667
1308	Ga0496106_0263987	3300048909	Bacteria	1378
1309	Ga0496106_0303472	3300048909	Bacteria	1281
1310	Ga0496106_0336430	3300048909	Bacteria	1212
1311	Ga0496106_0888819	3300048909	Bacteria	704
1312	Ga0496107_0011149	3300048910	Bacteria	6255
1313	Ga0496107_0013087	3300048910	Bacteria	5796
1314	Ga0496107_0290333	3300048910	Bacteria	1217
1315	Ga0496107_1005114	3300048910	Bacteria	605
1316	Ga0496108_0047992	3300048911	Bacteria	3570
1317	Ga0496108_0079769	3300048911	Bacteria	2771
1318	Ga0496108_0097977	3300048911	Bacteria	2499
1319	Ga0496108_0233559	3300048911	Bacteria	1599
1320	Ga0496109_0165663	3300048912	Bacteria	2072
1321	Ga0496109_0560617	3300048912	Bacteria	1077
1322	Ga0496109_0895090	3300048912	Bacteria	825
1323	Ga0496109_1016423	3300048912	Bacteria	766
1324	Ga0496110_0014218	3300048913	Bacteria	6604
1325	Ga0496110_0019559	3300048913	Bacteria	5701
1326	Ga0496110_0287688	3300048913	Bacteria	1497
1327	Ga0496110_0445239	3300048913	Bacteria	1181
1328	Ga0496110_0639206	3300048913	Bacteria	963
1329	Ga0496111_0006236	3300048914	Bacteria	7729
1330	Ga0496111_0078678	3300048914	Bacteria	2404
1331	Ga0496111_0120740	3300048914	Bacteria	1936
1332	Ga0496112_0006170	3300048915	Bacteria	10480
1333	Ga0496112_0521257	3300048915	Bacteria	1123
1334	Ga0496112_0662171	3300048915	Bacteria	973
1335	Ga0496113_0021435	3300048916	Bacteria	4558
1336	Ga0496113_0132157	3300048916	Bacteria	1959
1337	Ga0496113_0807760	3300048916	Bacteria	745
1338	Ga0496114_0171444	3300048917	Bacteria	1891
1339	Ga0496114_0646898	3300048917	Bacteria	930
1340	Ga0496114_0737873	3300048917	Bacteria	862
1341	Ga0496114_1307685	3300048917	Bacteria	612
1342	Ga0496115_0003033	3300048918	Bacteria	12058
1343	Ga0496115_0005527	3300048918	Bacteria	9201
1344	Ga0496115_0016573	3300048918	Bacteria	5614
1345	Ga0496115_0244595	3300048918	Bacteria	1478
1346	Ga0496115_0263840	3300048918	Bacteria	1416
1347	Ga0496115_0469138	3300048918	Bacteria	1015
1348	Ga0496115_0485431	3300048918	Bacteria	994
1349	Ga0496115_0566744	3300048918	Bacteria	906
1350	Ga0496115_1102849	3300048918	Bacteria	601
1351	Ga0496117_0360921	3300048920	Bacteria	747
1352	Ga0496118_0600202	3300048921	Bacteria	527
1353	Ga0496119_0509568	3300048922	Bacteria	559
1354	Ga0496121_0040887	3300048924	Bacteria	4061
1355	Ga0496121_0083526	3300048924	Bacteria	2521
1356	Ga0496121_0110939	3300048924	Bacteria	2092
1357	Ga0496121_0116161	3300048924	Bacteria	2030
1358	Ga0496121_0117650	3300048924	Bacteria	2013
1359	Ga0496121_0117916	3300048924	Bacteria	2010
1360	Ga0496121_0120514	3300048924	Bacteria	1982
1361	Ga0496121_0124913	3300048924	Bacteria	1936
1362	Ga0496121_0174578	3300048924	Bacteria	1557
1363	Ga0496121_0345785	3300048924	Bacteria	992
1364	Ga0496121_0385046	3300048924	Bacteria	923
1365	Ga0496121_0397472	3300048924	Bacteria	904
1366	Ga0496121_0489430	3300048924	Bacteria	783
1367	Ga0496121_0857479	3300048924	Bacteria	527
1368	Ga0496121_0859424	3300048924	Bacteria	526
1369	Ga0496122_0135095	3300048925	Bacteria	1557
1370	Ga0496124_0139066	3300048927	Bacteria	1918
1371	Ga0496124_0603699	3300048927	Bacteria	713
1372	Ga0496124_0646836	3300048927	Bacteria	679
1373	Ga0496125_0031970	3300048928	Bacteria	4680
1374	Ga0496125_0768485	3300048928	Bacteria	502
1375	Ga0496126_0004556	3300048929	Bacteria	16466
1376	Ga0496126_0008355	3300048929	Bacteria	11172
1377	Ga0496126_0017182	3300048929	Bacteria	7215
1378	Ga0496126_0028078	3300048929	Bacteria	5365
1379	Ga0496126_0040571	3300048929	Bacteria	4314
1380	Ga0496126_0158729	3300048929	Bacteria	1934
1381	Ga0496126_0199520	3300048929	Bacteria	1690
1382	Ga0496126_0323093	3300048929	Bacteria	1268
1383	Ga0496126_0344998	3300048929	Bacteria	1219
1384	Ga0496126_0535625	3300048929	Bacteria	931
1385	Ga0496126_0580454	3300048929	Bacteria	886
1386	Ga0496126_0610902	3300048929	Bacteria	858
1387	Ga0495678_099414	3300049459	Bacteria	1010
1388	Ga0495682_0040482	3300049460	Bacteria	1708
1389	Ga0495682_0181662	3300049460	Bacteria	748
1390	Ga0495682_0301326	3300049460	Bacteria	565
1391	Ga0501290_091997	3300049513	Bacteria	529
1392	Ga0501292_136894	3300049515	Bacteria	510
1393	Ga0501031_0004204	3300049568	Bacteria	9304
1394	Ga0501031_0055522	3300049568	Bacteria	2580
1395	Ga0501031_0117333	3300049568	Bacteria	1739
1396	Ga0501031_0423498	3300049568	Bacteria	860
1397	Ga0501032_0000165	3300049569	Bacteria	53852
1398	Ga0501032_0014183	3300049569	Bacteria	5645
1399	Ga0501032_0123690	3300049569	Bacteria	1709
1400	Ga0501033_0000298	3300049570	Bacteria	47634
1401	Ga0501033_0000300	3300049570	Bacteria	47067
1402	Ga0501033_0027113	3300049570	Bacteria	4310
1403	Ga0501033_0051634	3300049570	Bacteria	3047
1404	Ga0501033_0148296	3300049570	Bacteria	1693
1405	Ga0501034_0000058	3300049571	Bacteria	198554
1406	Ga0501034_0241594	3300049571	Bacteria	1752
1407	Ga0501034_0319573	3300049571	Bacteria	1485
1408	Ga0501034_0683867	3300049571	Bacteria	925
1409	Ga0501036_0023461	3300049572	Bacteria	5198
1410	Ga0501036_0044651	3300049572	Bacteria	3754
1411	Ga0501036_0046843	3300049572	Bacteria	3661
1412	Ga0501036_0083002	3300049572	Bacteria	2709
1413	Ga0501036_1459785	3300049572	Bacteria	554
1414	Ga0501036_1565690	3300049572	Bacteria	532
1415	Ga0501037_0000078	3300049573	Bacteria	90398
1416	Ga0501037_0000212	3300049573	Bacteria	51917
1417	Ga0501037_0115868	3300049573	Bacteria	1928
1418	Ga0501037_0305309	3300049573	Bacteria	1104
1419	Ga0501038_0000050	3300049574	Bacteria	99270
1420	Ga0501038_0001576	3300049574	Bacteria	21114
1421	Ga0501038_0016653	3300049574	Bacteria	6662
1422	Ga0501038_0178921	3300049574	Bacteria	1712
1423	Ga0501038_0616814	3300049574	Unclassified	819
1424	Ga0501038_0636448	3300049574	Bacteria	804
1425	Ga0501038_0702971	3300049574	Bacteria	757
1426	Ga0501038_0785286	3300049574	Bacteria	708
1427	Ga0501039_0000078	3300049575	Bacteria	73768
1428	Ga0501039_0013346	3300049575	Bacteria	6279
1429	Ga0501039_0087399	3300049575	Bacteria	2428
1430	Ga0501039_0104368	3300049575	Bacteria	2212
1431	Ga0501039_0441775	3300049575	Bacteria	1021
1432	Ga0501039_0999658	3300049575	Unclassified	650
1433	Ga0501040_0100764	3300049576	Bacteria	2014
1434	Ga0501041_0132892	3300049577	Bacteria	1550
1435	Ga0501041_0284058	3300049577	Bacteria	1042
1436	Ga0501042_0003673	3300049578	Bacteria	9676
1437	Ga0501042_0030226	3300049578	Bacteria	3824
1438	Ga0501043_0000220	3300049579	Bacteria	51696
1439	Ga0501043_0009796	3300049579	Bacteria	7509
1440	Ga0501043_0010699	3300049579	Bacteria	7187
1441	Ga0501043_0046901	3300049579	Bacteria	3397
1442	Ga0501043_0151502	3300049579	Bacteria	1815
1443	Ga0501043_0385517	3300049579	Bacteria	1060
1444	Ga0501043_0481689	3300049579	Bacteria	929
1445	Ga0501046_0000893	3300049580	Bacteria	29084
1446	Ga0501046_0017442	3300049580	Bacteria	5992
1447	Ga0501046_0026622	3300049580	Bacteria	4723
1448	Ga0501046_1056375	3300049580	Bacteria	562
1449	Ga0501047_0000538	3300049581	Bacteria	40982
1450	Ga0501047_0349421	3300049581	Bacteria	1315
1451	Ga0501047_0482459	3300049581	Bacteria	1067
1452	Ga0501048_0001589	3300049582	Bacteria	17249
1453	Ga0501048_0022964	3300049582	Bacteria	4559
1454	Ga0501048_0206064	3300049582	Bacteria	1395
1455	Ga0501067_0003278	3300049583	Bacteria	8913
1456	Ga0501067_0037308	3300049583	Bacteria	2699
1457	Ga0501068_0001155	3300049584	Bacteria	13997
1458	Ga0501068_0097373	3300049584	Bacteria	1820
1459	Ga0501068_0565668	3300049584	Bacteria	740
1460	Ga0501069_0203579	3300049585	Bacteria	1147
1461	Ga0501070_0001275	3300049586	Bacteria	22615
1462	Ga0501070_0135937	3300049586	Bacteria	2030
1463	Ga0501070_0140687	3300049586	Bacteria	1992
1464	Ga0501070_0355122	3300049586	Bacteria	1189
1465	Ga0501071_0147524	3300049587	Bacteria	1754
1466	Ga0501071_1354698	3300049587	Bacteria	550
1467	Ga0501072_0005008	3300049588	Bacteria	10081
1468	Ga0501072_0191622	3300049588	Bacteria	1630
1469	Ga0501073_0000061	3300049589	Bacteria	68332
1470	Ga0501073_0163534	3300049589	Bacteria	1541
1471	Ga0501073_0164569	3300049589	Bacteria	1536
1472	Ga0501074_0000022	3300049590	Bacteria	70431
1473	Ga0501074_0460481	3300049590	Bacteria	901
1474	Ga0501076_0236101	3300049592	Bacteria	1495
1475	Ga0501077_0106735	3300049593	Bacteria	1775
1476	Ga0501077_0969041	3300049593	Bacteria	547
1477	Ga0501202_141411	3300049652	Bacteria	622
1478	Ga0501239_089392	3300049672	Bacteria	506
1479	Ga0501225_0302718	3300049705	Bacteria	541
1480	Ga0501079_0001133	3300049741	Bacteria	18607
1481	Ga0501079_0231414	3300049741	Bacteria	1444
1482	Ga0501079_0378888	3300049741	Bacteria	1109
1483	Ga0501080_0000226	3300049742	Bacteria	42194
1484	Ga0501080_0039945	3300049742	Bacteria	4379
1485	Ga0501080_0369379	3300049742	Bacteria	1294
1486	Ga0501080_1114002	3300049742	Bacteria	681
1487	Ga0501081_0234636	3300049743	Bacteria	1337
1488	Ga0501083_0025747	3300049744	Bacteria	4072
1489	Ga0501035_0001069	3300049822	Bacteria	28719
1490	Ga0501035_0460195	3300049822	Bacteria	1051
1491	Ga0501035_0541214	3300049822	Bacteria	955
1492	Ga0501035_1145805	3300049822	Bacteria	605
1493	Ga0501044_0000145	3300049823	Bacteria	87425
1494	Ga0501044_0003557	3300049823	Bacteria	17536
1495	Ga0501044_0032057	3300049823	Bacteria	5525
1496	Ga0501044_0062401	3300049823	Bacteria	3809
1497	Ga0501044_0078401	3300049823	Bacteria	3348
1498	Ga0501044_0141689	3300049823	Bacteria	2392
1499	Ga0501044_0163912	3300049823	Bacteria	2198
1500	Ga0501044_0298603	3300049823	Bacteria	1540
1501	Ga0501044_0564049	3300049823	Bacteria	1034
1502	Ga0501045_0029679	3300049824	Bacteria	3954
1503	Ga0501045_0149637	3300049824	Bacteria	1736
1504	Ga0501045_0183344	3300049824	Bacteria	1560
1505	nmdc:mga03683_170087_c1	3300050489	Bacteria	990
1506	nmdc:mga03683_216574_c1	3300050489	Bacteria	579
1507	nmdc:mga03683_38967_c1	3300050489	Bacteria	1944
1508	nmdc:mga03683_49867_c1	3300050489	Bacteria	1744
1509	nmdc:mga03683_531674_c1	3300050489	Bacteria	571
1510	nmdc:mga03683_561793_c1	3300050489	Bacteria	556
1511	nmdc:mga03683_91293_c1	3300050489	Bacteria	1328
1512	nmdc:mga03683_95418_c1	3300050489	Bacteria	1302
1513	nmdc:mga03n38_398765_c1	3300050490	Bacteria	757
1514	nmdc:mga03n38_7616_c1	3300050490	Bacteria	3842
1515	nmdc:mga00v17_160188_c1	3300050491	Bacteria	1448
1516	nmdc:mga00v17_252989_c1	3300050491	Bacteria	1142
1517	nmdc:mga00v17_580231_c1	3300050491	Bacteria	724
1518	nmdc:mga00v17_70760_c1	3300050491	Bacteria	2161
1519	nmdc:mga0yw44_1007238_c1	3300050492	Bacteria	564
1520	nmdc:mga0yw44_137626_c1	3300050492	Bacteria	1585
1521	nmdc:mga0yw44_144061_c1	3300050492	Bacteria	1550
1522	nmdc:mga0yw44_38733_c1	3300050492	Bacteria	2823
1523	nmdc:mga0yw44_430541_c1	3300050492	Bacteria	894
1524	nmdc:mga0yw44_68534_c1	3300050492	Bacteria	2195
1525	nmdc:mga0k408_185592_c1	3300050493	Bacteria	1240
1526	nmdc:mga0k408_19644_c1	3300050493	Bacteria	3779
1527	nmdc:mga0k408_245015_c1	3300050493	Bacteria	1070
1528	nmdc:mga0k408_275799_c1	3300050493	Bacteria	1004
1529	nmdc:mga0k408_394620_c1	3300050493	Bacteria	824
1530	nmdc:mga0k408_617548_c1	3300050493	Bacteria	639
1531	nmdc:mga0k408_67897_c1	3300050493	Bacteria	2079
1532	nmdc:mga0k408_87001_c1	3300050493	Bacteria	1835
1533	nmdc:mga06z11_15695_c1	3300050494	Bacteria	3388
1534	nmdc:mga06z11_182212_c1	3300050494	Bacteria	1212
1535	nmdc:mga06z11_190940_c1	3300050494	Bacteria	1186
1536	nmdc:mga06z11_227015_c1	3300050494	Bacteria	1093
1537	nmdc:mga06z11_824251_c1	3300050494	Bacteria	565
1538	nmdc:mga06z11_991745_c1	3300050494	Bacteria	512
1539	nmdc:mga04h51_123241_c1	3300050495	Bacteria	968
1540	nmdc:mga04h51_296910_c1	3300050495	Bacteria	657
1541	nmdc:mga04h51_447832_c1	3300050495	Bacteria	546
1542	nmdc:mga07m45_20657_c1	3300050496	Bacteria	3578
1543	nmdc:mga07m45_21155_c1	3300050496	Bacteria	3539
1544	nmdc:mga07m45_62112_c1	3300050496	Bacteria	2117
1545	nmdc:mga07m45_769199_c1	3300050496	Bacteria	553
1546	nmdc:mga05p37_1142215_c1	3300050507	Bacteria	811
1547	nmdc:mga05p37_83615_c1	3300050507	Bacteria	3932
1548	nmdc:mga0qj67_1009575_c1	3300050509	Bacteria	652
1549	nmdc:mga08y16_1789164_c1	3300050511	Bacteria	568
1550	nmdc:mga08y16_271146_c1	3300050511	Bacteria	1752
1551	nmdc:mga08y16_416233_c1	3300050511	Bacteria	1374
1552	nmdc:mga0n895_135176_c1	3300050512	Bacteria	2492
1553	nmdc:mga0n895_2054710_c1	3300050512	Bacteria	528
1554	nmdc:mga0n895_213033_c1	3300050512	Bacteria	1962
1555	nmdc:mga0rr50_26698_c1	3300050513	Bacteria	4033
1556	nmdc:mga0rr50_523148_c1	3300050513	Bacteria	1009
1557	nmdc:mga08x19_1329369_c1	3300050514	Bacteria	509
1558	nmdc:mga08x19_166274_c1	3300050514	Bacteria	1500
1559	nmdc:mga0a205_935786_c1	3300050515	Bacteria	713
1560	nmdc:mga0sz30_534757_c1	3300050516	Bacteria	528
1561	Ga0495601_0046505	3300053077	Bacteria	2732
1562	Ga0495601_0856289	3300053077	Bacteria	575
1563	Ga0495601_0910307	3300053077	Bacteria	555
1564	Ga0495612_0085178	3300053078	Bacteria	1332
1565	Ga0495612_0114425	3300053078	Bacteria	1157
1566	Ga0500610_0255916	3300053079	Bacteria	803
1567	Ga0500610_0438067	3300053079	Bacteria	517
1568	Ga0500635_0183565	3300053080	Bacteria	809
1569	Ga0495619_0086471	3300053085	Bacteria	2119
1570	Ga0500578_0237101	3300053086	Bacteria	1103
1571	Ga0500643_021463	3300053087	Bacteria	2092
1572	Ga0500644_0112899	3300053088	Bacteria	1049
1573	Ga0500581_203357	3300053089	Bacteria	877
1574	Ga0500646_0052189	3300053090	Bacteria	1183
1575	Ga0500646_0134042	3300053090	Bacteria	807
1576	Ga0500583_0052534	3300053092	Bacteria	1896
1577	Ga0500583_0313683	3300053092	Bacteria	765
1578	Ga0500651_0353116	3300053093	Bacteria	834
1579	Ga0500651_0373310	3300053093	Bacteria	805
1580	Ga0500566_0149080	3300053094	Bacteria	1232
1581	Ga0500566_0353267	3300053094	Bacteria	673
1582	Ga0500641_0039461	3300053096	Bacteria	1902
1583	Ga0500641_0220905	3300053096	Bacteria	803
1584	Ga0500641_0339691	3300053096	Bacteria	606
1585	Ga0500648_257563	3300053097	Bacteria	813
1586	Ga0500654_103747	3300053099	Bacteria	1199
1587	Ga0500555_145039	3300053103	Bacteria	583
1588	Ga0500557_165831	3300053105	Bacteria	723
1589	Ga0500562_049744	3300053108	Bacteria	1120
1590	Ga0500569_011698	3300053109	Bacteria	2105
1591	Ga0500592_074442	3300053116	Bacteria	561
1592	Ga0500593_295606	3300053117	Bacteria	521
1593	Ga0500594_0024653	3300053118	Bacteria	1534
1594	Ga0500594_0176876	3300053118	Bacteria	695
1595	Ga0500595_003229	3300053119	Bacteria	7692
1596	Ga0500595_098849	3300053119	Bacteria	838
1597	Ga0500597_012954	3300053120	Bacteria	3080
1598	Ga0500628_191049	3300053129	Bacteria	588
1599	Ga0500655_038081	3300053133	Bacteria	939
1600	Ga0500658_0267775	3300053134	Bacteria	785
1601	Ga0500559_0500904	3300053136	Bacteria	558
1602	Ga0500568_0056730	3300053139	Bacteria	1526
1603	Ga0500568_0266362	3300053139	Bacteria	623
1604	Ga0500573_0260353	3300053140	Bacteria	888
1605	Ga0500573_0419937	3300053140	Bacteria	627
1606	Ga0500577_0000113	3300053142	Bacteria	19832
1607	Ga0500577_0042647	3300053142	Bacteria	1662
1608	Ga0500589_039952	3300053147	Bacteria	2190
1609	Ga0500589_100846	3300053147	Bacteria	1254
1610	Ga0500589_340992	3300053147	Bacteria	517
1611	Ga0500590_086870	3300053148	Bacteria	1525
1612	Ga0500590_137887	3300053148	Bacteria	1119
1613	Ga0500590_244946	3300053148	Bacteria	718
1614	Ga0500603_070796	3300053150	Bacteria	993
1615	Ga0500603_093138	3300053150	Bacteria	887
1616	Ga0500604_0026210	3300053151	Bacteria	1680
1617	Ga0500604_0132898	3300053151	Bacteria	837
1618	Ga0500627_0273206	3300053158	Bacteria	743
1619	Ga0500634_0018862	3300053161	Bacteria	3710
1620	Ga0500634_0239644	3300053161	Bacteria	763
1621	Ga0500638_169801	3300053162	Bacteria	951
1622	Ga0500638_252801	3300053162	Bacteria	708
1623	Ga0500639_269305	3300053163	Bacteria	666
1624	Ga0500636_0124155	3300053177	Bacteria	1445
1625	Ga0500636_0335601	3300053177	Bacteria	728
1626	Ga0500637_0526715	3300053178	Bacteria	578
1627	Ga0500611_156961	3300053727	Bacteria	627
1628	Ga0500645_032125	3300053730	Bacteria	1575
1629	Ga0500596_001916	3300053735	Bacteria	4173
1630	Ga0501084_0122244	3300054114	Bacteria	2189
1631	Ga0501082_0004306	3300060353	Bacteria	12447
1632	Ga0501082_0129527	3300060353	Bacteria	2189
1633	Ga0501082_0269553	3300060353	Bacteria	1481
1634	Ga0530510_0902169	3300061734	Bacteria	675
1635	Ga0530510_0914987	3300061734	Bacteria	670

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300005983	Ga0081540_1024736	Ga0081540_10247363	96
2	3300026067	Ga0207678_10722619	Ga0207678_107226192	96
3	3300005436	Ga0070713_100160079	Ga0070713_1001600792	98
4	3300003215	JGI25153J46596_10002083	JGI25153J46596_100020839	100
5	3300005937	Ga0081455_10130852	Ga0081455_101308523	100
6	3300025297	Ga0209758_1005243	Ga0209758_10052433	100
7	3300042438	Ga0439459_0049399	Ga0439459_0049399_378_695	100
8	3300048929	Ga0496126_0323093	Ga0496126_0323093_582_899	100
9	3300050489	nmdc:mga03683_49867_c1	nmdc:mga03683_49867_c1_562_879	100
10	3300061734	Ga0530510_0902169	Ga0530510_0902169_309_626	100
11	iso_pu_bacteria	2513237092	2513623306	101
12	iso_pu_bacteria	2513237096	2513658507	101
13	iso_pu_bacteria	2513237098	2513671963	101
14	iso_pu_bacteria	2513237101	2513694185	101
15	iso_pu_bacteria	2513237137	2513860090	101
16	iso_pu_bacteria	2513237139	2513873749	101
17	iso_pu_bacteria	2513237145	2513920623	101
18	iso_pu_bacteria	2513237161	2514015269	101
19	iso_pu_bacteria	2517572143	2517888612	101
20	iso_pu_bacteria	2524023210	2524467285	101
21	iso_pu_bacteria	2524023228	2524535074	101
22	iso_pu_bacteria	2617270735	2617350891	101
23	iso_pu_bacteria	2617270741	2617373924	101
24	iso_pu_bacteria	2667528175	2671119794	101
25	iso_pu_bacteria	2721755755	2723849469	101
26	iso_pu_bacteria	2728368998	2728750272	101
27	iso_pu_bacteria	2791355196	2793062949	101
28	iso_pu_bacteria	2791355197	2793067437	101
29	iso_pu_bacteria	2791355199	2793076964	101
30	iso_pu_bacteria	2802429603	2805915832	101
31	iso_pu_bacteria	2824671348	2824673361	101
32	iso_pu_bacteria	2824679649	2824685599	101
33	iso_pu_bacteria	2824687955	2824689820	101
34	iso_pu_bacteria	2824696289	2824698184	101
35	iso_pu_bacteria	2824732956	2824740632	101
36	iso_pu_bacteria	2824746037	2824753029	101
37	iso_pu_bacteria	2824773399	2824778567	101
38	iso_pu_bacteria	2838122688	2838124290	101
39	iso_pu_bacteria	2841941048	2841944629	101
40	iso_pu_bacteria	2841949485	2841951769	101
41	iso_pu_bacteria	2841966195	2841969459	101
42	iso_pu_bacteria	2841974524	2841980180	101
43	iso_pu_bacteria	2841983080	2841985437	101
44	iso_pu_bacteria	2842038055	2842043717	101
45	iso_pu_bacteria	2842045827	2842052293	101
46	iso_pu_bacteria	2847939898	2847941921	101
47	iso_pu_bacteria	2849076700	2849082834	101
48	iso_pu_bacteria	2874604998	2874608275	101
49	iso_pu_bacteria	2874612657	2874618014	101
50	iso_pu_bacteria	2874620515	2874624577	101
51	iso_pu_bacteria	2876808645	2876810224	101
52	iso_pu_bacteria	2879110137	2879112960	101
53	iso_pu_bacteria	2885366525	2885371244	101
54	iso_pu_bacteria	2885374607	2885380324	101
55	iso_pu_bacteria	2885383462	2885390216	101
56	iso_pu_bacteria	2889033259	2889035725	101
57	iso_pu_bacteria	2903748898	2903758887	101
58	iso_pu_bacteria	2903768456	2903776078	101
59	iso_pu_bacteria	2904666416	2904672084	101
60	iso_pu_bacteria	2904690495	2904699404	101
61	iso_pu_bacteria	2904699407	2904708223	101
62	iso_pu_bacteria	2906610324	2906614029	101
63	iso_pu_bacteria	2906635258	2906637704	101
64	iso_pu_bacteria	2906660503	2906668272	101
65	iso_pu_bacteria	2908739725	2908747152	101
66	iso_pu_bacteria	2908756301	2908764842	101
67	iso_pu_bacteria	2908775508	2908776440	101
68	iso_pu_bacteria	2922361189	2922364202	101
69	iso_pu_bacteria	2922386360	2922392772	101
70	iso_pu_bacteria	2922393267	2922394392	101
71	iso_pu_bacteria	2922425934	2922434517	101
72	iso_pu_bacteria	2935630451	2935637626	101
73	iso_pu_bacteria	2941507105	2941514137	101
74	iso_pu_bacteria	2941515067	2941522098	101
75	iso_pu_bacteria	2941523033	2941529836	101
76	iso_pu_bacteria	3005474847	3005483710	101
77	iso_pu_bacteria	3005483717	3005487428	101
78	iso_pu_bacteria	3005506211	3005509386	101
79	iso_pu_bacteria	3005587118	3005589588	101
80	iso_pu_bacteria	8006926726	8006932820	101
81	iso_pu_bacteria	8006933436	8006936493	101
82	iso_pu_bacteria	8006964411	8006969544	101
83	iso_pu_bacteria	8006973647	8006976459	101
84	iso_pu_bacteria	8006984368	8006989141	101
85	iso_pu_bacteria	8006994254	8007000099	101
86	iso_pu_bacteria	8019555841	8019562170	101
87	iso_pu_bacteria	8019565922	8019572231	101
88	iso_pu_bacteria	8056673599	8056677814	101
89	iso_pu_bacteria	8056681323	8056687606	101
90	iso_pu_bacteria	8056689827	8056691671	101
91	3300005327	Ga0070658_10072580	Ga0070658_100725803	103
92	3300025909	Ga0207705_10056903	Ga0207705_100569032	103
93	3300005347	Ga0070668_100843012	Ga0070668_1008430122	104
94	3300005438	Ga0070701_10463486	Ga0070701_104634862	104
95	3300005455	Ga0070663_100125036	Ga0070663_1001250362	104
96	3300005535	Ga0070684_101033612	Ga0070684_1010336122	104
97	3300005578	Ga0068854_101240491	Ga0068854_1012404911	104
98	3300009174	Ga0105241_12159047	Ga0105241_121590471	104
99	3300009177	Ga0105248_10619948	Ga0105248_106199481	104
100	3300009553	Ga0105249_11911191	Ga0105249_119111912	104
101	3300010159	Ga0099796_10118145	Ga0099796_101181452	104
102	3300013105	Ga0157369_10361197	Ga0157369_103611972	104
103	3300014969	Ga0157376_11836384	Ga0157376_118363841	104
104	3300025900	Ga0207710_10144305	Ga0207710_101443051	104
105	3300025909	Ga0207705_10402408	Ga0207705_104024082	104
106	3300025972	Ga0207668_11044471	Ga0207668_110444712	104
107	3300026067	Ga0207678_10058466	Ga0207678_100584662	104
108	3300031507	Ga0307509_10251596	Ga0307509_102515963	104
109	3300032126	Ga0307415_101135628	Ga0307415_1011356281	104
110	3300035724	Ga0373933_0000187	Ga0373933_0000187_26975_27289	104
111	3300037466	Ga0395898_0316904	Ga0395898_0316904_766_1080	104
112	3300048909	Ga0496106_0303472	Ga0496106_0303472_669_983	104
113	3300048929	Ga0496126_0017182	Ga0496126_0017182_4778_5092	104
114	3300048929	Ga0496126_0199520	Ga0496126_0199520_1051_1365	104
115	3300049568	Ga0501031_0055522	Ga0501031_0055522_1736_2050	104
116	3300049568	Ga0501031_0423498	Ga0501031_0423498_76_390	104
117	3300049569	Ga0501032_0014183	Ga0501032_0014183_3802_4116	104
118	3300049570	Ga0501033_0000300	Ga0501033_0000300_46158_46472	104
119	3300049570	Ga0501033_0027113	Ga0501033_0027113_949_1263	104
120	3300049570	Ga0501033_0051634	Ga0501033_0051634_2203_2517	104
121	3300049571	Ga0501034_0241594	Ga0501034_0241594_210_524	104
122	3300049571	Ga0501034_0319573	Ga0501034_0319573_531_845	104
123	3300049571	Ga0501034_0683867	Ga0501034_0683867_62_376	104
124	3300049572	Ga0501036_0044651	Ga0501036_0044651_641_955	104
125	3300049572	Ga0501036_0046843	Ga0501036_0046843_2883_3197	104
126	3300049572	Ga0501036_0083002	Ga0501036_0083002_908_1222	104
127	3300049572	Ga0501036_1565690	Ga0501036_1565690_98_412	104
128	3300049573	Ga0501037_0000212	Ga0501037_0000212_23149_23463	104
129	3300049573	Ga0501037_0115868	Ga0501037_0115868_1084_1398	104
130	3300049574	Ga0501038_0001576	Ga0501038_0001576_8880_9194	104
131	3300049574	Ga0501038_0016653	Ga0501038_0016653_5795_6109	104
132	3300049574	Ga0501038_0178921	Ga0501038_0178921_1379_1693	104
133	3300049574	Ga0501038_0702971	Ga0501038_0702971_184_498	104
134	3300049575	Ga0501039_0013346	Ga0501039_0013346_147_461	104
135	3300049575	Ga0501039_0087399	Ga0501039_0087399_224_538	104
136	3300049575	Ga0501039_0104368	Ga0501039_0104368_531_845	104
137	3300049575	Ga0501039_0441775	Ga0501039_0441775_303_617	104
138	3300049576	Ga0501040_0100764	Ga0501040_0100764_941_1255	104
139	3300049577	Ga0501041_0132892	Ga0501041_0132892_638_952	104
140	3300049577	Ga0501041_0284058	Ga0501041_0284058_567_881	104
141	3300049578	Ga0501042_0003673	Ga0501042_0003673_7760_8074	104
142	3300049578	Ga0501042_0030226	Ga0501042_0030226_2943_3257	104
143	3300049579	Ga0501043_0009796	Ga0501043_0009796_383_697	104
144	3300049579	Ga0501043_0010699	Ga0501043_0010699_6285_6599	104
145	3300049579	Ga0501043_0046901	Ga0501043_0046901_3039_3353	104
146	3300049579	Ga0501043_0385517	Ga0501043_0385517_551_865	104
147	3300049580	Ga0501046_0017442	Ga0501046_0017442_2929_3243	104
148	3300049580	Ga0501046_0026622	Ga0501046_0026622_3669_3983	104
149	3300049581	Ga0501047_0349421	Ga0501047_0349421_361_675	104
150	3300049581	Ga0501047_0482459	Ga0501047_0482459_284_598	104
151	3300049582	Ga0501048_0022964	Ga0501048_0022964_2992_3306	104
152	3300049583	Ga0501067_0037308	Ga0501067_0037308_2122_2436	104
153	3300049584	Ga0501068_0097373	Ga0501068_0097373_960_1274	104
154	3300049585	Ga0501069_0203579	Ga0501069_0203579_703_1017	104
155	3300049586	Ga0501070_0135937	Ga0501070_0135937_232_546	104
156	3300049586	Ga0501070_0140687	Ga0501070_0140687_1080_1394	104
157	3300049587	Ga0501071_1354698	Ga0501071_1354698_92_406	104
158	3300049588	Ga0501072_0191622	Ga0501072_0191622_1016_1330	104
159	3300049589	Ga0501073_0163534	Ga0501073_0163534_20_334	104
160	3300049590	Ga0501074_0460481	Ga0501074_0460481_573_887	104
161	3300049592	Ga0501076_0236101	Ga0501076_0236101_517_831	104
162	3300049593	Ga0501077_0106735	Ga0501077_0106735_1147_1461	104
163	3300049741	Ga0501079_0378888	Ga0501079_0378888_738_1052	104
164	3300049742	Ga0501080_0039945	Ga0501080_0039945_2698_3012	104
165	3300049743	Ga0501081_0234636	Ga0501081_0234636_535_849	104
166	3300049744	Ga0501083_0025747	Ga0501083_0025747_573_887	104
167	3300049822	Ga0501035_0460195	Ga0501035_0460195_365_679	104
168	3300049823	Ga0501044_0003557	Ga0501044_0003557_16120_16434	104
169	3300049823	Ga0501044_0032057	Ga0501044_0032057_853_1167	104
170	3300049823	Ga0501044_0062401	Ga0501044_0062401_372_686	104
171	3300049823	Ga0501044_0141689	Ga0501044_0141689_1548_1862	104
172	3300049823	Ga0501044_0298603	Ga0501044_0298603_1099_1413	104
173	3300049824	Ga0501045_0149637	Ga0501045_0149637_1399_1713	104
174	3300049824	Ga0501045_0183344	Ga0501045_0183344_833_1147	104
175	3300060353	Ga0501082_0269553	Ga0501082_0269553_641_955	104
176	3300001979	JGI24740J21852_10137553	JGI24740J21852_101375531	105
177	3300002067	JGI24735J21928_10005614	JGI24735J21928_100056145	105
178	3300002075	JGI24738J21930_10017596	JGI24738J21930_100175963	105
179	3300003322	rootL2_10158404	rootL2_101584044	105
180	3300003659	JGI25404J52841_10002608	JGI25404J52841_100026082	105
181	3300003659	JGI25404J52841_10020295	JGI25404J52841_100202952	105
182	3300003659	JGI25404J52841_10035632	JGI25404J52841_100356322	105
183	3300003659	JGI25404J52841_10091386	JGI25404J52841_100913861	105
184	3300003763	Ga0055529_1007857	Ga0055529_10078572	105
185	3300003911	JGI25405J52794_10046342	JGI25405J52794_100463421	105
186	3300005262	Ga0065165_1001383	Ga0065165_10013833	105
187	3300005290	Ga0065712_10576448	Ga0065712_105764481	105
188	3300005293	Ga0065715_10307051	Ga0065715_103070511	105
189	3300005295	Ga0065707_11030870	Ga0065707_110308701	105
190	3300005327	Ga0070658_10159550	Ga0070658_101595501	105
191	3300005327	Ga0070658_10740572	Ga0070658_107405722	105
192	3300005328	Ga0070676_11007463	Ga0070676_110074631	105
193	3300005329	Ga0070683_100010686	Ga0070683_1000106862	105
194	3300005329	Ga0070683_100633603	Ga0070683_1006336031	105
195	3300005330	Ga0070690_100453172	Ga0070690_1004531722	105
196	3300005330	Ga0070690_100561920	Ga0070690_1005619201	105
197	3300005331	Ga0070670_100630459	Ga0070670_1006304591	105
198	3300005331	Ga0070670_101665225	Ga0070670_1016652251	105
199	3300005333	Ga0070677_10106175	Ga0070677_101061752	105
200	3300005334	Ga0068869_100205866	Ga0068869_1002058662	105
201	3300005334	Ga0068869_100516052	Ga0068869_1005160522	105
202	3300005334	Ga0068869_100548238	Ga0068869_1005482382	105
203	3300005334	Ga0068869_101279482	Ga0068869_1012794821	105
204	3300005334	Ga0068869_101619973	Ga0068869_1016199731	105
205	3300005335	Ga0070666_10630118	Ga0070666_106301181	105
206	3300005336	Ga0070680_100014001	Ga0070680_1000140015	105
207	3300005336	Ga0070680_100045493	Ga0070680_1000454934	105
208	3300005336	Ga0070680_100193195	Ga0070680_1001931952	105
209	3300005336	Ga0070680_100234569	Ga0070680_1002345692	105
210	3300005336	Ga0070680_101655523	Ga0070680_1016555232	105
211	3300005337	Ga0070682_100164260	Ga0070682_1001642601	105
212	3300005337	Ga0070682_100278286	Ga0070682_1002782863	105
213	3300005337	Ga0070682_100569959	Ga0070682_1005699592	105
214	3300005338	Ga0068868_100032306	Ga0068868_1000323062	105
215	3300005338	Ga0068868_100055510	Ga0068868_1000555103	105
216	3300005338	Ga0068868_100375398	Ga0068868_1003753981	105
217	3300005338	Ga0068868_100913314	Ga0068868_1009133141	105
218	3300005338	Ga0068868_101086310	Ga0068868_1010863101	105
219	3300005338	Ga0068868_101263443	Ga0068868_1012634431	105
220	3300005339	Ga0070660_100004691	Ga0070660_1000046917	105
221	3300005339	Ga0070660_100116540	Ga0070660_1001165403	105
222	3300005339	Ga0070660_100156847	Ga0070660_1001568472	105
223	3300005339	Ga0070660_100233498	Ga0070660_1002334982	105
224	3300005339	Ga0070660_100827875	Ga0070660_1008278751	105
225	3300005341	Ga0070691_10153332	Ga0070691_101533321	105
226	3300005341	Ga0070691_10373040	Ga0070691_103730401	105
227	3300005341	Ga0070691_10476091	Ga0070691_104760911	105
228	3300005343	Ga0070687_100130860	Ga0070687_1001308602	105
229	3300005343	Ga0070687_100802882	Ga0070687_1008028821	105
230	3300005344	Ga0070661_100078090	Ga0070661_1000780903	105
231	3300005344	Ga0070661_100152771	Ga0070661_1001527712	105
232	3300005344	Ga0070661_100269106	Ga0070661_1002691061	105
233	3300005344	Ga0070661_101468561	Ga0070661_1014685611	105
234	3300005345	Ga0070692_10257777	Ga0070692_102577772	105
235	3300005345	Ga0070692_10748486	Ga0070692_107484862	105
236	3300005347	Ga0070668_100058218	Ga0070668_1000582183	105
237	3300005347	Ga0070668_100139687	Ga0070668_1001396872	105
238	3300005347	Ga0070668_100604795	Ga0070668_1006047951	105
239	3300005347	Ga0070668_100703328	Ga0070668_1007033282	105
240	3300005347	Ga0070668_102253042	Ga0070668_1022530421	105
241	3300005353	Ga0070669_100630247	Ga0070669_1006302472	105
242	3300005353	Ga0070669_101052425	Ga0070669_1010524251	105
243	3300005354	Ga0070675_100929551	Ga0070675_1009295511	105
244	3300005355	Ga0070671_100063199	Ga0070671_1000631995	105
245	3300005355	Ga0070671_100276066	Ga0070671_1002760662	105
246	3300005355	Ga0070671_100346905	Ga0070671_1003469052	105
247	3300005355	Ga0070671_100798640	Ga0070671_1007986401	105
248	3300005355	Ga0070671_101604849	Ga0070671_1016048491	105
249	3300005356	Ga0070674_100049204	Ga0070674_1000492042	105
250	3300005356	Ga0070674_100445345	Ga0070674_1004453452	105
251	3300005356	Ga0070674_100592572	Ga0070674_1005925722	105
252	3300005364	Ga0070673_100279277	Ga0070673_1002792772	105
253	3300005364	Ga0070673_100526569	Ga0070673_1005265691	105
254	3300005365	Ga0070688_100175960	Ga0070688_1001759602	105
255	3300005365	Ga0070688_100288020	Ga0070688_1002880201	105
256	3300005365	Ga0070688_101045452	Ga0070688_1010454522	105
257	3300005365	Ga0070688_101143766	Ga0070688_1011437661	105
258	3300005366	Ga0070659_100058965	Ga0070659_1000589654	105
259	3300005366	Ga0070659_100181158	Ga0070659_1001811582	105
260	3300005366	Ga0070659_102152873	Ga0070659_1021528731	105
261	3300005367	Ga0070667_100676427	Ga0070667_1006764271	105
262	3300005367	Ga0070667_100873417	Ga0070667_1008734172	105
263	3300005367	Ga0070667_101545146	Ga0070667_1015451461	105
264	3300005367	Ga0070667_101841340	Ga0070667_1018413401	105
265	3300005406	Ga0070703_10064934	Ga0070703_100649341	105
266	3300005434	Ga0070709_10032883	Ga0070709_100328832	105
267	3300005434	Ga0070709_10121393	Ga0070709_101213931	105
268	3300005434	Ga0070709_10310026	Ga0070709_103100261	105
269	3300005434	Ga0070709_11077158	Ga0070709_110771581	105
270	3300005435	Ga0070714_100651830	Ga0070714_1006518302	105
271	3300005435	Ga0070714_101067354	Ga0070714_1010673541	105
272	3300005435	Ga0070714_101232304	Ga0070714_1012323041	105
273	3300005436	Ga0070713_100064982	Ga0070713_1000649824	105
274	3300005436	Ga0070713_100629600	Ga0070713_1006296001	105
275	3300005436	Ga0070713_101170462	Ga0070713_1011704621	105
276	3300005437	Ga0070710_10424488	Ga0070710_104244882	105
277	3300005437	Ga0070710_10462703	Ga0070710_104627031	105
278	3300005437	Ga0070710_11324484	Ga0070710_113244842	105
279	3300005438	Ga0070701_10114065	Ga0070701_101140652	105
280	3300005439	Ga0070711_100686963	Ga0070711_1006869631	105
281	3300005441	Ga0070700_100102084	Ga0070700_1001020841	105
282	3300005444	Ga0070694_100835616	Ga0070694_1008356162	105
283	3300005444	Ga0070694_101249074	Ga0070694_1012490741	105
284	3300005445	Ga0070708_100152359	Ga0070708_1001523594	105
285	3300005445	Ga0070708_101356995	Ga0070708_1013569952	105
286	3300005455	Ga0070663_100004964	Ga0070663_10000496410	105
287	3300005455	Ga0070663_100016779	Ga0070663_1000167795	105
288	3300005455	Ga0070663_100134943	Ga0070663_1001349431	105
289	3300005455	Ga0070663_100160887	Ga0070663_1001608871	105
290	3300005455	Ga0070663_100179722	Ga0070663_1001797222	105
291	3300005455	Ga0070663_100187918	Ga0070663_1001879182	105
292	3300005455	Ga0070663_100234092	Ga0070663_1002340922	105
293	3300005455	Ga0070663_100269379	Ga0070663_1002693792	105
294	3300005455	Ga0070663_100312694	Ga0070663_1003126942	105
295	3300005455	Ga0070663_100396450	Ga0070663_1003964502	105
296	3300005455	Ga0070663_100752862	Ga0070663_1007528621	105
297	3300005456	Ga0070678_100038407	Ga0070678_1000384074	105
298	3300005456	Ga0070678_100048318	Ga0070678_1000483182	105
299	3300005456	Ga0070678_100480269	Ga0070678_1004802692	105
300	3300005456	Ga0070678_100555619	Ga0070678_1005556192	105
301	3300005456	Ga0070678_100829011	Ga0070678_1008290112	105
302	3300005457	Ga0070662_100125869	Ga0070662_1001258693	105
303	3300005457	Ga0070662_100291563	Ga0070662_1002915632	105
304	3300005457	Ga0070662_100377223	Ga0070662_1003772232	105
305	3300005457	Ga0070662_100727786	Ga0070662_1007277861	105
306	3300005457	Ga0070662_101421863	Ga0070662_1014218631	105
307	3300005458	Ga0070681_10016653	Ga0070681_100166533	105
308	3300005458	Ga0070681_10022259	Ga0070681_100222596	105
309	3300005458	Ga0070681_10022991	Ga0070681_100229915	105
310	3300005458	Ga0070681_10076536	Ga0070681_100765362	105
311	3300005459	Ga0068867_100884622	Ga0068867_1008846222	105
312	3300005459	Ga0068867_101083262	Ga0068867_1010832621	105
313	3300005459	Ga0068867_102149515	Ga0068867_1021495151	105
314	3300005466	Ga0070685_10302827	Ga0070685_103028271	105
315	3300005466	Ga0070685_10614567	Ga0070685_106145671	105
316	3300005467	Ga0070706_100500397	Ga0070706_1005003972	105
317	3300005467	Ga0070706_100599389	Ga0070706_1005993892	105
318	3300005467	Ga0070706_100682790	Ga0070706_1006827902	105
319	3300005468	Ga0070707_100121704	Ga0070707_1001217042	105
320	3300005468	Ga0070707_100601604	Ga0070707_1006016042	105
321	3300005471	Ga0070698_100070288	Ga0070698_1000702884	105
322	3300005471	Ga0070698_100260153	Ga0070698_1002601532	105
323	3300005471	Ga0070698_100513377	Ga0070698_1005133772	105
324	3300005518	Ga0070699_100927777	Ga0070699_1009277771	105
325	3300005518	Ga0070699_101327752	Ga0070699_1013277522	105
326	3300005518	Ga0070699_101786987	Ga0070699_1017869871	105
327	3300005530	Ga0070679_100007145	Ga0070679_1000071452	105
328	3300005530	Ga0070679_100034273	Ga0070679_1000342734	105
329	3300005530	Ga0070679_100115707	Ga0070679_1001157077	105
330	3300005530	Ga0070679_100188247	Ga0070679_1001882471	105
331	3300005530	Ga0070679_100281899	Ga0070679_1002818994	105
332	3300005530	Ga0070679_101046836	Ga0070679_1010468362	105
333	3300005535	Ga0070684_100011913	Ga0070684_1000119135	105
334	3300005535	Ga0070684_100036427	Ga0070684_1000364272	105
335	3300005535	Ga0070684_101403952	Ga0070684_1014039522	105
336	3300005536	Ga0070697_100035746	Ga0070697_1000357465	105
337	3300005536	Ga0070697_100472005	Ga0070697_1004720052	105
338	3300005539	Ga0068853_100004567	Ga0068853_1000045675	105
339	3300005539	Ga0068853_100012846	Ga0068853_1000128464	105
340	3300005539	Ga0068853_100157264	Ga0068853_1001572643	105
341	3300005539	Ga0068853_100165929	Ga0068853_1001659292	105
342	3300005539	Ga0068853_100431708	Ga0068853_1004317082	105
343	3300005539	Ga0068853_100525823	Ga0068853_1005258232	105
344	3300005539	Ga0068853_100665190	Ga0068853_1006651902	105
345	3300005539	Ga0068853_100826379	Ga0068853_1008263792	105
346	3300005539	Ga0068853_101514291	Ga0068853_1015142912	105
347	3300005543	Ga0070672_100262483	Ga0070672_1002624832	105
348	3300005543	Ga0070672_100360585	Ga0070672_1003605853	105
349	3300005543	Ga0070672_101135940	Ga0070672_1011359402	105
350	3300005544	Ga0070686_100025001	Ga0070686_1000250015	105
351	3300005545	Ga0070695_100682144	Ga0070695_1006821441	105
352	3300005546	Ga0070696_100901475	Ga0070696_1009014751	105
353	3300005547	Ga0070693_100084503	Ga0070693_1000845033	105
354	3300005547	Ga0070693_100210806	Ga0070693_1002108062	105
355	3300005547	Ga0070693_100333912	Ga0070693_1003339121	105
356	3300005547	Ga0070693_100842933	Ga0070693_1008429331	105
357	3300005548	Ga0070665_100053520	Ga0070665_1000535202	105
358	3300005548	Ga0070665_100066902	Ga0070665_1000669025	105
359	3300005548	Ga0070665_100105129	Ga0070665_1001051294	105
360	3300005548	Ga0070665_100159449	Ga0070665_1001594494	105
361	3300005548	Ga0070665_100348784	Ga0070665_1003487842	105
362	3300005548	Ga0070665_100455910	Ga0070665_1004559102	105
363	3300005548	Ga0070665_100548199	Ga0070665_1005481991	105
364	3300005548	Ga0070665_100702149	Ga0070665_1007021491	105
365	3300005548	Ga0070665_101282530	Ga0070665_1012825301	105
366	3300005548	Ga0070665_101511353	Ga0070665_1015113531	105
367	3300005548	Ga0070665_102001190	Ga0070665_1020011902	105
368	3300005563	Ga0068855_100061912	Ga0068855_1000619127	105
369	3300005563	Ga0068855_100179625	Ga0068855_1001796252	105
370	3300005563	Ga0068855_100218094	Ga0068855_1002180942	105
371	3300005563	Ga0068855_100251479	Ga0068855_1002514793	105
372	3300005563	Ga0068855_100263623	Ga0068855_1002636232	105
373	3300005563	Ga0068855_100369198	Ga0068855_1003691982	105
374	3300005563	Ga0068855_100421753	Ga0068855_1004217532	105
375	3300005563	Ga0068855_100561985	Ga0068855_1005619852	105
376	3300005563	Ga0068855_100765361	Ga0068855_1007653612	105
377	3300005563	Ga0068855_101070266	Ga0068855_1010702661	105
378	3300005563	Ga0068855_101139451	Ga0068855_1011394511	105
379	3300005563	Ga0068855_101180999	Ga0068855_1011809992	105
380	3300005564	Ga0070664_100129213	Ga0070664_1001292133	105
381	3300005564	Ga0070664_100225462	Ga0070664_1002254622	105
382	3300005564	Ga0070664_100383266	Ga0070664_1003832662	105
383	3300005564	Ga0070664_100527763	Ga0070664_1005277632	105
384	3300005577	Ga0068857_100025975	Ga0068857_1000259755	105
385	3300005577	Ga0068857_100098628	Ga0068857_1000986282	105
386	3300005577	Ga0068857_100135122	Ga0068857_1001351222	105
387	3300005577	Ga0068857_100418754	Ga0068857_1004187542	105
388	3300005577	Ga0068857_100466167	Ga0068857_1004661672	105
389	3300005577	Ga0068857_100479845	Ga0068857_1004798452	105
390	3300005578	Ga0068854_100084836	Ga0068854_1000848362	105
391	3300005578	Ga0068854_100168675	Ga0068854_1001686752	105
392	3300005578	Ga0068854_100202641	Ga0068854_1002026412	105
393	3300005578	Ga0068854_100344052	Ga0068854_1003440522	105
394	3300005578	Ga0068854_100351846	Ga0068854_1003518462	105
395	3300005578	Ga0068854_100381576	Ga0068854_1003815762	105
396	3300005578	Ga0068854_102160257	Ga0068854_1021602571	105
397	3300005614	Ga0068856_100004535	Ga0068856_1000045354	105
398	3300005614	Ga0068856_100099891	Ga0068856_1000998914	105
399	3300005614	Ga0068856_100352866	Ga0068856_1003528662	105
400	3300005614	Ga0068856_100375486	Ga0068856_1003754863	105
401	3300005614	Ga0068856_100594410	Ga0068856_1005944102	105
402	3300005614	Ga0068856_100961210	Ga0068856_1009612102	105
403	3300005614	Ga0068856_101910622	Ga0068856_1019106221	105
404	3300005614	Ga0068856_101975991	Ga0068856_1019759911	105
405	3300005614	Ga0068856_101982176	Ga0068856_1019821761	105
406	3300005615	Ga0070702_100081177	Ga0070702_1000811772	105
407	3300005615	Ga0070702_101275140	Ga0070702_1012751401	105
408	3300005615	Ga0070702_101330554	Ga0070702_1013305542	105
409	3300005616	Ga0068852_100473508	Ga0068852_1004735081	105
410	3300005616	Ga0068852_101139226	Ga0068852_1011392262	105
411	3300005616	Ga0068852_101601400	Ga0068852_1016014002	105
412	3300005616	Ga0068852_101808131	Ga0068852_1018081311	105
413	3300005617	Ga0068859_102087737	Ga0068859_1020877372	105
414	3300005617	Ga0068859_102670610	Ga0068859_1026706101	105
415	3300005618	Ga0068864_100497225	Ga0068864_1004972252	105
416	3300005618	Ga0068864_100584355	Ga0068864_1005843552	105
417	3300005618	Ga0068864_101016283	Ga0068864_1010162831	105
418	3300005618	Ga0068864_101224439	Ga0068864_1012244393	105
419	3300005618	Ga0068864_101393762	Ga0068864_1013937622	105
420	3300005718	Ga0068866_10042977	Ga0068866_100429774	105
421	3300005718	Ga0068866_10259854	Ga0068866_102598542	105
422	3300005719	Ga0068861_100033886	Ga0068861_1000338862	105
423	3300005719	Ga0068861_100046280	Ga0068861_1000462803	105
424	3300005719	Ga0068861_100116632	Ga0068861_1001166323	105
425	3300005719	Ga0068861_100377436	Ga0068861_1003774362	105
426	3300005834	Ga0068851_10016737	Ga0068851_100167372	105
427	3300005834	Ga0068851_10108107	Ga0068851_101081073	105
428	3300005834	Ga0068851_10136633	Ga0068851_101366332	105
429	3300005834	Ga0068851_10137591	Ga0068851_101375912	105
430	3300005834	Ga0068851_10669491	Ga0068851_106694912	105
431	3300005840	Ga0068870_10011211	Ga0068870_100112113	105
432	3300005841	Ga0068863_100476813	Ga0068863_1004768132	105
433	3300005841	Ga0068863_100481319	Ga0068863_1004813192	105
434	3300005841	Ga0068863_100970353	Ga0068863_1009703532	105
435	3300005842	Ga0068858_100022209	Ga0068858_1000222094	105
436	3300005842	Ga0068858_101015851	Ga0068858_1010158511	105
437	3300005843	Ga0068860_100000146	Ga0068860_10000014668	105
438	3300005843	Ga0068860_100456772	Ga0068860_1004567722	105
439	3300005843	Ga0068860_100480401	Ga0068860_1004804011	105
440	3300005843	Ga0068860_101562543	Ga0068860_1015625432	105
441	3300005843	Ga0068860_101896480	Ga0068860_1018964801	105
442	3300005844	Ga0068862_100252609	Ga0068862_1002526091	105
443	3300005844	Ga0068862_100395737	Ga0068862_1003957372	105
444	3300005844	Ga0068862_100560098	Ga0068862_1005600981	105
445	3300005844	Ga0068862_100661448	Ga0068862_1006614482	105
446	3300005844	Ga0068862_100725937	Ga0068862_1007259372	105
447	3300005844	Ga0068862_100780659	Ga0068862_1007806592	105
448	3300005937	Ga0081455_10000529	Ga0081455_1000052944	105
449	3300005937	Ga0081455_10013219	Ga0081455_100132192	105
450	3300005937	Ga0081455_10073523	Ga0081455_100735233	105
451	3300005937	Ga0081455_10075693	Ga0081455_100756933	105
452	3300005937	Ga0081455_10081501	Ga0081455_100815013	105
453	3300005937	Ga0081455_10283166	Ga0081455_102831661	105
454	3300005981	Ga0081538_10045410	Ga0081538_100454104	105
455	3300005983	Ga0081540_1002942	Ga0081540_10029428	105
456	3300005983	Ga0081540_1002967	Ga0081540_10029675	105
457	3300005983	Ga0081540_1006156	Ga0081540_10061565	105
458	3300005983	Ga0081540_1007439	Ga0081540_10074398	105
459	3300005983	Ga0081540_1009058	Ga0081540_10090586	105
460	3300005983	Ga0081540_1022583	Ga0081540_10225835	105
461	3300005983	Ga0081540_1038337	Ga0081540_10383373	105
462	3300005983	Ga0081540_1038576	Ga0081540_10385766	105
463	3300005983	Ga0081540_1074267	Ga0081540_10742672	105
464	3300005983	Ga0081540_1088474	Ga0081540_10884742	105
465	3300005983	Ga0081540_1112537	Ga0081540_11125372	105
466	3300005985	Ga0081539_10004031	Ga0081539_1000403116	105
467	3300005985	Ga0081539_10015361	Ga0081539_100153614	105
468	3300006028	Ga0070717_10000921	Ga0070717_1000092120	105
469	3300006028	Ga0070717_10276771	Ga0070717_102767712	105
470	3300006028	Ga0070717_11297202	Ga0070717_112972021	105
471	3300006038	Ga0075365_10013833	Ga0075365_100138337	105
472	3300006038	Ga0075365_10065799	Ga0075365_100657992	105
473	3300006038	Ga0075365_10075726	Ga0075365_100757264	105
474	3300006038	Ga0075365_10104190	Ga0075365_101041902	105
475	3300006038	Ga0075365_10260258	Ga0075365_102602582	105
476	3300006038	Ga0075365_10514212	Ga0075365_105142122	105
477	3300006038	Ga0075365_10693333	Ga0075365_106933331	105
478	3300006042	Ga0075368_10025298	Ga0075368_100252983	105
479	3300006042	Ga0075368_10043426	Ga0075368_100434263	105
480	3300006042	Ga0075368_10241406	Ga0075368_102414061	105
481	3300006048	Ga0075363_100080105	Ga0075363_1000801051	105
482	3300006048	Ga0075363_100120395	Ga0075363_1001203953	105
483	3300006048	Ga0075363_100303111	Ga0075363_1003031112	105
484	3300006051	Ga0075364_10082015	Ga0075364_100820153	105
485	3300006051	Ga0075364_10193897	Ga0075364_101938972	105
486	3300006051	Ga0075364_10482470	Ga0075364_104824701	105
487	3300006058	Ga0075432_10056253	Ga0075432_100562532	105
488	3300006163	Ga0070715_10086346	Ga0070715_100863464	105
489	3300006163	Ga0070715_10279832	Ga0070715_102798322	105
490	3300006163	Ga0070715_10658342	Ga0070715_106583421	105
491	3300006173	Ga0070716_100126406	Ga0070716_1001264064	105
492	3300006173	Ga0070716_100584041	Ga0070716_1005840412	105
493	3300006173	Ga0070716_101265472	Ga0070716_1012654721	105
494	3300006175	Ga0070712_100108184	Ga0070712_1001081842	105
495	3300006175	Ga0070712_101182445	Ga0070712_1011824452	105
496	3300006175	Ga0070712_101475599	Ga0070712_1014755992	105
497	3300006175	Ga0070712_101854768	Ga0070712_1018547681	105
498	3300006175	Ga0070712_101859744	Ga0070712_1018597441	105
499	3300006177	Ga0075362_10058080	Ga0075362_100580802	105
500	3300006177	Ga0075362_10110902	Ga0075362_101109022	105
501	3300006177	Ga0075362_10478679	Ga0075362_104786791	105
502	3300006178	Ga0075367_10009454	Ga0075367_100094548	105
503	3300006178	Ga0075367_10259138	Ga0075367_102591382	105
504	3300006178	Ga0075367_10266676	Ga0075367_102666762	105
505	3300006178	Ga0075367_10710167	Ga0075367_107101671	105
506	3300006186	Ga0075369_10099206	Ga0075369_100992062	105
507	3300006186	Ga0075369_10355689	Ga0075369_103556892	105
508	3300006186	Ga0075369_10395072	Ga0075369_103950722	105
509	3300006186	Ga0075369_10431979	Ga0075369_104319792	105
510	3300006194	Ga0075427_10016075	Ga0075427_100160752	105
511	3300006195	Ga0075366_10044842	Ga0075366_100448424	105
512	3300006195	Ga0075366_10055840	Ga0075366_100558403	105
513	3300006195	Ga0075366_10184265	Ga0075366_101842652	105
514	3300006195	Ga0075366_10221856	Ga0075366_102218562	105
515	3300006195	Ga0075366_10386656	Ga0075366_103866562	105
516	3300006195	Ga0075366_10397054	Ga0075366_103970542	105
517	3300006237	Ga0097621_100067295	Ga0097621_1000672952	105
518	3300006237	Ga0097621_100311525	Ga0097621_1003115252	105
519	3300006237	Ga0097621_100358425	Ga0097621_1003584252	105
520	3300006237	Ga0097621_100686832	Ga0097621_1006868322	105
521	3300006237	Ga0097621_100746575	Ga0097621_1007465752	105
522	3300006237	Ga0097621_101375683	Ga0097621_1013756831	105
523	3300006353	Ga0075370_10022767	Ga0075370_100227675	105
524	3300006353	Ga0075370_10087891	Ga0075370_100878912	105
525	3300006353	Ga0075370_10179809	Ga0075370_101798092	105
526	3300006353	Ga0075370_10435306	Ga0075370_104353062	105
527	3300006358	Ga0068871_100099400	Ga0068871_1000994004	105
528	3300006358	Ga0068871_100568288	Ga0068871_1005682883	105
529	3300006358	Ga0068871_100658259	Ga0068871_1006582591	105
530	3300006358	Ga0068871_100667875	Ga0068871_1006678751	105
531	3300006358	Ga0068871_100908200	Ga0068871_1009082002	105
532	3300006358	Ga0068871_101086175	Ga0068871_1010861751	105
533	3300006358	Ga0068871_102013661	Ga0068871_1020136611	105
534	3300006844	Ga0075428_101475349	Ga0075428_1014753491	105
535	3300006844	Ga0075428_102301280	Ga0075428_1023012801	105
536	3300006871	Ga0075434_100036748	Ga0075434_1000367483	105
537	3300006871	Ga0075434_100110045	Ga0075434_1001100453	105
538	3300006871	Ga0075434_100173018	Ga0075434_1001730181	105
539	3300006871	Ga0075434_100624093	Ga0075434_1006240932	105
540	3300006881	Ga0068865_100035229	Ga0068865_1000352294	105
541	3300006881	Ga0068865_100125321	Ga0068865_1001253213	105
542	3300006881	Ga0068865_101100856	Ga0068865_1011008561	105
543	3300006881	Ga0068865_101433524	Ga0068865_1014335242	105
544	3300006914	Ga0075436_100137780	Ga0075436_1001377802	105
545	3300006914	Ga0075436_100723849	Ga0075436_1007238492	105
546	3300006914	Ga0075436_101537619	Ga0075436_1015376191	105
547	3300006931	Ga0097620_102087601	Ga0097620_1020876012	105
548	3300006931	Ga0097620_102671569	Ga0097620_1026715692	105
549	3300006941	Ga0099825_1060993	Ga0099825_10609931	105
550	3300006942	Ga0099824_1005353	Ga0099824_100535311	105
551	3300006943	Ga0099822_1005965	Ga0099822_10059657	105
552	3300007076	Ga0075435_100070342	Ga0075435_1000703422	105
553	3300007265	Ga0099794_10012126	Ga0099794_100121263	105
554	3300007265	Ga0099794_10012643	Ga0099794_100126434	105
555	3300007788	Ga0099795_10151098	Ga0099795_101510982	105
556	3300007788	Ga0099795_10302781	Ga0099795_103027812	105
557	3300007788	Ga0099795_10309636	Ga0099795_103096362	105
558	3300009036	Ga0105244_10143608	Ga0105244_101436082	105
559	3300009092	Ga0105250_10044464	Ga0105250_100444641	105
560	3300009093	Ga0105240_10003165	Ga0105240_1000316522	105
561	3300009093	Ga0105240_10018737	Ga0105240_100187374	105
562	3300009093	Ga0105240_10027144	Ga0105240_1002714410	105
563	3300009093	Ga0105240_10305384	Ga0105240_103053843	105
564	3300009093	Ga0105240_10343866	Ga0105240_103438662	105
565	3300009093	Ga0105240_10346986	Ga0105240_103469861	105
566	3300009093	Ga0105240_10886902	Ga0105240_108869022	105
567	3300009094	Ga0111539_10075408	Ga0111539_100754086	105
568	3300009094	Ga0111539_10463630	Ga0111539_104636303	105
569	3300009094	Ga0111539_10785760	Ga0111539_107857602	105
570	3300009094	Ga0111539_11276182	Ga0111539_112761821	105
571	3300009098	Ga0105245_10018561	Ga0105245_100185613	105
572	3300009098	Ga0105245_10066825	Ga0105245_100668254	105
573	3300009098	Ga0105245_10125549	Ga0105245_101255493	105
574	3300009098	Ga0105245_10252785	Ga0105245_102527852	105
575	3300009098	Ga0105245_10268179	Ga0105245_102681793	105
576	3300009098	Ga0105245_10310050	Ga0105245_103100503	105
577	3300009098	Ga0105245_10588195	Ga0105245_105881952	105
578	3300009098	Ga0105245_12764411	Ga0105245_127644112	105
579	3300009101	Ga0105247_10032579	Ga0105247_100325794	105
580	3300009101	Ga0105247_10079257	Ga0105247_100792572	105
581	3300009101	Ga0105247_10305606	Ga0105247_103056061	105
582	3300009101	Ga0105247_10542351	Ga0105247_105423512	105
583	3300009101	Ga0105247_10898542	Ga0105247_108985421	105
584	3300009101	Ga0105247_11005341	Ga0105247_110053411	105
585	3300009101	Ga0105247_11241426	Ga0105247_112414261	105
586	3300009101	Ga0105247_11675898	Ga0105247_116758981	105
587	3300009147	Ga0114129_10169760	Ga0114129_101697603	105
588	3300009147	Ga0114129_10561499	Ga0114129_105614992	105
589	3300009148	Ga0105243_10199563	Ga0105243_101995632	105
590	3300009148	Ga0105243_10383577	Ga0105243_103835772	105
591	3300009148	Ga0105243_10529704	Ga0105243_105297042	105
592	3300009148	Ga0105243_11472117	Ga0105243_114721171	105
593	3300009174	Ga0105241_10027977	Ga0105241_100279773	105
594	3300009174	Ga0105241_10060985	Ga0105241_100609851	105
595	3300009174	Ga0105241_10119038	Ga0105241_101190381	105
596	3300009174	Ga0105241_10132401	Ga0105241_101324013	105
597	3300009174	Ga0105241_10182560	Ga0105241_101825601	105
598	3300009174	Ga0105241_10632019	Ga0105241_106320191	105
599	3300009174	Ga0105241_10751590	Ga0105241_107515902	105
600	3300009174	Ga0105241_12539719	Ga0105241_125397191	105
601	3300009176	Ga0105242_10111139	Ga0105242_101111393	105
602	3300009176	Ga0105242_10460772	Ga0105242_104607722	105
603	3300009176	Ga0105242_10627210	Ga0105242_106272102	105
604	3300009176	Ga0105242_12587130	Ga0105242_125871302	105
605	3300009176	Ga0105242_12589534	Ga0105242_125895341	105
606	3300009176	Ga0105242_13148728	Ga0105242_131487281	105
607	3300009177	Ga0105248_10212071	Ga0105248_102120712	105
608	3300009177	Ga0105248_10422548	Ga0105248_104225482	105
609	3300009177	Ga0105248_11069516	Ga0105248_110695162	105
610	3300009177	Ga0105248_11199457	Ga0105248_111994571	105
611	3300009177	Ga0105248_12608258	Ga0105248_126082581	105
612	3300009545	Ga0105237_10009523	Ga0105237_100095239	105
613	3300009545	Ga0105237_10012128	Ga0105237_100121289	105
614	3300009545	Ga0105237_10048342	Ga0105237_100483421	105
615	3300009545	Ga0105237_10106312	Ga0105237_101063123	105
616	3300009545	Ga0105237_10122720	Ga0105237_101227204	105
617	3300009545	Ga0105237_10174523	Ga0105237_101745231	105
618	3300009545	Ga0105237_10308382	Ga0105237_103083823	105
619	3300009545	Ga0105237_10459581	Ga0105237_104595812	105
620	3300009545	Ga0105237_10567082	Ga0105237_105670821	105
621	3300009545	Ga0105237_10876524	Ga0105237_108765242	105
622	3300009545	Ga0105237_11521222	Ga0105237_115212221	105
623	3300009551	Ga0105238_10000447	Ga0105238_1000044736	105
624	3300009551	Ga0105238_10035341	Ga0105238_100353414	105
625	3300009551	Ga0105238_10265590	Ga0105238_102655902	105
626	3300009551	Ga0105238_10298178	Ga0105238_102981782	105
627	3300009551	Ga0105238_10345513	Ga0105238_103455132	105
628	3300009551	Ga0105238_10390487	Ga0105238_103904872	105
629	3300009551	Ga0105238_10489318	Ga0105238_104893182	105
630	3300009551	Ga0105238_10683279	Ga0105238_106832791	105
631	3300009551	Ga0105238_12902910	Ga0105238_129029101	105
632	3300009551	Ga0105238_12912137	Ga0105238_129121371	105
633	3300009553	Ga0105249_10229348	Ga0105249_102293482	105
634	3300009553	Ga0105249_10364172	Ga0105249_103641722	105
635	3300009553	Ga0105249_10418611	Ga0105249_104186112	105
636	3300009553	Ga0105249_11476154	Ga0105249_114761542	105
637	3300009553	Ga0105249_11652514	Ga0105249_116525141	105
638	3300009553	Ga0105249_12971832	Ga0105249_129718321	105
639	3300010159	Ga0099796_10105265	Ga0099796_101052651	105
640	3300010375	Ga0105239_10050599	Ga0105239_100505996	105
641	3300010375	Ga0105239_10130442	Ga0105239_101304423	105
642	3300010375	Ga0105239_10149437	Ga0105239_101494373	105
643	3300010375	Ga0105239_10170738	Ga0105239_101707383	105
644	3300010375	Ga0105239_10217656	Ga0105239_102176562	105
645	3300010375	Ga0105239_10964807	Ga0105239_109648071	105
646	3300010375	Ga0105239_11355814	Ga0105239_113558142	105
647	3300010375	Ga0105239_11371643	Ga0105239_113716432	105
648	3300010375	Ga0105239_12702724	Ga0105239_127027241	105
649	3300010375	Ga0105239_12748230	Ga0105239_127482301	105
650	3300011119	Ga0105246_10008520	Ga0105246_100085203	105
651	3300011119	Ga0105246_10018685	Ga0105246_100186854	105
652	3300011119	Ga0105246_10097570	Ga0105246_100975703	105
653	3300011119	Ga0105246_10133357	Ga0105246_101333571	105
654	3300011119	Ga0105246_10330042	Ga0105246_103300424	105
655	3300011119	Ga0105246_10452483	Ga0105246_104524832	105
656	3300011119	Ga0105246_10589879	Ga0105246_105898792	105
657	3300011119	Ga0105246_10926253	Ga0105246_109262531	105
658	3300011119	Ga0105246_11031000	Ga0105246_110310001	105
659	3300012488	Ga0157343_1007325	Ga0157343_10073251	105
660	3300012513	Ga0157326_1098571	Ga0157326_10985711	105
661	3300013100	Ga0157373_10420053	Ga0157373_104200531	105
662	3300013100	Ga0157373_10423855	Ga0157373_104238551	105
663	3300013102	Ga0157371_10060775	Ga0157371_100607753	105
664	3300013102	Ga0157371_10350573	Ga0157371_103505732	105
665	3300013102	Ga0157371_10974399	Ga0157371_109743991	105
666	3300013102	Ga0157371_11364815	Ga0157371_113648152	105
667	3300013104	Ga0157370_10074879	Ga0157370_100748792	105
668	3300013104	Ga0157370_10100708	Ga0157370_101007083	105
669	3300013104	Ga0157370_10321501	Ga0157370_103215011	105
670	3300013104	Ga0157370_10392468	Ga0157370_103924682	105
671	3300013104	Ga0157370_11802462	Ga0157370_118024621	105
672	3300013105	Ga0157369_10107769	Ga0157369_101077692	105
673	3300013105	Ga0157369_10145551	Ga0157369_101455511	105
674	3300013105	Ga0157369_10159564	Ga0157369_101595644	105
675	3300013105	Ga0157369_10279615	Ga0157369_102796155	105
676	3300013105	Ga0157369_10466780	Ga0157369_104667801	105
677	3300013105	Ga0157369_11317386	Ga0157369_113173861	105
678	3300013296	Ga0157374_10043515	Ga0157374_100435152	105
679	3300013296	Ga0157374_10219358	Ga0157374_102193582	105
680	3300013296	Ga0157374_10239206	Ga0157374_102392062	105
681	3300013296	Ga0157374_10414859	Ga0157374_104148592	105
682	3300013296	Ga0157374_11293161	Ga0157374_112931611	105
683	3300013296	Ga0157374_11752113	Ga0157374_117521131	105
684	3300013296	Ga0157374_11831842	Ga0157374_118318422	105
685	3300013297	Ga0157378_10003984	Ga0157378_100039847	105
686	3300013297	Ga0157378_10370241	Ga0157378_103702412	105
687	3300013297	Ga0157378_10676448	Ga0157378_106764482	105
688	3300013297	Ga0157378_11013000	Ga0157378_110130002	105
689	3300013297	Ga0157378_11119527	Ga0157378_111195271	105
690	3300013297	Ga0157378_12106905	Ga0157378_121069052	105
691	3300013297	Ga0157378_12820798	Ga0157378_128207981	105
692	3300013297	Ga0157378_12883139	Ga0157378_128831392	105
693	3300013306	Ga0163162_10147490	Ga0163162_101474903	105
694	3300013306	Ga0163162_10155123	Ga0163162_101551234	105
695	3300013306	Ga0163162_10201812	Ga0163162_102018122	105
696	3300013306	Ga0163162_10792556	Ga0163162_107925562	105
697	3300013306	Ga0163162_11086176	Ga0163162_110861762	105
698	3300013306	Ga0163162_11477187	Ga0163162_114771871	105
699	3300013306	Ga0163162_12172697	Ga0163162_121726972	105
700	3300013306	Ga0163162_12417781	Ga0163162_124177811	105
701	3300013307	Ga0157372_10336472	Ga0157372_103364723	105
702	3300013307	Ga0157372_10607595	Ga0157372_106075952	105
703	3300013307	Ga0157372_10643952	Ga0157372_106439522	105
704	3300013307	Ga0157372_10795056	Ga0157372_107950562	105
705	3300013307	Ga0157372_10932646	Ga0157372_109326461	105
706	3300013307	Ga0157372_11469974	Ga0157372_114699741	105
707	3300013307	Ga0157372_11576285	Ga0157372_115762852	105
708	3300013307	Ga0157372_11754711	Ga0157372_117547111	105
709	3300013308	Ga0157375_10008110	Ga0157375_100081106	105
710	3300013308	Ga0157375_10312757	Ga0157375_103127571	105
711	3300013308	Ga0157375_10320726	Ga0157375_103207262	105
712	3300013308	Ga0157375_11241893	Ga0157375_112418931	105
713	3300013308	Ga0157375_11285854	Ga0157375_112858541	105
714	3300013308	Ga0157375_11504098	Ga0157375_115040982	105
715	3300014325	Ga0163163_10021545	Ga0163163_100215453	105
716	3300014325	Ga0163163_10165902	Ga0163163_101659023	105
717	3300014325	Ga0163163_10270683	Ga0163163_102706832	105
718	3300014325	Ga0163163_10289990	Ga0163163_102899902	105
719	3300014325	Ga0163163_10378096	Ga0163163_103780963	105
720	3300014325	Ga0163163_11893374	Ga0163163_118933741	105
721	3300014326	Ga0157380_10126730	Ga0157380_101267302	105
722	3300014326	Ga0157380_10813657	Ga0157380_108136571	105
723	3300014326	Ga0157380_11102945	Ga0157380_111029452	105
724	3300014326	Ga0157380_11317773	Ga0157380_113177731	105
725	3300014326	Ga0157380_11697646	Ga0157380_116976461	105
726	3300014326	Ga0157380_12794160	Ga0157380_127941601	105
727	3300014745	Ga0157377_10095022	Ga0157377_100950222	105
728	3300014745	Ga0157377_11290203	Ga0157377_112902031	105
729	3300014968	Ga0157379_10060017	Ga0157379_100600172	105
730	3300014968	Ga0157379_10345507	Ga0157379_103455071	105
731	3300014968	Ga0157379_10547555	Ga0157379_105475552	105
732	3300014968	Ga0157379_10603654	Ga0157379_106036542	105
733	3300014968	Ga0157379_10687514	Ga0157379_106875142	105
734	3300014969	Ga0157376_10012433	Ga0157376_100124334	105
735	3300014969	Ga0157376_10517081	Ga0157376_105170811	105
736	3300014969	Ga0157376_10926506	Ga0157376_109265061	105
737	3300014969	Ga0157376_11069929	Ga0157376_110699291	105
738	3300014969	Ga0157376_11089240	Ga0157376_110892401	105
739	3300014969	Ga0157376_11171651	Ga0157376_111716511	105
740	3300014969	Ga0157376_11648658	Ga0157376_116486581	105
741	3300015262	Ga0182007_10215541	Ga0182007_102155411	105
742	3300017792	Ga0163161_10478050	Ga0163161_104780502	105
743	3300017792	Ga0163161_10778149	Ga0163161_107781492	105
744	3300017792	Ga0163161_12007981	Ga0163161_120079811	105
745	3300021361	Ga0213872_10469388	Ga0213872_104693881	105
746	3300021388	Ga0213875_10035002	Ga0213875_100350023	105
747	3300024227	Ga0228598_1088149	Ga0228598_10881491	105
748	3300025254	Ga0209148_1015873	Ga0209148_10158732	105
749	3300025261	Ga0209233_1001681	Ga0209233_10016819	105
750	3300025272	Ga0209455_1006173	Ga0209455_10061732	105
751	3300025297	Ga0209758_1001166	Ga0209758_100116621	105
752	3300025297	Ga0209758_1032735	Ga0209758_10327352	105
753	3300025302	Ga0207426_1001672	Ga0207426_100167210	105
754	3300025304	Ga0209257_1009448	Ga0209257_10094482	105
755	3300025315	Ga0207697_10261974	Ga0207697_102619742	105
756	3300025321	Ga0207656_10003095	Ga0207656_100030952	105
757	3300025321	Ga0207656_10003494	Ga0207656_100034945	105
758	3300025321	Ga0207656_10022668	Ga0207656_100226682	105
759	3300025321	Ga0207656_10728128	Ga0207656_107281281	105
760	3300025711	Ga0207696_1141725	Ga0207696_11417251	105
761	3300025885	Ga0207653_10076410	Ga0207653_100764103	105
762	3300025893	Ga0207682_10137169	Ga0207682_101371692	105
763	3300025898	Ga0207692_10308138	Ga0207692_103081382	105
764	3300025898	Ga0207692_10584920	Ga0207692_105849202	105
765	3300025899	Ga0207642_10093247	Ga0207642_100932472	105
766	3300025899	Ga0207642_10595401	Ga0207642_105954011	105
767	3300025901	Ga0207688_10057085	Ga0207688_100570853	105
768	3300025901	Ga0207688_10058990	Ga0207688_100589902	105
769	3300025901	Ga0207688_10318249	Ga0207688_103182491	105
770	3300025901	Ga0207688_10338561	Ga0207688_103385612	105
771	3300025901	Ga0207688_10539861	Ga0207688_105398612	105
772	3300025903	Ga0207680_10595797	Ga0207680_105957971	105
773	3300025903	Ga0207680_11072500	Ga0207680_110725001	105
774	3300025904	Ga0207647_10016797	Ga0207647_100167975	105
775	3300025904	Ga0207647_10150706	Ga0207647_101507062	105
776	3300025904	Ga0207647_10181958	Ga0207647_101819582	105
777	3300025904	Ga0207647_10574995	Ga0207647_105749951	105
778	3300025904	Ga0207647_10577391	Ga0207647_105773912	105
779	3300025905	Ga0207685_10332980	Ga0207685_103329801	105
780	3300025905	Ga0207685_10548030	Ga0207685_105480301	105
781	3300025906	Ga0207699_10011077	Ga0207699_100110775	105
782	3300025906	Ga0207699_10024245	Ga0207699_100242452	105
783	3300025906	Ga0207699_10357201	Ga0207699_103572012	105
784	3300025906	Ga0207699_10404138	Ga0207699_104041382	105
785	3300025907	Ga0207645_10119278	Ga0207645_101192783	105
786	3300025907	Ga0207645_10687172	Ga0207645_106871721	105
787	3300025908	Ga0207643_10058441	Ga0207643_100584413	105
788	3300025908	Ga0207643_10361393	Ga0207643_103613932	105
789	3300025908	Ga0207643_10497886	Ga0207643_104978861	105
790	3300025909	Ga0207705_10142649	Ga0207705_101426492	105
791	3300025909	Ga0207705_10182940	Ga0207705_101829402	105
792	3300025909	Ga0207705_10460791	Ga0207705_104607911	105
793	3300025909	Ga0207705_11375741	Ga0207705_113757411	105
794	3300025910	Ga0207684_10154329	Ga0207684_101543292	105
795	3300025910	Ga0207684_10341231	Ga0207684_103412312	105
796	3300025910	Ga0207684_10492569	Ga0207684_104925691	105
797	3300025910	Ga0207684_10543042	Ga0207684_105430421	105
798	3300025911	Ga0207654_10003520	Ga0207654_100035203	105
799	3300025911	Ga0207654_10118440	Ga0207654_101184402	105
800	3300025911	Ga0207654_10674735	Ga0207654_106747352	105
801	3300025912	Ga0207707_10000866	Ga0207707_1000086635	105
802	3300025912	Ga0207707_10002523	Ga0207707_100025235	105
803	3300025912	Ga0207707_10006058	Ga0207707_100060588	105
804	3300025912	Ga0207707_10059926	Ga0207707_100599263	105
805	3300025912	Ga0207707_10312276	Ga0207707_103122762	105
806	3300025912	Ga0207707_10401597	Ga0207707_104015971	105
807	3300025913	Ga0207695_10000479	Ga0207695_1000047969	105
808	3300025913	Ga0207695_10028298	Ga0207695_100282984	105
809	3300025913	Ga0207695_10065818	Ga0207695_100658182	105
810	3300025913	Ga0207695_10338093	Ga0207695_103380932	105
811	3300025914	Ga0207671_10010105	Ga0207671_100101057	105
812	3300025914	Ga0207671_10041067	Ga0207671_100410673	105
813	3300025914	Ga0207671_10065596	Ga0207671_100655965	105
814	3300025914	Ga0207671_10091549	Ga0207671_100915492	105
815	3300025914	Ga0207671_10338048	Ga0207671_103380481	105
816	3300025914	Ga0207671_10472914	Ga0207671_104729142	105
817	3300025914	Ga0207671_10687991	Ga0207671_106879913	105
818	3300025914	Ga0207671_10745544	Ga0207671_107455442	105
819	3300025915	Ga0207693_10064099	Ga0207693_100640993	105
820	3300025915	Ga0207693_10491067	Ga0207693_104910672	105
821	3300025917	Ga0207660_10017571	Ga0207660_100175713	105
822	3300025917	Ga0207660_10059485	Ga0207660_100594851	105
823	3300025917	Ga0207660_10060401	Ga0207660_100604013	105
824	3300025917	Ga0207660_10091273	Ga0207660_100912733	105
825	3300025917	Ga0207660_10094774	Ga0207660_100947744	105
826	3300025917	Ga0207660_10134578	Ga0207660_101345782	105
827	3300025917	Ga0207660_11277078	Ga0207660_112770782	105
828	3300025918	Ga0207662_10129552	Ga0207662_101295523	105
829	3300025919	Ga0207657_10002309	Ga0207657_1000230917	105
830	3300025919	Ga0207657_10085616	Ga0207657_100856162	105
831	3300025919	Ga0207657_10115247	Ga0207657_101152473	105
832	3300025919	Ga0207657_10136778	Ga0207657_101367783	105
833	3300025919	Ga0207657_10153168	Ga0207657_101531682	105
834	3300025919	Ga0207657_10191190	Ga0207657_101911901	105
835	3300025919	Ga0207657_10665091	Ga0207657_106650911	105
836	3300025919	Ga0207657_11168370	Ga0207657_111683701	105
837	3300025920	Ga0207649_10153588	Ga0207649_101535882	105
838	3300025920	Ga0207649_10172568	Ga0207649_101725684	105
839	3300025920	Ga0207649_10744570	Ga0207649_107445702	105
840	3300025921	Ga0207652_10004639	Ga0207652_100046395	105
841	3300025921	Ga0207652_10049471	Ga0207652_100494713	105
842	3300025921	Ga0207652_10095389	Ga0207652_100953891	105
843	3300025921	Ga0207652_10140459	Ga0207652_101404592	105
844	3300025921	Ga0207652_10274271	Ga0207652_102742713	105
845	3300025921	Ga0207652_11097949	Ga0207652_110979492	105
846	3300025922	Ga0207646_10027132	Ga0207646_100271324	105
847	3300025922	Ga0207646_10711377	Ga0207646_107113771	105
848	3300025922	Ga0207646_11037899	Ga0207646_110378991	105
849	3300025923	Ga0207681_10189538	Ga0207681_101895383	105
850	3300025923	Ga0207681_10918620	Ga0207681_109186201	105
851	3300025923	Ga0207681_11006462	Ga0207681_110064622	105
852	3300025924	Ga0207694_10000972	Ga0207694_100009723	105
853	3300025924	Ga0207694_10026818	Ga0207694_100268183	105
854	3300025924	Ga0207694_10083118	Ga0207694_100831183	105
855	3300025924	Ga0207694_10215039	Ga0207694_102150392	105
856	3300025924	Ga0207694_10609594	Ga0207694_106095941	105
857	3300025924	Ga0207694_11385481	Ga0207694_113854811	105
858	3300025925	Ga0207650_10486084	Ga0207650_104860841	105
859	3300025926	Ga0207659_10117737	Ga0207659_101177373	105
860	3300025927	Ga0207687_10033918	Ga0207687_100339181	105
861	3300025927	Ga0207687_10224989	Ga0207687_102249891	105
862	3300025927	Ga0207687_10259581	Ga0207687_102595812	105
863	3300025927	Ga0207687_10396031	Ga0207687_103960312	105
864	3300025928	Ga0207700_10095435	Ga0207700_100954352	105
865	3300025928	Ga0207700_10742026	Ga0207700_107420262	105
866	3300025929	Ga0207664_10251897	Ga0207664_102518972	105
867	3300025929	Ga0207664_10334980	Ga0207664_103349802	105
868	3300025929	Ga0207664_11008957	Ga0207664_110089571	105
869	3300025931	Ga0207644_10451677	Ga0207644_104516772	105
870	3300025931	Ga0207644_10489432	Ga0207644_104894323	105
871	3300025931	Ga0207644_10610905	Ga0207644_106109051	105
872	3300025931	Ga0207644_10845112	Ga0207644_108451121	105
873	3300025931	Ga0207644_11267227	Ga0207644_112672272	105
874	3300025932	Ga0207690_10363788	Ga0207690_103637882	105
875	3300025932	Ga0207690_10736649	Ga0207690_107366491	105
876	3300025932	Ga0207690_10743672	Ga0207690_107436722	105
877	3300025932	Ga0207690_11637937	Ga0207690_116379372	105
878	3300025932	Ga0207690_11652298	Ga0207690_116522981	105
879	3300025933	Ga0207706_10082423	Ga0207706_100824234	105
880	3300025933	Ga0207706_10120397	Ga0207706_101203972	105
881	3300025933	Ga0207706_10120620	Ga0207706_101206202	105
882	3300025933	Ga0207706_10649332	Ga0207706_106493321	105
883	3300025934	Ga0207686_10309490	Ga0207686_103094902	105
884	3300025934	Ga0207686_10368117	Ga0207686_103681172	105
885	3300025934	Ga0207686_10666532	Ga0207686_106665321	105
886	3300025934	Ga0207686_10997057	Ga0207686_109970572	105
887	3300025934	Ga0207686_11040690	Ga0207686_110406901	105
888	3300025935	Ga0207709_10165542	Ga0207709_101655423	105
889	3300025935	Ga0207709_10588571	Ga0207709_105885712	105
890	3300025935	Ga0207709_11554097	Ga0207709_115540972	105
891	3300025936	Ga0207670_11452574	Ga0207670_114525741	105
892	3300025937	Ga0207669_10020620	Ga0207669_100206202	105
893	3300025937	Ga0207669_10354862	Ga0207669_103548621	105
894	3300025937	Ga0207669_10446178	Ga0207669_104461782	105
895	3300025938	Ga0207704_10450242	Ga0207704_104502422	105
896	3300025938	Ga0207704_10785012	Ga0207704_107850121	105
897	3300025938	Ga0207704_11376677	Ga0207704_113766771	105
898	3300025939	Ga0207665_10205233	Ga0207665_102052331	105
899	3300025939	Ga0207665_10996541	Ga0207665_109965411	105
900	3300025939	Ga0207665_11602792	Ga0207665_116027921	105
901	3300025940	Ga0207691_10188677	Ga0207691_101886773	105
902	3300025940	Ga0207691_10538846	Ga0207691_105388462	105
903	3300025940	Ga0207691_11492534	Ga0207691_114925341	105
904	3300025941	Ga0207711_10408973	Ga0207711_104089732	105
905	3300025941	Ga0207711_10543384	Ga0207711_105433842	105
906	3300025941	Ga0207711_10652628	Ga0207711_106526282	105
907	3300025941	Ga0207711_11240090	Ga0207711_112400901	105
908	3300025942	Ga0207689_10626724	Ga0207689_106267241	105
909	3300025942	Ga0207689_10805006	Ga0207689_108050062	105
910	3300025944	Ga0207661_10023539	Ga0207661_100235393	105
911	3300025944	Ga0207661_10490279	Ga0207661_104902792	105
912	3300025944	Ga0207661_11459596	Ga0207661_114595961	105
913	3300025944	Ga0207661_11545995	Ga0207661_115459951	105
914	3300025945	Ga0207679_10048943	Ga0207679_100489433	105
915	3300025945	Ga0207679_10296581	Ga0207679_102965813	105
916	3300025945	Ga0207679_10330832	Ga0207679_103308322	105
917	3300025945	Ga0207679_10371440	Ga0207679_103714402	105
918	3300025945	Ga0207679_10643392	Ga0207679_106433922	105
919	3300025949	Ga0207667_10008731	Ga0207667_100087318	105
920	3300025949	Ga0207667_10018900	Ga0207667_100189002	105
921	3300025949	Ga0207667_10049911	Ga0207667_100499112	105
922	3300025949	Ga0207667_10100081	Ga0207667_101000812	105
923	3300025949	Ga0207667_10166889	Ga0207667_101668893	105
924	3300025949	Ga0207667_10181801	Ga0207667_101818012	105
925	3300025949	Ga0207667_10392909	Ga0207667_103929092	105
926	3300025949	Ga0207667_11262070	Ga0207667_112620702	105
927	3300025960	Ga0207651_10047457	Ga0207651_100474572	105
928	3300025960	Ga0207651_10540347	Ga0207651_105403472	105
929	3300025961	Ga0207712_10384335	Ga0207712_103843351	105
930	3300025961	Ga0207712_11034311	Ga0207712_110343111	105
931	3300025961	Ga0207712_11772923	Ga0207712_117729231	105
932	3300025972	Ga0207668_10057151	Ga0207668_100571511	105
933	3300025972	Ga0207668_10918873	Ga0207668_109188731	105
934	3300025972	Ga0207668_11266607	Ga0207668_112666071	105
935	3300025972	Ga0207668_11696429	Ga0207668_116964291	105
936	3300025972	Ga0207668_11812662	Ga0207668_118126621	105
937	3300025981	Ga0207640_10021769	Ga0207640_100217692	105
938	3300025981	Ga0207640_10224821	Ga0207640_102248212	105
939	3300025981	Ga0207640_10290053	Ga0207640_102900532	105
940	3300025981	Ga0207640_10373215	Ga0207640_103732151	105
941	3300025981	Ga0207640_10460440	Ga0207640_104604401	105
942	3300025981	Ga0207640_12090405	Ga0207640_120904051	105
943	3300025986	Ga0207658_10699096	Ga0207658_106990961	105
944	3300025986	Ga0207658_11923288	Ga0207658_119232881	105
945	3300026023	Ga0207677_10653496	Ga0207677_106534962	105
946	3300026023	Ga0207677_10948449	Ga0207677_109484492	105
947	3300026023	Ga0207677_11001425	Ga0207677_110014251	105
948	3300026023	Ga0207677_11305181	Ga0207677_113051811	105
949	3300026023	Ga0207677_11426968	Ga0207677_114269682	105
950	3300026035	Ga0207703_10072874	Ga0207703_100728742	105
951	3300026035	Ga0207703_10123796	Ga0207703_101237961	105
952	3300026035	Ga0207703_10352301	Ga0207703_103523011	105
953	3300026035	Ga0207703_10775178	Ga0207703_107751782	105
954	3300026035	Ga0207703_11653921	Ga0207703_116539211	105
955	3300026041	Ga0207639_10023231	Ga0207639_100232314	105
956	3300026041	Ga0207639_10029890	Ga0207639_100298903	105
957	3300026041	Ga0207639_10098259	Ga0207639_100982593	105
958	3300026041	Ga0207639_10145854	Ga0207639_101458543	105
959	3300026041	Ga0207639_10265129	Ga0207639_102651292	105
960	3300026041	Ga0207639_10427153	Ga0207639_104271534	105
961	3300026041	Ga0207639_10608145	Ga0207639_106081452	105
962	3300026041	Ga0207639_10890560	Ga0207639_108905602	105
963	3300026041	Ga0207639_10944865	Ga0207639_109448651	105
964	3300026067	Ga0207678_10043944	Ga0207678_100439442	105
965	3300026067	Ga0207678_10096456	Ga0207678_100964562	105
966	3300026067	Ga0207678_10110505	Ga0207678_101105053	105
967	3300026067	Ga0207678_10192034	Ga0207678_101920342	105
968	3300026067	Ga0207678_10274158	Ga0207678_102741582	105
969	3300026067	Ga0207678_10285171	Ga0207678_102851712	105
970	3300026067	Ga0207678_10324005	Ga0207678_103240053	105
971	3300026067	Ga0207678_11045223	Ga0207678_110452232	105
972	3300026067	Ga0207678_11089571	Ga0207678_110895711	105
973	3300026067	Ga0207678_11276580	Ga0207678_112765801	105
974	3300026067	Ga0207678_11595670	Ga0207678_115956701	105
975	3300026075	Ga0207708_10342079	Ga0207708_103420792	105
976	3300026075	Ga0207708_11269831	Ga0207708_112698311	105
977	3300026078	Ga0207702_10000004	Ga0207702_10000004400	105
978	3300026078	Ga0207702_10343421	Ga0207702_103434211	105
979	3300026078	Ga0207702_10761322	Ga0207702_107613221	105
980	3300026078	Ga0207702_11032502	Ga0207702_110325021	105
981	3300026078	Ga0207702_11461112	Ga0207702_114611122	105
982	3300026078	Ga0207702_11865808	Ga0207702_118658082	105
983	3300026088	Ga0207641_10128963	Ga0207641_101289631	105
984	3300026088	Ga0207641_11838433	Ga0207641_118384331	105
985	3300026089	Ga0207648_10073823	Ga0207648_100738235	105
986	3300026089	Ga0207648_10253850	Ga0207648_102538503	105
987	3300026089	Ga0207648_10519163	Ga0207648_105191631	105
988	3300026089	Ga0207648_11524769	Ga0207648_115247691	105
989	3300026089	Ga0207648_11549511	Ga0207648_115495112	105
990	3300026095	Ga0207676_10132084	Ga0207676_101320842	105
991	3300026095	Ga0207676_11482888	Ga0207676_114828881	105
992	3300026116	Ga0207674_10004148	Ga0207674_1000414812	105
993	3300026116	Ga0207674_10038907	Ga0207674_100389073	105
994	3300026116	Ga0207674_10057093	Ga0207674_100570932	105
995	3300026116	Ga0207674_10062158	Ga0207674_100621583	105
996	3300026116	Ga0207674_10124947	Ga0207674_101249473	105
997	3300026116	Ga0207674_10269511	Ga0207674_102695112	105
998	3300026116	Ga0207674_12179883	Ga0207674_121798831	105
999	3300026118	Ga0207675_100028704	Ga0207675_1000287043	105
1000	3300026118	Ga0207675_100092714	Ga0207675_1000927143	105
1001	3300026118	Ga0207675_100144490	Ga0207675_1001444903	105
1002	3300026121	Ga0207683_10049215	Ga0207683_100492155	105
1003	3300026121	Ga0207683_10052988	Ga0207683_100529883	105
1004	3300026121	Ga0207683_10378075	Ga0207683_103780751	105
1005	3300026121	Ga0207683_10537718	Ga0207683_105377182	105
1006	3300026121	Ga0207683_10655978	Ga0207683_106559782	105
1007	3300026121	Ga0207683_11046809	Ga0207683_110468092	105
1008	3300026121	Ga0207683_11479640	Ga0207683_114796402	105
1009	3300026142	Ga0207698_10223269	Ga0207698_102232694	105
1010	3300026142	Ga0207698_11269844	Ga0207698_112698441	105
1011	3300026142	Ga0207698_11603407	Ga0207698_116034071	105
1012	3300026142	Ga0207698_12202340	Ga0207698_122023401	105
1013	3300026142	Ga0207698_12435864	Ga0207698_124358641	105
1014	3300027357	Ga0209589_1000631	Ga0209589_100063124	105
1015	3300027361	Ga0209489_101293	Ga0209489_10129324	105
1016	3300027363	Ga0209700_101306	Ga0209700_10130624	105
1017	3300027512	Ga0209179_1013088	Ga0209179_10130882	105
1018	3300027671	Ga0209588_1004454	Ga0209588_10044544	105
1019	3300027866	Ga0209813_10343145	Ga0209813_103431451	105
1020	3300027866	Ga0209813_10458033	Ga0209813_104580331	105
1021	3300027907	Ga0207428_10125785	Ga0207428_101257852	105
1022	3300027907	Ga0207428_10169435	Ga0207428_101694353	105
1023	3300027907	Ga0207428_10490388	Ga0207428_104903882	105
1024	3300028379	Ga0268266_10004734	Ga0268266_100047342	105
1025	3300028379	Ga0268266_10015035	Ga0268266_100150359	105
1026	3300028379	Ga0268266_10042105	Ga0268266_100421054	105
1027	3300028379	Ga0268266_10148457	Ga0268266_101484573	105
1028	3300028379	Ga0268266_10183193	Ga0268266_101831932	105
1029	3300028379	Ga0268266_10300790	Ga0268266_103007902	105
1030	3300028379	Ga0268266_10489580	Ga0268266_104895801	105
1031	3300028379	Ga0268266_10555303	Ga0268266_105553031	105
1032	3300028379	Ga0268266_10615915	Ga0268266_106159152	105
1033	3300028379	Ga0268266_11248602	Ga0268266_112486022	105
1034	3300028379	Ga0268266_12295989	Ga0268266_122959891	105
1035	3300028380	Ga0268265_10014189	Ga0268265_100141892	105
1036	3300028380	Ga0268265_10023668	Ga0268265_100236682	105
1037	3300028380	Ga0268265_10155908	Ga0268265_101559082	105
1038	3300028380	Ga0268265_10496625	Ga0268265_104966251	105
1039	3300028380	Ga0268265_10695778	Ga0268265_106957782	105
1040	3300028380	Ga0268265_11016429	Ga0268265_110164292	105
1041	3300028381	Ga0268264_10000227	Ga0268264_1000022793	105
1042	3300028381	Ga0268264_10393045	Ga0268264_103930452	105
1043	3300028573	Ga0265334_10042837	Ga0265334_100428373	105
1044	3300028786	Ga0307517_10000495	Ga0307517_1000049550	105
1045	3300028786	Ga0307517_10336332	Ga0307517_103363321	105
1046	3300028794	Ga0307515_10082194	Ga0307515_100821942	105
1047	3300030521	Ga0307511_10030128	Ga0307511_100301285	105
1048	3300030521	Ga0307511_10352791	Ga0307511_103527912	105
1049	3300030760	Ga0265762_1027850	Ga0265762_10278501	105
1050	3300031235	Ga0265330_10025239	Ga0265330_100252393	105
1051	3300031235	Ga0265330_10030261	Ga0265330_100302614	105
1052	3300031235	Ga0265330_10052303	Ga0265330_100523033	105
1053	3300031235	Ga0265330_10466288	Ga0265330_104662881	105
1054	3300031238	Ga0265332_10004631	Ga0265332_100046314	105
1055	3300031238	Ga0265332_10047785	Ga0265332_100477854	105
1056	3300031239	Ga0265328_10045444	Ga0265328_100454442	105
1057	3300031239	Ga0265328_10063250	Ga0265328_100632501	105
1058	3300031241	Ga0265325_10038995	Ga0265325_100389952	105
1059	3300031247	Ga0265340_10011206	Ga0265340_100112064	105
1060	3300031247	Ga0265340_10021523	Ga0265340_100215233	105
1061	3300031249	Ga0265339_10004095	Ga0265339_100040956	105
1062	3300031250	Ga0265331_10152165	Ga0265331_101521651	105
1063	3300031250	Ga0265331_10266946	Ga0265331_102669461	105
1064	3300031344	Ga0265316_10402644	Ga0265316_104026442	105
1065	3300031456	Ga0307513_10137235	Ga0307513_101372352	105
1066	3300031456	Ga0307513_10190833	Ga0307513_101908333	105
1067	3300031507	Ga0307509_10127524	Ga0307509_101275242	105
1068	3300031507	Ga0307509_10288620	Ga0307509_102886203	105
1069	3300031616	Ga0307508_10000002	Ga0307508_10000002280	105
1070	3300031616	Ga0307508_10064657	Ga0307508_100646574	105
1071	3300031616	Ga0307508_10120789	Ga0307508_101207892	105
1072	3300031616	Ga0307508_10237179	Ga0307508_102371792	105
1073	3300031616	Ga0307508_10252550	Ga0307508_102525502	105
1074	3300031616	Ga0307508_10288426	Ga0307508_102884261	105
1075	3300031616	Ga0307508_10526949	Ga0307508_105269491	105
1076	3300031712	Ga0265342_10070799	Ga0265342_100707992	105
1077	3300031712	Ga0265342_10095737	Ga0265342_100957373	105
1078	3300031730	Ga0307516_10030917	Ga0307516_100309174	105
1079	3300031730	Ga0307516_10064115	Ga0307516_100641153	105
1080	3300031730	Ga0307516_10118064	Ga0307516_101180642	105
1081	3300031730	Ga0307516_10226970	Ga0307516_102269702	105
1082	3300031730	Ga0307516_10384156	Ga0307516_103841562	105
1083	3300031730	Ga0307516_10544879	Ga0307516_105448792	105
1084	3300031731	Ga0307405_10434761	Ga0307405_104347612	105
1085	3300031824	Ga0307413_10124892	Ga0307413_101248922	105
1086	3300031852	Ga0307410_10187114	Ga0307410_101871142	105
1087	3300031852	Ga0307410_11548083	Ga0307410_115480832	105
1088	3300031901	Ga0307406_10148780	Ga0307406_101487802	105
1089	3300031901	Ga0307406_10232176	Ga0307406_102321761	105
1090	3300031901	Ga0307406_10503625	Ga0307406_105036252	105
1091	3300031903	Ga0307407_10109197	Ga0307407_101091972	105
1092	3300031903	Ga0307407_10637629	Ga0307407_106376292	105
1093	3300031903	Ga0307407_11186398	Ga0307407_111863981	105
1094	3300031911	Ga0307412_10175573	Ga0307412_101755731	105
1095	3300031911	Ga0307412_10241563	Ga0307412_102415632	105
1096	3300031911	Ga0307412_11208328	Ga0307412_112083282	105
1097	3300031911	Ga0307412_11624770	Ga0307412_116247701	105
1098	3300031995	Ga0307409_100051678	Ga0307409_1000516782	105
1099	3300031995	Ga0307409_100399770	Ga0307409_1003997702	105
1100	3300031995	Ga0307409_100424803	Ga0307409_1004248032	105
1101	3300031995	Ga0307409_101425487	Ga0307409_1014254871	105
1102	3300031995	Ga0307409_102772614	Ga0307409_1027726141	105
1103	3300032002	Ga0307416_100221775	Ga0307416_1002217753	105
1104	3300032002	Ga0307416_100339595	Ga0307416_1003395952	105
1105	3300032002	Ga0307416_100830206	Ga0307416_1008302061	105
1106	3300032002	Ga0307416_101036374	Ga0307416_1010363742	105
1107	3300032002	Ga0307416_102168156	Ga0307416_1021681561	105
1108	3300032004	Ga0307414_11010707	Ga0307414_110107071	105
1109	3300032004	Ga0307414_11569818	Ga0307414_115698181	105
1110	3300032005	Ga0307411_10558048	Ga0307411_105580482	105
1111	3300032005	Ga0307411_10793851	Ga0307411_107938512	105
1112	3300032005	Ga0307411_10862505	Ga0307411_108625051	105
1113	3300032005	Ga0307411_10943438	Ga0307411_109434382	105
1114	3300032005	Ga0307411_11636967	Ga0307411_116369671	105
1115	3300032126	Ga0307415_100126169	Ga0307415_1001261692	105
1116	3300032126	Ga0307415_100300121	Ga0307415_1003001213	105
1117	3300032126	Ga0307415_101266484	Ga0307415_1012664841	105
1118	3300033179	Ga0307507_10501924	Ga0307507_105019241	105
1119	3300033180	Ga0307510_10018457	Ga0307510_100184573	105
1120	3300033180	Ga0307510_10181217	Ga0307510_101812173	105
1121	3300033180	Ga0307510_10443521	Ga0307510_104435212	105
1122	3300033442	Ga0315911_1000013	Ga0315911_1000013194	105
1123	3300033545	Ga0316214_1009606	Ga0316214_10096062	105
1124	3300034816	Ga0373930_0043103	Ga0373930_0043103_345_662	105
1125	3300034817	Ga0373948_0165934	Ga0373948_0165934_167_484	105
1126	3300034817	Ga0373948_0197218	Ga0373948_0197218_94_411	105
1127	3300034819	Ga0373958_0076068	Ga0373958_0076068_426_743	105
1128	3300034957	Ga0373938_0033930	Ga0373938_0033930_42_359	105
1129	3300035085	Ga0373929_0074921	Ga0373929_0074921_245_562	105
1130	3300035086	Ga0373934_0186896	Ga0373934_0186896_31_348	105
1131	3300035088	Ga0373940_0086316	Ga0373940_0086316_51_368	105
1132	3300035089	Ga0373944_0080172	Ga0373944_0080172_128_445	105
1133	3300035090	Ga0373949_0278003	Ga0373949_0278003_182_499	105
1134	3300035092	Ga0373952_0027292	Ga0373952_0027292_360_677	105
1135	3300035111	Ga0373923_0192421	Ga0373923_0192421_593_910	105
1136	3300035113	Ga0373936_0029418	Ga0373936_0029418_854_1171	105
1137	3300035113	Ga0373936_0055703	Ga0373936_0055703_560_877	105
1138	3300035113	Ga0373936_0076809	Ga0373936_0076809_221_538	105
1139	3300035113	Ga0373936_0079938	Ga0373936_0079938_1013_1330	105
1140	3300035114	Ga0373939_0298228	Ga0373939_0298228_257_574	105
1141	3300035115	Ga0373941_0089676	Ga0373941_0089676_177_494	105
1142	3300035115	Ga0373941_0475840	Ga0373941_0475840_79_396	105
1143	3300035116	Ga0373945_0018937	Ga0373945_0018937_1113_1430	105
1144	3300035116	Ga0373945_0222045	Ga0373945_0222045_342_659	105
1145	3300035117	Ga0373953_0423571	Ga0373953_0423571_224_541	105
1146	3300035118	Ga0373954_0071365	Ga0373954_0071365_212_529	105
1147	3300035119	Ga0373956_0020381	Ga0373956_0020381_2344_2661	105
1148	3300035120	Ga0373957_0090569	Ga0373957_0090569_54_371	105
1149	3300035170	Ga0373943_0237130	Ga0373943_0237130_686_1003	105
1150	3300035171	Ga0373946_0022307	Ga0373946_0022307_2015_2332	105
1151	3300035172	Ga0373955_0799791	Ga0373955_0799791_241_558	105
1152	3300035172	Ga0373955_0826677	Ga0373955_0826677_224_541	105
1153	3300035207	Ga0373942_0015869	Ga0373942_0015869_366_683	105
1154	3300035207	Ga0373942_0196172	Ga0373942_0196172_92_409	105
1155	3300035241	Ga0373961_0219725	Ga0373961_0219725_221_538	105
1156	3300035242	Ga0373962_0163916	Ga0373962_0163916_120_437	105
1157	3300035242	Ga0373962_0277391	Ga0373962_0277391_83_400	105
1158	3300035410	Ga0373924_0026591	Ga0373924_0026591_106_423	105
1159	3300035691	Ga0373931_0016923	Ga0373931_0016923_1002_1319	105
1160	3300035691	Ga0373931_0297197	Ga0373931_0297197_490_807	105
1161	3300035691	Ga0373931_0808892	Ga0373931_0808892_256_573	105
1162	3300035692	Ga0373935_0011171	Ga0373935_0011171_2700_3017	105
1163	3300035692	Ga0373935_0096791	Ga0373935_0096791_1064_1381	105
1164	3300035692	Ga0373935_1082210	Ga0373935_1082210_208_525	105
1165	3300035695	Ga0373927_0004430	Ga0373927_0004430_1704_2021	105
1166	3300035695	Ga0373927_0013875	Ga0373927_0013875_3555_3872	105
1167	3300035695	Ga0373927_0041306	Ga0373927_0041306_1114_1431	105
1168	3300035695	Ga0373927_0088579	Ga0373927_0088579_406_723	105
1169	3300035695	Ga0373927_0420285	Ga0373927_0420285_149_466	105
1170	3300035724	Ga0373933_0343987	Ga0373933_0343987_490_807	105
1171	3300035725	Ga0373947_0097178	Ga0373947_0097178_1064_1381	105
1172	3300035725	Ga0373947_0164633	Ga0373947_0164633_113_430	105
1173	3300035725	Ga0373947_0243671	Ga0373947_0243671_219_536	105
1174	3300035725	Ga0373947_0547275	Ga0373947_0547275_85_402	105
1175	3300036401	Ga0373937_0565688	Ga0373937_0565688_677_994	105
1176	3300037068	Ga0373925_0062714	Ga0373925_0062714_567_884	105
1177	3300037068	Ga0373925_0132907	Ga0373925_0132907_835_1152	105
1178	3300037068	Ga0373925_0178563	Ga0373925_0178563_1234_1551	105
1179	3300037068	Ga0373925_0238823	Ga0373925_0238823_676_993	105
1180	3300037068	Ga0373925_0312039	Ga0373925_0312039_674_991	105
1181	3300037068	Ga0373925_0713694	Ga0373925_0713694_500_817	105
1182	3300037068	Ga0373925_0771455	Ga0373925_0771455_159_476	105
1183	3300037312	Ga0395899_0605223	Ga0395899_0605223_12_329	105
1184	3300037418	Ga0395900_0071705	Ga0395900_0071705_1081_1398	105
1185	3300037418	Ga0395900_0301324	Ga0395900_0301324_952_1269	105
1186	3300037418	Ga0395900_0305526	Ga0395900_0305526_536_853	105
1187	3300037466	Ga0395898_0005930	Ga0395898_0005930_435_752	105
1188	3300037466	Ga0395898_0088296	Ga0395898_0088296_1051_1368	105
1189	3300037466	Ga0395898_0104536	Ga0395898_0104536_667_984	105
1190	3300037466	Ga0395898_0155758	Ga0395898_0155758_701_1018	105
1191	3300037471	Ga0395905_0454645	Ga0395905_0454645_768_1085	105
1192	3300037471	Ga0395905_1911286	Ga0395905_1911286_44_361	105
1193	3300037853	Ga0436364_0327015	Ga0436364_0327015_3764_4081	105
1194	3300038443	Ga0395901_0180018	Ga0395901_0180018_946_1263	105
1195	3300038443	Ga0395901_0410814	Ga0395901_0410814_772_1089	105
1196	3300038443	Ga0395901_0454497	Ga0395901_0454497_264_581	105
1197	3300038443	Ga0395901_0497737	Ga0395901_0497737_21_338	105
1198	3300038443	Ga0395901_0702149	Ga0395901_0702149_131_448	105
1199	3300039437	Ga0436365_0736921	Ga0436365_0736921_13_330	105
1200	3300039437	Ga0436365_1881000	Ga0436365_1881000_312_629	105
1201	3300039447	Ga0436361_0731164	Ga0436361_0731164_824_1141	105
1202	3300039450	Ga0436363_0342599	Ga0436363_0342599_149_466	105
1203	3300039450	Ga0436363_1313129	Ga0436363_1313129_48_365	105
1204	3300041410	Ga0439461_0177761	Ga0439461_0177761_51_368	105
1205	3300041413	Ga0439465_0256997	Ga0439465_0256997_281_598	105
1206	3300041441	Ga0451787_333360	Ga0451787_333360_68_385	105
1207	3300041443	Ga0451789_0203289	Ga0451789_0203289_459_776	105
1208	3300041443	Ga0451789_0849786	Ga0451789_0849786_217_534	105
1209	3300041451	Ga0451791_0070016	Ga0451791_0070016_188_505	105
1210	3300041451	Ga0451791_1305121	Ga0451791_1305121_266_583	105
1211	3300041452	Ga0451793_1612221	Ga0451793_1612221_177_494	105
1212	3300041453	Ga0451797_1434425	Ga0451797_1434425_219_536	105
1213	3300041456	Ga0451795_1575551	Ga0451795_1575551_76_393	105
1214	3300041460	Ga0451802_1873086	Ga0451802_1873086_219_536	105
1215	3300041460	Ga0451802_2067954	Ga0451802_2067954_466_783	105
1216	3300041486	Ga0451807_1063360	Ga0451807_1063360_208_525	105
1217	3300041486	Ga0451807_1736873	Ga0451807_1736873_151_468	105
1218	3300041486	Ga0451807_1955077	Ga0451807_1955077_162_479	105
1219	3300041505	Ga0451849_1009538	Ga0451849_1009538_242_559	105
1220	3300041505	Ga0451849_1444799	Ga0451849_1444799_241_558	105
1221	3300041507	Ga0451851_0995136	Ga0451851_0995136_68_385	105
1222	3300041507	Ga0451851_1020942	Ga0451851_1020942_609_926	105
1223	3300041509	Ga0451843_0384136	Ga0451843_0384136_173_490	105
1224	3300041509	Ga0451843_0803775	Ga0451843_0803775_15_332	105
1225	3300041512	Ga0451853_0448747	Ga0451853_0448747_96_413	105
1226	3300041512	Ga0451853_0940289	Ga0451853_0940289_255_572	105
1227	3300041512	Ga0451853_2148146	Ga0451853_2148146_29_346	105
1228	3300042157	Ga0439458_0080648	Ga0439458_0080648_401_718	105
1229	3300042438	Ga0439459_0011282	Ga0439459_0011282_46_363	105
1230	3300044683	Ga0466965_0123027	Ga0466965_0123027_430_747	105
1231	3300044694	Ga0466963_0125535	Ga0466963_0125535_253_570	105
1232	3300044694	Ga0466963_0194225	Ga0466963_0194225_934_1251	105
1233	3300044842	Ga0466957_0110586	Ga0466957_0110586_1146_1463	105
1234	3300044842	Ga0466957_0155491	Ga0466957_0155491_241_558	105
1235	3300044842	Ga0466957_0651471	Ga0466957_0651471_280_597	105
1236	3300044901	Ga0466960_0557974	Ga0466960_0557974_134_451	105
1237	3300045051	Ga0451576_0604508	Ga0451576_0604508_561_878	105
1238	3300045976	Ga0466967_0046726	Ga0466967_0046726_1923_2240	105
1239	3300045976	Ga0466967_0221257	Ga0466967_0221257_992_1309	105
1240	3300045976	Ga0466967_0326166	Ga0466967_0326166_610_927	105
1241	3300045976	Ga0466967_1889146	Ga0466967_1889146_230_547	105
1242	3300046452	Ga0495617_051302	Ga0495617_051302_457_774	105
1243	3300046453	Ga0495627_152375	Ga0495627_152375_286_603	105
1244	3300046454	Ga0495592_0105028	Ga0495592_0105028_686_1003	105
1245	3300046454	Ga0495592_0288456	Ga0495592_0288456_334_651	105
1246	3300046455	Ga0495603_0023575	Ga0495603_0023575_155_472	105
1247	3300046455	Ga0495603_0303892	Ga0495603_0303892_14_331	105
1248	3300046455	Ga0495603_0430447	Ga0495603_0430447_307_624	105
1249	3300046457	Ga0495590_0052736	Ga0495590_0052736_844_1161	105
1250	3300046457	Ga0495590_0151475	Ga0495590_0151475_310_627	105
1251	3300046459	Ga0495629_0045208	Ga0495629_0045208_1916_2233	105
1252	3300046459	Ga0495629_0401513	Ga0495629_0401513_113_430	105
1253	3300046459	Ga0495629_0616822	Ga0495629_0616822_249_566	105
1254	3300046460	Ga0495638_0110701	Ga0495638_0110701_520_837	105
1255	3300046461	Ga0495641_0054239	Ga0495641_0054239_1245_1562	105
1256	3300046461	Ga0495641_0123289	Ga0495641_0123289_447_764	105
1257	3300046462	Ga0495651_0295796	Ga0495651_0295796_441_758	105
1258	3300046462	Ga0495651_0363302	Ga0495651_0363302_500_817	105
1259	3300046462	Ga0495651_0523334	Ga0495651_0523334_346_663	105
1260	3300046471	Ga0495650_0060535	Ga0495650_0060535_746_1063	105
1261	3300046471	Ga0495650_0212014	Ga0495650_0212014_156_473	105
1262	3300046472	Ga0495580_0012426	Ga0495580_0012426_5396_5713	105
1263	3300046472	Ga0495580_0471810	Ga0495580_0471810_115_432	105
1264	3300046473	Ga0495582_0325867	Ga0495582_0325867_149_466	105
1265	3300046474	Ga0495605_0174675	Ga0495605_0174675_618_935	105
1266	3300046475	Ga0495639_0015383	Ga0495639_0015383_666_983	105
1267	3300046475	Ga0495639_0043784	Ga0495639_0043784_1597_1914	105
1268	3300046476	Ga0495662_0242648	Ga0495662_0242648_335_652	105
1269	3300046477	Ga0495664_0135238	Ga0495664_0135238_269_586	105
1270	3300046491	Ga0495584_0047573	Ga0495584_0047573_1041_1358	105
1271	3300046491	Ga0495584_0210399	Ga0495584_0210399_490_807	105
1272	3300046491	Ga0495584_0210908	Ga0495584_0210908_656_973	105
1273	3300046492	Ga0495585_0082014	Ga0495585_0082014_262_579	105
1274	3300046492	Ga0495585_0141340	Ga0495585_0141340_532_849	105
1275	3300046492	Ga0495585_0198371	Ga0495585_0198371_11_328	105
1276	3300046492	Ga0495585_0236026	Ga0495585_0236026_99_416	105
1277	3300046492	Ga0495585_0300032	Ga0495585_0300032_195_512	105
1278	3300046499	Ga0495594_0059610	Ga0495594_0059610_308_625	105
1279	3300046499	Ga0495594_0664456	Ga0495594_0664456_54_371	105
1280	3300046500	Ga0495596_0053712	Ga0495596_0053712_896_1213	105
1281	3300046500	Ga0495596_0283176	Ga0495596_0283176_124_441	105
1282	3300046500	Ga0495596_0398690	Ga0495596_0398690_71_388	105
1283	3300046501	Ga0495607_0559336	Ga0495607_0559336_150_467	105
1284	3300046506	Ga0495583_0349594	Ga0495583_0349594_152_469	105
1285	3300046507	Ga0495606_0289543	Ga0495606_0289543_441_758	105
1286	3300046511	Ga0495608_0684195	Ga0495608_0684195_134_451	105
1287	3300046512	Ga0495610_0024944	Ga0495610_0024944_1780_2097	105
1288	3300046513	Ga0495616_0056264	Ga0495616_0056264_1606_1923	105
1289	3300046513	Ga0495616_0267016	Ga0495616_0267016_271_588	105
1290	3300046514	Ga0495618_0053902	Ga0495618_0053902_434_751	105
1291	3300046515	Ga0495620_0169473	Ga0495620_0169473_74_391	105
1292	3300046516	Ga0495628_0069977	Ga0495628_0069977_272_589	105
1293	3300046516	Ga0495628_0285402	Ga0495628_0285402_301_618	105
1294	3300046516	Ga0495628_0450566	Ga0495628_0450566_397_714	105
1295	3300046516	Ga0495628_0829974	Ga0495628_0829974_221_538	105
1296	3300046517	Ga0495630_0017072	Ga0495630_0017072_1712_2029	105
1297	3300046518	Ga0495631_0043609	Ga0495631_0043609_268_585	105
1298	3300046518	Ga0495631_0097424	Ga0495631_0097424_155_472	105
1299	3300046518	Ga0495631_0244620	Ga0495631_0244620_102_419	105
1300	3300046518	Ga0495631_0409407	Ga0495631_0409407_234_551	105
1301	3300046519	Ga0495632_0064418	Ga0495632_0064418_1324_1641	105
1302	3300046519	Ga0495632_0098695	Ga0495632_0098695_430_747	105
1303	3300046520	Ga0495637_0365866	Ga0495637_0365866_142_459	105
1304	3300046522	Ga0495643_0253859	Ga0495643_0253859_119_436	105
1305	3300046523	Ga0495644_0117089	Ga0495644_0117089_256_573	105
1306	3300046523	Ga0495644_0277525	Ga0495644_0277525_298_615	105
1307	3300046524	Ga0495648_0124410	Ga0495648_0124410_300_617	105
1308	3300046525	Ga0495663_0033143	Ga0495663_0033143_854_1171	105
1309	3300046525	Ga0495663_0043397	Ga0495663_0043397_290_607	105
1310	3300046525	Ga0495663_0307411	Ga0495663_0307411_62_379	105
1311	3300046529	Ga0495652_0186795	Ga0495652_0186795_144_461	105
1312	3300046531	Ga0495665_0078374	Ga0495665_0078374_268_585	105
1313	3300046533	Ga0495640_0031424	Ga0495640_0031424_2265_2582	105
1314	3300046533	Ga0495640_0412619	Ga0495640_0412619_360_677	105
1315	3300046535	Ga0495586_0566479	Ga0495586_0566479_144_461	105
1316	3300046535	Ga0495586_0797234	Ga0495586_0797234_97_414	105
1317	3300046536	Ga0495587_0184565	Ga0495587_0184565_89_406	105
1318	3300046536	Ga0495587_0287493	Ga0495587_0287493_342_659	105
1319	3300046537	Ga0495598_0015047	Ga0495598_0015047_743_1060	105
1320	3300046538	Ga0495609_0070336	Ga0495609_0070336_366_683	105
1321	3300046538	Ga0495609_0191628	Ga0495609_0191628_38_355	105
1322	3300046539	Ga0495621_0047130	Ga0495621_0047130_43_360	105
1323	3300046539	Ga0495621_0097191	Ga0495621_0097191_483_800	105
1324	3300046542	Ga0495597_0117851	Ga0495597_0117851_217_534	105
1325	3300046543	Ga0495645_0050875	Ga0495645_0050875_2544_2861	105
1326	3300046543	Ga0495645_0926129	Ga0495645_0926129_139_456	105
1327	3300046557	Ga0495622_0054182	Ga0495622_0054182_831_1148	105
1328	3300046557	Ga0495622_0144358	Ga0495622_0144358_506_823	105
1329	3300046557	Ga0495622_0295969	Ga0495622_0295969_267_584	105
1330	3300046558	Ga0495633_0044172	Ga0495633_0044172_1028_1345	105
1331	3300046558	Ga0495633_0292334	Ga0495633_0292334_218_535	105
1332	3300046559	Ga0495667_0294152	Ga0495667_0294152_578_895	105
1333	3300046615	Ga0495656_0025079	Ga0495656_0025079_1882_2199	105
1334	3300046615	Ga0495656_0113963	Ga0495656_0113963_143_460	105
1335	3300046615	Ga0495656_0138280	Ga0495656_0138280_533_850	105
1336	3300046615	Ga0495656_0204572	Ga0495656_0204572_590_907	105
1337	3300046615	Ga0495656_0330621	Ga0495656_0330621_53_370	105
1338	3300046615	Ga0495656_0769009	Ga0495656_0769009_190_507	105
1339	3300046616	Ga0495668_0018181	Ga0495668_0018181_3251_3568	105
1340	3300046616	Ga0495668_0050331	Ga0495668_0050331_1591_1908	105
1341	3300046616	Ga0495668_0059031	Ga0495668_0059031_443_760	105
1342	3300046616	Ga0495668_0630874	Ga0495668_0630874_43_360	105
1343	3300046642	Ga0495634_0076594	Ga0495634_0076594_1115_1432	105
1344	3300046642	Ga0495634_0432003	Ga0495634_0432003_187_504	105
1345	3300046648	Ga0495611_0023229	Ga0495611_0023229_2358_2675	105
1346	3300046648	Ga0495611_0085383	Ga0495611_0085383_720_1037	105
1347	3300046648	Ga0495611_0175151	Ga0495611_0175151_320_637	105
1348	3300046660	Ga0495625_0205181	Ga0495625_0205181_455_772	105
1349	3300046660	Ga0495625_0363904	Ga0495625_0363904_244_561	105
1350	3300046660	Ga0495625_0401922	Ga0495625_0401922_397_714	105
1351	3300046660	Ga0495625_0585196	Ga0495625_0585196_39_356	105
1352	3300046660	Ga0495625_0648699	Ga0495625_0648699_226_543	105
1353	3300046663	Ga0495635_0121251	Ga0495635_0121251_896_1213	105
1354	3300046664	Ga0495659_0018579	Ga0495659_0018579_412_729	105
1355	3300046664	Ga0495659_0019954	Ga0495659_0019954_40_357	105
1356	3300046664	Ga0495659_0382301	Ga0495659_0382301_113_430	105
1357	3300046665	Ga0495661_0125323	Ga0495661_0125323_512_829	105
1358	3300046674	Ga0495588_0007555	Ga0495588_0007555_2275_2592	105
1359	3300046674	Ga0495588_0401920	Ga0495588_0401920_10_327	105
1360	3300046674	Ga0495588_0737589	Ga0495588_0737589_69_386	105
1361	3300046678	Ga0495599_0278475	Ga0495599_0278475_448_765	105
1362	3300046678	Ga0495599_0344956	Ga0495599_0344956_180_497	105
1363	3300046678	Ga0495599_0814177	Ga0495599_0814177_73_390	105
1364	3300046679	Ga0495623_0062940	Ga0495623_0062940_362_679	105
1365	3300046679	Ga0495623_0125310	Ga0495623_0125310_471_788	105
1366	3300046680	Ga0495646_0124643	Ga0495646_0124643_798_1115	105
1367	3300046681	Ga0495647_0047541	Ga0495647_0047541_300_617	105
1368	3300046683	Ga0495658_0294074	Ga0495658_0294074_555_872	105
1369	3300046684	Ga0495669_0011098	Ga0495669_0011098_2413_2730	105
1370	3300046684	Ga0495669_0105855	Ga0495669_0105855_489_806	105
1371	3300046684	Ga0495669_0201806	Ga0495669_0201806_417_734	105
1372	3300046684	Ga0495669_0369224	Ga0495669_0369224_226_543	105
1373	3300046684	Ga0495669_0598662	Ga0495669_0598662_161_478	105
1374	3300046689	Ga0495613_0204724	Ga0495613_0204724_235_552	105
1375	3300046690	Ga0495624_0062936	Ga0495624_0062936_1950_2267	105
1376	3300046691	Ga0495670_0285819	Ga0495670_0285819_337_654	105
1377	3300046692	Ga0495671_0263223	Ga0495671_0263223_41_358	105
1378	3300046692	Ga0495671_0359668	Ga0495671_0359668_23_340	105
1379	3300046694	Ga0495649_0136314	Ga0495649_0136314_592_909	105
1380	3300046794	Ga0495589_0045823	Ga0495589_0045823_1735_2052	105
1381	3300046809	Ga0495600_0225447	Ga0495600_0225447_149_466	105
1382	3300046810	Ga0495660_0169048	Ga0495660_0169048_20_337	105
1383	3300047315	Ga0495581_0014621	Ga0495581_0014621_2113_2430	105
1384	3300047315	Ga0495581_0023902	Ga0495581_0023902_64_381	105
1385	3300047315	Ga0495581_0251732	Ga0495581_0251732_318_635	105
1386	3300047315	Ga0495581_0349642	Ga0495581_0349642_509_826	105
1387	3300047317	Ga0495604_0154393	Ga0495604_0154393_1063_1380	105
1388	3300047317	Ga0495604_0356448	Ga0495604_0356448_303_620	105
1389	3300047318	Ga0495636_0048529	Ga0495636_0048529_549_866	105
1390	3300047318	Ga0495636_0096474	Ga0495636_0096474_138_455	105
1391	3300047319	Ga0495674_0228167	Ga0495674_0228167_782_1099	105
1392	3300047319	Ga0495674_0278534	Ga0495674_0278534_753_1070	105
1393	3300047320	Ga0495672_0021095	Ga0495672_0021095_2445_2762	105
1394	3300047320	Ga0495672_0346526	Ga0495672_0346526_288_605	105
1395	3300047321	Ga0495676_0136425	Ga0495676_0136425_564_881	105
1396	3300047321	Ga0495676_0246965	Ga0495676_0246965_783_1100	105
1397	3300047322	Ga0495680_0547551	Ga0495680_0547551_56_373	105
1398	3300047323	Ga0495683_0061986	Ga0495683_0061986_1118_1435	105
1399	3300047323	Ga0495683_0191134	Ga0495683_0191134_35_352	105
1400	3300047443	Ga0495687_114038	Ga0495687_114038_149_466	105
1401	3300047444	Ga0495675_0187261	Ga0495675_0187261_253_570	105
1402	3300047445	Ga0495677_0099886	Ga0495677_0099886_723_1040	105
1403	3300047445	Ga0495677_0158237	Ga0495677_0158237_326_643	105
1404	3300047445	Ga0495677_0241699	Ga0495677_0241699_216_533	105
1405	3300047446	Ga0495679_059874	Ga0495679_059874_732_1049	105
1406	3300047447	Ga0495685_229790	Ga0495685_229790_181_498	105
1407	3300047469	Ga0495673_0043235	Ga0495673_0043235_398_715	105
1408	3300047471	Ga0495684_0011258	Ga0495684_0011258_1804_2121	105
1409	3300047471	Ga0495684_0810657	Ga0495684_0810657_103_420	105
1410	3300047472	Ga0495686_0295536	Ga0495686_0295536_465_782	105
1411	3300047472	Ga0495686_0347823	Ga0495686_0347823_250_567	105
1412	3300047472	Ga0495686_0471606	Ga0495686_0471606_315_632	105
1413	3300047673	Ga0495593_0016334	Ga0495593_0016334_460_777	105
1414	3300047673	Ga0495593_0120908	Ga0495593_0120908_226_543	105
1415	3300048091	Ga0495626_0102391	Ga0495626_0102391_901_1218	105
1416	3300048903	Ga0496100_0018221	Ga0496100_0018221_3619_3936	105
1417	3300048903	Ga0496100_0048543	Ga0496100_0048543_988_1305	105
1418	3300048903	Ga0496100_0818449	Ga0496100_0818449_251_568	105
1419	3300048903	Ga0496100_1137818	Ga0496100_1137818_36_353	105
1420	3300048903	Ga0496100_1230779	Ga0496100_1230779_195_512	105
1421	3300048904	Ga0496101_0015046	Ga0496101_0015046_3208_3525	105
1422	3300048904	Ga0496101_0069870	Ga0496101_0069870_341_658	105
1423	3300048904	Ga0496101_0473795	Ga0496101_0473795_41_358	105
1424	3300048904	Ga0496101_0486290	Ga0496101_0486290_149_466	105
1425	3300048904	Ga0496101_0827426	Ga0496101_0827426_208_525	105
1426	3300048904	Ga0496101_0853078	Ga0496101_0853078_89_406	105
1427	3300048904	Ga0496101_0915680	Ga0496101_0915680_341_658	105
1428	3300048904	Ga0496101_1555600	Ga0496101_1555600_20_337	105
1429	3300048905	Ga0496102_0004540	Ga0496102_0004540_9729_10046	105
1430	3300048905	Ga0496102_0051691	Ga0496102_0051691_2753_3070	105
1431	3300048905	Ga0496102_0170771	Ga0496102_0170771_544_861	105
1432	3300048905	Ga0496102_0363567	Ga0496102_0363567_691_1008	105
1433	3300048905	Ga0496102_0505020	Ga0496102_0505020_435_752	105
1434	3300048905	Ga0496102_0764047	Ga0496102_0764047_388_705	105
1435	3300048905	Ga0496102_0918944	Ga0496102_0918944_401_718	105
1436	3300048905	Ga0496102_0964030	Ga0496102_0964030_86_403	105
1437	3300048905	Ga0496102_1571745	Ga0496102_1571745_238_555	105
1438	3300048906	Ga0496103_0059946	Ga0496103_0059946_381_698	105
1439	3300048906	Ga0496103_0072927	Ga0496103_0072927_15_332	105
1440	3300048906	Ga0496103_0406964	Ga0496103_0406964_387_704	105
1441	3300048907	Ga0496104_0017703	Ga0496104_0017703_3774_4091	105
1442	3300048907	Ga0496104_0357700	Ga0496104_0357700_805_1122	105
1443	3300048907	Ga0496104_0383655	Ga0496104_0383655_246_563	105
1444	3300048907	Ga0496104_0489345	Ga0496104_0489345_691_1008	105
1445	3300048907	Ga0496104_0625529	Ga0496104_0625529_494_811	105
1446	3300048907	Ga0496104_0686409	Ga0496104_0686409_501_818	105
1447	3300048907	Ga0496104_0879600	Ga0496104_0879600_64_381	105
1448	3300048908	Ga0496105_0008057	Ga0496105_0008057_7264_7581	105
1449	3300048908	Ga0496105_0014022	Ga0496105_0014022_5809_6126	105
1450	3300048908	Ga0496105_1257835	Ga0496105_1257835_175_492	105
1451	3300048908	Ga0496105_1294021	Ga0496105_1294021_156_473	105
1452	3300048909	Ga0496106_0015715	Ga0496106_0015715_2392_2709	105
1453	3300048909	Ga0496106_0045300	Ga0496106_0045300_2344_2661	105
1454	3300048909	Ga0496106_0182289	Ga0496106_0182289_767_1084	105
1455	3300048909	Ga0496106_0263987	Ga0496106_0263987_23_340	105
1456	3300048909	Ga0496106_0336430	Ga0496106_0336430_815_1132	105
1457	3300048909	Ga0496106_0888819	Ga0496106_0888819_20_337	105
1458	3300048910	Ga0496107_0011149	Ga0496107_0011149_5063_5380	105
1459	3300048910	Ga0496107_0013087	Ga0496107_0013087_450_767	105
1460	3300048910	Ga0496107_0290333	Ga0496107_0290333_875_1192	105
1461	3300048910	Ga0496107_1005114	Ga0496107_1005114_256_573	105
1462	3300048911	Ga0496108_0047992	Ga0496108_0047992_3045_3362	105
1463	3300048911	Ga0496108_0079769	Ga0496108_0079769_1022_1339	105
1464	3300048911	Ga0496108_0097977	Ga0496108_0097977_278_595	105
1465	3300048911	Ga0496108_0233559	Ga0496108_0233559_875_1192	105
1466	3300048912	Ga0496109_0165663	Ga0496109_0165663_1351_1668	105
1467	3300048912	Ga0496109_0560617	Ga0496109_0560617_286_603	105
1468	3300048912	Ga0496109_0895090	Ga0496109_0895090_261_578	105
1469	3300048912	Ga0496109_1016423	Ga0496109_1016423_77_394	105
1470	3300048913	Ga0496110_0014218	Ga0496110_0014218_5734_6051	105
1471	3300048913	Ga0496110_0019559	Ga0496110_0019559_1765_2082	105
1472	3300048913	Ga0496110_0287688	Ga0496110_0287688_224_541	105
1473	3300048913	Ga0496110_0445239	Ga0496110_0445239_380_697	105
1474	3300048913	Ga0496110_0639206	Ga0496110_0639206_425_742	105
1475	3300048914	Ga0496111_0006236	Ga0496111_0006236_4481_4798	105
1476	3300048914	Ga0496111_0078678	Ga0496111_0078678_636_953	105
1477	3300048914	Ga0496111_0120740	Ga0496111_0120740_1210_1527	105
1478	3300048915	Ga0496112_0006170	Ga0496112_0006170_7496_7813	105
1479	3300048915	Ga0496112_0521257	Ga0496112_0521257_373_690	105
1480	3300048915	Ga0496112_0662171	Ga0496112_0662171_218_535	105
1481	3300048916	Ga0496113_0021435	Ga0496113_0021435_1109_1426	105
1482	3300048916	Ga0496113_0132157	Ga0496113_0132157_1534_1851	105
1483	3300048916	Ga0496113_0807760	Ga0496113_0807760_278_595	105
1484	3300048917	Ga0496114_0171444	Ga0496114_0171444_41_358	105
1485	3300048917	Ga0496114_0646898	Ga0496114_0646898_565_882	105
1486	3300048917	Ga0496114_0737873	Ga0496114_0737873_411_779	105
1487	3300048917	Ga0496114_1307685	Ga0496114_1307685_256_573	105
1488	3300048918	Ga0496115_0003033	Ga0496115_0003033_7691_8008	105
1489	3300048918	Ga0496115_0005527	Ga0496115_0005527_1266_1583	105
1490	3300048918	Ga0496115_0016573	Ga0496115_0016573_883_1200	105
1491	3300048918	Ga0496115_0244595	Ga0496115_0244595_931_1248	105
1492	3300048918	Ga0496115_0263840	Ga0496115_0263840_427_744	105
1493	3300048918	Ga0496115_0469138	Ga0496115_0469138_318_635	105
1494	3300048918	Ga0496115_0485431	Ga0496115_0485431_644_961	105
1495	3300048918	Ga0496115_0566744	Ga0496115_0566744_543_860	105
1496	3300048918	Ga0496115_1102849	Ga0496115_1102849_229_546	105
1497	3300048920	Ga0496117_0360921	Ga0496117_0360921_121_438	105
1498	3300048921	Ga0496118_0600202	Ga0496118_0600202_177_494	105
1499	3300048922	Ga0496119_0509568	Ga0496119_0509568_13_330	105
1500	3300048924	Ga0496121_0040887	Ga0496121_0040887_1627_1944	105
1501	3300048924	Ga0496121_0083526	Ga0496121_0083526_1126_1443	105
1502	3300048924	Ga0496121_0110939	Ga0496121_0110939_378_695	105
1503	3300048924	Ga0496121_0116161	Ga0496121_0116161_818_1135	105
1504	3300048924	Ga0496121_0117650	Ga0496121_0117650_289_606	105
1505	3300048924	Ga0496121_0117916	Ga0496121_0117916_45_362	105
1506	3300048924	Ga0496121_0120514	Ga0496121_0120514_560_877	105
1507	3300048924	Ga0496121_0124913	Ga0496121_0124913_94_411	105
1508	3300048924	Ga0496121_0174578	Ga0496121_0174578_430_747	105
1509	3300048924	Ga0496121_0345785	Ga0496121_0345785_634_951	105
1510	3300048924	Ga0496121_0385046	Ga0496121_0385046_423_740	105
1511	3300048924	Ga0496121_0397472	Ga0496121_0397472_80_397	105
1512	3300048924	Ga0496121_0489430	Ga0496121_0489430_36_353	105
1513	3300048924	Ga0496121_0857479	Ga0496121_0857479_75_392	105
1514	3300048924	Ga0496121_0859424	Ga0496121_0859424_20_337	105
1515	3300048925	Ga0496122_0135095	Ga0496122_0135095_483_800	105
1516	3300048927	Ga0496124_0139066	Ga0496124_0139066_1409_1726	105
1517	3300048927	Ga0496124_0603699	Ga0496124_0603699_370_687	105
1518	3300048927	Ga0496124_0646836	Ga0496124_0646836_40_357	105
1519	3300048928	Ga0496125_0031970	Ga0496125_0031970_3394_3711	105
1520	3300048928	Ga0496125_0768485	Ga0496125_0768485_137_454	105
1521	3300048929	Ga0496126_0004556	Ga0496126_0004556_9884_10201	105
1522	3300048929	Ga0496126_0008355	Ga0496126_0008355_7570_7887	105
1523	3300048929	Ga0496126_0028078	Ga0496126_0028078_265_582	105
1524	3300048929	Ga0496126_0040571	Ga0496126_0040571_2283_2600	105
1525	3300048929	Ga0496126_0158729	Ga0496126_0158729_264_581	105
1526	3300048929	Ga0496126_0344998	Ga0496126_0344998_743_1060	105
1527	3300048929	Ga0496126_0535625	Ga0496126_0535625_429_746	105
1528	3300048929	Ga0496126_0580454	Ga0496126_0580454_230_547	105
1529	3300048929	Ga0496126_0610902	Ga0496126_0610902_113_430	105
1530	3300049459	Ga0495678_099414	Ga0495678_099414_52_369	105
1531	3300049460	Ga0495682_0040482	Ga0495682_0040482_643_960	105
1532	3300049460	Ga0495682_0181662	Ga0495682_0181662_252_569	105
1533	3300049460	Ga0495682_0301326	Ga0495682_0301326_230_547	105
1534	3300049513	Ga0501290_091997	Ga0501290_091997_145_462	105
1535	3300049515	Ga0501292_136894	Ga0501292_136894_74_391	105
1536	3300049568	Ga0501031_0004204	Ga0501031_0004204_8088_8420	105
1537	3300049568	Ga0501031_0117333	Ga0501031_0117333_605_922	105
1538	3300049569	Ga0501032_0000165	Ga0501032_0000165_27349_27681	105
1539	3300049569	Ga0501032_0123690	Ga0501032_0123690_495_812	105
1540	3300049570	Ga0501033_0000298	Ga0501033_0000298_460_792	105
1541	3300049570	Ga0501033_0148296	Ga0501033_0148296_1051_1368	105
1542	3300049571	Ga0501034_0000058	Ga0501034_0000058_45977_46309	105
1543	3300049572	Ga0501036_0023461	Ga0501036_0023461_395_727	105
1544	3300049572	Ga0501036_1459785	Ga0501036_1459785_182_499	105
1545	3300049573	Ga0501037_0000078	Ga0501037_0000078_89607_89939	105
1546	3300049573	Ga0501037_0305309	Ga0501037_0305309_699_1016	105
1547	3300049574	Ga0501038_0000050	Ga0501038_0000050_45998_46330	105
1548	3300049574	Ga0501038_0616814	Ga0501038_0616814_327_644	105
1549	3300049574	Ga0501038_0636448	Ga0501038_0636448_73_390	105
1550	3300049574	Ga0501038_0785286	Ga0501038_0785286_156_473	105
1551	3300049575	Ga0501039_0000078	Ga0501039_0000078_29421_29753	105
1552	3300049575	Ga0501039_0999658	Ga0501039_0999658_38_355	105
1553	3300049579	Ga0501043_0000220	Ga0501043_0000220_959_1291	105
1554	3300049579	Ga0501043_0151502	Ga0501043_0151502_1202_1519	105
1555	3300049579	Ga0501043_0481689	Ga0501043_0481689_171_488	105
1556	3300049580	Ga0501046_0000893	Ga0501046_0000893_460_792	105
1557	3300049580	Ga0501046_1056375	Ga0501046_1056375_229_546	105
1558	3300049581	Ga0501047_0000538	Ga0501047_0000538_18699_19031	105
1559	3300049582	Ga0501048_0001589	Ga0501048_0001589_524_856	105
1560	3300049582	Ga0501048_0206064	Ga0501048_0206064_309_626	105
1561	3300049583	Ga0501067_0003278	Ga0501067_0003278_418_750	105
1562	3300049584	Ga0501068_0001155	Ga0501068_0001155_13572_13904	105
1563	3300049584	Ga0501068_0565668	Ga0501068_0565668_286_603	105
1564	3300049586	Ga0501070_0001275	Ga0501070_0001275_446_778	105
1565	3300049586	Ga0501070_0355122	Ga0501070_0355122_515_832	105
1566	3300049587	Ga0501071_0147524	Ga0501071_0147524_1306_1623	105
1567	3300049588	Ga0501072_0005008	Ga0501072_0005008_205_537	105
1568	3300049589	Ga0501073_0000061	Ga0501073_0000061_5090_5422	105
1569	3300049589	Ga0501073_0164569	Ga0501073_0164569_1039_1356	105
1570	3300049590	Ga0501074_0000022	Ga0501074_0000022_37877_38209	105
1571	3300049593	Ga0501077_0969041	Ga0501077_0969041_154_471	105
1572	3300049652	Ga0501202_141411	Ga0501202_141411_144_461	105
1573	3300049672	Ga0501239_089392	Ga0501239_089392_103_420	105
1574	3300049705	Ga0501225_0302718	Ga0501225_0302718_63_380	105
1575	3300049741	Ga0501079_0001133	Ga0501079_0001133_22_354	105
1576	3300049741	Ga0501079_0231414	Ga0501079_0231414_107_424	105
1577	3300049742	Ga0501080_0000226	Ga0501080_0000226_23619_23951	105
1578	3300049742	Ga0501080_0369379	Ga0501080_0369379_68_385	105
1579	3300049742	Ga0501080_1114002	Ga0501080_1114002_295_627	105
1580	3300049822	Ga0501035_0001069	Ga0501035_0001069_460_792	105
1581	3300049822	Ga0501035_0541214	Ga0501035_0541214_315_632	105
1582	3300049822	Ga0501035_1145805	Ga0501035_1145805_260_577	105
1583	3300049823	Ga0501044_0000145	Ga0501044_0000145_41130_41462	105
1584	3300049823	Ga0501044_0078401	Ga0501044_0078401_1127_1444	105
1585	3300049823	Ga0501044_0163912	Ga0501044_0163912_701_1018	105
1586	3300049823	Ga0501044_0564049	Ga0501044_0564049_230_547	105
1587	3300049824	Ga0501045_0029679	Ga0501045_0029679_410_742	105
1588	3300050489	nmdc:mga03683_170087_c1	nmdc:mga03683_170087_c1_554_871	105
1589	3300050489	nmdc:mga03683_216574_c1	nmdc:mga03683_216574_c1_27_344	105
1590	3300050489	nmdc:mga03683_38967_c1	nmdc:mga03683_38967_c1_1383_1700	105
1591	3300050489	nmdc:mga03683_531674_c1	nmdc:mga03683_531674_c1_209_526	105
1592	3300050489	nmdc:mga03683_561793_c1	nmdc:mga03683_561793_c1_41_358	105
1593	3300050489	nmdc:mga03683_91293_c1	nmdc:mga03683_91293_c1_814_1131	105
1594	3300050489	nmdc:mga03683_95418_c1	nmdc:mga03683_95418_c1_570_887	105
1595	3300050490	nmdc:mga03n38_398765_c1	nmdc:mga03n38_398765_c1_241_558	105
1596	3300050490	nmdc:mga03n38_7616_c1	nmdc:mga03n38_7616_c1_1688_2005	105
1597	3300050491	nmdc:mga00v17_160188_c1	nmdc:mga00v17_160188_c1_616_933	105
1598	3300050491	nmdc:mga00v17_252989_c1	nmdc:mga00v17_252989_c1_358_675	105
1599	3300050491	nmdc:mga00v17_580231_c1	nmdc:mga00v17_580231_c1_45_362	105
1600	3300050491	nmdc:mga00v17_70760_c1	nmdc:mga00v17_70760_c1_1429_1746	105
1601	3300050492	nmdc:mga0yw44_1007238_c1	nmdc:mga0yw44_1007238_c1_230_547	105
1602	3300050492	nmdc:mga0yw44_137626_c1	nmdc:mga0yw44_137626_c1_428_745	105
1603	3300050492	nmdc:mga0yw44_144061_c1	nmdc:mga0yw44_144061_c1_1024_1341	105
1604	3300050492	nmdc:mga0yw44_38733_c1	nmdc:mga0yw44_38733_c1_2376_2693	105
1605	3300050492	nmdc:mga0yw44_430541_c1	nmdc:mga0yw44_430541_c1_354_671	105
1606	3300050492	nmdc:mga0yw44_68534_c1	nmdc:mga0yw44_68534_c1_430_747	105
1607	3300050493	nmdc:mga0k408_185592_c1	nmdc:mga0k408_185592_c1_388_705	105
1608	3300050493	nmdc:mga0k408_19644_c1	nmdc:mga0k408_19644_c1_345_662	105
1609	3300050493	nmdc:mga0k408_245015_c1	nmdc:mga0k408_245015_c1_79_396	105
1610	3300050493	nmdc:mga0k408_275799_c1	nmdc:mga0k408_275799_c1_459_776	105
1611	3300050493	nmdc:mga0k408_394620_c1	nmdc:mga0k408_394620_c1_303_620	105
1612	3300050493	nmdc:mga0k408_617548_c1	nmdc:mga0k408_617548_c1_282_599	105
1613	3300050493	nmdc:mga0k408_67897_c1	nmdc:mga0k408_67897_c1_27_344	105
1614	3300050493	nmdc:mga0k408_87001_c1	nmdc:mga0k408_87001_c1_1309_1626	105
1615	3300050494	nmdc:mga06z11_15695_c1	nmdc:mga06z11_15695_c1_1977_2294	105
1616	3300050494	nmdc:mga06z11_182212_c1	nmdc:mga06z11_182212_c1_314_631	105
1617	3300050494	nmdc:mga06z11_190940_c1	nmdc:mga06z11_190940_c1_629_946	105
1618	3300050494	nmdc:mga06z11_227015_c1	nmdc:mga06z11_227015_c1_199_516	105
1619	3300050494	nmdc:mga06z11_824251_c1	nmdc:mga06z11_824251_c1_234_551	105
1620	3300050494	nmdc:mga06z11_991745_c1	nmdc:mga06z11_991745_c1_88_405	105
1621	3300050495	nmdc:mga04h51_123241_c1	nmdc:mga04h51_123241_c1_504_821	105
1622	3300050495	nmdc:mga04h51_296910_c1	nmdc:mga04h51_296910_c1_220_537	105
1623	3300050495	nmdc:mga04h51_447832_c1	nmdc:mga04h51_447832_c1_29_346	105
1624	3300050496	nmdc:mga07m45_20657_c1	nmdc:mga07m45_20657_c1_2834_3151	105
1625	3300050496	nmdc:mga07m45_21155_c1	nmdc:mga07m45_21155_c1_2720_3037	105
1626	3300050496	nmdc:mga07m45_62112_c1	nmdc:mga07m45_62112_c1_1276_1593	105
1627	3300050496	nmdc:mga07m45_769199_c1	nmdc:mga07m45_769199_c1_155_472	105
1628	3300050507	nmdc:mga05p37_1142215_c1	nmdc:mga05p37_1142215_c1_375_692	105
1629	3300050507	nmdc:mga05p37_83615_c1	nmdc:mga05p37_83615_c1_1251_1568	105
1630	3300050509	nmdc:mga0qj67_1009575_c1	nmdc:mga0qj67_1009575_c1_317_634	105
1631	3300050511	nmdc:mga08y16_1789164_c1	nmdc:mga08y16_1789164_c1_22_339	105
1632	3300050511	nmdc:mga08y16_271146_c1	nmdc:mga08y16_271146_c1_1089_1406	105
1633	3300050511	nmdc:mga08y16_416233_c1	nmdc:mga08y16_416233_c1_26_343	105
1634	3300050512	nmdc:mga0n895_135176_c1	nmdc:mga0n895_135176_c1_749_1066	105
1635	3300050512	nmdc:mga0n895_2054710_c1	nmdc:mga0n895_2054710_c1_95_412	105
1636	3300050512	nmdc:mga0n895_213033_c1	nmdc:mga0n895_213033_c1_447_764	105
1637	3300050513	nmdc:mga0rr50_26698_c1	nmdc:mga0rr50_26698_c1_2939_3256	105
1638	3300050513	nmdc:mga0rr50_523148_c1	nmdc:mga0rr50_523148_c1_66_383	105
1639	3300050514	nmdc:mga08x19_1329369_c1	nmdc:mga08x19_1329369_c1_150_467	105
1640	3300050514	nmdc:mga08x19_166274_c1	nmdc:mga08x19_166274_c1_190_507	105
1641	3300050515	nmdc:mga0a205_935786_c1	nmdc:mga0a205_935786_c1_350_667	105
1642	3300050516	nmdc:mga0sz30_534757_c1	nmdc:mga0sz30_534757_c1_86_403	105
1643	3300053077	Ga0495601_0046505	Ga0495601_0046505_2043_2360	105
1644	3300053077	Ga0495601_0856289	Ga0495601_0856289_35_352	105
1645	3300053077	Ga0495601_0910307	Ga0495601_0910307_181_498	105
1646	3300053078	Ga0495612_0085178	Ga0495612_0085178_420_737	105
1647	3300053078	Ga0495612_0114425	Ga0495612_0114425_370_687	105
1648	3300053079	Ga0500610_0255916	Ga0500610_0255916_401_718	105
1649	3300053079	Ga0500610_0438067	Ga0500610_0438067_148_465	105
1650	3300053080	Ga0500635_0183565	Ga0500635_0183565_316_633	105
1651	3300053085	Ga0495619_0086471	Ga0495619_0086471_1096_1413	105
1652	3300053086	Ga0500578_0237101	Ga0500578_0237101_771_1088	105
1653	3300053087	Ga0500643_021463	Ga0500643_021463_1602_1919	105
1654	3300053088	Ga0500644_0112899	Ga0500644_0112899_387_704	105
1655	3300053089	Ga0500581_203357	Ga0500581_203357_66_383	105
1656	3300053090	Ga0500646_0052189	Ga0500646_0052189_364_681	105
1657	3300053090	Ga0500646_0134042	Ga0500646_0134042_477_794	105
1658	3300053092	Ga0500583_0052534	Ga0500583_0052534_870_1187	105
1659	3300053092	Ga0500583_0313683	Ga0500583_0313683_300_617	105
1660	3300053093	Ga0500651_0353116	Ga0500651_0353116_273_590	105
1661	3300053093	Ga0500651_0373310	Ga0500651_0373310_25_342	105
1662	3300053094	Ga0500566_0149080	Ga0500566_0149080_734_1051	105
1663	3300053094	Ga0500566_0353267	Ga0500566_0353267_148_465	105
1664	3300053096	Ga0500641_0039461	Ga0500641_0039461_1058_1375	105
1665	3300053096	Ga0500641_0220905	Ga0500641_0220905_153_470	105
1666	3300053096	Ga0500641_0339691	Ga0500641_0339691_205_522	105
1667	3300053097	Ga0500648_257563	Ga0500648_257563_448_765	105
1668	3300053099	Ga0500654_103747	Ga0500654_103747_312_629	105
1669	3300053103	Ga0500555_145039	Ga0500555_145039_80_397	105
1670	3300053105	Ga0500557_165831	Ga0500557_165831_387_704	105
1671	3300053108	Ga0500562_049744	Ga0500562_049744_689_1006	105
1672	3300053109	Ga0500569_011698	Ga0500569_011698_965_1282	105
1673	3300053116	Ga0500592_074442	Ga0500592_074442_17_334	105
1674	3300053117	Ga0500593_295606	Ga0500593_295606_40_357	105
1675	3300053118	Ga0500594_0024653	Ga0500594_0024653_153_470	105
1676	3300053118	Ga0500594_0176876	Ga0500594_0176876_267_584	105
1677	3300053119	Ga0500595_003229	Ga0500595_003229_6875_7192	105
1678	3300053119	Ga0500595_098849	Ga0500595_098849_165_482	105
1679	3300053120	Ga0500597_012954	Ga0500597_012954_126_443	105
1680	3300053129	Ga0500628_191049	Ga0500628_191049_251_568	105
1681	3300053133	Ga0500655_038081	Ga0500655_038081_387_704	105
1682	3300053134	Ga0500658_0267775	Ga0500658_0267775_38_355	105
1683	3300053136	Ga0500559_0500904	Ga0500559_0500904_112_429	105
1684	3300053139	Ga0500568_0056730	Ga0500568_0056730_451_768	105
1685	3300053139	Ga0500568_0266362	Ga0500568_0266362_245_562	105
1686	3300053140	Ga0500573_0260353	Ga0500573_0260353_503_820	105
1687	3300053140	Ga0500573_0419937	Ga0500573_0419937_36_353	105
1688	3300053142	Ga0500577_0000113	Ga0500577_0000113_4887_5204	105
1689	3300053142	Ga0500577_0042647	Ga0500577_0042647_438_755	105
1690	3300053147	Ga0500589_039952	Ga0500589_039952_913_1230	105
1691	3300053147	Ga0500589_100846	Ga0500589_100846_552_869	105
1692	3300053147	Ga0500589_340992	Ga0500589_340992_172_489	105
1693	3300053148	Ga0500590_086870	Ga0500590_086870_189_506	105
1694	3300053148	Ga0500590_137887	Ga0500590_137887_307_624	105
1695	3300053148	Ga0500590_244946	Ga0500590_244946_96_413	105
1696	3300053150	Ga0500603_070796	Ga0500603_070796_575_892	105
1697	3300053150	Ga0500603_093138	Ga0500603_093138_419_736	105
1698	3300053151	Ga0500604_0026210	Ga0500604_0026210_461_778	105
1699	3300053151	Ga0500604_0132898	Ga0500604_0132898_422_739	105
1700	3300053158	Ga0500627_0273206	Ga0500627_0273206_23_340	105
1701	3300053161	Ga0500634_0018862	Ga0500634_0018862_3176_3493	105
1702	3300053161	Ga0500634_0239644	Ga0500634_0239644_47_364	105
1703	3300053162	Ga0500638_169801	Ga0500638_169801_556_873	105
1704	3300053162	Ga0500638_252801	Ga0500638_252801_234_551	105
1705	3300053163	Ga0500639_269305	Ga0500639_269305_69_386	105
1706	3300053177	Ga0500636_0124155	Ga0500636_0124155_460_777	105
1707	3300053177	Ga0500636_0335601	Ga0500636_0335601_35_352	105
1708	3300053178	Ga0500637_0526715	Ga0500637_0526715_177_494	105
1709	3300053727	Ga0500611_156961	Ga0500611_156961_108_425	105
1710	3300053730	Ga0500645_032125	Ga0500645_032125_310_627	105
1711	3300053735	Ga0500596_001916	Ga0500596_001916_1448_1765	105
1712	3300054114	Ga0501084_0122244	Ga0501084_0122244_1733_2065	105
1713	3300060353	Ga0501082_0004306	Ga0501082_0004306_3907_4239	105
1714	3300060353	Ga0501082_0129527	Ga0501082_0129527_1496_1813	105
1715	3300061734	Ga0530510_0914987	Ga0530510_0914987_169_486	105

Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
2vrz-assembly1.cif.gz_A	structural analysis of homodimeric staphylococcal aureus esxa	0.555	2	93
2vrz-assembly1.cif.gz_B	structural analysis of homodimeric staphylococcal aureus esxa	0.5368	2	93
4j7k-assembly1.cif.gz_A	the crystal structure of a secreted protein esxb (mutant e54q) from bacillus anthracis str. sterne	0.5177	3	93
4j41-assembly3.cif.gz_E	the crystal structure of a secreted protein esxb (mutant p67a) from bacillus anthracis str. sterne	0.4925	3	93
4j41-assembly1.cif.gz_A	the crystal structure of a secreted protein esxb (mutant p67a) from bacillus anthracis str. sterne	0.491	3	93

ID	Description	Score	Start	End	Superfamily
3zbhH00	Mainly Alpha;Orthogonal Bundle;Helix Hairpins;ESAT-6-like	0.6035	3	93	1.10.287.1060
af_B6T671_153_231_1.10.287.1260	Mainly Alpha;Orthogonal Bundle;Helix Hairpins;	0.5961	3	93	1.10.287.1260
af_B6T671_153_231_1.10.287.1260	Mainly Alpha;Orthogonal Bundle;Helix Hairpins;	0.5471	3	93	1.10.287.1260
2vrzB00	Mainly Alpha;Orthogonal Bundle;Helix Hairpins;ESAT-6-like	0.5368	2	93	1.10.287.1060
2vs0B00	Mainly Alpha;Orthogonal Bundle;Helix Hairpins;ESAT-6-like	0.534	2	93	1.10.287.1060

ID	Description	Score	Start	End	GO Terms
AF-A0A537SYB4-F1-model_v4	Uncharacterized protein	0.7252	1	105	GO:0016020
AF-A0A537SYB4-F1-model_v4	Uncharacterized protein	0.7192	1	105	GO:0016020
AF-A0A1Q3KB22-F1-model_v4	Uncharacterized protein	0.7079	1	105	GO:0016020
AF-A0A2N5XNX0-F1-model_v4	Uncharacterized protein	0.7073	2	100	GO:0016020
AF-A0A380WCY5-F1-model_v4	Uncharacterized protein	0.7071	1	105	GO:0016020

Feature Viewer

pLDDT	pTM	Quality
82.27	0.56	Medium

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F495447

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map