F495458

General Info

Members Datasets Scaffolds Average Seq Length
1717 1175 3434 266

Family's Representative Sequence

Representative Sequence 3300048907|Ga0496104_0057690|Ga0496104_0057690_108_905
Length 254
Sequence MKRGKFDITVLTLGFAYSFNASKLVTVWGGFSLQWYKSMWSNQGLMDAAWVTLRVGILSATIGTILGTLAALSLTRFARFPGRVLFSGMIYAPLVMPEVITGLSLLLLFVAVGVDRGFWTVVIAHTTFTMCYVAIVVQSRLLTFDRSLEEAALDLGCPPVKTFFRITLPLIFPAVIAFTLSLDDLVIASFATGPGATTLPIKIYSQVRLGVTPEINAICTILIGLVTIGVIVASVASKRTELQRMRDEHAAARN

Samples

Sample ID Description Type Environment
1 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
7 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
8 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
9 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
10 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
11 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
12 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
13 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
14 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
15 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
16 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
17 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
18 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
19 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
20 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
21 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
36 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
62 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
63 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
64 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
65 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
66 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
67 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
68 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
69 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
74 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
75 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300009763 Root nodule microbial communities of legume samples collected from Mexico - Siratro Mexico nodule mix Metagenome Nodule
87 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
91 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
92 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
93 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
94 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
103 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
104 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
107 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
108 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
109 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
110 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
111 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
112 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
113 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
114 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
115 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
116 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
118 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
119 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
120 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
122 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
123 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
125 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
126 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
127 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
128 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
129 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
161 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
163 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
164 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
168 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
169 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
170 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
171 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
172 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
173 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
174 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
175 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
176 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
177 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
178 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
179 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
180 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
181 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
182 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
183 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
184 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
185 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
186 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
187 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
188 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
189 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
190 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
191 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
192 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
193 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
194 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
195 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
196 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
197 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
198 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
199 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
200 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
201 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
202 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
203 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
204 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
205 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
206 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
207 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
208 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
209 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
210 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
211 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
212 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
213 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
214 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
215 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
216 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
217 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
218 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
219 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
220 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
221 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
222 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
223 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
224 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
225 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
226 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
227 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
228 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
229 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
230 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
231 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
232 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
233 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
234 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
235 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
236 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
237 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
238 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
239 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
240 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
241 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
242 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
243 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
244 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
245 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
246 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
247 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
248 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
249 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
250 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
251 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
252 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
253 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
254 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
255 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
256 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
257 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
258 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
259 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
260 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
261 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
262 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
263 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
264 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
265 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
266 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
267 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
268 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
269 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
270 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
271 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
272 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
273 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
274 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
275 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
276 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
277 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
278 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
279 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
280 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
281 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
282 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
283 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
284 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
285 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
286 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
287 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
288 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
289 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
290 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
291 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
292 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
293 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
294 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
295 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
296 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
297 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
298 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
299 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
300 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
301 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
302 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
303 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
304 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
305 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
306 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
307 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
308 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
309 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
310 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
311 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
312 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
313 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
314 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
315 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
316 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
317 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
318 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
319 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
320 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
321 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
322 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
323 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
324 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
325 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
326 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
327 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
328 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
329 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
330 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
331 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
332 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
333 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
334 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
335 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
336 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
337 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
338 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
339 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
340 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
341 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
342 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
343 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
344 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
345 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
346 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
347 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
348 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
349 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
350 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
351 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
352 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
353 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
354 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
355 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
356 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
357 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
358 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
359 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
360 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
361 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
362 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
363 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
364 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
365 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
366 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
367 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
368 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
369 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
370 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
371 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
372 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
373 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
374 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
375 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
376 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
377 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
378 2509276019 Ensifer aridi TW10 Isolate Nodule
379 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
380 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
381 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
382 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
383 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
384 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
385 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
386 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
387 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
388 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
389 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
390 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
391 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
392 2512875024
393 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
394 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
395 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
396 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
397 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
398 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
399 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
400 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
401 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
402 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
403 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
404 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
405 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
406 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
407 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
408 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
409 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
410 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
411 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
412 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
413 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
414 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
415 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
416 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
417 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
418 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
419 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
420 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
421 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
422 2516143018 Ensifer sp. BR816 Isolate Nodule
423 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
424 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
425 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
426 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
427 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
428 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
429 2519899620 Rhizobium sp. Pop5 Isolate Nodule
430 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
431 2534681786 Brucella suis 92/29 Isolate Unclassified
432 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
433 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
434 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
435 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
436 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
437 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
438 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
439 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
440 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
441 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
442 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
443 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
444 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
445 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
446 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
447 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
448 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
449 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
450 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
451 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
452 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
453 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
454 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
455 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
456 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
457 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
458 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
459 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
460 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
461 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
462 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
463 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
464 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
465 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
466 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
467 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
468 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
469 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
470 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
471 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
472 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
473 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
474 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
475 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
476 2643221557 Ensifer sp. Root558 Isolate Unclassified
477 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
478 2643221582 Rhizobium sp. Root651 Isolate Unclassified
479 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
480 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
481 2643221599 Rhizobium sp. Root708 Isolate Unclassified
482 2643221607 Rhizobium sp. Root73 Isolate Unclassified
483 2643221610 Ensifer sp. Root74 Isolate Unclassified
484 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
485 2643221618 Ensifer sp. Root231 Isolate Unclassified
486 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
487 2643221626 Ensifer sp. Root31 Isolate Unclassified
488 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
489 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
490 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
491 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
492 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
493 2643221655 Ensifer sp. Root1252 Isolate Unclassified
494 2643221659 Ensifer sp. Root127 Isolate Unclassified
495 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
496 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
497 2643221668 Ensifer sp. Root423 Isolate Unclassified
498 2643221675 Ensifer sp. Root1298 Isolate Unclassified
499 2643221680 Ensifer sp. Root1312 Isolate Unclassified
500 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
501 2643221688 Rhizobium sp. Root482 Isolate Unclassified
502 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
503 2643221693 Rhizobium sp. Root491 Isolate Unclassified
504 2643221698 Ensifer sp. Root142 Isolate Unclassified
505 2643221712 Ensifer sp. Root258 Isolate Unclassified
506 2643221718 Rhizobium sp. Root268 Isolate Unclassified
507 2643221723 Ensifer sp. Root278 Isolate Unclassified
508 2643221726 Ensifer sp. Root954 Isolate Unclassified
509 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
510 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
511 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
512 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
513 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
514 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
515 2718217882 Rhizobium sp. N741 Isolate Nodule
516 2718217927 Rhizobium sp. N324 Isolate Nodule
517 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
518 2718218009 Rhizobium sp. N561 Isolate Nodule
519 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
520 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
521 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
522 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
523 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
524 2718218363 Rhizobium sp. N113 Isolate Nodule
525 2718218365 Rhizobium sp. N731 Isolate Nodule
526 2718218366 Rhizobium sp. N621 Isolate Nodule
527 2718218423 Rhizobium sp. N941 Isolate Nodule
528 2721755514 Rhizobium sp. N6212 Isolate Nodule
529 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
530 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
531 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
532 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
533 2721755809 Rhizobium sp. N541 Isolate Nodule
534 2721755810 Rhizobium sp. N871 Isolate Nodule
535 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
536 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
537 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
538 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
539 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
540 2728369365 Rhizobium sp. N1341 Isolate Nodule
541 2728369397 Rhizobium sp. N1314 Isolate Nodule
542 2738541293 Rhizobium sp. GV031 Isolate Unclassified
543 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
544 2738543024 Aminobacter sp. AP02 Isolate Unclassified
545 2751185800 Brucella pituitosa AA2 Isolate Unclassified
546 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
547 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
548 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
549 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
550 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
551 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
552 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
553 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
554 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
555 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
556 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
557 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
558 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
559 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
560 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
561 2791355256 Rhizobium sp. M10 Isolate Nodule
562 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
563 2791355260 Rhizobium sp. L9 Isolate Nodule
564 2791355261 Rhizobium sp. J15 Isolate Nodule
565 2791355262 Rhizobium sp. M1 Isolate Nodule
566 2791355263 Rhizobium chutanense C5 Isolate Nodule
567 2791355264 Rhizobium sp. S9 Isolate Nodule
568 2791355265 Rhizobium sp. H4 Isolate Nodule
569 2791355266 Rhizobium sp. L43 Isolate Nodule
570 2791355267 Rhizobium sp. L18 Isolate Nodule
571 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
572 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
573 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
574 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
575 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
576 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
577 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
578 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
579 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
580 2802429633 Rhizobium anhuiense J3 Isolate Nodule
581 2802429634 Rhizobium anhuiense S10 Isolate Nodule
582 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
583 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
584 2802429637 Rhizobium anhuiense C15 Isolate Nodule
585 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
586 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
587 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
588 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
589 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
590 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
591 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
592 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
593 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
594 2838048938 Rhizobium pisi 27/80 Isolate Nodule
595 2838061910 Rhizobium phaseoli L15 Isolate Nodule
596 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
597 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
598 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
599 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
600 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
601 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
602 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
603 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
604 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
605 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
606 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
607 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
608 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
609 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
610 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
611 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
612 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
613 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
614 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
615 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
616 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
617 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
618 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
619 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
620 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
621 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
622 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
623 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
624 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
625 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
626 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
627 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
628 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
629 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
630 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
631 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
632 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
633 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
634 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
635 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
636 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
637 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
638 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
639 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
640 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
641 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
642 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
643 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
644 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
645 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
646 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
647 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
648 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
649 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
650 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
651 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
652 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
653 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
654 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
655 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
656 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
657 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
658 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
659 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
660 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
661 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
662 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
663 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
664 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
665 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
666 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
667 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
668 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
669 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
670 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
671 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
672 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
673 2844163670 Ensifer sp. 1H6 Isolate Unclassified
674 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
675 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
676 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
677 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
678 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
679 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
680 2854911287 Brucella lupini LUP21 Isolate Unclassified
681 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
682 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
683 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
684 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
685 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
686 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
687 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
688 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
689 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
690 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
691 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
692 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
693 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
694 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
695 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
696 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
697 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
698 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
699 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
700 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
701 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
702 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
703 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
704 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
705 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
706 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
707 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
708 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
709 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
710 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
711 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
712 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
713 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
714 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
715 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
716 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
717 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
718 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
719 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
720 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
721 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
722 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
723 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
724 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
725 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
726 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
727 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
728 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
729 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
730 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
731 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
732 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
733 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
734 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
735 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
736 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
737 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
738 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
739 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
740 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
741 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
742 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
743 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
744 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
745 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
746 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
747 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
748 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
749 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
750 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
751 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
752 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
753 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
754 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
755 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
756 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
757 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
758 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
759 2891088606 Methylosinus sp. 3S-1 Isolate Rhizosphere
760 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
761 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
762 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
763 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
764 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
765 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
766 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
767 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
768 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
769 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
770 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
771 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
772 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
773 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
774 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
775 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
776 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
777 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
778 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
779 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
780 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
781 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
782 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
783 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
784 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
785 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
786 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
787 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
788 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
789 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
790 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
791 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
792 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
793 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
794 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
795 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
796 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
797 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
798 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
799 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
800 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
801 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
802 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
803 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
804 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
805 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
806 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
807 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
808 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
809 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
810 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
811 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
812 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
813 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
814 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
815 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
816 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
817 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
818 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
819 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
820 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
821 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
822 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
823 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
824 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
825 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
826 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
827 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
828 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
829 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
830 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
831 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
832 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
833 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
834 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
835 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
836 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
837 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
838 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
839 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
840 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
841 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
842 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
843 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
844 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
845 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
846 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
847 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
848 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
849 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
850 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
851 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
852 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
853 2933599457 Rhizobium phaseoli M3 Isolate Nodule
854 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
855 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
856 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
857 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
858 2936381700 Rhizobium chutanense C16 Isolate Unclassified
859 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
860 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
861 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
862 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
863 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
864 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
865 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
866 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
867 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
868 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
869 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
870 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
871 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
872 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
873 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
874 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
875 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
876 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
877 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
878 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
879 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
880 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
881 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
882 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
883 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
884 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
885 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
886 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
887 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
888 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
889 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
890 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
891 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
892 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
893 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
894 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
895 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
896 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
897 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
898 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
899 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
900 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
901 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
902 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
903 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
904 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
905 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
906 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
907 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
908 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
909 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
910 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
911 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
912 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
913 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
914 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
915 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
916 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
917 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
918 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
919 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
920 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
921 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
922 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
923 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
924 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
925 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
926 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
927 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
928 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
929 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
930 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
931 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
932 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
933 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
934 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
935 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
936 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
937 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
938 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
939 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
940 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
941 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
942 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
943 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
944 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
945 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
946 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
947 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
948 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
949 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
950 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
951 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
952 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
953 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
954 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
955 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
956 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
957 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
958 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
959 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
960 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
961 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
962 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
963 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
964 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
965 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
966 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
967 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
968 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
969 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
970 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
971 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
972 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
973 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
974 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
975 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
976 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
977 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
978 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
979 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
980 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
981 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
982 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
983 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
984 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
985 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
986 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
987 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
988 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
989 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
990 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
991 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
992 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
993 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
994 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
995 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
996 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
997 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
998 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
999 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
1000 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
1001 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
1002 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
1003 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
1004 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
1005 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
1006 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
1007 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
1008 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
1009 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
1010 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
1011 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
1012 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
1013 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
1014 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
1015 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
1016 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
1017 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
1018 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
1019 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
1020 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
1021 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
1022 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
1023 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
1024 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
1025 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
1026 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
1027 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
1028 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
1029 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
1030 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
1031 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
1032 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
1033 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
1034 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
1035 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
1036 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
1037 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
1038 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
1039 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
1040 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
1041 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
1042 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
1043 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
1044 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
1045 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
1046 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
1047 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
1048 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
1049 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
1050 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
1051 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
1052 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
1053 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
1054 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
1055 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
1056 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
1057 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
1058 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
1059 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
1060 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
1061 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
1062 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
1063 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
1064 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
1065 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
1066 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
1067 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
1068 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
1069 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
1070 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
1071 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
1072 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
1073 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
1074 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
1075 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
1076 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
1077 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
1078 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
1079 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
1080 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
1081 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
1082 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
1083 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
1084 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
1085 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
1086 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
1087 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
1088 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
1089 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
1090 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
1091 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
1092 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
1093 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
1094 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
1095 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
1096 2996887358 Rhizobium sp. R711 Isolate Nodule
1097 2996893221 Rhizobium sp. R635 Isolate Nodule
1098 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
1099 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
1100 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
1101 3004167301 Mesorhizobium loti 582 Isolate Unclassified
1102 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
1103 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
1104 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
1105 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
1106 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
1107 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
1108 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
1109 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
1110 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
1111 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
1112 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
1113 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
1114 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
1115 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
1116 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
1117 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
1118 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
1119 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
1120 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
1121 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
1122 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
1123 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
1124 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
1125 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
1126 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
1127 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
1128 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
1129 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
1130 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
1131 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
1132 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
1133 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
1134 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
1135 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
1136 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
1137 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
1138 8005258706 Rhizobium sp. R693 Isolate Nodule
1139 8005275841 Rhizobium sp. N4311 Isolate Nodule
1140 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
1141 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
1142 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
1143 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
1144 8005321885 Rhizobium sp. R72 Isolate Nodule
1145 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
1146 8005382845 Rhizobium sp. R634 Isolate Nodule
1147 8005395548 Rhizobium sp. R339 Isolate Nodule
1148 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
1149 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
1150 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
1151 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
1152 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
1153 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
1154 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
1155 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
1156 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
1157 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
1158 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
1159 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
1160 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
1161 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
1162 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
1163 8018176218 Rhizobium sp. N122 Isolate Nodule
1164 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
1165 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
1166 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
1167 8024501048 Rhizobium sp. H4 Isolate Nodule
1168 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
1169 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
1170 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
1171 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
1172 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
1173 8056382006 Rhizobium croatiense 13T Isolate Nodule
1174 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
1175 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 52.94
Metatranscriptomes 0.12
Isolates 46.94

Biome Distribution

Category Percentage (%)
Aerial Root 0.29
Bulb 0
Endosphere 12.81
Nodule 37.45
Rhizoplane 2.74
Rhizosphere 34.36
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496104_0057690 3300048907 Bacteria 3674
2 JGI24740J21852_10003648 3300001979 Bacteria 6710
3 JGI25156J39149_1011633 3300002705 Bacteria 1979
4 JGI25158J39367_1002742 3300002739 Bacteria 2807
5 JGI25157J39369_1002049 3300002741 Bacteria 5765
6 JGI25152J39213_1001989 3300002773 Bacteria 8067
7 JGI25152J39213_1003655 3300002773 Bacteria 5173
8 JGI25152J39213_1003941 3300002773 Bacteria 4858
9 JGI25152J39213_1005371 3300002773 Bacteria 3755
10 JGI25152J39213_1006110 3300002773 Bacteria 3353
11 JGI25152J39213_1006231 3300002773 Bacteria 3302
12 JGI25150J39212_1000012 3300002774 Bacteria 182468
13 JGI25150J39212_1000635 3300002774 Bacteria 13309
14 JGI25150J39212_1004118 3300002774 Bacteria 3279
15 JGI25150J39212_1013033 3300002774 Bacteria 1452
16 JGI25159J45721_1000016 3300002987 Bacteria 139656
17 JGI25159J45721_1000903 3300002987 Bacteria 12921
18 JGI25151J46595_10000025 3300003187 Bacteria 213302
19 JGI25151J46595_10000346 3300003187 Bacteria 49745
20 JGI25151J46595_10005451 3300003187 Bacteria 6570
21 JGI25151J46595_10005499 3300003187 Bacteria 6531
22 JGI25151J46595_10017127 3300003187 Bacteria 3152
23 JGI25406J46586_10003471 3300003203 Bacteria 7412
24 JGI25406J46586_10004531 3300003203 Bacteria 6469
25 JGI25406J46586_10051175 3300003203 Bacteria 1383
26 JGI25406J46586_10064206 3300003203 Bacteria 1174
27 JGI25153J46596_10001067 3300003215 Bacteria 16714
28 JGI25153J46596_10001672 3300003215 Bacteria 13149
29 JGI25153J46596_10003250 3300003215 Bacteria 9136
30 JGI25153J46596_10007980 3300003215 Bacteria 5122
31 JGI25153J46596_10014039 3300003215 Bacteria 3353
32 JGI25153J46596_10014326 3300003215 Bacteria 3302
33 JGI25160J50197_1000002 3300003354 Bacteria 561707
34 JGI25161J50226_1000074 3300003374 Bacteria 85547
35 JGI25161J50226_1000397 3300003374 Bacteria 21635
36 JGI25161J50226_1006024 3300003374 Bacteria 2251
37 Ga0055529_1003391 3300003763 Bacteria 2654
38 Ga0055526_1001675 3300003771 Bacteria 15546
39 Ga0055526_1003529 3300003771 Bacteria 9876
40 Ga0055526_1003766 3300003771 Bacteria 9463
41 Ga0055526_1015038 3300003771 Bacteria 3134
42 Ga0055526_1016134 3300003771 Bacteria 2945
43 Ga0055524_1000384 3300003775 Bacteria 38108
44 Ga0055524_1005796 3300003775 Bacteria 5457
45 Ga0055524_1006985 3300003775 Bacteria 4850
46 Ga0055524_1011084 3300003775 Bacteria 3544
47 Ga0055524_1029125 3300003775 Bacteria 1640
48 Ga0055524_1038230 3300003775 Bacteria 1259
49 Ga0055524_1050089 3300003775 Bacteria 956
50 Ga0055528_1000642 3300003790 Bacteria 25591
51 Ga0055528_1000866 3300003790 Bacteria 20524
52 Ga0055528_1001522 3300003790 Bacteria 13999
53 Ga0055528_1031997 3300003790 Bacteria 1355
54 Ga0055540_1000471 3300003792 Bacteria 31092
55 Ga0055540_1002010 3300003792 Bacteria 11314
56 Ga0055540_1016068 3300003792 Bacteria 2147
57 Ga0055540_1018350 3300003792 Bacteria 1919
58 Ga0055543_1000022 3300004625 Bacteria 140745
59 Ga0055543_1000141 3300004625 Bacteria 60055
60 Ga0055543_1001242 3300004625 Bacteria 10604
61 Ga0065165_1000058 3300005262 Bacteria 184784
62 Ga0070690_100004984 3300005330 Bacteria 7433
63 Ga0070670_100135511 3300005331 Bacteria 2128
64 Ga0070670_100305429 3300005331 Bacteria 1392
65 Ga0070680_100036295 3300005336 Bacteria 3982
66 Ga0070682_100040460 3300005337 Bacteria 2868
67 Ga0070682_100164415 3300005337 Bacteria 1536
68 Ga0070660_100218298 3300005339 Bacteria 1549
69 Ga0070689_100001622 3300005340 Bacteria 14368
70 Ga0070689_100445583 3300005340 Bacteria 1101
71 Ga0070691_10158127 3300005341 Bacteria 1167
72 Ga0070668_100006623 3300005347 Bacteria 8584
73 Ga0070668_100008269 3300005347 Bacteria 7723
74 Ga0070668_100014191 3300005347 Bacteria 5952
75 Ga0070668_100023623 3300005347 Bacteria 4651
76 Ga0070668_100074040 3300005347 Bacteria 2656
77 Ga0070668_100084250 3300005347 Bacteria 2496
78 Ga0070669_100113247 3300005353 Bacteria 2061
79 Ga0070675_100162214 3300005354 Bacteria 1923
80 Ga0070675_100635039 3300005354 Bacteria 970
81 Ga0070671_100005795 3300005355 Bacteria 9839
82 Ga0070671_100130128 3300005355 Bacteria 2120
83 Ga0070688_100003117 3300005365 Bacteria 8477
84 Ga0070659_100032393 3300005366 Bacteria 4054
85 Ga0070667_100016097 3300005367 Bacteria 6186
86 Ga0070667_100393777 3300005367 Bacteria 1260
87 Ga0070709_10052912 3300005434 Bacteria 2554
88 Ga0070713_100385128 3300005436 Bacteria 1307
89 Ga0070705_100012932 3300005440 Bacteria 4258
90 Ga0070700_100267034 3300005441 Bacteria 1235
91 Ga0070708_100764056 3300005445 Bacteria 909
92 Ga0070663_100071387 3300005455 Bacteria 2526
93 Ga0070678_100098451 3300005456 Bacteria 2261
94 Ga0070681_10006028 3300005458 Bacteria 11744
95 Ga0070679_100014502 3300005530 Bacteria 7570
96 Ga0070684_100134267 3300005535 Bacteria 2234
97 Ga0068853_100015631 3300005539 Bacteria 6235
98 Ga0070696_100032028 3300005546 Bacteria 3606
99 Ga0070665_100003769 3300005548 Bacteria 16042
100 Ga0070665_100004421 3300005548 Bacteria 14769
101 Ga0070665_100025086 3300005548 Bacteria 6009
102 Ga0070665_100781846 3300005548 Bacteria 968
103 Ga0068855_100288527 3300005563 Bacteria 1820
104 Ga0070664_100156462 3300005564 Bacteria 2014
105 Ga0070664_100173555 3300005564 Bacteria 1913
106 Ga0068856_100246320 3300005614 Bacteria 1802
107 Ga0068856_100479612 3300005614 Bacteria 1264
108 Ga0070702_100062629 3300005615 Bacteria 2169
109 Ga0070702_100066993 3300005615 Bacteria 2108
110 Ga0068859_100021694 3300005617 Bacteria 6445
111 Ga0068859_100071069 3300005617 Bacteria 3516
112 Ga0068859_100348761 3300005617 Bacteria 1575
113 Ga0068859_100383314 3300005617 Bacteria 1501
114 Ga0068864_100025873 3300005618 Bacteria 4945
115 Ga0068864_100025900 3300005618 Bacteria 4943
116 Ga0068866_10163645 3300005718 Bacteria 1300
117 Ga0068861_100032017 3300005719 Bacteria 3869
118 Ga0068860_100000083 3300005843 Bacteria 168189
119 Ga0068860_100087672 3300005843 Bacteria 2963
120 Ga0068860_100138148 3300005843 Bacteria 2341
121 Ga0068860_100461223 3300005843 Bacteria 1264
122 Ga0068860_100783811 3300005843 Bacteria 966
123 Ga0068862_100050812 3300005844 Bacteria 3544
124 Ga0068862_100070545 3300005844 Bacteria 3016
125 Ga0068862_100155563 3300005844 Bacteria 2038
126 Ga0068862_100204986 3300005844 Bacteria 1779
127 Ga0068862_100222386 3300005844 Bacteria 1710
128 Ga0068862_100307554 3300005844 Bacteria 1460
129 Ga0081455_10107875 3300005937 Bacteria 2219
130 Ga0081539_10000881 3300005985 Bacteria 57379
131 Ga0081539_10016778 3300005985 Bacteria 5198
132 Ga0070717_10173981 3300006028 Bacteria 1874
133 Ga0075365_10003968 3300006038 Bacteria 7748
134 Ga0075365_10015283 3300006038 Bacteria 4639
135 Ga0075365_10058029 3300006038 Bacteria 2576
136 Ga0075365_10138288 3300006038 Bacteria 1689
137 Ga0075365_10174103 3300006038 Bacteria 1503
138 Ga0075368_10000355 3300006042 Bacteria 13436
139 Ga0075368_10024940 3300006042 Bacteria 2292
140 Ga0075368_10074969 3300006042 Bacteria 1371
141 Ga0075363_100022130 3300006048 Bacteria 3211
142 Ga0075363_100112488 3300006048 Bacteria 1514
143 Ga0075364_10022542 3300006051 Bacteria 3978
144 Ga0075364_10152227 3300006051 Bacteria 1559
145 Ga0075364_10162493 3300006051 Bacteria 1508
146 Ga0075364_10273369 3300006051 Bacteria 1149
147 Ga0070716_100072389 3300006173 Bacteria 2029
148 Ga0075362_10049994 3300006177 Bacteria 1869
149 Ga0075362_10051585 3300006177 Bacteria 1842
150 Ga0075362_10090892 3300006177 Bacteria 1417
151 Ga0075362_10162958 3300006177 Bacteria 1074
152 Ga0075367_10000124 3300006178 Bacteria 22440
153 Ga0075367_10002714 3300006178 Bacteria 8171
154 Ga0075367_10010369 3300006178 Bacteria 4894
155 Ga0075367_10045731 3300006178 Bacteria 2569
156 Ga0075369_10001413 3300006186 Bacteria 8182
157 Ga0075369_10007695 3300006186 Bacteria 4117
158 Ga0075369_10025016 3300006186 Bacteria 2479
159 Ga0075369_10043510 3300006186 Bacteria 1927
160 Ga0075366_10021892 3300006195 Bacteria 3716
161 Ga0075366_10085442 3300006195 Bacteria 1887
162 Ga0075366_10115249 3300006195 Bacteria 1618
163 Ga0097621_100436463 3300006237 Bacteria 1178
164 Ga0075370_10025169 3300006353 Bacteria 3290
165 Ga0075370_10188242 3300006353 Bacteria 1216
166 Ga0097620_100021695 3300006931 Bacteria 6445
167 Ga0097620_100071067 3300006931 Bacteria 3516
168 Ga0097620_100348769 3300006931 Bacteria 1575
169 Ga0097620_100383329 3300006931 Bacteria 1501
170 Ga0099826_10000423 3300006948 Bacteria 20100
171 Ga0099826_10006813 3300006948 Bacteria 8363
172 Ga0099826_10101545 3300006948 Bacteria 1734
173 Ga0099795_10055087 3300007788 Bacteria 1460
174 Ga0105251_10010361 3300009011 Bacteria 5415
175 Ga0105240_10712829 3300009093 Bacteria 1094
176 Ga0111539_10309258 3300009094 Bacteria 1839
177 Ga0105245_10445948 3300009098 Bacteria 1302
178 Ga0105247_10056622 3300009101 Bacteria 2422
179 Ga0105247_10347259 3300009101 Bacteria 1042
180 Ga0114129_10675954 3300009147 Bacteria 1330
181 Ga0105243_10012317 3300009148 Bacteria 6468
182 Ga0105243_10067473 3300009148 Bacteria 2879
183 Ga0105241_10050610 3300009174 Bacteria 3167
184 Ga0105241_10088427 3300009174 Bacteria 2439
185 Ga0105241_10293398 3300009174 Bacteria 1393
186 Ga0105248_10014988 3300009177 Bacteria 8533
187 Ga0105248_10020676 3300009177 Bacteria 7294
188 Ga0105237_10034925 3300009545 Bacteria 5088
189 Ga0105237_10041352 3300009545 Bacteria 4649
190 Ga0105237_10563059 3300009545 Bacteria 1146
191 Ga0105237_10882249 3300009545 Bacteria 901
192 Ga0105249_10438761 3300009553 Bacteria 1343
193 Ga0123340_1051759 3300009763 Bacteria 1460
194 Ga0123342_1014771 3300009766 Bacteria 7342
195 Ga0123342_1029482 3300009766 Bacteria 2847
196 Ga0105239_10028240 3300010375 Bacteria 6172
197 Ga0105239_10073717 3300010375 Bacteria 3753
198 Ga0105239_10124983 3300010375 Bacteria 2858
199 Ga0105239_10143028 3300010375 Bacteria 2667
200 Ga0105246_10467859 3300011119 Bacteria 1063
201 Ga0157373_10001801 3300013100 Bacteria 16297
202 Ga0157371_10000058 3300013102 Bacteria 171756
203 Ga0157370_10000792 3300013104 Bacteria 39754
204 Ga0157369_10083884 3300013105 Bacteria 3407
205 Ga0171463_1001 3300013249 Bacteria 1406070
206 Ga0157374_10535891 3300013296 Bacteria 1178
207 Ga0157378_10071978 3300013297 Bacteria 3105
208 Ga0163162_10254260 3300013306 Bacteria 1889
209 Ga0163162_10964457 3300013306 Bacteria 963
210 Ga0157372_10451691 3300013307 Bacteria 1498
211 Ga0157375_10195734 3300013308 Bacteria 2176
212 Ga0163163_10009574 3300014325 Bacteria 8659
213 Ga0163163_10128427 3300014325 Bacteria 2574
214 Ga0157376_10177241 3300014969 Bacteria 1945
215 Ga0157376_10679045 3300014969 Bacteria 1033
216 Ga0182006_1022618 3300015261 Bacteria 2612
217 Ga0182007_10016195 3300015262 Bacteria 2757
218 Ga0183363_1012 3300015690 Bacteria 90054
219 Ga0163161_10388757 3300017792 Bacteria 1116
220 Ga0214544_1000012 3300021320 Bacteria 229808
221 Ga0214542_1000011 3300021321 Bacteria 238260
222 Ga0214542_1017282 3300021321 Bacteria 6588
223 Ga0214543_1000004 3300021327 Bacteria 527190
224 Ga0214543_1000256 3300021327 Bacteria 82084
225 Ga0213875_10000030 3300021388 Bacteria 178500
226 Ga0228711_1000019 3300022739 Bacteria 111795
227 Ga0228710_1000022 3300022740 Bacteria 111795
228 Ga0209436_100429 3300025208 Bacteria 18855
229 Ga0209436_100737 3300025208 Bacteria 13643
230 Ga0207425_1000012 3300025245 Bacteria 528324
231 Ga0207425_1001525 3300025245 Bacteria 9512
232 Ga0207425_1003710 3300025245 Bacteria 4794
233 Ga0207425_1006553 3300025245 Bacteria 3171
234 Ga0209646_1009151 3300025246 Bacteria 1576
235 Ga0209026_1000116 3300025250 Bacteria 133228
236 Ga0209148_1000256 3300025254 Bacteria 83479
237 Ga0209759_1000153 3300025256 Bacteria 119494
238 Ga0209129_1000081 3300025258 Bacteria 183694
239 Ga0209129_1000123 3300025258 Bacteria 133661
240 Ga0209129_1000726 3300025258 Bacteria 21238
241 Ga0209129_1001366 3300025258 Bacteria 13698
242 Ga0209129_1002322 3300025258 Bacteria 9429
243 Ga0209129_1010413 3300025258 Bacteria 2321
244 Ga0209129_1019425 3300025258 Bacteria 1284
245 Ga0209233_1000047 3300025261 Bacteria 459614
246 Ga0209233_1006535 3300025261 Bacteria 3749
247 Ga0209455_1000409 3300025272 Bacteria 34679
248 Ga0209673_1000015 3300025273 Bacteria 530618
249 Ga0209673_1000967 3300025273 Bacteria 35634
250 Ga0209673_1001074 3300025273 Bacteria 30901
251 Ga0209673_1001964 3300025273 Bacteria 16078
252 Ga0209673_1003197 3300025273 Bacteria 9937
253 Ga0209673_1005594 3300025273 Bacteria 6279
254 Ga0209130_1000002 3300025284 Bacteria 722648
255 Ga0209130_1000008 3300025284 Bacteria 581232
256 Ga0209130_1011836 3300025284 Bacteria 2314
257 Ga0209676_1012908 3300025292 Bacteria 3246
258 Ga0209025_1000024 3300025294 Bacteria 528324
259 Ga0209025_1000441 3300025294 Bacteria 81951
260 Ga0209025_1000528 3300025294 Bacteria 72802
261 Ga0209025_1000631 3300025294 Bacteria 62429
262 Ga0209025_1000970 3300025294 Bacteria 43006
263 Ga0209025_1003049 3300025294 Bacteria 16508
264 Ga0209025_1003063 3300025294 Bacteria 16420
265 Ga0209025_1003580 3300025294 Bacteria 14522
266 Ga0209025_1007670 3300025294 Bacteria 7971
267 Ga0209025_1014304 3300025294 Bacteria 4894
268 Ga0209025_1022843 3300025294 Bacteria 3298
269 Ga0209025_1052054 3300025294 Bacteria 1620
270 Ga0209564_1000091 3300025295 Bacteria 249103
271 Ga0209564_1000382 3300025295 Bacteria 81070
272 Ga0209564_1000830 3300025295 Bacteria 41868
273 Ga0209564_1001931 3300025295 Bacteria 18509
274 Ga0209564_1005067 3300025295 Bacteria 7691
275 Ga0209564_1016131 3300025295 Bacteria 2994
276 Ga0209564_1025178 3300025295 Bacteria 2011
277 Ga0209564_1051984 3300025295 Bacteria 989
278 Ga0209758_1000046 3300025297 Bacteria 364931
279 Ga0209758_1001048 3300025297 Bacteria 36241
280 Ga0209758_1001507 3300025297 Bacteria 27061
281 Ga0209758_1001962 3300025297 Bacteria 22243
282 Ga0209758_1002450 3300025297 Bacteria 18942
283 Ga0209758_1002458 3300025297 Bacteria 18888
284 Ga0209758_1002490 3300025297 Bacteria 18719
285 Ga0209758_1033320 3300025297 Bacteria 2072
286 Ga0209256_1000180 3300025299 Bacteria 123687
287 Ga0209256_1000541 3300025299 Bacteria 54431
288 Ga0209256_1000874 3300025299 Bacteria 37312
289 Ga0209256_1001340 3300025299 Bacteria 26171
290 Ga0209256_1005494 3300025299 Bacteria 7255
291 Ga0209256_1005579 3300025299 Bacteria 7162
292 Ga0209256_1014814 3300025299 Bacteria 2772
293 Ga0209256_1018807 3300025299 Bacteria 2226
294 Ga0209256_1018895 3300025299 Bacteria 2218
295 Ga0207426_1000013 3300025302 Bacteria 721897
296 Ga0207426_1000016 3300025302 Bacteria 581232
297 Ga0207426_1000063 3300025302 Bacteria 358920
298 Ga0207426_1000172 3300025302 Bacteria 163690
299 Ga0207426_1001124 3300025302 Bacteria 24372
300 Ga0209051_1000084 3300025303 Bacteria 190324
301 Ga0209051_1002801 3300025303 Bacteria 12034
302 Ga0209051_1023790 3300025303 Bacteria 2538
303 Ga0209051_1028922 3300025303 Bacteria 2179
304 Ga0209257_1002194 3300025304 Bacteria 20197
305 Ga0209257_1007835 3300025304 Bacteria 6315
306 Ga0209257_1021726 3300025304 Bacteria 2319
307 Ga0207710_10119331 3300025900 Bacteria 1258
308 Ga0207647_10009890 3300025904 Bacteria 6755
309 Ga0207647_10015550 3300025904 Bacteria 5214
310 Ga0207647_10149812 3300025904 Bacteria 1364
311 Ga0207699_10007510 3300025906 Bacteria 5333
312 Ga0207645_10019613 3300025907 Bacteria 4432
313 Ga0207705_10138964 3300025909 Bacteria 1813
314 Ga0207654_10075474 3300025911 Bacteria 2015
315 Ga0207695_10147766 3300025913 Bacteria 2292
316 Ga0207671_10032373 3300025914 Bacteria 3893
317 Ga0207671_10118463 3300025914 Bacteria 2022
318 Ga0207671_10187119 3300025914 Bacteria 1613
319 Ga0207671_10334587 3300025914 Bacteria 1199
320 Ga0207693_10162802 3300025915 Bacteria 1756
321 Ga0207660_10118213 3300025917 Bacteria 2005
322 Ga0207657_10105467 3300025919 Bacteria 2333
323 Ga0207657_10135462 3300025919 Bacteria 2016
324 Ga0207652_10515267 3300025921 Bacteria 1076
325 Ga0207650_10255069 3300025925 Bacteria 1421
326 Ga0207690_10259193 3300025932 Bacteria 1346
327 Ga0207670_10001231 3300025936 Bacteria 13520
328 Ga0207670_10460986 3300025936 Bacteria 1026
329 Ga0207669_10141686 3300025937 Bacteria 1670
330 Ga0207704_10086021 3300025938 Bacteria 2049
331 Ga0207711_10116001 3300025941 Bacteria 2387
332 Ga0207711_10153095 3300025941 Bacteria 2082
333 Ga0207679_10109678 3300025945 Bacteria 2175
334 Ga0207668_10004893 3300025972 Bacteria 7880
335 Ga0207668_10023824 3300025972 Bacteria 3941
336 Ga0207668_10096720 3300025972 Bacteria 2183
337 Ga0207668_10146336 3300025972 Bacteria 1823
338 Ga0207658_10208395 3300025986 Bacteria 1637
339 Ga0207658_10329177 3300025986 Bacteria 1324
340 Ga0207678_10000100 3300026067 Bacteria 70537
341 Ga0207702_10446584 3300026078 Bacteria 1254
342 Ga0207702_10863996 3300026078 Bacteria 896
343 Ga0207648_10216168 3300026089 Bacteria 1702
344 Ga0207676_10007593 3300026095 Bacteria 7698
345 Ga0207674_10106290 3300026116 Bacteria 2784
346 Ga0207675_100031839 3300026118 Bacteria 4913
347 Ga0207675_100305961 3300026118 Bacteria 1549
348 Ga0207683_10025771 3300026121 Bacteria 5072
349 Ga0207683_10111605 3300026121 Bacteria 2448
350 Ga0207698_10630914 3300026142 Bacteria 1059
351 Ga0207698_10678705 3300026142 Bacteria 1023
352 Ga0209281_1000227 3300027111 Bacteria 119329
353 Ga0209281_1000519 3300027111 Bacteria 50062
354 Ga0209371_1000009 3300027312 Bacteria 963030
355 Ga0209371_1000547 3300027312 Bacteria 35249
356 Ga0209282_1000042 3300027666 Bacteria 119329
357 Ga0209282_1000224 3300027666 Bacteria 29523
358 Ga0209282_1003866 3300027666 Bacteria 8997
359 Ga0209813_10000358 3300027866 Bacteria 11644
360 Ga0209813_10012420 3300027866 Bacteria 2251
361 Ga0209813_10021450 3300027866 Bacteria 1816
362 Ga0268266_10003101 3300028379 Bacteria 16931
363 Ga0268266_10006291 3300028379 Bacteria 10886
364 Ga0268266_10015355 3300028379 Bacteria 6572
365 Ga0268266_10515040 3300028379 Bacteria 1143
366 Ga0268266_10801064 3300028379 Bacteria 910
367 Ga0268265_10002598 3300028380 Bacteria 13459
368 Ga0268265_10039627 3300028380 Bacteria 3474
369 Ga0268265_10272616 3300028380 Bacteria 1510
370 Ga0268264_10000055 3300028381 Bacteria 314947
371 Ga0268264_10033405 3300028381 Bacteria 4226
372 Ga0268264_10051148 3300028381 Bacteria 3442
373 Ga0268264_10462787 3300028381 Bacteria 1231
374 Ga0265318_10143745 3300028577 Bacteria 875
375 Ga0307515_10000023 3300028794 Bacteria 400846
376 Ga0307515_10004227 3300028794 Bacteria 29832
377 Ga0268256_1000010 3300030500 Bacteria 963034
378 Ga0268256_1016656 3300030500 Bacteria 2096
379 Ga0265770_1017861 3300030878 Bacteria 1100
380 Ga0265330_10083083 3300031235 Bacteria 1379
381 Ga0265328_10010982 3300031239 Bacteria 3630
382 Ga0265328_10016074 3300031239 Bacteria 2918
383 Ga0265325_10002414 3300031241 Bacteria 12620
384 Ga0265325_10003327 3300031241 Bacteria 10569
385 Ga0265329_10062820 3300031242 Bacteria 1175
386 Ga0265340_10012328 3300031247 Bacteria 4516
387 Ga0265340_10044194 3300031247 Bacteria 2180
388 Ga0265340_10045406 3300031247 Bacteria 2146
389 Ga0265340_10064914 3300031247 Bacteria 1739
390 Ga0265339_10040311 3300031249 Bacteria 2596
391 Ga0265331_10003656 3300031250 Bacteria 9815
392 Ga0265327_10001660 3300031251 Bacteria 26802
393 Ga0265327_10015085 3300031251 Bacteria 5012
394 Ga0265316_10031264 3300031344 Bacteria 4355
395 Ga0265316_10040084 3300031344 Bacteria 3757
396 Ga0265316_10057891 3300031344 Bacteria 3020
397 Ga0265316_10059448 3300031344 Bacteria 2972
398 Ga0307513_10006014 3300031456 Bacteria 15931
399 Ga0307513_10016341 3300031456 Bacteria 8958
400 Ga0307513_10192335 3300031456 Bacteria 1890
401 Ga0265313_10003820 3300031595 Bacteria 11894
402 Ga0265313_10029972 3300031595 Bacteria 2807
403 Ga0265314_10010850 3300031711 Bacteria 7572
404 Ga0265314_10036703 3300031711 Bacteria 3558
405 Ga0265342_10018121 3300031712 Bacteria 4568
406 Ga0265342_10084702 3300031712 Bacteria 1825
407 Ga0265342_10207728 3300031712 Bacteria 1060
408 Ga0307405_10015383 3300031731 Bacteria 4144
409 Ga0307413_10183526 3300031824 Bacteria 1494
410 Ga0307406_10046275 3300031901 Bacteria 2737
411 Ga0307412_10027331 3300031911 Bacteria 3556
412 Ga0307412_10078925 3300031911 Bacteria 2269
413 Ga0307412_10150819 3300031911 Bacteria 1715
414 Ga0315914_1000009 3300031967 Bacteria 182444
415 Ga0307409_100529568 3300031995 Bacteria 1153
416 Ga0307416_100603293 3300032002 Bacteria 1178
417 Ga0307414_10287044 3300032004 Bacteria 1385
418 Ga0307415_100510670 3300032126 Bacteria 1053
419 Ga0315913_1000015 3300033430 Bacteria 119325
420 Ga0315915_1000013 3300033464 Bacteria 182438
421 Ga0373930_0011195 3300034816 Bacteria 1617
422 Ga0373928_0032115 3300035084 Bacteria 1169
423 Ga0373951_0007101 3300035091 Bacteria 2548
424 Ga0373941_0147295 3300035115 Bacteria 861
425 Ga0373943_0000613 3300035170 Bacteria 15479
426 Ga0373931_0070810 3300035691 Bacteria 1903
427 Ga0373935_0005946 3300035692 Bacteria 7237
428 Ga0373927_0000806 3300035695 Bacteria 23954
429 Ga0373947_0000256 3300035725 Bacteria 29989
430 Ga0373947_0346379 3300035725 Bacteria 996
431 Ga0373925_0013258 3300037068 Bacteria 5965
432 Ga0395899_0000014 3300037312 Bacteria 488813
433 Ga0395900_0000007 3300037418 Bacteria 488860
434 Ga0395898_0000011 3300037466 Bacteria 488860
435 Ga0395905_0000008 3300037471 Bacteria 488860
436 Ga0395905_0011842 3300037471 Bacteria 8419
437 Ga0395905_0464233 3300037471 Bacteria 1165
438 Ga0436364_0053004 3300037853 Bacteria 3170
439 Ga0436364_0207431 3300037853 Bacteria 52858
440 Ga0436364_0563011 3300037853 Bacteria 1123
441 Ga0436364_0628381 3300037853 Bacteria 2046
442 Ga0395901_0000020 3300038443 Bacteria 314918
443 Ga0395901_0027330 3300038443 Bacteria 5861
444 Ga0395901_0027701 3300038443 Bacteria 5826
445 Ga0436365_0289217 3300039437 Bacteria 4910
446 Ga0439438_036258 3300041405 Bacteria 1294
447 Ga0439465_0001471 3300041413 Bacteria 7635
448 Ga0439465_0004192 3300041413 Bacteria 4690
449 Ga0439465_0031347 3300041413 Bacteria 1693
450 Ga0439465_0053697 3300041413 Bacteria 1324
451 Ga0451787_397122 3300041441 Bacteria 1529
452 Ga0451807_0622738 3300041486 Bacteria 1282
453 Ga0451837_1340741 3300041494 Bacteria 1512
454 Ga0451839_1498607 3300041496 Bacteria 1125
455 Ga0451841_1101904 3300041498 Bacteria 886
456 Ga0451845_0022414 3300041501 Bacteria 2111
457 Ga0451851_0106610 3300041507 Bacteria 1084
458 Ga0451843_0615050 3300041509 Bacteria 1756
459 Ga0451843_1153044 3300041509 Bacteria 889
460 Ga0451853_4116506 3300041512 Bacteria 1047
461 Ga0439432_022899 3300042006 Bacteria 2062
462 Ga0439432_034204 3300042006 Bacteria 1633
463 Ga0439449_0100599 3300042007 Bacteria 1069
464 Ga0439457_020608 3300042014 Bacteria 1463
465 Ga0450920_028507 3300042122 Bacteria 1094
466 Ga0450906_029462 3300042145 Bacteria 970
467 Ga0439434_0073404 3300042435 Bacteria 1079
468 Ga0450918_001536 3300042531 Bacteria 4555
469 Ga0451577_0048226 3300042876 Bacteria 3806
470 Ga0466965_0240164 3300044683 Bacteria 970
471 Ga0466960_0003639 3300044901 Bacteria 5950
472 Ga0451576_0000457 3300045051 Bacteria 92619
473 Ga0451576_0639612 3300045051 Bacteria 1118
474 Ga0495627_083255 3300046453 Bacteria 925
475 Ga0495638_0022249 3300046460 Bacteria 4163
476 Ga0495638_0023748 3300046460 Bacteria 4005
477 Ga0495638_0099707 3300046460 Bacteria 1738
478 Ga0495638_0131159 3300046460 Bacteria 1472
479 Ga0495650_0034324 3300046471 Bacteria 2247
480 Ga0495580_0044198 3300046472 Bacteria 3170
481 Ga0495605_0128815 3300046474 Bacteria 1142
482 Ga0495585_0004077 3300046492 Bacteria 9595
483 Ga0495585_0025667 3300046492 Bacteria 3372
484 Ga0495585_0151849 3300046492 Bacteria 1207
485 Ga0495596_0059795 3300046500 Bacteria 1485
486 Ga0495607_0033186 3300046501 Bacteria 3142
487 Ga0495583_0001709 3300046506 Bacteria 21089
488 Ga0495583_0015869 3300046506 Bacteria 4076
489 Ga0495583_0039945 3300046506 Bacteria 2207
490 Ga0495610_0001297 3300046512 Bacteria 22270
491 Ga0495610_0013489 3300046512 Bacteria 4854
492 Ga0495616_0016614 3300046513 Bacteria 4070
493 Ga0495616_0046111 3300046513 Bacteria 2202
494 Ga0495616_0123801 3300046513 Bacteria 1191
495 Ga0495618_0181186 3300046514 Bacteria 1338
496 Ga0495620_0016232 3300046515 Bacteria 3743
497 Ga0495620_0019139 3300046515 Bacteria 3375
498 Ga0495630_0004618 3300046517 Bacteria 9656
499 Ga0495631_0000651 3300046518 Bacteria 22509
500 Ga0495631_0103618 3300046518 Bacteria 1224
501 Ga0495632_0015871 3300046519 Bacteria 4206
502 Ga0495632_0028828 3300046519 Bacteria 2896
503 Ga0495643_0053111 3300046522 Bacteria 2173
504 Ga0495648_0027504 3300046524 Bacteria 3805
505 Ga0495648_0047779 3300046524 Bacteria 2642
506 Ga0495666_0012120 3300046526 Bacteria 4304
507 Ga0495654_0001032 3300046530 Bacteria 20404
508 Ga0495654_0079010 3300046530 Bacteria 1546
509 Ga0495654_0113723 3300046530 Bacteria 1232
510 Ga0495665_0042485 3300046531 Bacteria 2419
511 Ga0495640_0123195 3300046533 Bacteria 1683
512 Ga0495609_0058088 3300046538 Bacteria 1711
513 Ga0495597_0031888 3300046542 Bacteria 2394
514 Ga0495633_0060660 3300046558 Bacteria 1772
515 Ga0495668_0003018 3300046616 Bacteria 13127
516 Ga0495668_0017367 3300046616 Bacteria 4174
517 Ga0495668_0031652 3300046616 Bacteria 2981
518 Ga0495611_0095065 3300046648 Bacteria 1379
519 Ga0495625_0001384 3300046660 Bacteria 29779
520 Ga0495625_0017986 3300046660 Bacteria 5524
521 Ga0495625_0064023 3300046660 Bacteria 2595
522 Ga0495625_0113690 3300046660 Bacteria 1848
523 Ga0495625_0243837 3300046660 Bacteria 1169
524 Ga0495661_0216745 3300046665 Bacteria 994
525 Ga0495588_0002043 3300046674 Bacteria 8626
526 Ga0495588_0137928 3300046674 Bacteria 1288
527 Ga0495658_0047318 3300046683 Bacteria 2422
528 Ga0495624_0007453 3300046690 Bacteria 7678
529 Ga0495671_0041827 3300046692 Bacteria 2306
530 Ga0495660_0023466 3300046810 Bacteria 3517
531 Ga0495660_0029351 3300046810 Bacteria 3104
532 Ga0495672_0024115 3300047320 Bacteria 3926
533 Ga0495687_019134 3300047443 Bacteria 3367
534 Ga0495673_0033885 3300047469 Bacteria 2365
535 Ga0495681_0017611 3300047470 Bacteria 3959
536 Ga0495684_0005376 3300047471 Bacteria 9971
537 Ga0495684_0007110 3300047471 Bacteria 8688
538 Ga0495686_0005372 3300047472 Bacteria 10128
539 Ga0495686_0031564 3300047472 Bacteria 3435
540 Ga0495686_0035111 3300047472 Bacteria 3225
541 Ga0495686_0213673 3300047472 Bacteria 1101
542 Ga0495593_0031816 3300047673 Bacteria 2879
543 Ga0495615_0042369 3300048090 Bacteria 1142
544 Ga0496100_0011359 3300048903 Bacteria 5067
545 Ga0496101_0013345 3300048904 Bacteria 5500
546 Ga0496101_0036946 3300048904 Bacteria 3462
547 Ga0496101_0051851 3300048904 Bacteria 2957
548 Ga0496101_0215314 3300048904 Bacteria 1489
549 Ga0496102_0007685 3300048905 Bacteria 9209
550 Ga0496102_0152186 3300048905 Bacteria 2174
551 Ga0496102_0191113 3300048905 Bacteria 1929
552 Ga0496103_0025599 3300048906 Bacteria 3567
553 Ga0496103_0209709 3300048906 Bacteria 1253
554 Ga0496104_0445266 3300048907 Bacteria 1207
555 Ga0496105_0000392 3300048908 Bacteria 28815
556 Ga0496106_0021532 3300048909 Bacteria 4787
557 Ga0496106_0070794 3300048909 Bacteria 2664
558 Ga0496106_0214127 3300048909 Bacteria 1535
559 Ga0496106_0409951 3300048909 Bacteria 1089
560 Ga0496107_0032993 3300048910 Bacteria 3703
561 Ga0496108_0001992 3300048911 Bacteria 16351
562 Ga0496109_0012017 3300048912 Bacteria 7456
563 Ga0496110_0122735 3300048913 Bacteria 2342
564 Ga0496111_0001116 3300048914 Bacteria 14864
565 Ga0496111_0022364 3300048914 Bacteria 4426
566 Ga0496112_0002870 3300048915 Bacteria 14007
567 Ga0496112_0025119 3300048915 Bacteria 5717
568 Ga0496112_0042420 3300048915 Bacteria 4451
569 Ga0496113_0004045 3300048916 Bacteria 8930
570 Ga0496113_0080376 3300048916 Bacteria 2497
571 Ga0496113_0149293 3300048916 Bacteria 1843
572 Ga0496113_0280657 3300048916 Bacteria 1332
573 Ga0496114_0084239 3300048917 Bacteria 2691
574 Ga0496114_0152441 3300048917 Bacteria 2006
575 Ga0496115_0006960 3300048918 Bacteria 8305
576 Ga0496115_0050412 3300048918 Bacteria 3335
577 Ga0496115_0120401 3300048918 Bacteria 2160
578 Ga0496116_0001443 3300048919 Bacteria 26678
579 Ga0496116_0002283 3300048919 Bacteria 20327
580 Ga0496116_0018419 3300048919 Bacteria 5385
581 Ga0496116_0050161 3300048919 Bacteria 2783
582 Ga0496116_0055920 3300048919 Bacteria 2589
583 Ga0496116_0188455 3300048919 Bacteria 1095
584 Ga0496117_0000002 3300048920 Bacteria 2483758
585 Ga0496117_0004761 3300048920 Bacteria 14728
586 Ga0496117_0005892 3300048920 Bacteria 12664
587 Ga0496117_0047517 3300048920 Bacteria 3076
588 Ga0496117_0052840 3300048920 Bacteria 2859
589 Ga0496117_0104866 3300048920 Bacteria 1778
590 Ga0496118_0000233 3300048921 Bacteria 97731
591 Ga0496118_0007687 3300048921 Bacteria 11337
592 Ga0496118_0029929 3300048921 Bacteria 4556
593 Ga0496118_0038968 3300048921 Bacteria 3800
594 Ga0496119_0001089 3300048922 Bacteria 34251
595 Ga0496119_0018827 3300048922 Bacteria 5116
596 Ga0496119_0020869 3300048922 Bacteria 4755
597 Ga0496119_0061517 3300048922 Bacteria 2241
598 Ga0496119_0062517 3300048922 Bacteria 2218
599 Ga0496119_0204399 3300048922 Bacteria 1020
600 Ga0496120_0000021 3300048923 Bacteria 250966
601 Ga0496120_0009069 3300048923 Bacteria 7105
602 Ga0496120_0184618 3300048923 Bacteria 1021
603 Ga0496121_0004125 3300048924 Bacteria 19907
604 Ga0496121_0021858 3300048924 Bacteria 6246
605 Ga0496121_0063365 3300048924 Bacteria 3021
606 Ga0496121_0143804 3300048924 Bacteria 1765
607 Ga0496121_0194844 3300048924 Bacteria 1449
608 Ga0496121_0215073 3300048924 Bacteria 1358
609 Ga0496121_0281058 3300048924 Bacteria 1138
610 Ga0496121_0285018 3300048924 Bacteria 1128
611 Ga0496122_0000001 3300048925 Bacteria 1827766
612 Ga0496122_0001050 3300048925 Bacteria 48341
613 Ga0496122_0002105 3300048925 Bacteria 29496
614 Ga0496122_0002628 3300048925 Bacteria 25114
615 Ga0496122_0013396 3300048925 Bacteria 8030
616 Ga0496122_0031795 3300048925 Bacteria 4381
617 Ga0496122_0032728 3300048925 Bacteria 4293
618 Ga0496122_0046656 3300048925 Bacteria 3352
619 Ga0496122_0047999 3300048925 Bacteria 3289
620 Ga0496122_0219559 3300048925 Bacteria 1092
621 Ga0496123_0000001 3300048926 Bacteria 1831497
622 Ga0496123_0000158 3300048926 Bacteria 136078
623 Ga0496123_0002010 3300048926 Bacteria 26259
624 Ga0496123_0005487 3300048926 Bacteria 12754
625 Ga0496123_0016492 3300048926 Bacteria 5996
626 Ga0496123_0017583 3300048926 Bacteria 5741
627 Ga0496123_0053756 3300048926 Bacteria 2658
628 Ga0496124_0000743 3300048927 Bacteria 53428
629 Ga0496124_0003963 3300048927 Bacteria 17651
630 Ga0496124_0011436 3300048927 Bacteria 8874
631 Ga0496124_0015389 3300048927 Bacteria 7332
632 Ga0496124_0034825 3300048927 Bacteria 4412
633 Ga0496124_0041399 3300048927 Bacteria 3975
634 Ga0496124_0049494 3300048927 Bacteria 3585
635 Ga0496124_0069924 3300048927 Bacteria 2913
636 Ga0496124_0261566 3300048927 Bacteria 1273
637 Ga0496125_0000695 3300048928 Bacteria 55563
638 Ga0496125_0013510 3300048928 Bacteria 8022
639 Ga0496125_0016113 3300048928 Bacteria 7192
640 Ga0496125_0021027 3300048928 Bacteria 6100
641 Ga0496125_0041633 3300048928 Bacteria 3924
642 Ga0496125_0074229 3300048928 Bacteria 2638
643 Ga0496125_0282926 3300048928 Bacteria 1026
644 Ga0496126_0000195 3300048929 Bacteria 135582
645 Ga0496126_0086852 3300048929 Bacteria 2757
646 Ga0496126_0455450 3300048929 Bacteria 1029
647 Ga0495678_011095 3300049459 Bacteria 4330
648 Ga0495678_027883 3300049459 Bacteria 2390
649 Ga0495678_077409 3300049459 Bacteria 1203
650 Ga0501031_0000003 3300049568 Bacteria 206821
651 Ga0501031_0123922 3300049568 Bacteria 1688
652 Ga0501031_0169540 3300049568 Bacteria 1426
653 Ga0501031_0217196 3300049568 Bacteria 1245
654 Ga0501032_0000010 3300049569 Bacteria 206795
655 Ga0501032_0000587 3300049569 Bacteria 29296
656 Ga0501032_0012946 3300049569 Bacteria 5944
657 Ga0501032_0028404 3300049569 Bacteria 3844
658 Ga0501032_0049889 3300049569 Bacteria 2823
659 Ga0501032_0068127 3300049569 Bacteria 2376
660 Ga0501032_0081072 3300049569 Bacteria 2159
661 Ga0501032_0097643 3300049569 Bacteria 1947
662 Ga0501033_0000017 3300049570 Bacteria 206819
663 Ga0501033_0000076 3300049570 Bacteria 93921
664 Ga0501033_0000521 3300049570 Bacteria 36032
665 Ga0501033_0003783 3300049570 Bacteria 12302
666 Ga0501033_0005881 3300049570 Bacteria 9639
667 Ga0501033_0011725 3300049570 Bacteria 6703
668 Ga0501033_0016419 3300049570 Bacteria 5608
669 Ga0501033_0141001 3300049570 Bacteria 1742
670 Ga0501033_0223152 3300049570 Bacteria 1341
671 Ga0501033_0236443 3300049570 Bacteria 1297
672 Ga0501033_0244080 3300049570 Bacteria 1274
673 Ga0501033_0396228 3300049570 Bacteria 963
674 Ga0501034_0000053 3300049571 Bacteria 206821
675 Ga0501034_0000077 3300049571 Bacteria 173873
676 Ga0501034_0001873 3300049571 Bacteria 26689
677 Ga0501034_0008667 3300049571 Bacteria 10724
678 Ga0501034_0009703 3300049571 Bacteria 10066
679 Ga0501034_0050206 3300049571 Bacteria 4207
680 Ga0501034_0058149 3300049571 Bacteria 3886
681 Ga0501034_0087591 3300049571 Bacteria 3113
682 Ga0501034_0136949 3300049571 Bacteria 2429
683 Ga0501034_0148265 3300049571 Bacteria 2322
684 Ga0501034_0166741 3300049571 Bacteria 2171
685 Ga0501034_0224552 3300049571 Bacteria 1829
686 Ga0501034_0353748 3300049571 Bacteria 1397
687 Ga0501034_0386069 3300049571 Bacteria 1325
688 Ga0501034_0423857 3300049571 Bacteria 1251
689 Ga0501034_0479686 3300049571 Bacteria 1159
690 Ga0501034_0562339 3300049571 Bacteria 1049
691 Ga0501036_0000009 3300049572 Bacteria 206821
692 Ga0501036_0002844 3300049572 Bacteria 13723
693 Ga0501036_0028303 3300049572 Bacteria 4736
694 Ga0501036_0030433 3300049572 Bacteria 4559
695 Ga0501036_0036991 3300049572 Bacteria 4129
696 Ga0501036_0084228 3300049572 Bacteria 2688
697 Ga0501036_0109061 3300049572 Bacteria 2339
698 Ga0501036_0146725 3300049572 Bacteria 1990
699 Ga0501036_0164430 3300049572 Bacteria 1871
700 Ga0501036_0165501 3300049572 Bacteria 1864
701 Ga0501037_0000008 3300049573 Bacteria 206812
702 Ga0501037_0000224 3300049573 Bacteria 49243
703 Ga0501037_0000812 3300049573 Bacteria 23359
704 Ga0501037_0002684 3300049573 Bacteria 12837
705 Ga0501037_0019672 3300049573 Bacteria 4981
706 Ga0501037_0062874 3300049573 Bacteria 2706
707 Ga0501037_0129370 3300049573 Bacteria 1811
708 Ga0501037_0189083 3300049573 Bacteria 1458
709 Ga0501038_0000008 3300049574 Bacteria 206821
710 Ga0501038_0000241 3300049574 Bacteria 46177
711 Ga0501038_0109237 3300049574 Bacteria 2292
712 Ga0501038_0131033 3300049574 Bacteria 2059
713 Ga0501038_0154162 3300049574 Bacteria 1871
714 Ga0501038_0277545 3300049574 Bacteria 1320
715 Ga0501038_0442920 3300049574 Bacteria 1000
716 Ga0501039_0000021 3300049575 Bacteria 162552
717 Ga0501039_0000131 3300049575 Bacteria 52205
718 Ga0501039_0000196 3300049575 Bacteria 43498
719 Ga0501039_0319359 3300049575 Bacteria 1221
720 Ga0501039_0342868 3300049575 Bacteria 1174
721 Ga0501040_0003914 3300049576 Bacteria 9662
722 Ga0501040_0074137 3300049576 Bacteria 2352
723 Ga0501040_0271701 3300049576 Bacteria 1210
724 Ga0501041_0087680 3300049577 Bacteria 1921
725 Ga0501042_0011075 3300049578 Bacteria 6074
726 Ga0501042_0304709 3300049578 Bacteria 1151
727 Ga0501043_0000005 3300049579 Bacteria 254466
728 Ga0501043_0000043 3300049579 Bacteria 115410
729 Ga0501043_0000405 3300049579 Bacteria 38778
730 Ga0501043_0010702 3300049579 Bacteria 7186
731 Ga0501043_0210303 3300049579 Bacteria 1508
732 Ga0501043_0372383 3300049579 Bacteria 1082
733 Ga0501043_0379472 3300049579 Bacteria 1070
734 Ga0501046_0001156 3300049580 Bacteria 25669
735 Ga0501046_0026209 3300049580 Bacteria 4762
736 Ga0501046_0038328 3300049580 Bacteria 3848
737 Ga0501047_0000129 3300049581 Bacteria 91572
738 Ga0501047_0000894 3300049581 Bacteria 30442
739 Ga0501047_0005104 3300049581 Bacteria 12319
740 Ga0501047_0020856 3300049581 Bacteria 6294
741 Ga0501047_0030968 3300049581 Bacteria 5158
742 Ga0501047_0046886 3300049581 Bacteria 4175
743 Ga0501047_0049610 3300049581 Bacteria 4053
744 Ga0501047_0052545 3300049581 Bacteria 3939
745 Ga0501047_0056209 3300049581 Bacteria 3805
746 Ga0501047_0087523 3300049581 Bacteria 2992
747 Ga0501047_0212705 3300049581 Bacteria 1791
748 Ga0501047_0481443 3300049581 Bacteria 1069
749 Ga0501047_0686654 3300049581 Bacteria 842
750 Ga0501048_0000282 3300049582 Bacteria 34461
751 Ga0501048_0004455 3300049582 Bacteria 10658
752 Ga0501048_0020443 3300049582 Bacteria 4852
753 Ga0501067_0000213 3300049583 Bacteria 32191
754 Ga0501067_0001197 3300049583 Bacteria 14101
755 Ga0501067_0028159 3300049583 Bacteria 3112
756 Ga0501067_0036197 3300049583 Bacteria 2741
757 Ga0501067_0042891 3300049583 Bacteria 2512
758 Ga0501067_0045622 3300049583 Bacteria 2433
759 Ga0501068_0005249 3300049584 Bacteria 7072
760 Ga0501068_0027596 3300049584 Bacteria 3353
761 Ga0501069_0000011 3300049585 Bacteria 153214
762 Ga0501069_0025402 3300049585 Bacteria 3238
763 Ga0501069_0055908 3300049585 Bacteria 2198
764 Ga0501069_0076670 3300049585 Bacteria 1880
765 Ga0501069_0159404 3300049585 Bacteria 1299
766 Ga0501069_0196147 3300049585 Bacteria 1169
767 Ga0501069_0367186 3300049585 Bacteria 849
768 Ga0501070_0000117 3300049586 Bacteria 70793
769 Ga0501070_0001936 3300049586 Bacteria 18277
770 Ga0501070_0004936 3300049586 Bacteria 11386
771 Ga0501070_0005238 3300049586 Bacteria 11055
772 Ga0501070_0006463 3300049586 Bacteria 9977
773 Ga0501070_0107545 3300049586 Bacteria 2305
774 Ga0501070_0120810 3300049586 Bacteria 2165
775 Ga0501070_0136845 3300049586 Bacteria 2022
776 Ga0501071_0005058 3300049587 Bacteria 8437
777 Ga0501071_0238175 3300049587 Bacteria 1372
778 Ga0501072_0386210 3300049588 Bacteria 1111
779 Ga0501072_0503666 3300049588 Bacteria 958
780 Ga0501073_0011311 3300049589 Bacteria 6530
781 Ga0501073_0015653 3300049589 Bacteria 5500
782 Ga0501073_0027903 3300049589 Bacteria 4034
783 Ga0501073_0067096 3300049589 Bacteria 2501
784 Ga0501073_0073448 3300049589 Bacteria 2381
785 Ga0501073_0096224 3300049589 Bacteria 2056
786 Ga0501073_0100118 3300049589 Bacteria 2012
787 Ga0501073_0146464 3300049589 Bacteria 1636
788 Ga0501073_0176648 3300049589 Bacteria 1478
789 Ga0501073_0197845 3300049589 Bacteria 1390
790 Ga0501073_0256299 3300049589 Bacteria 1208
791 Ga0501073_0425378 3300049589 Bacteria 918
792 Ga0501074_0002555 3300049590 Bacteria 12701
793 Ga0501074_0016136 3300049590 Bacteria 5428
794 Ga0501074_0033856 3300049590 Bacteria 3704
795 Ga0501075_0171117 3300049591 Bacteria 1657
796 Ga0501076_0008864 3300049592 Bacteria 7398
797 Ga0501076_0070351 3300049592 Bacteria 2797
798 Ga0501077_0043446 3300049593 Bacteria 2856
799 Ga0501079_0337543 3300049741 Bacteria 1180
800 Ga0501080_0000053 3300049742 Bacteria 74409
801 Ga0501080_0005693 3300049742 Bacteria 11145
802 Ga0501080_0014905 3300049742 Bacteria 7157
803 Ga0501080_0018576 3300049742 Bacteria 6434
804 Ga0501080_0050494 3300049742 Bacteria 3871
805 Ga0501080_0065574 3300049742 Bacteria 3377
806 Ga0501080_0071736 3300049742 Bacteria 3221
807 Ga0501080_0077400 3300049742 Bacteria 3093
808 Ga0501080_0455512 3300049742 Bacteria 1146
809 Ga0501080_0525103 3300049742 Bacteria 1056
810 Ga0501081_0003348 3300049743 Bacteria 10196
811 Ga0501081_0262315 3300049743 Bacteria 1263
812 Ga0501083_0000406 3300049744 Bacteria 27431
813 Ga0501083_0017663 3300049744 Bacteria 4973
814 Ga0501083_0090776 3300049744 Bacteria 2017
815 Ga0501083_0181102 3300049744 Bacteria 1376
816 Ga0501280_003795 3300049776 Bacteria 2278
817 Ga0501035_0000010 3300049822 Bacteria 309349
818 Ga0501035_0000023 3300049822 Bacteria 206821
819 Ga0501035_0000107 3300049822 Bacteria 103130
820 Ga0501035_0000449 3300049822 Bacteria 46083
821 Ga0501035_0001177 3300049822 Bacteria 27251
822 Ga0501035_0003419 3300049822 Bacteria 15188
823 Ga0501035_0003519 3300049822 Bacteria 14970
824 Ga0501035_0007710 3300049822 Bacteria 10052
825 Ga0501035_0065014 3300049822 Bacteria 3241
826 Ga0501035_0156239 3300049822 Bacteria 1977
827 Ga0501035_0342862 3300049822 Bacteria 1251
828 Ga0501035_0469443 3300049822 Bacteria 1039
829 Ga0501044_0000006 3300049823 Bacteria 291413
830 Ga0501044_0000021 3300049823 Bacteria 206821
831 Ga0501044_0000154 3300049823 Bacteria 85407
832 Ga0501044_0008423 3300049823 Bacteria 11307
833 Ga0501044_0010150 3300049823 Bacteria 10235
834 Ga0501044_0032199 3300049823 Bacteria 5513
835 Ga0501044_0036530 3300049823 Bacteria 5140
836 Ga0501044_0053659 3300049823 Bacteria 4146
837 Ga0501044_0085982 3300049823 Bacteria 3177
838 Ga0501044_0087274 3300049823 Bacteria 3151
839 Ga0501044_0091619 3300049823 Bacteria 3066
840 Ga0501044_0098638 3300049823 Bacteria 2941
841 Ga0501044_0126201 3300049823 Bacteria 2556
842 Ga0501044_0280465 3300049823 Bacteria 1600
843 Ga0501045_0007088 3300049824 Bacteria 7770
844 Ga0501045_0140475 3300049824 Bacteria 1796
845 Ga0501045_0141357 3300049824 Bacteria 1790
846 nmdc:mga03683_51889_c1 3300050489 Bacteria 1713
847 nmdc:mga03683_91461_c1 3300050489 Bacteria 1327
848 nmdc:mga03n38_3995_c1 3300050490 Bacteria 4818
849 nmdc:mga00v17_132932_c1 3300050491 Bacteria 1591
850 nmdc:mga00v17_211366_c1 3300050491 Bacteria 1255
851 nmdc:mga00v17_3192_c1 3300050491 Bacteria 8448
852 nmdc:mga00v17_72_c1 3300050491 Bacteria 60922
853 nmdc:mga0yw44_166453_c1 3300050492 Bacteria 1446
854 nmdc:mga0yw44_1917_c1 3300050492 Bacteria 8593
855 nmdc:mga0yw44_96982_c1 3300050492 Bacteria 1872
856 nmdc:mga0k408_37840_c1 3300050493 Bacteria 2770
857 nmdc:mga0k408_68174_c1 3300050493 Bacteria 2075
858 nmdc:mga0k408_82874_c1 3300050493 Bacteria 1880
859 nmdc:mga06z11_11753_c1 3300050494 Bacteria 3786
860 nmdc:mga06z11_260156_c1 3300050494 Bacteria 1024
861 nmdc:mga06z11_52758_c1 3300050494 Bacteria 2088
862 nmdc:mga06z11_62571_c1 3300050494 Bacteria 1944
863 nmdc:mga06z11_91541_c1 3300050494 Bacteria 1652
864 nmdc:mga04h51_11247_c1 3300050495 Bacteria 2480
865 nmdc:mga04h51_56754_c1 3300050495 Bacteria 1330
866 nmdc:mga07m45_123910_c1 3300050496 Bacteria 1109
867 nmdc:mga07m45_50268_c1 3300050496 Bacteria 2349
868 nmdc:mga0rr50_41028_c1 3300050513 Bacteria 3369
869 nmdc:mga08x19_22_c1 3300050514 Bacteria 297462
870 nmdc:mga0sz30_119851_c1 3300050516 Bacteria 1156
871 nmdc:mga0sz30_13611_c1 3300050516 Bacteria 3188
872 nmdc:mga0sz30_175615_c1 3300050516 Bacteria 950
873 nmdc:mga0sz30_26730_c1 3300050516 Bacteria 2367
874 nmdc:mga0sz30_609_c1 3300050516 Bacteria 13266
875 Ga0500610_0064816 3300053079 Bacteria 1906
876 Ga0495619_0105390 3300053085 Bacteria 1922
877 Ga0500578_0109792 3300053086 Bacteria 1739
878 Ga0500651_0167214 3300053093 Bacteria 1313
879 Ga0500556_0000033 3300053104 Bacteria 147801
880 Ga0500560_018504 3300053107 Bacteria 1943
881 Ga0500569_001278 3300053109 Bacteria 4689
882 Ga0500569_021263 3300053109 Bacteria 1713
883 Ga0500594_0002582 3300053118 Bacteria 3934
884 Ga0500618_001151 3300053125 Bacteria 12825
885 Ga0500642_0019133 3300053130 Bacteria 2665
886 Ga0500658_0000230 3300053134 Bacteria 26381
887 Ga0500658_0141410 3300053134 Bacteria 1080
888 Ga0500561_0000123 3300053137 Bacteria 14866
889 Ga0500568_0000205 3300053139 Bacteria 51687
890 Ga0500568_0000924 3300053139 Bacteria 20259
891 Ga0500568_0004782 3300053139 Bacteria 7160
892 Ga0500568_0066844 3300053139 Bacteria 1382
893 Ga0500573_0007042 3300053140 Bacteria 6113
894 Ga0500604_0050123 3300053151 Bacteria 1286
895 Ga0500616_0002449 3300053153 Bacteria 15425
896 Ga0500616_0017030 3300053153 Bacteria 4127
897 Ga0500616_0068987 3300053153 Bacteria 1809
898 Ga0500616_0080810 3300053153 Bacteria 1634
899 Ga0500620_029555 3300053155 Bacteria 1723
900 Ga0500622_0001035 3300053156 Bacteria 23258
901 Ga0500622_0132185 3300053156 Bacteria 1198
902 Ga0500624_000320 3300053157 Bacteria 16425
903 Ga0500627_0052506 3300053158 Bacteria 1779
904 Ga0500627_0101530 3300053158 Bacteria 1291
905 Ga0500633_0009280 3300053160 Bacteria 2579
906 Ga0501084_0238511 3300054114 Bacteria 1535
907 Ga0501084_0453913 3300054114 Bacteria 1083
908 Ga0587072_023137 3300059643 Bacteria 1114
909 Ga0501082_0048193 3300060353 Bacteria 3672
910 Ga0530510_0239918 3300061734 Bacteria 1349
911 Ga0530510_0558227 3300061734 Bacteria 870
912 2503200587 2503198000 Bacteria 6884444
913 2509107042 2508501122 Bacteria 6292184
914 2509116880 2508501123 Bacteria 6283661
915 2509141882 2508501127 Bacteria 7037543
916 2509373983 2509276018 Bacteria 6910194
917 2509375002 2509276019 Bacteria 6802256
918 2509388439 2509276021 Bacteria 7634384
919 2509395375 2509276022 Bacteria 6200534
920 2509443987 2509276033 Bacteria 7180565
921 2510131414 2510065019 Bacteria 6903379
922 2510305154 2510065057 Bacteria 6649661
923 2510316340 2510065059 Bacteria 6847884
924 2510897768 2510461076 Bacteria 8618824
925 2511184788 2510917028 Bacteria 6185411
926 2511196816 2510917030 Bacteria 7460662
927 2511389351 2511231027 Bacteria 5013807
928 2511500536 2511231052 Bacteria 6974333
929 2512531995 2512047086 Bacteria 6850303
930 2512928794 2512875016 Bacteria 6529530
931 2512963538 2512875024 Bacteria 7195110
932 2512972687 2512875026 Bacteria 6861065
933 2513570633 2513237084 Bacteria 7231967
934 2513580214 2513237085 Bacteria 7695351
935 2513584162 2513237086 Bacteria 7265287
936 2513591482 2513237087 Bacteria 5817514
937 2513596735 2513237088 Bacteria 6927906
938 2513602924 2513237089 Bacteria 6553624
939 2513612360 2513237090 Bacteria 7096802
940 2513620441 2513237091 Bacteria 6900273
941 2513634261 2513237093 Bacteria 7545552
942 2513713190 2513237103 Bacteria 7647401
943 2513864850 2513237138 Bacteria 7368160
944 2513880611 2513237140 Bacteria 7076289
945 2513903341 2513237143 Bacteria 6664116
946 2513910356 2513237144 Bacteria 7530820
947 2513928304 2513237146 Bacteria 7166346
948 2513986333 2513237156 Bacteria 6402557
949 2513996768 2513237159 Bacteria 6810126
950 2514005176 2513237160 Bacteria 6650282
951 2514020246 2513237162 Bacteria 7468464
952 2514038189 2513237164 Bacteria 7563725
953 2514422798 2513237305 Bacteria 7293571
954 2514590767 2513237351 Bacteria 6968952
955 2515110375 2515075009 Bacteria 7288508
956 2515607724 2515154107 Bacteria 6795637
957 2515634575 2515154113 Bacteria 7807172
958 2515643800 2515154114 Bacteria 7848616
959 2515657198 2515154116 Bacteria 7552979
960 2515743301 2515154134 Bacteria 7220242
961 2516204337 2516143018 Bacteria 6951533
962 2516891858 2516653046 Bacteria 6989037
963 2517039062 2516653077 Bacteria 7555578
964 2517079318 2516653085 Bacteria 7346596
965 2517093259 2517093000 Bacteria 7412387
966 2517409526 2517287029 Bacteria 6905599
967 2517568654 2517487022 Bacteria 7227575
968 2520375540 2519899620 Bacteria 6499161
969 2530647821 2529292951 Bacteria 6916614
970 2535485290 2534681786 Bacteria 3308809
971 2535515095 2534681796 Bacteria 7146037
972 2537872806 2537561587 Bacteria 5425293
973 2551679337 2551306084 Bacteria 8942552
974 2551686158 2551306085 Bacteria 7347181
975 2551692118 2551306086 Bacteria 6843938
976 2551699805 2551306087 Bacteria 7351905
977 2551710541 2551306089 Bacteria 7162724
978 2551712287 2551306089 Bacteria 7162724
979 2551723203 2551306090 Bacteria 7953713
980 2551729900 2551306091 Bacteria 7086830
981 2551733414 2551306092 Bacteria 6992595
982 2551743530 2551306093 Bacteria 7064773
983 2554246643 2554235003 Bacteria 5877155
984 2558866004 2558860100 Bacteria 8458965
985 2559293871 2558860242 Bacteria 5568029
986 2561466895 2558860983 Bacteria 4133860
987 2585165003 2582581283 Bacteria 6030556
988 2585203673 2582581294 Bacteria 6626667
989 2585227077 2582581298 Bacteria 7315509
990 2585233195 2582581299 Bacteria 6518058
991 2585255914 2582581304 Bacteria 5831370
992 2585269547 2582581306 Bacteria 6450535
993 2585385485 2582581865 Bacteria 6644329
994 2585391905 2582581866 Bacteria 6859583
995 2585398550 2582581867 Bacteria 7184437
996 2585529265 2585427526 Bacteria 7258840
997 2585539684 2585427528 Bacteria 6842387
998 2585550498 2585427529 Bacteria 7395659
999 2585819300 2585427590 Bacteria 6824633
1000 2585837641 2585427593 Bacteria 7141551
1001 2585844653 2585427594 Bacteria 6180594
1002 2588514338 2588253730 Bacteria 6881675
1003 2597811165 2597489875 Bacteria 7010078
1004 2599333005 2599185156 Bacteria 5403036
1005 2599419186 2599185170 Bacteria 7295545
1006 2599605420 2599185210 Bacteria 5624189
1007 2599719550 2599185236 Bacteria 6875203
1008 2599940577 2599185301 Bacteria 6161860
1009 2600191457 2599185352 Bacteria 7228948
1010 2601609156 2600255279 Bacteria 5605316
1011 2601745931 2600255308 Bacteria 5611129
1012 2616297117 2615840624 Bacteria 6557588
1013 2643770262 2643221550 Bacteria 4619371
1014 2643778057 2643221551 Bacteria 3750538
1015 2643796505 2643221555 Bacteria 3749717
1016 2643806297 2643221557 Bacteria 7184309
1017 2643840341 2643221564 Bacteria 4193379
1018 2643921141 2643221582 Bacteria 5804683
1019 2643989854 2643221595 Bacteria 6565519
1020 2644001280 2643221598 Bacteria 4578346
1021 2644007319 2643221599 Bacteria 6292121
1022 2644047122 2643221607 Bacteria 6314006
1023 2644070101 2643221610 Bacteria 7480339
1024 2644086002 2643221614 Bacteria 4260023
1025 2644103236 2643221618 Bacteria 7717186
1026 2644132498 2643221623 Bacteria 5239945
1027 2644151892 2643221626 Bacteria 8069654
1028 2644153506 2643221627 Bacteria 6761570
1029 2644190587 2643221634 Bacteria 6705461
1030 2644203439 2643221636 Bacteria 6583769
1031 2644206701 2643221637 Bacteria 5345260
1032 2644241547 2643221643 Bacteria 5749658
1033 2644306164 2643221655 Bacteria 7722067
1034 2644330414 2643221659 Bacteria 7890716
1035 2644345331 2643221661 Bacteria 4267604
1036 2644369605 2643221666 Bacteria 4265935
1037 2644381072 2643221668 Bacteria 7306521
1038 2644414978 2643221675 Bacteria 7473456
1039 2644448635 2643221680 Bacteria 7473610
1040 2644479911 2643221686 Bacteria 6310811
1041 2644492247 2643221688 Bacteria 5260751
1042 2644496750 2643221689 Bacteria 6042950
1043 2644519215 2643221693 Bacteria 5513853
1044 2644542840 2643221698 Bacteria 7756764
1045 2644618886 2643221712 Bacteria 7729434
1046 2644650348 2643221718 Bacteria 5345506
1047 2644674023 2643221723 Bacteria 7095460
1048 2644689057 2643221726 Bacteria 7455827
1049 2657681898 2657244999 Bacteria 5946535
1050 2671694879 2671180139 Bacteria 4196045
1051 2688597754 2687453392 Bacteria 6880454
1052 2692317253 2690316117 Bacteria 6800650
1053 2694629152 2693429783 Bacteria 7019804
1054 2694636934 2693429784 Bacteria 7241525
1055 2719179570 2718217882 Bacteria 6556348
1056 2719384123 2718217927 Bacteria 6972593
1057 2719663916 2718217997 Bacteria 6740740
1058 2719730240 2718218009 Bacteria 6478651
1059 2720490335 2718218199 Bacteria 6740745
1060 2720611710 2718218232 Bacteria 6720332
1061 2720618559 2718218233 Bacteria 6662049
1062 2720629967 2718218235 Bacteria 6630699
1063 2720773662 2718218269 Bacteria 6906114
1064 2721145663 2718218363 Bacteria 6524337
1065 2721157179 2718218365 Bacteria 6274507
1066 2721162542 2718218366 Bacteria 6425255
1067 2721397893 2718218423 Bacteria 6438183
1068 2722838712 2721755514 Bacteria 6424414
1069 2723025335 2721755556 Bacteria 6745503
1070 2723558918 2721755684 Bacteria 6859907
1071 2723565488 2721755685 Bacteria 6704835
1072 2723578247 2721755686 Bacteria 7343952
1073 2724036703 2721755809 Bacteria 6438790
1074 2724042996 2721755810 Bacteria 6479005
1075 2724088269 2721755819 Bacteria 6906405
1076 2724102753 2721755822 Bacteria 6726041
1077 2724108653 2721755823 Bacteria 6752556
1078 2725948993 2724679232 Bacteria 7646494
1079 2730106271 2728369352 Bacteria 6745171
1080 2730162807 2728369365 Bacteria 6555560
1081 2730296811 2728369397 Bacteria 6274511
1082 2738801241 2738541293 Bacteria 7065685
1083 2739037074 2738541333 Bacteria 7106503
1084 2739309602 2738543024 Bacteria 5603683
1085 2753358023 2751185800 Bacteria 5467370
1086 2753461347 2751185821 Bacteria 6189929
1087 2756676349 2756170246 Bacteria 7451806
1088 2757569210 2757320392 Bacteria 3737298
1089 2758638830 2758568016 Bacteria 5645291
1090 2765464329 2765235802 Bacteria 5618596
1091 2766066567 2765235942 Bacteria 7445910
1092 2770194656 2767802442 Bacteria 5747986
1093 2776272542 2775506902 Bacteria 6208009
1094 2776284483 2775506904 Bacteria 5954060
1095 2792582919 2791355082 Bacteria 5973319
1096 2792623808 2791355091 Bacteria 6135441
1097 2792629812 2791355092 Bacteria 6248105
1098 2792638147 2791355094 Bacteria 7011481
1099 2792750120 2791355123 Bacteria 8049106
1100 2793283344 2791355253 Bacteria 5171699
1101 2793295210 2791355256 Bacteria 6798008
1102 2793316330 2791355259 Bacteria 7254731
1103 2793323438 2791355260 Bacteria 6598818
1104 2793326168 2791355261 Bacteria 6661293
1105 2793334228 2791355262 Bacteria 6774204
1106 2793341806 2791355263 Bacteria 6872478
1107 2793348143 2791355264 Bacteria 6429314
1108 2793357235 2791355265 Bacteria 6539969
1109 2793361512 2791355266 Bacteria 7116587
1110 2793364674 2791355267 Bacteria 7222458
1111 2802720313 2802428858 Bacteria 6636079
1112 2802726132 2802428859 Bacteria 6667919
1113 2802731703 2802428860 Bacteria 6525526
1114 2802739454 2802428861 Bacteria 6534206
1115 2802742596 2802428862 Bacteria 6633353
1116 2802749301 2802428863 Bacteria 6410669
1117 2804750917 2802429268 Bacteria 6094027
1118 2805929369 2802429605 Bacteria 6875453
1119 2805932372 2802429606 Bacteria 6346811
1120 2806047544 2802429633 Bacteria 7341974
1121 2806054963 2802429634 Bacteria 7083200
1122 2806062135 2802429635 Bacteria 7650140
1123 2806067139 2802429636 Bacteria 7597525
1124 2806076460 2802429637 Bacteria 7067217
1125 2808986353 2808606387 Bacteria 5697198
1126 2819556484 2818991439 Bacteria 6907412
1127 2828307785 2828305725 Bacteria 4916900
1128 2837651952 2837651117 Bacteria 3772164
1129 2837683332 2837678835 Bacteria 5252418
1130 2838020284 2838016132 Bacteria 6577831
1131 2838028180 2838022645 Bacteria 6494267
1132 2838037130 2838035591 Bacteria 7166484
1133 2838044424 2838042994 Bacteria 6046894
1134 2838051500 2838048938 Bacteria 6044578
1135 2838063974 2838061910 Bacteria 6794874
1136 2838071108 2838068647 Bacteria 6208656
1137 2838075375 2838074704 Bacteria 6785777
1138 2838663694 2838661181 Bacteria 7385261
1139 2838672397 2838668709 Bacteria 6671819
1140 2838677213 2838675328 Bacteria 4909118
1141 2838680582 2838680041 Bacteria 6545511
1142 2838691585 2838686498 Bacteria 7807632
1143 2838695385 2838694306 Bacteria 6853137
1144 2838703861 2838701080 Bacteria 6669771
1145 2838708761 2838707686 Bacteria 6619912
1146 2838716101 2838714209 Bacteria 5525906
1147 2838720099 2838719591 Bacteria 5523910
1148 2838726853 2838724970 Bacteria 4908691
1149 2838733931 2838729681 Bacteria 7400765
1150 2838747005 2838742623 Bacteria 7396178
1151 2839994244 2839993093 Bacteria 5512535
1152 2840769355 2840764183 Bacteria 6358399
1153 2841735624 2841734538 Bacteria 6784580
1154 2841847032 2841846520 Bacteria 5345850
1155 2841856146 2841851746 Bacteria 7532261
1156 2841860438 2841859092 Bacteria 5436171
1157 2841866815 2841864319 Bacteria 6742987
1158 2842080004 2842077413 Bacteria 6508645
1159 2842120623 2842118031 Bacteria 7033875
1160 2842126939 2842124991 Bacteria 5346824
1161 2842132106 2842130223 Bacteria 4909145
1162 2842148347 2842146304 Bacteria 5957337
1163 2842152725 2842152218 Bacteria 4908957
1164 2842161934 2842156927 Bacteria 6894975
1165 2842169690 2842163707 Bacteria 6916235
1166 2842172346 2842170452 Bacteria 5525737
1167 2842176344 2842175837 Bacteria 4908771
1168 2842185776 2842180545 Bacteria 6888678
1169 2842189208 2842187318 Bacteria 5524014
1170 2842192883 2842192696 Bacteria 6147454
1171 2842205173 2842198810 Bacteria 6608673
1172 2842206954 2842205361 Bacteria 6340321
1173 2842213522 2842211629 Bacteria 5523832
1174 2842218797 2842217011 Bacteria 7497767
1175 2842224860 2842224351 Bacteria 5524473
1176 2842235304 2842229732 Bacteria 7475766
1177 2842238173 2842237096 Bacteria 6620661
1178 2842248241 2842243621 Bacteria 7421798
1179 2842253413 2842250916 Bacteria 6579627
1180 2842262165 2842257432 Bacteria 7401195
1181 2842268762 2842264693 Bacteria 6472963
1182 2842276558 2842271015 Bacteria 7807131
1183 2842280353 2842278818 Bacteria 6340002
1184 2842286835 2842285085 Bacteria 6011953
1185 2842293664 2842291075 Bacteria 7076806
1186 2842306505 2842304105 Bacteria 7023636
1187 2842312622 2842311132 Bacteria 6616990
1188 2842322511 2842317721 Bacteria 6793725
1189 2842343076 2842341865 Bacteria 7003929
1190 2842367198 2842363717 Bacteria 6844742
1191 2842371045 2842370503 Bacteria 7038661
1192 2842380061 2842377471 Bacteria 7140707
1193 2842387132 2842384541 Bacteria 7057858
1194 2842399245 2842395702 Bacteria 6780583
1195 2842403612 2842402390 Bacteria 6681310
1196 2842410686 2842409023 Bacteria 6687331
1197 2842417332 2842415677 Bacteria 6596907
1198 2842424724 2842422224 Bacteria 6239196
1199 2842433038 2842428310 Bacteria 6767288
1200 2842439343 2842434925 Bacteria 6502746
1201 2842445972 2842441272 Bacteria 6769273
1202 2842451847 2842447887 Bacteria 6754142
1203 2842467158 2842462802 Bacteria 6588055
1204 2842473814 2842469257 Bacteria 6752936
1205 2842492463 2842489311 Bacteria 6620893
1206 2842500043 2842495871 Bacteria 6820686
1207 2842517223 2842515876 Bacteria 5436280
1208 2842521699 2842521101 Bacteria 6569494
1209 2842873042 2842871566 Bacteria 4827117
1210 2842923311 2842922631 Bacteria 5824079
1211 2844004354 2844002411 Bacteria 7168230
1212 2844009853 2844009547 Bacteria 6728125
1213 2844170748 2844163670 Bacteria 7266046
1214 2844455994 2844454524 Bacteria 7952546
1215 2847417680 2847417321 Bacteria 6913799
1216 2847672619 2847670302 Bacteria 6165597
1217 2847691814 2847686936 Bacteria 6278406
1218 2848992485 2848992105 Bacteria 6810864
1219 2850079978 2850079185 Bacteria 6848280
1220 2854916251 2854911287 Bacteria 5582813
1221 2855831775 2855825444 Bacteria 6785811
1222 2855840006 2855839649 Bacteria 7135830
1223 2855874533 2855872281 Bacteria 6964271
1224 2856315158 2856314179 Bacteria 6477897
1225 2856328166 2856320880 Bacteria 7263508
1226 2856329858 2856328259 Bacteria 6528202
1227 2856338767 2856334872 Bacteria 7037011
1228 2856346631 2856342000 Bacteria 7176905
1229 2856367610 2856364286 Bacteria 6939991
1230 2857353652 2857349434 Bacteria 7926032
1231 2857371920 2857367948 Bacteria 6965560
1232 2857523442 2857516855 Bacteria 7787325
1233 2858803970 2858800743 Bacteria 6603254
1234 2869166964 2869162929 Bacteria 6399702
1235 2869172489 2869169390 Bacteria 6659796
1236 2869235717 2869234852 Bacteria 6654993
1237 2869244336 2869242130 Bacteria 6609239
1238 2869256717 2869249662 Bacteria 6868783
1239 2869258705 2869256925 Bacteria 6981691
1240 2869266048 2869264136 Bacteria 6880765
1241 2869276259 2869271264 Bacteria 6908218
1242 2869284299 2869278585 Bacteria 7077053
1243 2869286818 2869285874 Bacteria 6901219
1244 2871434082 2871429161 Bacteria 6547891
1245 2871451033 2871444079 Bacteria 6423508
1246 2871454746 2871451962 Bacteria 7336357
1247 2871462916 2871459585 Bacteria 6866887
1248 2871474267 2871466892 Bacteria 6923287
1249 2871475683 2871474448 Bacteria 6806570
1250 2871483939 2871481445 Bacteria 6700002
1251 2871490078 2871488783 Bacteria 6929816
1252 2871501989 2871495908 Bacteria 6935695
1253 2874107154 2874102143 Bacteria 6342645
1254 2874111819 2874109183 Bacteria 6517025
1255 2874118188 2874116593 Bacteria 6674494
1256 2874126822 2874123672 Bacteria 7238285
1257 2874132334 2874131515 Bacteria 6820270
1258 2874139238 2874139085 Bacteria 7021506
1259 2874147740 2874146452 Bacteria 7533118
1260 2874156658 2874155637 Bacteria 6724144
1261 2874163841 2874162495 Bacteria 6174670
1262 2874170895 2874168670 Bacteria 8062617
1263 2876369163 2876363079 Bacteria 6544991
1264 2876378442 2876377896 Bacteria 6565995
1265 2876386215 2876386047 Bacteria 6698674
1266 2876393784 2876392853 Bacteria 6660880
1267 2876401499 2876399893 Bacteria 6927900
1268 2876414768 2876413966 Bacteria 6831344
1269 2876421596 2876420981 Bacteria 6687741
1270 2878041987 2878035449 Bacteria 6555736
1271 2878736119 2878730984 Bacteria 6380721
1272 2878740085 2878738818 Bacteria 7136951
1273 2878746792 2878745973 Bacteria 6867388
1274 2878753237 2878753008 Bacteria 6922523
1275 2878765774 2878760144 Bacteria 6823465
1276 2878772448 2878767105 Bacteria 6898628
1277 2878775284 2878774303 Bacteria 6108671
1278 2878781186 2878781027 Bacteria 6834456
1279 2878791401 2878788777 Bacteria 6567085
1280 2881158433 2881155292 Bacteria 6461656
1281 2881164085 2881161766 Bacteria 7127907
1282 2881847276 2881845957 Bacteria 6611900
1283 2881867778 2881861095 Bacteria 7128710
1284 2882634307 2882632389 Bacteria 8154593
1285 2882912866 2882912400 Bacteria 6801539
1286 2885308820 2885305155 Bacteria 7348390
1287 2885319094 2885318864 Bacteria 6729568
1288 2885332328 2885326080 Bacteria 7134805
1289 2885335947 2885334103 Bacteria 7216818
1290 2885349542 2885342637 Bacteria 7011821
1291 2885354795 2885350715 Bacteria 6787678
1292 2888342457 2888337043 Bacteria 6629336
1293 2888346304 2888343758 Bacteria 6611049
1294 2888351802 2888350351 Bacteria 7372807
1295 2889013776 2889010040 Bacteria 6749192
1296 2889021522 2889016732 Bacteria 6700763
1297 2889795369 2889790730 Bacteria 5689708
1298 2889916061 2889914905 Bacteria 5702301
1299 2891093155 2891088606 Bacteria 4762464
1300 2891374936 2891373044 Bacteria 5202277
1301 2894655391 2894652903 Bacteria 4587256
1302 2894819416 2894817345 Bacteria 4892941
1303 2896391552 2896384573 Bacteria 7700774
1304 2899792504 2899792073 Bacteria 4926588
1305 2899847906 2899845264 Bacteria 5672268
1306 2903449371 2903448605 Bacteria 7357801
1307 2903497998 2903492973 Bacteria 13473544
1308 2903500680 2903492973 Bacteria 13473544
1309 2903515962 2903513507 Bacteria 6344008
1310 2903526369 2903521522 Bacteria 6525694
1311 2903529656 2903528002 Bacteria 6586099
1312 2903546720 2903540706 Bacteria 7062119
1313 2904579082 2904578770 Bacteria 5302906
1314 2904660509 2904659560 Bacteria 6685615
1315 2906309172 2906308376 Bacteria 6841989
1316 2906326779 2906321335 Bacteria 6579571
1317 2906328732 2906328253 Bacteria 6585166
1318 2906357193 2906354277 Bacteria 6991324
1319 2906365194 2906363423 Bacteria 6856682
1320 2906372139 2906370794 Bacteria 6881062
1321 2906393385 2906386501 Bacteria 5977019
1322 2906394515 2906393657 Bacteria 6790866
1323 2906406115 2906401398 Bacteria 6693206
1324 2906412301 2906408224 Bacteria 6162342
1325 2906415155 2906414383 Bacteria 6580790
1326 2913297990 2913295892 Bacteria 6333755
1327 2915652847 2915650412 Bacteria 4288180
1328 2915980785 2915980308 Bacteria 6624279
1329 2915992627 2915986958 Bacteria 6739310
1330 2915999677 2915993759 Bacteria 7016183
1331 2916001999 2916000859 Bacteria 6865702
1332 2916011985 2916007675 Bacteria 6898660
1333 2916016049 2916014648 Bacteria 6946486
1334 2916022537 2916021584 Bacteria 6854472
1335 2916033363 2916028427 Bacteria 6748433
1336 2916038811 2916035215 Bacteria 6755766
1337 2916042794 2916041962 Bacteria 6820487
1338 2916050252 2916048683 Bacteria 6543552
1339 2916057718 2916055098 Bacteria 6758838
1340 2916063648 2916061851 Bacteria 6737736
1341 2917555967 2917554339 Bacteria 4987857
1342 2919101350 2919100787 Bacteria 7710546
1343 2919116304 2919114240 Bacteria 5700270
1344 2919122090 2919119836 Bacteria 5208557
1345 2919454236 2919450847 Bacteria 5631160
1346 2920763391 2920760137 Bacteria 7427611
1347 2920823377 2920822456 Bacteria 6897201
1348 2921207177 2921201388 Bacteria 6926299
1349 2921245201 2921244191 Bacteria 6568419
1350 2921257157 2921250672 Bacteria 6677771
1351 2921260347 2921257292 Bacteria 6808382
1352 2921266488 2921263974 Bacteria 6864552
1353 2921287562 2921282425 Bacteria 6826397
1354 2921291941 2921289301 Bacteria 7316391
1355 2921299139 2921296804 Bacteria 7176999
1356 2922136560 2922130491 Bacteria 7173936
1357 2922157492 2922151315 Bacteria 6902399
1358 2922160061 2922158528 Bacteria 6573167
1359 2922174598 2922172374 Bacteria 6167644
1360 2922183264 2922178524 Bacteria 6025201
1361 2922189179 2922185730 Bacteria 7113964
1362 2923557143 2923556063 Bacteria 6793593
1363 2924146051 2924144063 Bacteria 6883928
1364 2924154446 2924150972 Bacteria 7169444
1365 2924163504 2924158325 Bacteria 7188855
1366 2924165983 2924165586 Bacteria 7260590
1367 2924174664 2924172951 Bacteria 6749356
1368 2924180863 2924179722 Bacteria 6843264
1369 2924191817 2924186466 Bacteria 6876637
1370 2924194292 2924193448 Bacteria 6955718
1371 2924202437 2924200457 Bacteria 6757188
1372 2924209669 2924207177 Bacteria 6917007
1373 2924218018 2924214083 Bacteria 7080103
1374 2924224272 2924221636 Bacteria 7113495
1375 2924232994 2924228884 Bacteria 6633132
1376 2924722625 2924718760 Bacteria 6331356
1377 2924728221 2924726620 Bacteria 6271473
1378 2924738438 2924733363 Bacteria 7574837
1379 2924747272 2924741084 Bacteria 6661321
1380 2924754203 2924748358 Bacteria 6154725
1381 2924757633 2924754689 Bacteria 6774424
1382 2924765499 2924762789 Bacteria 6561353
1383 2924777684 2924776078 Bacteria 7492003
1384 2924791166 2924784321 Bacteria 7416538
1385 2926757258 2926754445 Bacteria 5964435
1386 2926761473 2926760298 Bacteria 5505990
1387 2928521972 2928521798 Bacteria 4960112
1388 2933007370 2933006813 Bacteria 4912075
1389 2933012134 2933011516 Bacteria 5439334
1390 2933017682 2933016740 Bacteria 6355406
1391 2933573574 2933570622 Bacteria 7023390
1392 2933593995 2933586486 Bacteria 7667493
1393 2933594578 2933594066 Bacteria 5594265
1394 2933601907 2933599457 Bacteria 5858799
1395 2935895908 2935894831 Bacteria 6620579
1396 2935907167 2935901341 Bacteria 7341747
1397 2936368931 2936367885 Bacteria 7324495
1398 2936378454 2936375103 Bacteria 6652732
1399 2936383741 2936381700 Bacteria 7006523
1400 2936999120 2936996657 Bacteria 6298727
1401 2937005046 2937002841 Bacteria 6934057
1402 2937011327 2937009748 Bacteria 6746052
1403 2937018766 2937016420 Bacteria 6782579
1404 2937023820 2937023124 Bacteria 6815156
1405 2937034528 2937029754 Bacteria 6424026
1406 2937041311 2937036028 Bacteria 6846469
1407 2937049482 2937042894 Bacteria 6741576
1408 2937053987 2937049772 Bacteria 6757901
1409 2937060448 2937056579 Bacteria 7107896
1410 2937070044 2937063883 Bacteria 7199456
1411 2937071519 2937071275 Bacteria 6984483
1412 2937078739 2937078374 Bacteria 6610289
1413 2937086070 2937084907 Bacteria 6618516
1414 2937103439 2937098957 Bacteria 7249374
1415 2937110368 2937106411 Bacteria 6947143
1416 2937114676 2937113482 Bacteria 6505872
1417 2937122586 2937119839 Bacteria 6597547
1418 2937128464 2937126314 Bacteria 6771275
1419 2937813969 2937813078 Bacteria 7783518
1420 2937828722 2937822353 Bacteria 7290551
1421 2937837047 2937836603 Bacteria 6811263
1422 2937845197 2937843397 Bacteria 5256375
1423 2937850882 2937848649 Bacteria 6983481
1424 2937863172 2937861824 Bacteria 6660327
1425 2937874196 2937868953 Bacteria 6639878
1426 2937883902 2937877337 Bacteria 7246526
1427 2937892388 2937891427 Bacteria 6357007
1428 2937976653 2937972304 Bacteria 7532020
1429 2937981879 2937980651 Bacteria 6517427
1430 2938000579 2937994558 Bacteria 7036190
1431 2938015395 2938014810 Bacteria 6700592
1432 2939672847 2939669807 Bacteria 5028511
1433 2941500709 2941499720 Bacteria 7599444
1434 2954014671 2954011201 Bacteria 4762601
1435 2957382056 2957375807 Bacteria 6425588
1436 2957383664 2957382221 Bacteria 6737050
1437 2957394077 2957388812 Bacteria 6778072
1438 2957399558 2957395598 Bacteria 6822399
1439 2957403712 2957402308 Bacteria 6741770
1440 2957411037 2957408893 Bacteria 6558585
1441 2957421564 2957415311 Bacteria 6991633
1442 2957426227 2957422303 Bacteria 7172205
1443 2957435414 2957430029 Bacteria 7022557
1444 2957439532 2957437181 Bacteria 6568994
1445 2957447117 2957443900 Bacteria 6869977
1446 2957457329 2957450854 Bacteria 6765715
1447 2957464401 2957457609 Bacteria 6967680
1448 2957466183 2957464669 Bacteria 6568877
1449 2957471753 2957471148 Bacteria 6797643
1450 2957480326 2957478035 Bacteria 6756658
1451 2957489018 2957484790 Bacteria 6703082
1452 2957494601 2957491536 Bacteria 6695180
1453 2957499058 2957498199 Bacteria 7126688
1454 2957508619 2957505466 Bacteria 7253085
1455 2958038397 2958034702 Bacteria 6989922
1456 2958056007 2958041894 Bacteria 13082850
1457 2958056370 2958041894 Bacteria 13082850
1458 2958066458 2958064165 Bacteria 7158582
1459 2958075381 2958071322 Bacteria 6815895
1460 2958091180 2958084443 Bacteria 7312792
1461 2958098955 2958092219 Bacteria 6861151
1462 2958102913 2958100919 Bacteria 6800575
1463 2958114968 2958108152 Bacteria 6681128
1464 2958121449 2958115193 Bacteria 6923548
1465 2958125021 2958122699 Bacteria 7280457
1466 2958131222 2958130278 Bacteria 6897202
1467 2958143854 2958137437 Bacteria 6050276
1468 2958151158 2958144490 Bacteria 6677056
1469 2958163523 2958158011 Bacteria 6058449
1470 2958170950 2958165035 Bacteria 6906348
1471 2958174207 2958172287 Bacteria 6716688
1472 2958180621 2958179912 Bacteria 6874908
1473 2960585708 2960584000 Bacteria 6864594
1474 2960594767 2960591022 Bacteria 6622873
1475 2960599738 2960597568 Bacteria 6550735
1476 2960605544 2960603979 Bacteria 6898737
1477 2960616934 2960610863 Bacteria 6691244
1478 2960621705 2960617483 Bacteria 6727748
1479 2960629192 2960624210 Bacteria 6875384
1480 2960637456 2960631154 Bacteria 6732508
1481 2960644790 2960637947 Bacteria 7296468
1482 2960647694 2960645483 Bacteria 7211087
1483 2960657207 2960652885 Bacteria 7083688
1484 2960660401 2960660292 Bacteria 7041660
1485 2960668425 2960667422 Bacteria 6763020
1486 2960675592 2960674078 Bacteria 6609048
1487 2960686612 2960680706 Bacteria 6624464
1488 2960690335 2960687367 Bacteria 6535474
1489 2960698823 2960693952 Bacteria 6749742
1490 2961078455 2961077736 Bacteria 7079850
1491 2961120831 2961114664 Bacteria 6680456
1492 2961137081 2961136820 Bacteria 6775228
1493 2961169394 2961163497 Bacteria 6901077
1494 2961177061 2961170736 Bacteria 7072258
1495 2961184271 2961183825 Bacteria 6688536
1496 2963650439 2963644680 Bacteria 6530403
1497 2964609375 2964607997 Bacteria 7101408
1498 2964619809 2964615318 Bacteria 6809089
1499 2964622434 2964621998 Bacteria 6834995
1500 2964634318 2964628898 Bacteria 7083044
1501 2964636408 2964636051 Bacteria 7091832
1502 2964646967 2964643177 Bacteria 6820887
1503 2964650342 2964649959 Bacteria 6675118
1504 2964659475 2964656573 Bacteria 7100150
1505 2964665802 2964663802 Bacteria 7019362
1506 2964674982 2964670856 Bacteria 6851364
1507 2964680620 2964678106 Bacteria 6792020
1508 2964691101 2964685014 Bacteria 6839111
1509 2964693040 2964691889 Bacteria 6802758
1510 2964704133 2964698721 Bacteria 6765331
1511 2964707185 2964705432 Bacteria 7114648
1512 2964718573 2964712639 Bacteria 6695970
1513 2964719890 2964719344 Bacteria 7286602
1514 2965023646 2965018300 Bacteria 6883036
1515 2965031047 2965025482 Bacteria 6532201
1516 2965035567 2965032056 Bacteria 6887443
1517 2965040347 2965040258 Bacteria 6855979
1518 2965050726 2965047637 Bacteria 6623551
1519 2965067219 2965062239 Bacteria 7412989
1520 2965093465 2965089291 Bacteria 6866420
1521 2965115132 2965110997 Bacteria 6693150
1522 2965121531 2965119406 Bacteria 6956431
1523 2967669776 2967664464 Bacteria 6948836
1524 2967678178 2967671571 Bacteria 7021409
1525 2967684968 2967678726 Bacteria 7264382
1526 2967691526 2967686174 Bacteria 6678622
1527 2967695080 2967693043 Bacteria 6804451
1528 2967700359 2967699805 Bacteria 6854538
1529 2967712776 2967706974 Bacteria 7186053
1530 2967714674 2967714385 Bacteria 7000047
1531 2967730559 2967728569 Bacteria 6641507
1532 2967736321 2967735183 Bacteria 6827012
1533 2967747814 2967742019 Bacteria 6794534
1534 2967751846 2967748971 Bacteria 6733771
1535 2967761298 2967755722 Bacteria 6814706
1536 2967762678 2967762386 Bacteria 6923502
1537 2967771303 2967769361 Bacteria 6587838
1538 2967776734 2967775926 Bacteria 6738189
1539 2968002813 2967996073 Bacteria 6787468
1540 2968005210 2968003550 Bacteria 6929263
1541 2968021298 2968016561 Bacteria 7022047
1542 2968085612 2968083720 Bacteria 7351627
1543 2968095268 2968091066 Bacteria 6052692
1544 2968101239 2968097103 Bacteria 6107094
1545 2968111568 2968110612 Bacteria 6814636
1546 2968120210 2968117919 Bacteria 6536078
1547 2968128613 2968128360 Bacteria 6270294
1548 2968177784 2968171901 Bacteria 6894245
1549 2970023311 2970019648 Bacteria 7072033
1550 2970030580 2970026789 Bacteria 6785236
1551 2970034021 2970033650 Bacteria 7118744
1552 2970045500 2970040964 Bacteria 6731123
1553 2970052617 2970047711 Bacteria 7088379
1554 2970057420 2970054988 Bacteria 6611507
1555 2970063963 2970061556 Bacteria 7099761
1556 2970071369 2970068827 Bacteria 7123112
1557 2970080401 2970076120 Bacteria 6697332
1558 2970087338 2970082768 Bacteria 6183754
1559 2970095376 2970088815 Bacteria 6933825
1560 2970101514 2970095765 Bacteria 6936963
1561 2970103366 2970102677 Bacteria 6812532
1562 2970116048 2970109326 Bacteria 6863976
1563 2970121902 2970116247 Bacteria 6501857
1564 2970126298 2970122695 Bacteria 6625855
1565 2970131578 2970129317 Bacteria 6806560
1566 2970143474 2970136068 Bacteria 7207982
1567 2970148541 2970143518 Bacteria 6446480
1568 2970153264 2970149975 Bacteria 6779706
1569 2970159522 2970156795 Bacteria 7168044
1570 2970167708 2970164137 Bacteria 6861252
1571 2970177018 2970170962 Bacteria 6876229
1572 2970181887 2970177841 Bacteria 6768001
1573 2970188446 2970184632 Bacteria 7054431
1574 2970196435 2970191845 Bacteria 7032787
1575 2970476403 2970469710 Bacteria 6969209
1576 2970491393 2970489779 Bacteria 6517260
1577 2970509734 2970503327 Bacteria 7099517
1578 2970516056 2970510686 Bacteria 7006402
1579 2970527812 2970524798 Bacteria 6840927
1580 2970532485 2970532167 Bacteria 6553173
1581 2970541928 2970540015 Bacteria 6977556
1582 2970554658 2970547951 Bacteria 6931819
1583 2970560630 2970554993 Bacteria 6814252
1584 2970598915 2970593180 Bacteria 7073582
1585 2970620938 2970619444 Bacteria 6986144
1586 2970628607 2970627176 Bacteria 6680862
1587 2977517728 2977516862 Bacteria 6940108
1588 2977529133 2977523885 Bacteria 6960446
1589 2977535862 2977530762 Bacteria 6951399
1590 2977539988 2977537788 Bacteria 6929320
1591 2977549464 2977544691 Bacteria 6875412
1592 2977552920 2977551784 Bacteria 7125765
1593 2977559279 2977558990 Bacteria 6863948
1594 2977567521 2977565890 Bacteria 6901543
1595 2977573169 2977572785 Bacteria 6763888
1596 2977580448 2977579622 Bacteria 6772100
1597 2977822170 2977821940 Bacteria 6906439
1598 2977835541 2977828996 Bacteria 7007971
1599 2977846967 2977843712 Bacteria 6753583
1600 2977854915 2977851361 Bacteria 6694324
1601 2977859098 2977858184 Bacteria 6215359
1602 2977865319 2977864932 Bacteria 7534097
1603 2977879351 2977872689 Bacteria 7270173
1604 2977913816 2977907340 Bacteria 6577984
1605 2977923858 2977922695 Bacteria 6956781
1606 2977937066 2977935797 Bacteria 6252826
1607 2977945747 2977942078 Bacteria 7570577
1608 2977979669 2977971508 Bacteria 7472917
1609 2977989984 2977986579 Bacteria 6581278
1610 2978973314 2978969890 Bacteria 5400756
1611 2979093239 2979089926 Bacteria 5670289
1612 2979099376 2979095461 Bacteria 5669583
1613 2979105210 2979100975 Bacteria 5423623
1614 2979710603 2979710463 Bacteria 6785254
1615 2979764888 2979764755 Bacteria 6610066
1616 2979774499 2979772303 Bacteria 6618277
1617 2979780033 2979779861 Bacteria 6219781
1618 2979797620 2979793036 Bacteria 6808957
1619 2979814521 2979808191 Bacteria 7179355
1620 2984512934 2984509177 Bacteria 5274802
1621 2984520702 2984518228 Bacteria 5277463
1622 2984539994 2984537506 Bacteria 5277481
1623 2984591595 2984587000 Bacteria 5263363
1624 2984602185 2984601300 Bacteria 5455244
1625 2987642935 2987636660 Bacteria 8088555
1626 2987645850 2987645492 Bacteria 6117018
1627 2987654527 2987652177 Bacteria 6969023
1628 2987665628 2987659509 Bacteria 6966464
1629 2987671735 2987666974 Bacteria 6509233
1630 2987680931 2987673487 Bacteria 6884027
1631 2989351407 2989349275 Bacteria 6349068
1632 2989772789 2989771324 Bacteria 5605128
1633 2996312907 2996310559 Bacteria 6357320
1634 2996337642 2996336353 Bacteria 5511628
1635 2996346062 2996341866 Bacteria 6643098
1636 2996356395 2996348954 Bacteria 7239054
1637 2996393962 2996386984 Bacteria 6978667
1638 2996892174 2996887358 Bacteria 5795980
1639 2996893431 2996893221 Bacteria 5823108
1640 3000142382 3000135777 Bacteria 6891109
1641 3002142635 3002141150 Bacteria 5254435
1642 3003931953 3003930520 Bacteria 5667563
1643 3004172300 3004167301 Bacteria 8330599
1644 3004194582 3004188549 Bacteria 6952365
1645 3004197774 3004195979 Bacteria 6776956
1646 3004210728 3004203850 Bacteria 7307914
1647 3004213296 3004211236 Bacteria 7417683
1648 3004221368 3004218560 Bacteria 7421728
1649 3004236236 3004232784 Bacteria 6662140
1650 3004271607 3004268573 Bacteria 7043476
1651 3004282699 3004275668 Bacteria 7114440
1652 3004294588 3004289098 Bacteria 6135450
1653 3004338364 3004334049 Bacteria 8449246
1654 3005411231 3005409236 Bacteria 7188837
1655 3005446182 3005445848 Bacteria 6906074
1656 3005452839 3005452660 Bacteria 5889319
1657 637078492 637000159 Bacteria 7596297
1658 639646644 639633055 Bacteria 7751309
1659 643824539 643692032 Bacteria 6891900
1660 648739372 648276728 Bacteria 6968865
1661 649872297 649633066 Bacteria 6690028
1662 650739062 650716007 Bacteria 5573770
1663 8001848076 8001845381 Bacteria 5804942
1664 8002288290 8002285264 Bacteria 6717907
1665 8003572694 8003570095 Bacteria 5747666
1666 8003992449 8003992118 Bacteria 7266902
1667 8003999777 8003999396 Bacteria 7063185
1668 8004307328 8004300914 Bacteria 6132239
1669 8004320707 8004312739 Bacteria 7444653
1670 8004374808 8004374579 Bacteria 6898112
1671 8004388102 8004387939 Bacteria 7049250
1672 8004403783 8004395343 Bacteria 6620908
1673 8004447206 8004445564 Bacteria 6322258
1674 8004639099 8004633249 Bacteria 6723080
1675 8004644526 8004640170 Bacteria 6723001
1676 8004697201 8004695233 Bacteria 6731676
1677 8004713182 8004703790 Bacteria 8006957
1678 8004715429 8004714634 Bacteria 6776161
1679 8004729883 8004727605 Bacteria 6643904
1680 8005263476 8005258706 Bacteria 6184835
1681 8005278834 8005275841 Bacteria 6929066
1682 8005289012 8005282627 Bacteria 6675747
1683 8005291086 8005289223 Bacteria 6634003
1684 8005301550 8005301065 Bacteria 6614431
1685 8005309197 8005307578 Bacteria 7395396
1686 8005326701 8005321885 Bacteria 5795980
1687 8005377437 8005376324 Bacteria 6590079
1688 8005387300 8005382845 Bacteria 6732062
1689 8005400123 8005395548 Bacteria 6806915
1690 8005432930 8005430974 Bacteria 6689030
1691 8005461014 8005460587 Bacteria 7157962
1692 8005498658 8005497431 Bacteria 6477605
1693 8005543768 8005542996 Bacteria 7077758
1694 8005560629 8005556819 Bacteria 6908598
1695 8005563912 8005563573 Bacteria 7153261
1696 8005576919 8005570704 Bacteria 6957481
1697 8005619852 8005619151 Bacteria 7030230
1698 8005628424 8005626139 Bacteria 6534237
1699 8005670069 8005668836 Bacteria 6953162
1700 8005690266 8005688590 Bacteria 6610080
1701 8005699257 8005695170 Bacteria 6912330
1702 8018133121 8018127388 Bacteria 7351159
1703 8018153603 8018150411 Bacteria 5549903
1704 8018169022 8018163183 Bacteria 7277977
1705 8018179460 8018176218 Bacteria 6896178
1706 8023684234 8023680758 Bacteria 7729763
1707 8024480273 8024479707 Bacteria 6954785
1708 8024491417 8024486573 Bacteria 6540512
1709 8024501606 8024501048 Bacteria 6427847
1710 8045866279 8045864390 Bacteria 5043873
1711 8049293475 8049293176 Bacteria 6128433
1712 8054559212 8054558443 Bacteria 5204801
1713 8055619096 8055617313 Bacteria 7548464
1714 8056375631 8056375014 Bacteria 7006639
1715 8056385945 8056382006 Bacteria 6408074
1716 8056879034 8056875544 Bacteria 4355797
1717 8057876045 8057874678 Bacteria 7494653
1718 Ga0496104_0057690
1719 JGI24740J21852_10003648
1720 JGI25156J39149_1011633
1721 JGI25158J39367_1002742
1722 JGI25157J39369_1002049
1723 JGI25152J39213_1001989
1724 JGI25152J39213_1003655
1725 JGI25152J39213_1003941
1726 JGI25152J39213_1005371
1727 JGI25152J39213_1006110
1728 JGI25152J39213_1006231
1729 JGI25150J39212_1000012
1730 JGI25150J39212_1000635
1731 JGI25150J39212_1004118
1732 JGI25150J39212_1013033
1733 JGI25159J45721_1000016
1734 JGI25159J45721_1000903
1735 JGI25151J46595_10000025
1736 JGI25151J46595_10000346
1737 JGI25151J46595_10005451
1738 JGI25151J46595_10005499
1739 JGI25151J46595_10017127
1740 JGI25406J46586_10003471
1741 JGI25406J46586_10004531
1742 JGI25406J46586_10051175
1743 JGI25406J46586_10064206
1744 JGI25153J46596_10001067
1745 JGI25153J46596_10001672
1746 JGI25153J46596_10003250
1747 JGI25153J46596_10007980
1748 JGI25153J46596_10014039
1749 JGI25153J46596_10014326
1750 JGI25160J50197_1000002
1751 JGI25161J50226_1000074
1752 JGI25161J50226_1000397
1753 JGI25161J50226_1006024
1754 Ga0055529_1003391
1755 Ga0055526_1001675
1756 Ga0055526_1003529
1757 Ga0055526_1003766
1758 Ga0055526_1015038
1759 Ga0055526_1016134
1760 Ga0055524_1000384
1761 Ga0055524_1005796
1762 Ga0055524_1006985
1763 Ga0055524_1011084
1764 Ga0055524_1029125
1765 Ga0055524_1038230
1766 Ga0055524_1050089
1767 Ga0055528_1000642
1768 Ga0055528_1000866
1769 Ga0055528_1001522
1770 Ga0055528_1031997
1771 Ga0055540_1000471
1772 Ga0055540_1002010
1773 Ga0055540_1016068
1774 Ga0055540_1018350
1775 Ga0055543_1000022
1776 Ga0055543_1000141
1777 Ga0055543_1001242
1778 Ga0065165_1000058
1779 Ga0070690_100004984
1780 Ga0070670_100135511
1781 Ga0070670_100305429
1782 Ga0070680_100036295
1783 Ga0070682_100040460
1784 Ga0070682_100164415
1785 Ga0070660_100218298
1786 Ga0070689_100001622
1787 Ga0070689_100445583
1788 Ga0070691_10158127
1789 Ga0070668_100006623
1790 Ga0070668_100008269
1791 Ga0070668_100014191
1792 Ga0070668_100023623
1793 Ga0070668_100074040
1794 Ga0070668_100084250
1795 Ga0070669_100113247
1796 Ga0070675_100162214
1797 Ga0070675_100635039
1798 Ga0070671_100005795
1799 Ga0070671_100130128
1800 Ga0070688_100003117
1801 Ga0070659_100032393
1802 Ga0070667_100016097
1803 Ga0070667_100393777
1804 Ga0070709_10052912
1805 Ga0070713_100385128
1806 Ga0070705_100012932
1807 Ga0070700_100267034
1808 Ga0070708_100764056
1809 Ga0070663_100071387
1810 Ga0070678_100098451
1811 Ga0070681_10006028
1812 Ga0070679_100014502
1813 Ga0070684_100134267
1814 Ga0068853_100015631
1815 Ga0070696_100032028
1816 Ga0070665_100003769
1817 Ga0070665_100004421
1818 Ga0070665_100025086
1819 Ga0070665_100781846
1820 Ga0068855_100288527
1821 Ga0070664_100156462
1822 Ga0070664_100173555
1823 Ga0068856_100246320
1824 Ga0068856_100479612
1825 Ga0070702_100062629
1826 Ga0070702_100066993
1827 Ga0068859_100021694
1828 Ga0068859_100071069
1829 Ga0068859_100348761
1830 Ga0068859_100383314
1831 Ga0068864_100025873
1832 Ga0068864_100025900
1833 Ga0068866_10163645
1834 Ga0068861_100032017
1835 Ga0068860_100000083
1836 Ga0068860_100087672
1837 Ga0068860_100138148
1838 Ga0068860_100461223
1839 Ga0068860_100783811
1840 Ga0068862_100050812
1841 Ga0068862_100070545
1842 Ga0068862_100155563
1843 Ga0068862_100204986
1844 Ga0068862_100222386
1845 Ga0068862_100307554
1846 Ga0081455_10107875
1847 Ga0081539_10000881
1848 Ga0081539_10016778
1849 Ga0070717_10173981
1850 Ga0075365_10003968
1851 Ga0075365_10015283
1852 Ga0075365_10058029
1853 Ga0075365_10138288
1854 Ga0075365_10174103
1855 Ga0075368_10000355
1856 Ga0075368_10024940
1857 Ga0075368_10074969
1858 Ga0075363_100022130
1859 Ga0075363_100112488
1860 Ga0075364_10022542
1861 Ga0075364_10152227
1862 Ga0075364_10162493
1863 Ga0075364_10273369
1864 Ga0070716_100072389
1865 Ga0075362_10049994
1866 Ga0075362_10051585
1867 Ga0075362_10090892
1868 Ga0075362_10162958
1869 Ga0075367_10000124
1870 Ga0075367_10002714
1871 Ga0075367_10010369
1872 Ga0075367_10045731
1873 Ga0075369_10001413
1874 Ga0075369_10007695
1875 Ga0075369_10025016
1876 Ga0075369_10043510
1877 Ga0075366_10021892
1878 Ga0075366_10085442
1879 Ga0075366_10115249
1880 Ga0097621_100436463
1881 Ga0075370_10025169
1882 Ga0075370_10188242
1883 Ga0097620_100021695
1884 Ga0097620_100071067
1885 Ga0097620_100348769
1886 Ga0097620_100383329
1887 Ga0099826_10000423
1888 Ga0099826_10006813
1889 Ga0099826_10101545
1890 Ga0099795_10055087
1891 Ga0105251_10010361
1892 Ga0105240_10712829
1893 Ga0111539_10309258
1894 Ga0105245_10445948
1895 Ga0105247_10056622
1896 Ga0105247_10347259
1897 Ga0114129_10675954
1898 Ga0105243_10012317
1899 Ga0105243_10067473
1900 Ga0105241_10050610
1901 Ga0105241_10088427
1902 Ga0105241_10293398
1903 Ga0105248_10014988
1904 Ga0105248_10020676
1905 Ga0105237_10034925
1906 Ga0105237_10041352
1907 Ga0105237_10563059
1908 Ga0105237_10882249
1909 Ga0105249_10438761
1910 Ga0123340_1051759
1911 Ga0123342_1014771
1912 Ga0123342_1029482
1913 Ga0105239_10028240
1914 Ga0105239_10073717
1915 Ga0105239_10124983
1916 Ga0105239_10143028
1917 Ga0105246_10467859
1918 Ga0157373_10001801
1919 Ga0157371_10000058
1920 Ga0157370_10000792
1921 Ga0157369_10083884
1922 Ga0171463_1001
1923 Ga0157374_10535891
1924 Ga0157378_10071978
1925 Ga0163162_10254260
1926 Ga0163162_10964457
1927 Ga0157372_10451691
1928 Ga0157375_10195734
1929 Ga0163163_10009574
1930 Ga0163163_10128427
1931 Ga0157376_10177241
1932 Ga0157376_10679045
1933 Ga0182006_1022618
1934 Ga0182007_10016195
1935 Ga0183363_1012
1936 Ga0163161_10388757
1937 Ga0214544_1000012
1938 Ga0214542_1000011
1939 Ga0214542_1017282
1940 Ga0214543_1000004
1941 Ga0214543_1000256
1942 Ga0213875_10000030
1943 Ga0228711_1000019
1944 Ga0228710_1000022
1945 Ga0209436_100429
1946 Ga0209436_100737
1947 Ga0207425_1000012
1948 Ga0207425_1001525
1949 Ga0207425_1003710
1950 Ga0207425_1006553
1951 Ga0209646_1009151
1952 Ga0209026_1000116
1953 Ga0209148_1000256
1954 Ga0209759_1000153
1955 Ga0209129_1000081
1956 Ga0209129_1000123
1957 Ga0209129_1000726
1958 Ga0209129_1001366
1959 Ga0209129_1002322
1960 Ga0209129_1010413
1961 Ga0209129_1019425
1962 Ga0209233_1000047
1963 Ga0209233_1006535
1964 Ga0209455_1000409
1965 Ga0209673_1000015
1966 Ga0209673_1000967
1967 Ga0209673_1001074
1968 Ga0209673_1001964
1969 Ga0209673_1003197
1970 Ga0209673_1005594
1971 Ga0209130_1000002
1972 Ga0209130_1000008
1973 Ga0209130_1011836
1974 Ga0209676_1012908
1975 Ga0209025_1000024
1976 Ga0209025_1000441
1977 Ga0209025_1000528
1978 Ga0209025_1000631
1979 Ga0209025_1000970
1980 Ga0209025_1003049
1981 Ga0209025_1003063
1982 Ga0209025_1003580
1983 Ga0209025_1007670
1984 Ga0209025_1014304
1985 Ga0209025_1022843
1986 Ga0209025_1052054
1987 Ga0209564_1000091
1988 Ga0209564_1000382
1989 Ga0209564_1000830
1990 Ga0209564_1001931
1991 Ga0209564_1005067
1992 Ga0209564_1016131
1993 Ga0209564_1025178
1994 Ga0209564_1051984
1995 Ga0209758_1000046
1996 Ga0209758_1001048
1997 Ga0209758_1001507
1998 Ga0209758_1001962
1999 Ga0209758_1002450
2000 Ga0209758_1002458
2001 Ga0209758_1002490
2002 Ga0209758_1033320
2003 Ga0209256_1000180
2004 Ga0209256_1000541
2005 Ga0209256_1000874
2006 Ga0209256_1001340
2007 Ga0209256_1005494
2008 Ga0209256_1005579
2009 Ga0209256_1014814
2010 Ga0209256_1018807
2011 Ga0209256_1018895
2012 Ga0207426_1000013
2013 Ga0207426_1000016
2014 Ga0207426_1000063
2015 Ga0207426_1000172
2016 Ga0207426_1001124
2017 Ga0209051_1000084
2018 Ga0209051_1002801
2019 Ga0209051_1023790
2020 Ga0209051_1028922
2021 Ga0209257_1002194
2022 Ga0209257_1007835
2023 Ga0209257_1021726
2024 Ga0207710_10119331
2025 Ga0207647_10009890
2026 Ga0207647_10015550
2027 Ga0207647_10149812
2028 Ga0207699_10007510
2029 Ga0207645_10019613
2030 Ga0207705_10138964
2031 Ga0207654_10075474
2032 Ga0207695_10147766
2033 Ga0207671_10032373
2034 Ga0207671_10118463
2035 Ga0207671_10187119
2036 Ga0207671_10334587
2037 Ga0207693_10162802
2038 Ga0207660_10118213
2039 Ga0207657_10105467
2040 Ga0207657_10135462
2041 Ga0207652_10515267
2042 Ga0207650_10255069
2043 Ga0207690_10259193
2044 Ga0207670_10001231
2045 Ga0207670_10460986
2046 Ga0207669_10141686
2047 Ga0207704_10086021
2048 Ga0207711_10116001
2049 Ga0207711_10153095
2050 Ga0207679_10109678
2051 Ga0207668_10004893
2052 Ga0207668_10023824
2053 Ga0207668_10096720
2054 Ga0207668_10146336
2055 Ga0207658_10208395
2056 Ga0207658_10329177
2057 Ga0207678_10000100
2058 Ga0207702_10446584
2059 Ga0207702_10863996
2060 Ga0207648_10216168
2061 Ga0207676_10007593
2062 Ga0207674_10106290
2063 Ga0207675_100031839
2064 Ga0207675_100305961
2065 Ga0207683_10025771
2066 Ga0207683_10111605
2067 Ga0207698_10630914
2068 Ga0207698_10678705
2069 Ga0209281_1000227
2070 Ga0209281_1000519
2071 Ga0209371_1000009
2072 Ga0209371_1000547
2073 Ga0209282_1000042
2074 Ga0209282_1000224
2075 Ga0209282_1003866
2076 Ga0209813_10000358
2077 Ga0209813_10012420
2078 Ga0209813_10021450
2079 Ga0268266_10003101
2080 Ga0268266_10006291
2081 Ga0268266_10015355
2082 Ga0268266_10515040
2083 Ga0268266_10801064
2084 Ga0268265_10002598
2085 Ga0268265_10039627
2086 Ga0268265_10272616
2087 Ga0268264_10000055
2088 Ga0268264_10033405
2089 Ga0268264_10051148
2090 Ga0268264_10462787
2091 Ga0265318_10143745
2092 Ga0307515_10000023
2093 Ga0307515_10004227
2094 Ga0268256_1000010
2095 Ga0268256_1016656
2096 Ga0265770_1017861
2097 Ga0265330_10083083
2098 Ga0265328_10010982
2099 Ga0265328_10016074
2100 Ga0265325_10002414
2101 Ga0265325_10003327
2102 Ga0265329_10062820
2103 Ga0265340_10012328
2104 Ga0265340_10044194
2105 Ga0265340_10045406
2106 Ga0265340_10064914
2107 Ga0265339_10040311
2108 Ga0265331_10003656
2109 Ga0265327_10001660
2110 Ga0265327_10015085
2111 Ga0265316_10031264
2112 Ga0265316_10040084
2113 Ga0265316_10057891
2114 Ga0265316_10059448
2115 Ga0307513_10006014
2116 Ga0307513_10016341
2117 Ga0307513_10192335
2118 Ga0265313_10003820
2119 Ga0265313_10029972
2120 Ga0265314_10010850
2121 Ga0265314_10036703
2122 Ga0265342_10018121
2123 Ga0265342_10084702
2124 Ga0265342_10207728
2125 Ga0307405_10015383
2126 Ga0307413_10183526
2127 Ga0307406_10046275
2128 Ga0307412_10027331
2129 Ga0307412_10078925
2130 Ga0307412_10150819
2131 Ga0315914_1000009
2132 Ga0307409_100529568
2133 Ga0307416_100603293
2134 Ga0307414_10287044
2135 Ga0307415_100510670
2136 Ga0315913_1000015
2137 Ga0315915_1000013
2138 Ga0373930_0011195
2139 Ga0373928_0032115
2140 Ga0373951_0007101
2141 Ga0373941_0147295
2142 Ga0373943_0000613
2143 Ga0373931_0070810
2144 Ga0373935_0005946
2145 Ga0373927_0000806
2146 Ga0373947_0000256
2147 Ga0373947_0346379
2148 Ga0373925_0013258
2149 Ga0395899_0000014
2150 Ga0395900_0000007
2151 Ga0395898_0000011
2152 Ga0395905_0000008
2153 Ga0395905_0011842
2154 Ga0395905_0464233
2155 Ga0436364_0053004
2156 Ga0436364_0207431
2157 Ga0436364_0563011
2158 Ga0436364_0628381
2159 Ga0395901_0000020
2160 Ga0395901_0027330
2161 Ga0395901_0027701
2162 Ga0436365_0289217
2163 Ga0439438_036258
2164 Ga0439465_0001471
2165 Ga0439465_0004192
2166 Ga0439465_0031347
2167 Ga0439465_0053697
2168 Ga0451787_397122
2169 Ga0451807_0622738
2170 Ga0451837_1340741
2171 Ga0451839_1498607
2172 Ga0451841_1101904
2173 Ga0451845_0022414
2174 Ga0451851_0106610
2175 Ga0451843_0615050
2176 Ga0451843_1153044
2177 Ga0451853_4116506
2178 Ga0439432_022899
2179 Ga0439432_034204
2180 Ga0439449_0100599
2181 Ga0439457_020608
2182 Ga0450920_028507
2183 Ga0450906_029462
2184 Ga0439434_0073404
2185 Ga0450918_001536
2186 Ga0451577_0048226
2187 Ga0466965_0240164
2188 Ga0466960_0003639
2189 Ga0451576_0000457
2190 Ga0451576_0639612
2191 Ga0495627_083255
2192 Ga0495638_0022249
2193 Ga0495638_0023748
2194 Ga0495638_0099707
2195 Ga0495638_0131159
2196 Ga0495650_0034324
2197 Ga0495580_0044198
2198 Ga0495605_0128815
2199 Ga0495585_0004077
2200 Ga0495585_0025667
2201 Ga0495585_0151849
2202 Ga0495596_0059795
2203 Ga0495607_0033186
2204 Ga0495583_0001709
2205 Ga0495583_0015869
2206 Ga0495583_0039945
2207 Ga0495610_0001297
2208 Ga0495610_0013489
2209 Ga0495616_0016614
2210 Ga0495616_0046111
2211 Ga0495616_0123801
2212 Ga0495618_0181186
2213 Ga0495620_0016232
2214 Ga0495620_0019139
2215 Ga0495630_0004618
2216 Ga0495631_0000651
2217 Ga0495631_0103618
2218 Ga0495632_0015871
2219 Ga0495632_0028828
2220 Ga0495643_0053111
2221 Ga0495648_0027504
2222 Ga0495648_0047779
2223 Ga0495666_0012120
2224 Ga0495654_0001032
2225 Ga0495654_0079010
2226 Ga0495654_0113723
2227 Ga0495665_0042485
2228 Ga0495640_0123195
2229 Ga0495609_0058088
2230 Ga0495597_0031888
2231 Ga0495633_0060660
2232 Ga0495668_0003018
2233 Ga0495668_0017367
2234 Ga0495668_0031652
2235 Ga0495611_0095065
2236 Ga0495625_0001384
2237 Ga0495625_0017986
2238 Ga0495625_0064023
2239 Ga0495625_0113690
2240 Ga0495625_0243837
2241 Ga0495661_0216745
2242 Ga0495588_0002043
2243 Ga0495588_0137928
2244 Ga0495658_0047318
2245 Ga0495624_0007453
2246 Ga0495671_0041827
2247 Ga0495660_0023466
2248 Ga0495660_0029351
2249 Ga0495672_0024115
2250 Ga0495687_019134
2251 Ga0495673_0033885
2252 Ga0495681_0017611
2253 Ga0495684_0005376
2254 Ga0495684_0007110
2255 Ga0495686_0005372
2256 Ga0495686_0031564
2257 Ga0495686_0035111
2258 Ga0495686_0213673
2259 Ga0495593_0031816
2260 Ga0495615_0042369
2261 Ga0496100_0011359
2262 Ga0496101_0013345
2263 Ga0496101_0036946
2264 Ga0496101_0051851
2265 Ga0496101_0215314
2266 Ga0496102_0007685
2267 Ga0496102_0152186
2268 Ga0496102_0191113
2269 Ga0496103_0025599
2270 Ga0496103_0209709
2271 Ga0496104_0445266
2272 Ga0496105_0000392
2273 Ga0496106_0021532
2274 Ga0496106_0070794
2275 Ga0496106_0214127
2276 Ga0496106_0409951
2277 Ga0496107_0032993
2278 Ga0496108_0001992
2279 Ga0496109_0012017
2280 Ga0496110_0122735
2281 Ga0496111_0001116
2282 Ga0496111_0022364
2283 Ga0496112_0002870
2284 Ga0496112_0025119
2285 Ga0496112_0042420
2286 Ga0496113_0004045
2287 Ga0496113_0080376
2288 Ga0496113_0149293
2289 Ga0496113_0280657
2290 Ga0496114_0084239
2291 Ga0496114_0152441
2292 Ga0496115_0006960
2293 Ga0496115_0050412
2294 Ga0496115_0120401
2295 Ga0496116_0001443
2296 Ga0496116_0002283
2297 Ga0496116_0018419
2298 Ga0496116_0050161
2299 Ga0496116_0055920
2300 Ga0496116_0188455
2301 Ga0496117_0000002
2302 Ga0496117_0004761
2303 Ga0496117_0005892
2304 Ga0496117_0047517
2305 Ga0496117_0052840
2306 Ga0496117_0104866
2307 Ga0496118_0000233
2308 Ga0496118_0007687
2309 Ga0496118_0029929
2310 Ga0496118_0038968
2311 Ga0496119_0001089
2312 Ga0496119_0018827
2313 Ga0496119_0020869
2314 Ga0496119_0061517
2315 Ga0496119_0062517
2316 Ga0496119_0204399
2317 Ga0496120_0000021
2318 Ga0496120_0009069
2319 Ga0496120_0184618
2320 Ga0496121_0004125
2321 Ga0496121_0021858
2322 Ga0496121_0063365
2323 Ga0496121_0143804
2324 Ga0496121_0194844
2325 Ga0496121_0215073
2326 Ga0496121_0281058
2327 Ga0496121_0285018
2328 Ga0496122_0000001
2329 Ga0496122_0001050
2330 Ga0496122_0002105
2331 Ga0496122_0002628
2332 Ga0496122_0013396
2333 Ga0496122_0031795
2334 Ga0496122_0032728
2335 Ga0496122_0046656
2336 Ga0496122_0047999
2337 Ga0496122_0219559
2338 Ga0496123_0000001
2339 Ga0496123_0000158
2340 Ga0496123_0002010
2341 Ga0496123_0005487
2342 Ga0496123_0016492
2343 Ga0496123_0017583
2344 Ga0496123_0053756
2345 Ga0496124_0000743
2346 Ga0496124_0003963
2347 Ga0496124_0011436
2348 Ga0496124_0015389
2349 Ga0496124_0034825
2350 Ga0496124_0041399
2351 Ga0496124_0049494
2352 Ga0496124_0069924
2353 Ga0496124_0261566
2354 Ga0496125_0000695
2355 Ga0496125_0013510
2356 Ga0496125_0016113
2357 Ga0496125_0021027
2358 Ga0496125_0041633
2359 Ga0496125_0074229
2360 Ga0496125_0282926
2361 Ga0496126_0000195
2362 Ga0496126_0086852
2363 Ga0496126_0455450
2364 Ga0495678_011095
2365 Ga0495678_027883
2366 Ga0495678_077409
2367 Ga0501031_0000003
2368 Ga0501031_0123922
2369 Ga0501031_0169540
2370 Ga0501031_0217196
2371 Ga0501032_0000010
2372 Ga0501032_0000587
2373 Ga0501032_0012946
2374 Ga0501032_0028404
2375 Ga0501032_0049889
2376 Ga0501032_0068127
2377 Ga0501032_0081072
2378 Ga0501032_0097643
2379 Ga0501033_0000017
2380 Ga0501033_0000076
2381 Ga0501033_0000521
2382 Ga0501033_0003783
2383 Ga0501033_0005881
2384 Ga0501033_0011725
2385 Ga0501033_0016419
2386 Ga0501033_0141001
2387 Ga0501033_0223152
2388 Ga0501033_0236443
2389 Ga0501033_0244080
2390 Ga0501033_0396228
2391 Ga0501034_0000053
2392 Ga0501034_0000077
2393 Ga0501034_0001873
2394 Ga0501034_0008667
2395 Ga0501034_0009703
2396 Ga0501034_0050206
2397 Ga0501034_0058149
2398 Ga0501034_0087591
2399 Ga0501034_0136949
2400 Ga0501034_0148265
2401 Ga0501034_0166741
2402 Ga0501034_0224552
2403 Ga0501034_0353748
2404 Ga0501034_0386069
2405 Ga0501034_0423857
2406 Ga0501034_0479686
2407 Ga0501034_0562339
2408 Ga0501036_0000009
2409 Ga0501036_0002844
2410 Ga0501036_0028303
2411 Ga0501036_0030433
2412 Ga0501036_0036991
2413 Ga0501036_0084228
2414 Ga0501036_0109061
2415 Ga0501036_0146725
2416 Ga0501036_0164430
2417 Ga0501036_0165501
2418 Ga0501037_0000008
2419 Ga0501037_0000224
2420 Ga0501037_0000812
2421 Ga0501037_0002684
2422 Ga0501037_0019672
2423 Ga0501037_0062874
2424 Ga0501037_0129370
2425 Ga0501037_0189083
2426 Ga0501038_0000008
2427 Ga0501038_0000241
2428 Ga0501038_0109237
2429 Ga0501038_0131033
2430 Ga0501038_0154162
2431 Ga0501038_0277545
2432 Ga0501038_0442920
2433 Ga0501039_0000021
2434 Ga0501039_0000131
2435 Ga0501039_0000196
2436 Ga0501039_0319359
2437 Ga0501039_0342868
2438 Ga0501040_0003914
2439 Ga0501040_0074137
2440 Ga0501040_0271701
2441 Ga0501041_0087680
2442 Ga0501042_0011075
2443 Ga0501042_0304709
2444 Ga0501043_0000005
2445 Ga0501043_0000043
2446 Ga0501043_0000405
2447 Ga0501043_0010702
2448 Ga0501043_0210303
2449 Ga0501043_0372383
2450 Ga0501043_0379472
2451 Ga0501046_0001156
2452 Ga0501046_0026209
2453 Ga0501046_0038328
2454 Ga0501047_0000129
2455 Ga0501047_0000894
2456 Ga0501047_0005104
2457 Ga0501047_0020856
2458 Ga0501047_0030968
2459 Ga0501047_0046886
2460 Ga0501047_0049610
2461 Ga0501047_0052545
2462 Ga0501047_0056209
2463 Ga0501047_0087523
2464 Ga0501047_0212705
2465 Ga0501047_0481443
2466 Ga0501047_0686654
2467 Ga0501048_0000282
2468 Ga0501048_0004455
2469 Ga0501048_0020443
2470 Ga0501067_0000213
2471 Ga0501067_0001197
2472 Ga0501067_0028159
2473 Ga0501067_0036197
2474 Ga0501067_0042891
2475 Ga0501067_0045622
2476 Ga0501068_0005249
2477 Ga0501068_0027596
2478 Ga0501069_0000011
2479 Ga0501069_0025402
2480 Ga0501069_0055908
2481 Ga0501069_0076670
2482 Ga0501069_0159404
2483 Ga0501069_0196147
2484 Ga0501069_0367186
2485 Ga0501070_0000117
2486 Ga0501070_0001936
2487 Ga0501070_0004936
2488 Ga0501070_0005238
2489 Ga0501070_0006463
2490 Ga0501070_0107545
2491 Ga0501070_0120810
2492 Ga0501070_0136845
2493 Ga0501071_0005058
2494 Ga0501071_0238175
2495 Ga0501072_0386210
2496 Ga0501072_0503666
2497 Ga0501073_0011311
2498 Ga0501073_0015653
2499 Ga0501073_0027903
2500 Ga0501073_0067096
2501 Ga0501073_0073448
2502 Ga0501073_0096224
2503 Ga0501073_0100118
2504 Ga0501073_0146464
2505 Ga0501073_0176648
2506 Ga0501073_0197845
2507 Ga0501073_0256299
2508 Ga0501073_0425378
2509 Ga0501074_0002555
2510 Ga0501074_0016136
2511 Ga0501074_0033856
2512 Ga0501075_0171117
2513 Ga0501076_0008864
2514 Ga0501076_0070351
2515 Ga0501077_0043446
2516 Ga0501079_0337543
2517 Ga0501080_0000053
2518 Ga0501080_0005693
2519 Ga0501080_0014905
2520 Ga0501080_0018576
2521 Ga0501080_0050494
2522 Ga0501080_0065574
2523 Ga0501080_0071736
2524 Ga0501080_0077400
2525 Ga0501080_0455512
2526 Ga0501080_0525103
2527 Ga0501081_0003348
2528 Ga0501081_0262315
2529 Ga0501083_0000406
2530 Ga0501083_0017663
2531 Ga0501083_0090776
2532 Ga0501083_0181102
2533 Ga0501280_003795
2534 Ga0501035_0000010
2535 Ga0501035_0000023
2536 Ga0501035_0000107
2537 Ga0501035_0000449
2538 Ga0501035_0001177
2539 Ga0501035_0003419
2540 Ga0501035_0003519
2541 Ga0501035_0007710
2542 Ga0501035_0065014
2543 Ga0501035_0156239
2544 Ga0501035_0342862
2545 Ga0501035_0469443
2546 Ga0501044_0000006
2547 Ga0501044_0000021
2548 Ga0501044_0000154
2549 Ga0501044_0008423
2550 Ga0501044_0010150
2551 Ga0501044_0032199
2552 Ga0501044_0036530
2553 Ga0501044_0053659
2554 Ga0501044_0085982
2555 Ga0501044_0087274
2556 Ga0501044_0091619
2557 Ga0501044_0098638
2558 Ga0501044_0126201
2559 Ga0501044_0280465
2560 Ga0501045_0007088
2561 Ga0501045_0140475
2562 Ga0501045_0141357
2563 nmdc:mga03683_51889_c1
2564 nmdc:mga03683_91461_c1
2565 nmdc:mga03n38_3995_c1
2566 nmdc:mga00v17_132932_c1
2567 nmdc:mga00v17_211366_c1
2568 nmdc:mga00v17_3192_c1
2569 nmdc:mga00v17_72_c1
2570 nmdc:mga0yw44_166453_c1
2571 nmdc:mga0yw44_1917_c1
2572 nmdc:mga0yw44_96982_c1
2573 nmdc:mga0k408_37840_c1
2574 nmdc:mga0k408_68174_c1
2575 nmdc:mga0k408_82874_c1
2576 nmdc:mga06z11_11753_c1
2577 nmdc:mga06z11_260156_c1
2578 nmdc:mga06z11_52758_c1
2579 nmdc:mga06z11_62571_c1
2580 nmdc:mga06z11_91541_c1
2581 nmdc:mga04h51_11247_c1
2582 nmdc:mga04h51_56754_c1
2583 nmdc:mga07m45_123910_c1
2584 nmdc:mga07m45_50268_c1
2585 nmdc:mga0rr50_41028_c1
2586 nmdc:mga08x19_22_c1
2587 nmdc:mga0sz30_119851_c1
2588 nmdc:mga0sz30_13611_c1
2589 nmdc:mga0sz30_175615_c1
2590 nmdc:mga0sz30_26730_c1
2591 nmdc:mga0sz30_609_c1
2592 Ga0500610_0064816
2593 Ga0495619_0105390
2594 Ga0500578_0109792
2595 Ga0500651_0167214
2596 Ga0500556_0000033
2597 Ga0500560_018504
2598 Ga0500569_001278
2599 Ga0500569_021263
2600 Ga0500594_0002582
2601 Ga0500618_001151
2602 Ga0500642_0019133
2603 Ga0500658_0000230
2604 Ga0500658_0141410
2605 Ga0500561_0000123
2606 Ga0500568_0000205
2607 Ga0500568_0000924
2608 Ga0500568_0004782
2609 Ga0500568_0066844
2610 Ga0500573_0007042
2611 Ga0500604_0050123
2612 Ga0500616_0002449
2613 Ga0500616_0017030
2614 Ga0500616_0068987
2615 Ga0500616_0080810
2616 Ga0500620_029555
2617 Ga0500622_0001035
2618 Ga0500622_0132185
2619 Ga0500624_000320
2620 Ga0500627_0052506
2621 Ga0500627_0101530
2622 Ga0500633_0009280
2623 Ga0501084_0238511
2624 Ga0501084_0453913
2625 Ga0587072_023137
2626 Ga0501082_0048193
2627 Ga0530510_0239918
2628 Ga0530510_0558227
2629 2503200587
2630 2509107042
2631 2509116880
2632 2509141882
2633 2509373983
2634 2509375002
2635 2509388439
2636 2509395375
2637 2509443987
2638 2510131414
2639 2510305154
2640 2510316340
2641 2510897768
2642 2511184788
2643 2511196816
2644 2511389351
2645 2511500536
2646 2512531995
2647 2512928794
2648 2512963538
2649 2512972687
2650 2513570633
2651 2513580214
2652 2513584162
2653 2513591482
2654 2513596735
2655 2513602924
2656 2513612360
2657 2513620441
2658 2513634261
2659 2513713190
2660 2513864850
2661 2513880611
2662 2513903341
2663 2513910356
2664 2513928304
2665 2513986333
2666 2513996768
2667 2514005176
2668 2514020246
2669 2514038189
2670 2514422798
2671 2514590767
2672 2515110375
2673 2515607724
2674 2515634575
2675 2515643800
2676 2515657198
2677 2515743301
2678 2516204337
2679 2516891858
2680 2517039062
2681 2517079318
2682 2517093259
2683 2517409526
2684 2517568654
2685 2520375540
2686 2530647821
2687 2535485290
2688 2535515095
2689 2537872806
2690 2551679337
2691 2551686158
2692 2551692118
2693 2551699805
2694 2551710541
2695 2551712287
2696 2551723203
2697 2551729900
2698 2551733414
2699 2551743530
2700 2554246643
2701 2558866004
2702 2559293871
2703 2561466895
2704 2585165003
2705 2585203673
2706 2585227077
2707 2585233195
2708 2585255914
2709 2585269547
2710 2585385485
2711 2585391905
2712 2585398550
2713 2585529265
2714 2585539684
2715 2585550498
2716 2585819300
2717 2585837641
2718 2585844653
2719 2588514338
2720 2597811165
2721 2599333005
2722 2599419186
2723 2599605420
2724 2599719550
2725 2599940577
2726 2600191457
2727 2601609156
2728 2601745931
2729 2616297117
2730 2643770262
2731 2643778057
2732 2643796505
2733 2643806297
2734 2643840341
2735 2643921141
2736 2643989854
2737 2644001280
2738 2644007319
2739 2644047122
2740 2644070101
2741 2644086002
2742 2644103236
2743 2644132498
2744 2644151892
2745 2644153506
2746 2644190587
2747 2644203439
2748 2644206701
2749 2644241547
2750 2644306164
2751 2644330414
2752 2644345331
2753 2644369605
2754 2644381072
2755 2644414978
2756 2644448635
2757 2644479911
2758 2644492247
2759 2644496750
2760 2644519215
2761 2644542840
2762 2644618886
2763 2644650348
2764 2644674023
2765 2644689057
2766 2657681898
2767 2671694879
2768 2688597754
2769 2692317253
2770 2694629152
2771 2694636934
2772 2719179570
2773 2719384123
2774 2719663916
2775 2719730240
2776 2720490335
2777 2720611710
2778 2720618559
2779 2720629967
2780 2720773662
2781 2721145663
2782 2721157179
2783 2721162542
2784 2721397893
2785 2722838712
2786 2723025335
2787 2723558918
2788 2723565488
2789 2723578247
2790 2724036703
2791 2724042996
2792 2724088269
2793 2724102753
2794 2724108653
2795 2725948993
2796 2730106271
2797 2730162807
2798 2730296811
2799 2738801241
2800 2739037074
2801 2739309602
2802 2753358023
2803 2753461347
2804 2756676349
2805 2757569210
2806 2758638830
2807 2765464329
2808 2766066567
2809 2770194656
2810 2776272542
2811 2776284483
2812 2792582919
2813 2792623808
2814 2792629812
2815 2792638147
2816 2792750120
2817 2793283344
2818 2793295210
2819 2793316330
2820 2793323438
2821 2793326168
2822 2793334228
2823 2793341806
2824 2793348143
2825 2793357235
2826 2793361512
2827 2793364674
2828 2802720313
2829 2802726132
2830 2802731703
2831 2802739454
2832 2802742596
2833 2802749301
2834 2804750917
2835 2805929369
2836 2805932372
2837 2806047544
2838 2806054963
2839 2806062135
2840 2806067139
2841 2806076460
2842 2808986353
2843 2819556484
2844 2828307785
2845 2837651952
2846 2837683332
2847 2838020284
2848 2838028180
2849 2838037130
2850 2838044424
2851 2838051500
2852 2838063974
2853 2838071108
2854 2838075375
2855 2838663694
2856 2838672397
2857 2838677213
2858 2838680582
2859 2838691585
2860 2838695385
2861 2838703861
2862 2838708761
2863 2838716101
2864 2838720099
2865 2838726853
2866 2838733931
2867 2838747005
2868 2839994244
2869 2840769355
2870 2841735624
2871 2841847032
2872 2841856146
2873 2841860438
2874 2841866815
2875 2842080004
2876 2842120623
2877 2842126939
2878 2842132106
2879 2842148347
2880 2842152725
2881 2842161934
2882 2842169690
2883 2842172346
2884 2842176344
2885 2842185776
2886 2842189208
2887 2842192883
2888 2842205173
2889 2842206954
2890 2842213522
2891 2842218797
2892 2842224860
2893 2842235304
2894 2842238173
2895 2842248241
2896 2842253413
2897 2842262165
2898 2842268762
2899 2842276558
2900 2842280353
2901 2842286835
2902 2842293664
2903 2842306505
2904 2842312622
2905 2842322511
2906 2842343076
2907 2842367198
2908 2842371045
2909 2842380061
2910 2842387132
2911 2842399245
2912 2842403612
2913 2842410686
2914 2842417332
2915 2842424724
2916 2842433038
2917 2842439343
2918 2842445972
2919 2842451847
2920 2842467158
2921 2842473814
2922 2842492463
2923 2842500043
2924 2842517223
2925 2842521699
2926 2842873042
2927 2842923311
2928 2844004354
2929 2844009853
2930 2844170748
2931 2844455994
2932 2847417680
2933 2847672619
2934 2847691814
2935 2848992485
2936 2850079978
2937 2854916251
2938 2855831775
2939 2855840006
2940 2855874533
2941 2856315158
2942 2856328166
2943 2856329858
2944 2856338767
2945 2856346631
2946 2856367610
2947 2857353652
2948 2857371920
2949 2857523442
2950 2858803970
2951 2869166964
2952 2869172489
2953 2869235717
2954 2869244336
2955 2869256717
2956 2869258705
2957 2869266048
2958 2869276259
2959 2869284299
2960 2869286818
2961 2871434082
2962 2871451033
2963 2871454746
2964 2871462916
2965 2871474267
2966 2871475683
2967 2871483939
2968 2871490078
2969 2871501989
2970 2874107154
2971 2874111819
2972 2874118188
2973 2874126822
2974 2874132334
2975 2874139238
2976 2874147740
2977 2874156658
2978 2874163841
2979 2874170895
2980 2876369163
2981 2876378442
2982 2876386215
2983 2876393784
2984 2876401499
2985 2876414768
2986 2876421596
2987 2878041987
2988 2878736119
2989 2878740085
2990 2878746792
2991 2878753237
2992 2878765774
2993 2878772448
2994 2878775284
2995 2878781186
2996 2878791401
2997 2881158433
2998 2881164085
2999 2881847276
3000 2881867778
3001 2882634307
3002 2882912866
3003 2885308820
3004 2885319094
3005 2885332328
3006 2885335947
3007 2885349542
3008 2885354795
3009 2888342457
3010 2888346304
3011 2888351802
3012 2889013776
3013 2889021522
3014 2889795369
3015 2889916061
3016 2891093155
3017 2891374936
3018 2894655391
3019 2894819416
3020 2896391552
3021 2899792504
3022 2899847906
3023 2903449371
3024 2903497998
3025 2903500680
3026 2903515962
3027 2903526369
3028 2903529656
3029 2903546720
3030 2904579082
3031 2904660509
3032 2906309172
3033 2906326779
3034 2906328732
3035 2906357193
3036 2906365194
3037 2906372139
3038 2906393385
3039 2906394515
3040 2906406115
3041 2906412301
3042 2906415155
3043 2913297990
3044 2915652847
3045 2915980785
3046 2915992627
3047 2915999677
3048 2916001999
3049 2916011985
3050 2916016049
3051 2916022537
3052 2916033363
3053 2916038811
3054 2916042794
3055 2916050252
3056 2916057718
3057 2916063648
3058 2917555967
3059 2919101350
3060 2919116304
3061 2919122090
3062 2919454236
3063 2920763391
3064 2920823377
3065 2921207177
3066 2921245201
3067 2921257157
3068 2921260347
3069 2921266488
3070 2921287562
3071 2921291941
3072 2921299139
3073 2922136560
3074 2922157492
3075 2922160061
3076 2922174598
3077 2922183264
3078 2922189179
3079 2923557143
3080 2924146051
3081 2924154446
3082 2924163504
3083 2924165983
3084 2924174664
3085 2924180863
3086 2924191817
3087 2924194292
3088 2924202437
3089 2924209669
3090 2924218018
3091 2924224272
3092 2924232994
3093 2924722625
3094 2924728221
3095 2924738438
3096 2924747272
3097 2924754203
3098 2924757633
3099 2924765499
3100 2924777684
3101 2924791166
3102 2926757258
3103 2926761473
3104 2928521972
3105 2933007370
3106 2933012134
3107 2933017682
3108 2933573574
3109 2933593995
3110 2933594578
3111 2933601907
3112 2935895908
3113 2935907167
3114 2936368931
3115 2936378454
3116 2936383741
3117 2936999120
3118 2937005046
3119 2937011327
3120 2937018766
3121 2937023820
3122 2937034528
3123 2937041311
3124 2937049482
3125 2937053987
3126 2937060448
3127 2937070044
3128 2937071519
3129 2937078739
3130 2937086070
3131 2937103439
3132 2937110368
3133 2937114676
3134 2937122586
3135 2937128464
3136 2937813969
3137 2937828722
3138 2937837047
3139 2937845197
3140 2937850882
3141 2937863172
3142 2937874196
3143 2937883902
3144 2937892388
3145 2937976653
3146 2937981879
3147 2938000579
3148 2938015395
3149 2939672847
3150 2941500709
3151 2954014671
3152 2957382056
3153 2957383664
3154 2957394077
3155 2957399558
3156 2957403712
3157 2957411037
3158 2957421564
3159 2957426227
3160 2957435414
3161 2957439532
3162 2957447117
3163 2957457329
3164 2957464401
3165 2957466183
3166 2957471753
3167 2957480326
3168 2957489018
3169 2957494601
3170 2957499058
3171 2957508619
3172 2958038397
3173 2958056007
3174 2958056370
3175 2958066458
3176 2958075381
3177 2958091180
3178 2958098955
3179 2958102913
3180 2958114968
3181 2958121449
3182 2958125021
3183 2958131222
3184 2958143854
3185 2958151158
3186 2958163523
3187 2958170950
3188 2958174207
3189 2958180621
3190 2960585708
3191 2960594767
3192 2960599738
3193 2960605544
3194 2960616934
3195 2960621705
3196 2960629192
3197 2960637456
3198 2960644790
3199 2960647694
3200 2960657207
3201 2960660401
3202 2960668425
3203 2960675592
3204 2960686612
3205 2960690335
3206 2960698823
3207 2961078455
3208 2961120831
3209 2961137081
3210 2961169394
3211 2961177061
3212 2961184271
3213 2963650439
3214 2964609375
3215 2964619809
3216 2964622434
3217 2964634318
3218 2964636408
3219 2964646967
3220 2964650342
3221 2964659475
3222 2964665802
3223 2964674982
3224 2964680620
3225 2964691101
3226 2964693040
3227 2964704133
3228 2964707185
3229 2964718573
3230 2964719890
3231 2965023646
3232 2965031047
3233 2965035567
3234 2965040347
3235 2965050726
3236 2965067219
3237 2965093465
3238 2965115132
3239 2965121531
3240 2967669776
3241 2967678178
3242 2967684968
3243 2967691526
3244 2967695080
3245 2967700359
3246 2967712776
3247 2967714674
3248 2967730559
3249 2967736321
3250 2967747814
3251 2967751846
3252 2967761298
3253 2967762678
3254 2967771303
3255 2967776734
3256 2968002813
3257 2968005210
3258 2968021298
3259 2968085612
3260 2968095268
3261 2968101239
3262 2968111568
3263 2968120210
3264 2968128613
3265 2968177784
3266 2970023311
3267 2970030580
3268 2970034021
3269 2970045500
3270 2970052617
3271 2970057420
3272 2970063963
3273 2970071369
3274 2970080401
3275 2970087338
3276 2970095376
3277 2970101514
3278 2970103366
3279 2970116048
3280 2970121902
3281 2970126298
3282 2970131578
3283 2970143474
3284 2970148541
3285 2970153264
3286 2970159522
3287 2970167708
3288 2970177018
3289 2970181887
3290 2970188446
3291 2970196435
3292 2970476403
3293 2970491393
3294 2970509734
3295 2970516056
3296 2970527812
3297 2970532485
3298 2970541928
3299 2970554658
3300 2970560630
3301 2970598915
3302 2970620938
3303 2970628607
3304 2977517728
3305 2977529133
3306 2977535862
3307 2977539988
3308 2977549464
3309 2977552920
3310 2977559279
3311 2977567521
3312 2977573169
3313 2977580448
3314 2977822170
3315 2977835541
3316 2977846967
3317 2977854915
3318 2977859098
3319 2977865319
3320 2977879351
3321 2977913816
3322 2977923858
3323 2977937066
3324 2977945747
3325 2977979669
3326 2977989984
3327 2978973314
3328 2979093239
3329 2979099376
3330 2979105210
3331 2979710603
3332 2979764888
3333 2979774499
3334 2979780033
3335 2979797620
3336 2979814521
3337 2984512934
3338 2984520702
3339 2984539994
3340 2984591595
3341 2984602185
3342 2987642935
3343 2987645850
3344 2987654527
3345 2987665628
3346 2987671735
3347 2987680931
3348 2989351407
3349 2989772789
3350 2996312907
3351 2996337642
3352 2996346062
3353 2996356395
3354 2996393962
3355 2996892174
3356 2996893431
3357 3000142382
3358 3002142635
3359 3003931953
3360 3004172300
3361 3004194582
3362 3004197774
3363 3004210728
3364 3004213296
3365 3004221368
3366 3004236236
3367 3004271607
3368 3004282699
3369 3004294588
3370 3004338364
3371 3005411231
3372 3005446182
3373 3005452839
3374 637078492
3375 639646644
3376 643824539
3377 648739372
3378 649872297
3379 650739062
3380 8001848076
3381 8002288290
3382 8003572694
3383 8003992449
3384 8003999777
3385 8004307328
3386 8004320707
3387 8004374808
3388 8004388102
3389 8004403783
3390 8004447206
3391 8004639099
3392 8004644526
3393 8004697201
3394 8004713182
3395 8004715429
3396 8004729883
3397 8005263476
3398 8005278834
3399 8005289012
3400 8005291086
3401 8005301550
3402 8005309197
3403 8005326701
3404 8005377437
3405 8005387300
3406 8005400123
3407 8005432930
3408 8005461014
3409 8005498658
3410 8005543768
3411 8005560629
3412 8005563912
3413 8005576919
3414 8005619852
3415 8005628424
3416 8005670069
3417 8005690266
3418 8005699257
3419 8018133121
3420 8018153603
3421 8018169022
3422 8018179460
3423 8023684234
3424 8024480273
3425 8024491417
3426 8024501606
3427 8045866279
3428 8049293475
3429 8054559212
3430 8055619096
3431 8056375631
3432 8056385945
3433 8056879034
3434 8057876045

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

63

246

0.78

Map