F495462

General Info

Members Datasets Scaffolds Average Seq Length
1718 690 3436 94

Family's Representative Sequence

Representative Sequence 3300048919|Ga0496116_0003454|Ga0496116_0003454_11792_12112
Length 106
Sequence MSRASAYVKGGTHMGRSLKKGPFIDGYLLKKVEDLNETNKKVVIKTWSRRSTIFPQFIGHTFAVYDGRKHVPVYVTEDMVGHKLGEFAPTRTYKGHASDDKKTGRR

Samples

Sample ID Description Type Environment
1 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
6 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
7 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
8 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
9 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
10 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
11 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
12 3300003567 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_04_fullP_mix3_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
13 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
14 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
15 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
16 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
17 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
18 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
19 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
20 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
21 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
22 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
23 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
24 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
25 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
26 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
27 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
28 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
29 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
30 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
31 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
32 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
33 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
34 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
35 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
36 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
37 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
38 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
39 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
40 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
41 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
42 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
43 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
44 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
45 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
46 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
47 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
48 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
49 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
50 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
51 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
52 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
53 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
54 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
55 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
56 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
57 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
58 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
59 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
60 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
61 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
62 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
63 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
64 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
65 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
66 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
67 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
68 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
69 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
70 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
71 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
72 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
73 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
74 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
75 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
76 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
77 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
78 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
79 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
80 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
81 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
82 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
83 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
84 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
86 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
87 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
88 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
89 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
90 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
92 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
93 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
94 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
95 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
96 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
97 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
99 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
100 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
101 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
102 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
103 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
104 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
105 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
106 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
107 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
108 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
109 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
110 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
111 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
112 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
113 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
114 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
115 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
116 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
117 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
118 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
119 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
120 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
121 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
122 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
123 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
125 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
126 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
127 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
128 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
129 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
130 3300023309 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.ctcc.R1 Metatranscriptome Rhizosphere
131 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
135 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
137 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
138 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
139 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
140 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
142 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
143 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
208 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
212 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
213 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
214 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
218 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
219 3300029272 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B1.ctno.R1 Metatranscriptome Rhizosphere
220 3300029273 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B1.stno.R1 Metatranscriptome Rhizosphere
221 3300029280 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stcc.R1 Metatranscriptome Rhizosphere
222 3300029282 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B1.stcc.R1 Metatranscriptome Rhizosphere
223 3300029283 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.ctno.R1 Metatranscriptome Rhizosphere
224 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
225 3300030083 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 Metagenome Unclassified
226 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
227 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
228 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
229 3300030863 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
230 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
231 3300030880 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
232 3300030963 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
233 3300031018 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
234 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
235 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
236 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
237 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
238 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
239 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
240 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
241 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
242 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
243 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
244 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
245 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
246 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
247 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
248 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
249 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
250 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
251 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
252 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
253 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
254 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
255 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
256 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
257 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
258 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
259 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
260 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
261 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
262 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
263 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
264 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
265 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
266 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
267 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
268 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
269 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
270 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
271 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
272 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
273 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
274 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
275 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
276 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
277 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
278 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
279 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
280 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
281 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
282 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
283 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
284 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
285 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
286 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
287 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
288 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
289 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
290 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
291 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
292 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
293 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
294 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
295 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
296 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
297 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
298 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
299 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
300 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
301 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
302 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
303 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
304 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
305 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
306 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
307 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
308 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
309 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
310 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
311 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
312 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
313 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
314 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
315 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
316 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
317 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
318 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
319 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
320 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
321 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
322 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
323 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
324 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
325 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
326 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
327 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
328 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
329 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
330 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
331 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
332 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
333 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
334 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
335 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
336 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
337 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
338 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
339 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
340 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
341 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
342 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
343 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
344 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
345 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
346 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
347 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
348 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
349 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
350 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
351 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
352 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
353 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
354 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
355 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
356 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
357 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
358 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
359 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
360 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
361 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
362 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
363 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
364 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
365 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
366 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
367 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
368 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
369 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
370 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
371 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
372 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
373 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
374 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
375 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
376 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
377 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
378 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
379 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
380 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
381 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
382 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
383 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
384 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
385 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
386 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
387 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
388 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
389 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
390 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
391 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
392 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
393 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
394 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
395 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
396 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
397 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
398 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
399 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
400 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
401 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
402 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
403 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
404 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
405 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
406 3300049131 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
407 3300049132 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
408 3300049133 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
409 3300049134 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
410 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
411 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
412 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
413 3300049163 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
414 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
415 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
416 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
417 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
418 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
419 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
420 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
421 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
422 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
423 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
424 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
425 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
426 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
427 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
428 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
429 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
430 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
431 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
432 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
433 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
434 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
435 3300049542 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
436 3300049543 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
437 3300049544 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
438 3300049545 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
439 3300049546 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
440 3300049547 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
441 3300049548 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
442 3300049549 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
443 3300049550 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
444 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
445 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
446 3300049553 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
447 3300049554 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
448 3300049555 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
449 3300049556 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
450 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
451 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
452 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
453 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
454 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
455 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
456 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
457 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
458 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
459 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
460 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
461 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
462 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
463 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
464 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
465 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
466 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
467 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
468 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
469 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
470 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
471 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
472 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
473 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
474 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
475 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
476 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
477 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
478 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
479 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
480 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
481 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
482 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
483 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
484 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
485 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
486 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
487 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
488 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
489 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
490 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
491 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
492 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
493 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
494 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
495 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
496 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
497 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
498 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
499 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
500 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
501 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
502 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
503 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
504 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
505 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
506 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
507 3300060243 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 1R_CW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
508 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
509 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
510 2510917027 Brevibacillus sp. CF112 Isolate Rhizosphere
511 2511231119 Bacillus velezensis CAU B946 Isolate Rhizosphere
512 2512564039 Paenibacillus mucilaginosus 3016 Isolate Rhizosphere
513 2524023129 Paenibacillus pinihumi DSM 23905 Isolate Rhizosphere
514 2545555800 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
515 2548877040 Paenibacillus sonchi X19-5 Isolate Rhizosphere
516 2554235283 Bacillus safensis VK Isolate Rhizosphere
517 2554235469 Sporolactobacillus laevolacticus DSM 442 Isolate Rhizosphere
518 2563366752 Paenibacillus pini JCM 16418 Isolate Rhizosphere
519 2571042143 Paenibacillus graminis RSA19 Isolate Unclassified
520 2571042588 Paenibacillus zanthoxyli JH29 Isolate Unclassified
521 2576861424 Paenibacillus sabinae T27 Isolate Rhizosphere
522 2576861599 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
523 2579778775 Paenibacillus durus P3L-5 Isolate Unclassified
524 2585428059 Paenibacillus chondroitinus OK414 Isolate Rhizosphere
525 2593339131 Bacillus sp. UNCCL81 Isolate Unclassified
526 2593339198 Paenibacillus sp. UNCCL117 Isolate Unclassified
527 2600255286 Paenibacillus sp. NFR01 Isolate Rhizoplane
528 2619619294 Paenibacillus durus ATCC 35681 Isolate Unclassified
529 2630968484 Bacillus methylotrophicus KACC 13105 Isolate Rhizosphere
530 2643221543 Paenibacillus sp. Root52 Isolate Unclassified
531 2643221676 Paenibacillus sp. Root444D2 Isolate Unclassified
532 2643221729 Bacillus sp. Root11 Isolate Unclassified
533 2643221730 Bacillus sp. Root131 Isolate Unclassified
534 2643221731 Bacillus sp. Root147 Isolate Unclassified
535 2643221732 Bacillus sp. Root239 Isolate Unclassified
536 2643221735 Bacillus sp. Root920 Isolate Unclassified
537 2648501850 Bacillus amyloliquefaciens RHNK22 Isolate Rhizosphere
538 2671180330 Peribacillus simplex SH-B26 Isolate Unclassified
539 2671180694 Paenibacillus sp. A3 Isolate Unclassified
540 2671180844 Bacillus amyloliquefaciens Bs006 Isolate Unclassified
541 2684622632 Bacillus cereus 905 Isolate Unclassified
542 2684623153 Bacillus pumilus SH-B9 Isolate Unclassified
543 2687453109 Bacillus pumilus SH-B11 Isolate Unclassified
544 2695420354 Bacillus sp. Co1-6 Isolate Unclassified
545 2695420987 Bacillus thuringiensis KNU-07 Isolate Unclassified
546 2703719227 Bacillus mycoides GOE6 Isolate Rhizosphere
547 2711768088 Sporolactobacillus terrae DSM 11697 Isolate Rhizosphere
548 2716884898 Bacillus methylotrophicus FKM10 Isolate Rhizosphere
549 2718218445 Bacillus sp. B25(2016b) Isolate Rhizosphere
550 2721755693 Paenibacillus polymyxa YC0573 Isolate Rhizosphere
551 2728368933 Paenibacillus jilunlii DSM 23019 Isolate Rhizosphere
552 2728369359 Paenibacillus polymyxa YC0136 Isolate Rhizosphere
553 2738541295 Bacillus sp. OK085 Isolate Unclassified
554 2738541358 Bacillus sp. OV752 Isolate Unclassified
555 2738543006 Bacillus sp. OK077 Isolate Unclassified
556 2738543010 Bacillus sp. YR335 Isolate Unclassified
557 2738543017 Bacillus sp. OV186 Isolate Unclassified
558 2751185905 Paenibacillus kribbensis 6hRe76 Isolate Unclassified
559 2757320391 Bacillus sp. NFR08 Isolate Rhizoplane
560 2775507177 Bacillus sp. AFS055030 Isolate Unclassified
561 2775507192 Bacillus sp. AFS041924 Isolate Unclassified
562 2791355222 Paenibacillus oryzae 1DrF-4 Isolate Unclassified
563 2802428803 Paenibacillus peoriae NMA1017 Isolate Rhizosphere
564 2808606399 Bacillus sp. SJZ110 Isolate Rhizosphere
565 2811994870 Bacillus sp. JB4 Isolate Unclassified
566 2816332186 Peribacillus frigoritolerans 3612 Isolate Unclassified
567 2816332295 Bacillus paralicheniformis MDJK30 Isolate Rhizosphere
568 2818991441 Niallia circulans 3243 Isolate Rhizosphere
569 2818991443 Bacillus thuringiensis 1230 Isolate Unclassified
570 2818991459 Paenibacillus sp. 597 Isolate Unclassified
571 2818991465 Priestia megaterium 3291 Isolate Rhizosphere
572 2818991468 Bacillus safensis 3300 Isolate Rhizosphere
573 2821111986 Paenibacillus illinoisensis 582 Isolate Unclassified
574 2823526263 Bacillus altitudinis P-10 Isolate Unclassified
575 2842682962 Bacillus sp. R-72492 Isolate Unclassified
576 2842882022 Bacillus sp. R-71893 Isolate Unclassified
577 2849139964 Bacillus sp. R-71875 Isolate Unclassified
578 2857453340 Paenibacillus sp. R-74130 Isolate Unclassified
579 2857472729 Cohnella sp. R-74144 Isolate Unclassified
580 2857581216 Bacillus sp. R-71922 Isolate Unclassified
581 2857586860 Bacillus sp. R-71935 Isolate Unclassified
582 2857604169 Domibacillus sp. R-71921 Isolate Unclassified
583 2860837431 Bacillus sp. WR11 Isolate Unclassified
584 2864733723 Paenibacillus sp. JGP012 Isolate Rhizosphere
585 2864997549 Paenibacillus sp. R-72005 Isolate Unclassified
586 2865002811 Paenibacillus sp. R-74131 Isolate Unclassified
587 2877768649 Bacillus amyloliquefaciens Y14 Isolate Rhizosphere
588 2880169592 Bacillus velezensis T20E-257 Isolate Unclassified
589 2881636855 Paenibacillus sp. 7197 Isolate Rhizosphere
590 2881644220 Siminovitchia terrae LMG 29736 Isolate Rhizosphere
591 2885526491 Paenibacillus sp. LK1 Isolate Rhizosphere
592 2888578766 Paenibacillus lycopersici 12200R-189 Isolate Rhizosphere
593 2889042446 Paenibacillus sp. 37 Isolate Rhizosphere
594 2889049205 Paenibacillus rhizovicinus 14171R-81 Isolate Rhizosphere
595 2889276214 Paenibacillus sp. PvR133 Isolate Rhizosphere
596 2889295896 Paenibacillus sp. PvR098 Isolate Rhizosphere
597 2897109615 Bacillus amyloliquefaciens YP6 Isolate Unclassified
598 2904162308 Paenibacillus sp. AD87 Isolate Unclassified
599 2904490793 Paenibacillus sp. 1295 Isolate Rhizosphere
600 2904524088 Priestia megaterium 1428 Isolate Rhizosphere
601 2904560550 Bacillus velezensis 1780 Isolate Rhizosphere
602 2904595352 Paenibacillus sp. 1182 Isolate Unclassified
603 2904755435 Paenibacillus aceris KACC 19194 Isolate Rhizosphere
604 2907202186 Paenibacillus sp. HJL G12 Isolate Unclassified
605 2908665501 Bacillus pumilus 1391 Isolate Rhizosphere
606 2915606848 Brevibacillus sp. HD1.4A Isolate Rhizosphere
607 2919093281 Bacillus safensis 1383 Isolate Rhizosphere
608 2919143609 Priestia megaterium 1751 Isolate Rhizosphere
609 2919160200 Paenibacillus sp. 2003 Isolate Unclassified
610 2919414237 Neobacillus niacini 3240 Isolate Rhizosphere
611 2919425241 Bacillus sp. 3255 Isolate Rhizosphere
612 2919517244 Priestia aryabhattai 3820 Isolate Unclassified
613 2919720352 Priestia megaterium 4340 Isolate Unclassified
614 2919726948 Bacillus pumilus 4489 Isolate Unclassified
615 2925326138 Paenibacillus hemerocallicola KCTC 33185 Isolate Unclassified
616 2928093941 Priestia aryabhattai 1389 Isolate Rhizosphere
617 2929004312 Priestia megaterium 1104 Isolate Unclassified
618 2929206907 Paenibacillus sp. R-74146 Hybrid assembly Isolate Unclassified
619 2929233124 Bacillus sp. R-74298 Hybrid assembly Isolate Unclassified
620 2929297113 Heliophilum fasciatum MTM Isolate Rhizosphere
621 2931384279 Paenibacillus sp. DR312 Isolate Rhizosphere
622 2936340661 Gottfriedia acidiceleris 1-17 Isolate Rhizosphere
623 2936361878 Neobacillus endophyticus BRMEA1 Isolate Unclassified
624 2938649242 Paenibacillus helianthi P26E Isolate Rhizosphere
625 2938917290 Bacillus sp. CR71 Isolate Unclassified
626 2939679117 Paenibacillus sp. 4624 Isolate Rhizosphere
627 2939702853 Paenibacillus sp. PvR008 Isolate Rhizosphere
628 2945991243 Paenibacillus sp. B21a W2I17 Isolate Rhizosphere
629 2946053406 Paenibacillus sp. W4I10 Isolate Rhizosphere
630 2947426588 Bacillus sp. RZ2MS9 Isolate Rhizosphere
631 2954773129 Bacillus sp. TBS-096 Isolate Rhizosphere
632 2956897341 Ectobacillus funiculus W18-2 Isolate Rhizosphere
633 2960319331 Priestia megaterium AFS057444 Isolate Unclassified
634 2960375949 Priestia megaterium AFS067084 Isolate Unclassified
635 2962290636 Bacillus subtilis TLO3 Isolate Rhizosphere
636 2965761152 Bacillus sp. COPE52 Isolate Unclassified
637 2968558590 Paenibacillus sp. P3E Isolate Rhizosphere
638 2969136845 Bacillus subtilis TLO3 Isolate Rhizosphere
639 2969141011 Bacillus velezensis MH25 Isolate Unclassified
640 2969765954 Bacillus intestinalis GM2 Isolate Rhizosphere
641 2969770375 Bacillus subtilis GM5 Isolate Rhizosphere
642 2971403814 Paenibacillus tritici LMG 29502 Isolate Unclassified
643 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
644 2971511577 Paenibacillus apii 7124 Isolate Rhizosphere
645 2971893375 Bacillus sp. HNA3 Isolate Rhizosphere
646 2977254563 Bacillus sp. SORGH_AS 510 Isolate Unclassified
647 2979083700 Bacillus toyonensis SORGH_AS 407 Isolate Unclassified
648 2980125574 Paenibacillus sp. tmac-D7 Isolate Unclassified
649 2980176882 Paenibacillus apii 7028 Isolate Rhizosphere
650 2980182181 Paenibacillus cymbidii R196 Isolate Unclassified
651 2980492589 Bacillus subtilis GQJK2 Isolate Rhizosphere
652 2981284811 Paenibacillus sp. PvR052 Isolate Rhizosphere
653 2981289755 Paenibacillus sp. PvR148 Isolate Rhizosphere
654 2981980479 Paenibacillus sp. PvR018 Isolate Rhizosphere
655 2981985349 Paenibacillus sp. PvR053 Isolate Rhizosphere
656 2984527788 Paenibacillus sp. SORGH_AS306 Isolate Aerial Root
657 2984532647 Paenibacillus sp. SORGH_AS338 Isolate Aerial Root
658 2988225383 Paenibacillus sp. P46E Isolate Rhizosphere
659 2990275345 Bacillus sp. SLBN-46 Isolate Unclassified
660 2996632988 Paenibacillus sp. P32E Isolate Rhizosphere
661 2996706504 Paenibacillus sp. OT2-17 Isolate Rhizosphere
662 3001267043 Bacillus sp. FJAT-49870 Isolate Rhizosphere
663 3001272096 Lederbergia citrisecunda FJAT-49732 Isolate Rhizosphere
664 3001892409 Neobacillus rhizophilus FJAT-49825 Isolate Rhizosphere
665 3006858327 Bacillus paralicheniformis SUBG0010 Isolate Unclassified
666 3006879489 Bacillus atrophaeus UCMB-5137 Isolate Rhizosphere
667 3006978542 Bacillus sp. FJAT-49705 Isolate Rhizosphere
668 648028048 Paenibacillus polymyxa E681 Isolate Rhizosphere
669 8002317523 Cohnella sp. GbtcB17 Isolate Unclassified
670 8022621104 Bacillus sp. PIC28 Isolate Rhizosphere
671 8022630665 Bacillus sp. PW192 Isolate Rhizosphere
672 8022653035 Bacillus sp. Rc4 Isolate Unclassified
673 8022792930 Bacillus sp. Xin Isolate Rhizosphere
674 8022893055 Bacillus aryabhattai AFS007213 Isolate Unclassified
675 8022914991 Bacillus aryabhattai SQU-R12 Isolate Unclassified
676 8023438354 Bacillus sp. BH2 Isolate Unclassified
677 8023444577 Bacillus sp. BH32 Isolate Unclassified
678 8046991243 Cohnella rhizosphaerae DSM 28161 Isolate Rhizosphere
679 8051952484 Bacillus amyloliquefaciens K2 Isolate Rhizosphere
680 8052174270 Bacillus velezensis CH13 Isolate Rhizosphere
681 8054280661 Metabacillus kandeliae GX 13764 Isolate Rhizosphere
682 8054465665 Paenibacillus sonchi IIRRBNF1 Isolate Rhizosphere
683 8054795415 Paenibacillus periandrae PM10 Isolate Nodule
684 8055632911 Paenibacillus radicibacter N1-5-1-14 Isolate Unclassified
685 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified
686 8057473075 Paenibacillus endoradicis T3-5-0-4 Isolate Unclassified
687 8057582654 Bacillus arachidis YX15 Isolate Rhizosphere
688 8057632132 Cytobacillus kochii RZ2 Isolate Rhizosphere
689 8057733483 Paenibacillus apiarius MW-14 Isolate Rhizosphere
690 8057977335 Paenibacillus oenotherae DT7-4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 60.71
Metatranscriptomes 28.75
Isolates 10.54

Biome Distribution

Category Percentage (%)
Aerial Root 0.12
Bulb 0
Endosphere 3.38
Nodule 0.06
Rhizoplane 4.25
Rhizosphere 82.71
Stem 0
Stem Tuber 0
Unclassified 0.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496116_0003454 3300048919 Bacteria 15588
2 SwRhRL2b_contig_213193 2162886007 Bacteria 929
3 JGI24736J21556_1046494 3300001904 Bacteria 667
4 JGI24740J21852_10082807 3300001979 Bacteria 838
5 JGI24743J22301_10016305 3300001991 Bacteria 1385
6 JGI24033J26618_1020881 3300002155 Bacteria 838
7 JGI25151J46595_10000678 3300003187 Bacteria 28776
8 JGI25151J46595_10000735 3300003187 Bacteria 26974
9 JGI25151J46595_10009543 3300003187 Bacteria 4581
10 JGI25151J46595_10009794 3300003187 Bacteria 4511
11 JGI25151J46595_10012392 3300003187 Bacteria 3882
12 JGI25151J46595_10136169 3300003187 Bacteria 605
13 JGI25165J46597_1016815 3300003214 Bacteria 979
14 rootH1_10000848 3300003316 Bacteria 58943
15 rootH2_10053907 3300003320 Bacteria 2237
16 rootL2_10000406 3300003322 Bacteria 26536
17 rootL2_10015753 3300003322 Bacteria 1798
18 Ga0006554J51385_1033852 3300003567 Bacteria 1337
19 Ga0006562J51391_1000046 3300003578 Bacteria 48312
20 Ga0006562J51391_1000361 3300003578 Bacteria 31803
21 Ga0006562J51391_1000677 3300003578 Bacteria 45519
22 Ga0006562J51391_1015323 3300003578 Bacteria 6111
23 Ga0055538_1000286 3300003751 Bacteria 25743
24 Ga0055532_1000266 3300003758 Bacteria 34080
25 Ga0055532_1003438 3300003758 Bacteria 2711
26 Ga0055532_1028664 3300003758 Bacteria 529
27 Ga0055535_1000913 3300003761 Bacteria 19960
28 Ga0055536_1032063 3300003781 Bacteria 1365
29 Ga0055528_1000586 3300003790 Bacteria 27486
30 Ga0055541_1000319 3300003841 Bacteria 15656
31 Ga0055541_1001260 3300003841 Bacteria 5586
32 Ga0055541_1001864 3300003841 Bacteria 4395
33 Ga0055541_1024461 3300003841 Bacteria 663
34 Ga0058692_1040989 3300003856 Bacteria 812
35 Ga0058863_10038888 3300004799 Bacteria 4963
36 Ga0058863_11363707 3300004799 Bacteria 986
37 Ga0058863_11799934 3300004799 Bacteria 550
38 Ga0058861_11402842 3300004800 Bacteria 865
39 Ga0058861_12067592 3300004800 Bacteria 1532
40 Ga0058862_12871386 3300004803 Bacteria 1374
41 Ga0065165_1062104 3300005262 Bacteria 1020
42 Ga0065704_10156589 3300005289 Bacteria 1386
43 Ga0070658_10010767 3300005327 Bacteria 7331
44 Ga0070658_10028665 3300005327 Bacteria 4471
45 Ga0070658_10113875 3300005327 Bacteria 2242
46 Ga0070658_10530949 3300005327 Bacteria 1018
47 Ga0070676_10003937 3300005328 Bacteria 7793
48 Ga0070676_10038362 3300005328 Bacteria 2767
49 Ga0070683_100007295 3300005329 Bacteria 9327
50 Ga0070683_100055839 3300005329 Bacteria 3665
51 Ga0070683_100218692 3300005329 Bacteria 1810
52 Ga0070683_100292648 3300005329 Bacteria 1549
53 Ga0070683_100671922 3300005329 Bacteria 992
54 Ga0070683_101593584 3300005329 Bacteria 628
55 Ga0070670_100003586 3300005331 Bacteria 12920
56 Ga0070670_100005012 3300005331 Bacteria 11141
57 Ga0070670_100076604 3300005331 Bacteria 2874
58 Ga0068869_100012179 3300005334 Bacteria 5673
59 Ga0068869_100035406 3300005334 Bacteria 3537
60 Ga0070666_10026243 3300005335 Bacteria 3803
61 Ga0070666_10030632 3300005335 Bacteria 3546
62 Ga0070666_10433297 3300005335 Bacteria 948
63 Ga0070680_100002604 3300005336 Bacteria 13361
64 Ga0070680_100137049 3300005336 Bacteria 2051
65 Ga0070680_100185617 3300005336 Bacteria 1752
66 Ga0070680_100315371 3300005336 Bacteria 1327
67 Ga0070680_101874588 3300005336 Bacteria 520
68 Ga0070682_100139157 3300005337 Bacteria 1652
69 Ga0070682_101285441 3300005337 Bacteria 621
70 Ga0068868_100001679 3300005338 Bacteria 15136
71 Ga0068868_100015707 3300005338 Bacteria 5608
72 Ga0068868_100038932 3300005338 Bacteria 3691
73 Ga0070660_100486432 3300005339 Bacteria 1026
74 Ga0070660_100619230 3300005339 Bacteria 906
75 Ga0070660_100790164 3300005339 Bacteria 798
76 Ga0070691_10991025 3300005341 Bacteria 524
77 Ga0070661_100025903 3300005344 Bacteria 4215
78 Ga0070661_100107733 3300005344 Bacteria 2078
79 Ga0070661_100438434 3300005344 Bacteria 1038
80 Ga0070668_100741717 3300005347 Bacteria 869
81 Ga0070668_101017090 3300005347 Bacteria 745
82 Ga0070669_100014591 3300005353 Bacteria 5591
83 Ga0070669_100298492 3300005353 Bacteria 1295
84 Ga0070675_100012859 3300005354 Bacteria 6567
85 Ga0070675_100035195 3300005354 Bacteria 4068
86 Ga0070675_101599526 3300005354 Bacteria 601
87 Ga0070671_100003263 3300005355 Bacteria 12656
88 Ga0070671_100014943 3300005355 Bacteria 6271
89 Ga0070671_100191065 3300005355 Bacteria 1735
90 Ga0070673_100013868 3300005364 Bacteria 5594
91 Ga0070659_100094581 3300005366 Bacteria 2400
92 Ga0070659_100762408 3300005366 Bacteria 840
93 Ga0070659_102027902 3300005366 Bacteria 517
94 Ga0070667_100001517 3300005367 Bacteria 20776
95 Ga0070667_100027341 3300005367 Bacteria 4745
96 Ga0070709_10947728 3300005434 Bacteria 683
97 Ga0070709_11124461 3300005434 Bacteria 629
98 Ga0070709_11366420 3300005434 Bacteria 573
99 Ga0070709_11453456 3300005434 Bacteria 556
100 Ga0070714_100418659 3300005435 Bacteria 1269
101 Ga0070714_101925157 3300005435 Bacteria 577
102 Ga0070713_100069410 3300005436 Bacteria 2972
103 Ga0070713_100113217 3300005436 Bacteria 2368
104 Ga0070713_100622588 3300005436 Bacteria 1026
105 Ga0070710_10463050 3300005437 Bacteria 861
106 Ga0070710_10670491 3300005437 Bacteria 729
107 Ga0070711_100115645 3300005439 Bacteria 1975
108 Ga0070711_100479857 3300005439 Bacteria 1022
109 Ga0070708_100327370 3300005445 Bacteria 1443
110 Ga0070663_100443489 3300005455 Bacteria 1069
111 Ga0070663_101619885 3300005455 Bacteria 577
112 Ga0070663_102002259 3300005455 Bacteria 521
113 Ga0070678_100033078 3300005456 Bacteria 3586
114 Ga0070681_10001062 3300005458 Bacteria 23407
115 Ga0070681_10113171 3300005458 Bacteria 2653
116 Ga0070681_10289580 3300005458 Bacteria 1548
117 Ga0070681_10646948 3300005458 Bacteria 972
118 Ga0070681_11010173 3300005458 Bacteria 752
119 Ga0068867_100145111 3300005459 Bacteria 1859
120 Ga0070706_100200060 3300005467 Bacteria 1866
121 Ga0070707_100147928 3300005468 Bacteria 2286
122 Ga0070698_100384297 3300005471 Bacteria 1336
123 Ga0070699_100237826 3300005518 Bacteria 1625
124 Ga0070679_100060017 3300005530 Bacteria 3790
125 Ga0070679_100066127 3300005530 Bacteria 3603
126 Ga0070679_100067206 3300005530 Bacteria 3574
127 Ga0070679_100294226 3300005530 Bacteria 1575
128 Ga0070679_101671013 3300005530 Bacteria 585
129 Ga0070684_100043376 3300005535 Bacteria 3883
130 Ga0070684_100082885 3300005535 Bacteria 2841
131 Ga0070684_100495127 3300005535 Bacteria 1132
132 Ga0070684_100937542 3300005535 Bacteria 812
133 Ga0070684_100960489 3300005535 Bacteria 801
134 Ga0070697_100310175 3300005536 Bacteria 1357
135 Ga0068853_100001096 3300005539 Bacteria 19171
136 Ga0068853_100133809 3300005539 Bacteria 2221
137 Ga0068853_100142757 3300005539 Bacteria 2150
138 Ga0068853_100364943 3300005539 Bacteria 1346
139 Ga0068853_100983581 3300005539 Bacteria 812
140 Ga0070672_100168746 3300005543 Bacteria 1819
141 Ga0070672_100223348 3300005543 Bacteria 1580
142 Ga0070665_100015044 3300005548 Bacteria 7766
143 Ga0070665_100065929 3300005548 Bacteria 3632
144 Ga0070665_100092190 3300005548 Bacteria 3034
145 Ga0070704_101856817 3300005549 Bacteria 558
146 Ga0068855_100000642 3300005563 Bacteria 42759
147 Ga0068855_100005786 3300005563 Bacteria 15090
148 Ga0068855_100019267 3300005563 Bacteria 8202
149 Ga0068855_100077022 3300005563 Bacteria 3869
150 Ga0068855_100146849 3300005563 Bacteria 2684
151 Ga0068855_100433886 3300005563 Bacteria 1436
152 Ga0068855_100540482 3300005563 Bacteria 1262
153 Ga0070664_100070029 3300005564 Bacteria 3003
154 Ga0070664_100769851 3300005564 Bacteria 899
155 Ga0068857_100024212 3300005577 Bacteria 5343
156 Ga0068857_100154377 3300005577 Bacteria 2081
157 Ga0068857_100237069 3300005577 Bacteria 1669
158 Ga0068857_100519894 3300005577 Bacteria 1118
159 Ga0068854_100081038 3300005578 Bacteria 2396
160 Ga0068854_100311965 3300005578 Bacteria 1276
161 Ga0068854_100902952 3300005578 Bacteria 776
162 Ga0068856_100010942 3300005614 Bacteria 8804
163 Ga0068856_100018870 3300005614 Bacteria 6688
164 Ga0068856_100104028 3300005614 Bacteria 2832
165 Ga0068856_100511850 3300005614 Bacteria 1221
166 Ga0068856_100805980 3300005614 Bacteria 959
167 Ga0068856_101150623 3300005614 Bacteria 793
168 Ga0068856_101505192 3300005614 Bacteria 687
169 Ga0068856_101591523 3300005614 Bacteria 667
170 Ga0068852_100024674 3300005616 Bacteria 4863
171 Ga0068852_100054705 3300005616 Bacteria 3441
172 Ga0068852_100220948 3300005616 Bacteria 1802
173 Ga0068852_100315455 3300005616 Bacteria 1517
174 Ga0068852_100355062 3300005616 Bacteria 1432
175 Ga0068852_100674498 3300005616 Bacteria 1043
176 Ga0068852_100845663 3300005616 Bacteria 930
177 Ga0068852_100869877 3300005616 Bacteria 917
178 Ga0068859_100022836 3300005617 Bacteria 6272
179 Ga0068864_100005797 3300005618 Bacteria 10134
180 Ga0068864_100071645 3300005618 Bacteria 3019
181 Ga0068851_10018984 3300005834 Bacteria 3320
182 Ga0068851_10034554 3300005834 Bacteria 2524
183 Ga0068851_10375856 3300005834 Bacteria 832
184 Ga0068851_10381747 3300005834 Bacteria 826
185 Ga0068851_10729687 3300005834 Bacteria 611
186 Ga0068870_10034626 3300005840 Bacteria 2585
187 Ga0068863_100005496 3300005841 Bacteria 12472
188 Ga0068858_100047133 3300005842 Bacteria 3996
189 Ga0068858_100057329 3300005842 Bacteria 3600
190 Ga0068860_100000786 3300005843 Bacteria 35473
191 Ga0068860_100545493 3300005843 Bacteria 1161
192 Ga0068862_100808179 3300005844 Bacteria 916
193 Ga0068862_101712281 3300005844 Bacteria 637
194 Ga0070717_10045133 3300006028 Bacteria 3602
195 Ga0070717_10275992 3300006028 Bacteria 1490
196 Ga0070717_12045167 3300006028 Bacteria 516
197 Ga0070715_10360263 3300006163 Bacteria 797
198 Ga0070712_100369334 3300006175 Bacteria 1178
199 Ga0070712_100369860 3300006175 Bacteria 1178
200 Ga0070712_101438966 3300006175 Bacteria 602
201 Ga0070712_101537332 3300006175 Bacteria 582
202 Ga0075367_10998897 3300006178 Bacteria 534
203 Ga0097621_100005101 3300006237 Bacteria 9222
204 Ga0097621_100109961 3300006237 Bacteria 2328
205 Ga0075370_10747646 3300006353 Bacteria 595
206 Ga0068871_100004090 3300006358 Bacteria 10086
207 Ga0068871_100018858 3300006358 Bacteria 5256
208 Ga0075430_101041394 3300006846 Bacteria 674
209 Ga0075429_100640588 3300006880 Bacteria 931
210 Ga0068865_100390365 3300006881 Bacteria 1138
211 Ga0097620_100022837 3300006931 Bacteria 6272
212 Ga0105251_10002306 3300009011 Bacteria 15129
213 Ga0105251_10077887 3300009011 Bacteria 1536
214 Ga0105251_10241236 3300009011 Bacteria 814
215 Ga0105244_10012810 3300009036 Bacteria 4942
216 Ga0105244_10041217 3300009036 Bacteria 2393
217 Ga0105244_10062257 3300009036 Bacteria 1876
218 Ga0105244_10445696 3300009036 Bacteria 595
219 Ga0105244_10527490 3300009036 Bacteria 544
220 Ga0105250_10059344 3300009092 Bacteria 1536
221 Ga0105240_10020515 3300009093 Bacteria 8810
222 Ga0105240_10023114 3300009093 Bacteria 8231
223 Ga0105240_10032555 3300009093 Bacteria 6750
224 Ga0105240_10050651 3300009093 Bacteria 5233
225 Ga0105240_10057620 3300009093 Bacteria 4852
226 Ga0105240_10257917 3300009093 Bacteria 2013
227 Ga0105240_10293798 3300009093 Bacteria 1861
228 Ga0105240_10907968 3300009093 Bacteria 947
229 Ga0105240_12347450 3300009093 Bacteria 552
230 Ga0105240_12536730 3300009093 Bacteria 530
231 Ga0105245_10000731 3300009098 Bacteria 29612
232 Ga0105245_10007135 3300009098 Bacteria 9802
233 Ga0105245_10191213 3300009098 Bacteria 1960
234 Ga0105245_10244214 3300009098 Bacteria 1742
235 Ga0105245_11387320 3300009098 Bacteria 752
236 Ga0105247_10000354 3300009101 Bacteria 39709
237 Ga0105247_10054318 3300009101 Bacteria 2472
238 Ga0105247_10303362 3300009101 Bacteria 1109
239 Ga0105247_10955169 3300009101 Bacteria 666
240 Ga0114129_12927940 3300009147 Bacteria 564
241 Ga0114129_13214632 3300009147 Bacteria 531
242 Ga0105243_10000301 3300009148 Bacteria 54622
243 Ga0105243_11045142 3300009148 Bacteria 822
244 Ga0105241_10003327 3300009174 Bacteria 11961
245 Ga0105241_10019071 3300009174 Bacteria 5058
246 Ga0105241_10046891 3300009174 Bacteria 3283
247 Ga0105241_10283985 3300009174 Bacteria 1415
248 Ga0105242_10003155 3300009176 Bacteria 12872
249 Ga0105242_11651624 3300009176 Bacteria 676
250 Ga0105248_10002627 3300009177 Bacteria 19981
251 Ga0105248_10006787 3300009177 Bacteria 12550
252 Ga0105248_10740796 3300009177 Bacteria 1109
253 Ga0105248_12095466 3300009177 Bacteria 643
254 Ga0105248_12344769 3300009177 Bacteria 608
255 Ga0105237_10036030 3300009545 Bacteria 5005
256 Ga0105237_10036694 3300009545 Bacteria 4960
257 Ga0105237_10184786 3300009545 Bacteria 2085
258 Ga0105237_10388491 3300009545 Bacteria 1400
259 Ga0105237_10949913 3300009545 Bacteria 866
260 Ga0105237_11496270 3300009545 Bacteria 682
261 Ga0105238_10010551 3300009551 Bacteria 9278
262 Ga0105238_10031377 3300009551 Bacteria 5409
263 Ga0105238_10196265 3300009551 Bacteria 1994
264 Ga0105238_10230359 3300009551 Bacteria 1829
265 Ga0105238_10494404 3300009551 Bacteria 1223
266 Ga0105238_11386598 3300009551 Bacteria 730
267 Ga0105238_11461412 3300009551 Bacteria 712
268 Ga0105238_11929273 3300009551 Bacteria 624
269 Ga0105249_10087450 3300009553 Bacteria 2908
270 Ga0105249_10267104 3300009553 Bacteria 1703
271 Ga0105239_10009258 3300010375 Bacteria 11132
272 Ga0105239_10014845 3300010375 Bacteria 8637
273 Ga0105239_10018959 3300010375 Bacteria 7604
274 Ga0105239_10428367 3300010375 Bacteria 1499
275 Ga0105239_10770450 3300010375 Bacteria 1102
276 Ga0105239_11111053 3300010375 Bacteria 910
277 Ga0105239_11447239 3300010375 Bacteria 794
278 Ga0105246_10000077 3300011119 Bacteria 41151
279 Ga0105246_10004133 3300011119 Bacteria 8810
280 Ga0105246_10025174 3300011119 Bacteria 3878
281 Ga0105246_10082771 3300011119 Bacteria 2291
282 Ga0157373_10107156 3300013100 Bacteria 1965
283 Ga0157373_10272511 3300013100 Bacteria 1198
284 Ga0157373_10709039 3300013100 Bacteria 738
285 Ga0157371_10156861 3300013102 Bacteria 1625
286 Ga0157371_10252764 3300013102 Bacteria 1269
287 Ga0157371_10626220 3300013102 Bacteria 802
288 Ga0157370_10001390 3300013104 Bacteria 29988
289 Ga0157370_10006622 3300013104 Bacteria 12731
290 Ga0157370_10127454 3300013104 Bacteria 2376
291 Ga0157370_10526723 3300013104 Bacteria 1084
292 Ga0157370_10642220 3300013104 Bacteria 970
293 Ga0157370_10864940 3300013104 Bacteria 821
294 Ga0157369_10004351 3300013105 Bacteria 16713
295 Ga0157369_10008438 3300013105 Bacteria 11818
296 Ga0157369_10013194 3300013105 Bacteria 9351
297 Ga0157369_10069033 3300013105 Bacteria 3797
298 Ga0157369_10234339 3300013105 Bacteria 1919
299 Ga0157369_10257505 3300013105 Bacteria 1820
300 Ga0157369_10549164 3300013105 Bacteria 1194
301 Ga0157369_10696510 3300013105 Bacteria 1046
302 Ga0157369_11186870 3300013105 Bacteria 779
303 Ga0157369_11625291 3300013105 Bacteria 657
304 Ga0157369_11925178 3300013105 Bacteria 600
305 Ga0157374_10002988 3300013296 Bacteria 14155
306 Ga0157374_10010090 3300013296 Bacteria 8111
307 Ga0157374_10043454 3300013296 Bacteria 4152
308 Ga0157374_10045280 3300013296 Bacteria 4072
309 Ga0157374_10070986 3300013296 Bacteria 3283
310 Ga0157374_10267053 3300013296 Bacteria 1687
311 Ga0157374_10636731 3300013296 Bacteria 1078
312 Ga0157374_10656450 3300013296 Bacteria 1061
313 Ga0157378_10000237 3300013297 Bacteria 53846
314 Ga0157378_10019987 3300013297 Bacteria 5888
315 Ga0157378_10020240 3300013297 Bacteria 5853
316 Ga0157378_10030845 3300013297 Bacteria 4733
317 Ga0157378_10039530 3300013297 Bacteria 4184
318 Ga0163162_10031415 3300013306 Bacteria 5268
319 Ga0163162_10120074 3300013306 Bacteria 2732
320 Ga0163162_13486915 3300013306 Bacteria 500
321 Ga0157372_10000424 3300013307 Bacteria 46469
322 Ga0157372_10065708 3300013307 Bacteria 4074
323 Ga0157372_10092295 3300013307 Bacteria 3444
324 Ga0157372_10128758 3300013307 Bacteria 2911
325 Ga0157372_10130936 3300013307 Bacteria 2886
326 Ga0157372_10313368 3300013307 Bacteria 1826
327 Ga0157372_10528821 3300013307 Bacteria 1375
328 Ga0157372_10593241 3300013307 Bacteria 1291
329 Ga0157372_11394363 3300013307 Bacteria 808
330 Ga0157372_11485178 3300013307 Bacteria 781
331 Ga0157372_12288291 3300013307 Bacteria 621
332 Ga0157375_10024173 3300013308 Bacteria 5620
333 Ga0157375_10083448 3300013308 Bacteria 3240
334 Ga0157375_10084569 3300013308 Bacteria 3222
335 Ga0163163_10008178 3300014325 Bacteria 9278
336 Ga0163163_10101857 3300014325 Bacteria 2894
337 Ga0182008_10050838 3300014497 Bacteria 2057
338 Ga0157377_10000299 3300014745 Bacteria 23241
339 Ga0157379_10007463 3300014968 Bacteria 9468
340 Ga0157379_10072913 3300014968 Bacteria 3073
341 Ga0157379_10339244 3300014968 Bacteria 1374
342 Ga0157379_11775534 3300014968 Bacteria 606
343 Ga0157376_10001057 3300014969 Bacteria 18039
344 Ga0157376_10004748 3300014969 Bacteria 9455
345 Ga0157376_10027401 3300014969 Bacteria 4516
346 Ga0157376_10584539 3300014969 Bacteria 1109
347 Ga0157376_10598071 3300014969 Bacteria 1097
348 Ga0163161_10831402 3300017792 Bacteria 778
349 Ga0197907_10927678 3300020069 Bacteria 535
350 Ga0197907_11334415 3300020069 Bacteria 645
351 Ga0206356_10096944 3300020070 Bacteria 588
352 Ga0206351_10499662 3300020077 Bacteria 628
353 Ga0206352_10848511 3300020078 Bacteria 904
354 Ga0206352_11344399 3300020078 Bacteria 960
355 Ga0206350_10067152 3300020080 Bacteria 592
356 Ga0206350_11376406 3300020080 Bacteria 731
357 Ga0206353_10888394 3300020082 Bacteria 791
358 Ga0206353_11437168 3300020082 Bacteria 1491
359 Ga0206353_11689256 3300020082 Bacteria 1860
360 Ga0213876_10401832 3300021384 Bacteria 729
361 Ga0224712_10009206 3300022467 Bacteria 2964
362 Ga0224712_10042705 3300022467 Bacteria 1720
363 Ga0224712_10463267 3300022467 Bacteria 610
364 Ga0256744_107106 3300023309 Bacteria 749
365 Ga0209784_100141 3300025224 Bacteria 67045
366 Ga0209784_104860 3300025224 Bacteria 901
367 Ga0209566_100221 3300025225 Bacteria 56770
368 Ga0209566_100273 3300025225 Bacteria 48159
369 Ga0209566_100512 3300025225 Bacteria 26820
370 Ga0209566_103758 3300025225 Bacteria 2221
371 Ga0209147_100198 3300025229 Bacteria 67714
372 Ga0209147_100385 3300025229 Bacteria 30752
373 Ga0209147_101980 3300025229 Bacteria 5977
374 Ga0209147_107627 3300025229 Bacteria 1395
375 Ga0209437_100331 3300025233 Bacteria 58796
376 Ga0209437_106937 3300025233 Bacteria 1867
377 Ga0209258_100927 3300025242 Bacteria 14498
378 Ga0209233_1002003 3300025261 Bacteria 7713
379 Ga0209673_1001330 3300025273 Bacteria 24762
380 Ga0209130_1014791 3300025284 Bacteria 1946
381 Ga0209130_1015250 3300025284 Bacteria 1900
382 Ga0209130_1053714 3300025284 Bacteria 723
383 Ga0209130_1057683 3300025284 Bacteria 684
384 Ga0209675_1004714 3300025291 Bacteria 5966
385 Ga0209675_1035822 3300025291 Bacteria 1128
386 Ga0209675_1041839 3300025291 Bacteria 997
387 Ga0209676_1000745 3300025292 Bacteria 44098
388 Ga0209025_1000639 3300025294 Bacteria 61845
389 Ga0209025_1000976 3300025294 Bacteria 42839
390 Ga0209025_1001421 3300025294 Bacteria 31646
391 Ga0209025_1010512 3300025294 Bacteria 6262
392 Ga0209025_1014524 3300025294 Bacteria 4832
393 Ga0209025_1015652 3300025294 Bacteria 4551
394 Ga0209025_1045113 3300025294 Bacteria 1832
395 Ga0209025_1049611 3300025294 Bacteria 1687
396 Ga0209025_1055754 3300025294 Bacteria 1525
397 Ga0209025_1083683 3300025294 Bacteria 1072
398 Ga0207426_1023848 3300025302 Bacteria 2083
399 Ga0207426_1161456 3300025302 Bacteria 513
400 Ga0207697_10017259 3300025315 Bacteria 2967
401 Ga0207656_10087909 3300025321 Bacteria 1406
402 Ga0207656_10212377 3300025321 Bacteria 938
403 Ga0207696_1000471 3300025711 Bacteria 34549
404 Ga0207696_1001142 3300025711 Bacteria 15286
405 Ga0207655_1000971 3300025728 Bacteria 29540
406 Ga0207655_1001486 3300025728 Bacteria 21499
407 Ga0207655_1039477 3300025728 Bacteria 2049
408 Ga0207655_1130267 3300025728 Bacteria 820
409 Ga0207655_1197922 3300025728 Bacteria 602
410 Ga0207655_1215894 3300025728 Bacteria 562
411 Ga0207655_1229809 3300025728 Bacteria 536
412 Ga0207713_1000405 3300025735 Bacteria 46074
413 Ga0207713_1007861 3300025735 Bacteria 6217
414 Ga0207713_1012576 3300025735 Bacteria 4511
415 Ga0207692_10425061 3300025898 Bacteria 832
416 Ga0207692_10816738 3300025898 Bacteria 610
417 Ga0207710_10000981 3300025900 Bacteria 14984
418 Ga0207710_10006009 3300025900 Bacteria 5203
419 Ga0207688_10525463 3300025901 Bacteria 742
420 Ga0207680_10040705 3300025903 Bacteria 2706
421 Ga0207680_10114336 3300025903 Bacteria 1756
422 Ga0207680_10286564 3300025903 Bacteria 1145
423 Ga0207647_10004892 3300025904 Bacteria 9886
424 Ga0207647_10020423 3300025904 Bacteria 4442
425 Ga0207685_10529278 3300025905 Bacteria 624
426 Ga0207685_10538842 3300025905 Bacteria 619
427 Ga0207699_10380011 3300025906 Bacteria 1002
428 Ga0207699_10752201 3300025906 Bacteria 715
429 Ga0207645_10007324 3300025907 Bacteria 7801
430 Ga0207645_10024412 3300025907 Bacteria 3920
431 Ga0207643_10071627 3300025908 Bacteria 1996
432 Ga0207705_10035811 3300025909 Bacteria 3551
433 Ga0207705_10049624 3300025909 Bacteria 3020
434 Ga0207705_10514440 3300025909 Bacteria 930
435 Ga0207705_10542378 3300025909 Bacteria 904
436 Ga0207705_10651369 3300025909 Bacteria 819
437 Ga0207684_10019216 3300025910 Bacteria 5845
438 Ga0207654_10001818 3300025911 Bacteria 11074
439 Ga0207654_10013381 3300025911 Bacteria 4221
440 Ga0207654_10049266 3300025911 Bacteria 2415
441 Ga0207654_10335367 3300025911 Bacteria 1037
442 Ga0207707_10000624 3300025912 Bacteria 35078
443 Ga0207707_10233542 3300025912 Bacteria 1600
444 Ga0207707_10593043 3300025912 Bacteria 938
445 Ga0207695_10000379 3300025913 Bacteria 101331
446 Ga0207695_10000384 3300025913 Bacteria 100121
447 Ga0207695_10001178 3300025913 Bacteria 45089
448 Ga0207695_10003215 3300025913 Bacteria 23264
449 Ga0207695_10189409 3300025913 Bacteria 1975
450 Ga0207695_10193386 3300025913 Bacteria 1951
451 Ga0207695_10448132 3300025913 Bacteria 1174
452 Ga0207695_10549223 3300025913 Bacteria 1037
453 Ga0207695_10860868 3300025913 Bacteria 786
454 Ga0207671_10000071 3300025914 Bacteria 159699
455 Ga0207671_10000503 3300025914 Bacteria 53115
456 Ga0207671_10029151 3300025914 Bacteria 4123
457 Ga0207671_10968842 3300025914 Bacteria 671
458 Ga0207671_11301378 3300025914 Bacteria 566
459 Ga0207693_10021027 3300025915 Bacteria 5188
460 Ga0207693_10374482 3300025915 Bacteria 1114
461 Ga0207663_10195780 3300025916 Bacteria 1455
462 Ga0207663_10366822 3300025916 Bacteria 1094
463 Ga0207660_10003099 3300025917 Bacteria 10867
464 Ga0207660_10274908 3300025917 Bacteria 1335
465 Ga0207660_10411650 3300025917 Bacteria 1090
466 Ga0207660_10927792 3300025917 Bacteria 710
467 Ga0207657_10495943 3300025919 Bacteria 957
468 Ga0207657_10609434 3300025919 Bacteria 852
469 Ga0207657_10667096 3300025919 Bacteria 809
470 Ga0207657_11331646 3300025919 Bacteria 541
471 Ga0207649_10007836 3300025920 Bacteria 5812
472 Ga0207649_10037634 3300025920 Bacteria 2924
473 Ga0207649_10072355 3300025920 Bacteria 2205
474 Ga0207649_11483743 3300025920 Bacteria 537
475 Ga0207652_10049501 3300025921 Bacteria 3597
476 Ga0207652_10406320 3300025921 Bacteria 1229
477 Ga0207652_10439917 3300025921 Bacteria 1175
478 Ga0207652_10511347 3300025921 Bacteria 1081
479 Ga0207646_10151361 3300025922 Bacteria 2092
480 Ga0207681_10039956 3300025923 Bacteria 3118
481 Ga0207681_10534366 3300025923 Bacteria 963
482 Ga0207694_10000247 3300025924 Bacteria 51633
483 Ga0207694_10001290 3300025924 Bacteria 21610
484 Ga0207694_10049671 3300025924 Bacteria 3247
485 Ga0207694_10104531 3300025924 Bacteria 2247
486 Ga0207650_10032901 3300025925 Bacteria 3753
487 Ga0207650_10144626 3300025925 Bacteria 1872
488 Ga0207650_10448961 3300025925 Bacteria 1073
489 Ga0207650_10562968 3300025925 Bacteria 956
490 Ga0207659_10035540 3300025926 Bacteria 3445
491 Ga0207659_11132187 3300025926 Bacteria 673
492 Ga0207687_10004776 3300025927 Bacteria 9015
493 Ga0207687_10023510 3300025927 Bacteria 4109
494 Ga0207687_10172618 3300025927 Bacteria 1669
495 Ga0207687_10230870 3300025927 Bacteria 1462
496 Ga0207700_10010087 3300025928 Bacteria 5939
497 Ga0207700_10076852 3300025928 Bacteria 2592
498 Ga0207700_10738709 3300025928 Bacteria 879
499 Ga0207664_10218061 3300025929 Bacteria 1653
500 Ga0207664_10575276 3300025929 Bacteria 1011
501 Ga0207644_10002812 3300025931 Bacteria 11222
502 Ga0207644_10008147 3300025931 Bacteria 6866
503 Ga0207644_10085502 3300025931 Bacteria 2340
504 Ga0207690_10153599 3300025932 Bacteria 1709
505 Ga0207690_10524240 3300025932 Bacteria 961
506 Ga0207706_10003090 3300025933 Bacteria 15998
507 Ga0207686_10004531 3300025934 Bacteria 7445
508 Ga0207709_10000416 3300025935 Bacteria 41461
509 Ga0207709_10026556 3300025935 Bacteria 3328
510 Ga0207669_10584370 3300025937 Bacteria 906
511 Ga0207704_10232777 3300025938 Bacteria 1371
512 Ga0207665_10100583 3300025939 Bacteria 2017
513 Ga0207665_10217896 3300025939 Bacteria 1397
514 Ga0207665_10930120 3300025939 Bacteria 690
515 Ga0207691_10008111 3300025940 Bacteria 10082
516 Ga0207691_10354977 3300025940 Bacteria 1254
517 Ga0207711_10027616 3300025941 Bacteria 4768
518 Ga0207711_10045923 3300025941 Bacteria 3732
519 Ga0207711_10087252 3300025941 Bacteria 2737
520 Ga0207711_10252906 3300025941 Bacteria 1618
521 Ga0207711_10448790 3300025941 Bacteria 1200
522 Ga0207711_11685084 3300025941 Bacteria 577
523 Ga0207689_10000502 3300025942 Bacteria 36903
524 Ga0207689_10007888 3300025942 Bacteria 9297
525 Ga0207661_10029458 3300025944 Bacteria 4216
526 Ga0207661_10072040 3300025944 Bacteria 2826
527 Ga0207661_10137450 3300025944 Bacteria 2100
528 Ga0207661_10167167 3300025944 Bacteria 1912
529 Ga0207661_10246633 3300025944 Bacteria 1586
530 Ga0207679_10023401 3300025945 Bacteria 4224
531 Ga0207679_10351814 3300025945 Bacteria 1284
532 Ga0207667_10006951 3300025949 Bacteria 13678
533 Ga0207667_10008805 3300025949 Bacteria 11950
534 Ga0207667_10014641 3300025949 Bacteria 8931
535 Ga0207667_10060987 3300025949 Bacteria 3947
536 Ga0207667_10371585 3300025949 Bacteria 1457
537 Ga0207667_10919072 3300025949 Bacteria 866
538 Ga0207667_11448986 3300025949 Bacteria 659
539 Ga0207667_11485453 3300025949 Bacteria 649
540 Ga0207651_10416249 3300025960 Bacteria 1146
541 Ga0207712_10226277 3300025961 Bacteria 1498
542 Ga0207668_10204145 3300025972 Bacteria 1576
543 Ga0207640_10782303 3300025981 Bacteria 825
544 Ga0207640_10807724 3300025981 Bacteria 813
545 Ga0207658_10000267 3300025986 Bacteria 55017
546 Ga0207658_10184464 3300025986 Bacteria 1729
547 Ga0207677_10000115 3300026023 Bacteria 65569
548 Ga0207677_10129298 3300026023 Bacteria 1914
549 Ga0207677_10241466 3300026023 Bacteria 1462
550 Ga0207703_10041774 3300026035 Bacteria 3676
551 Ga0207703_10051602 3300026035 Bacteria 3334
552 Ga0207639_10000868 3300026041 Bacteria 20542
553 Ga0207639_10188656 3300026041 Bacteria 1759
554 Ga0207639_10208644 3300026041 Bacteria 1680
555 Ga0207678_10147456 3300026067 Bacteria 2008
556 Ga0207678_10443503 3300026067 Bacteria 1128
557 Ga0207702_10001589 3300026078 Bacteria 22475
558 Ga0207702_10003889 3300026078 Bacteria 13450
559 Ga0207702_10047957 3300026078 Bacteria 3601
560 Ga0207702_10696570 3300026078 Bacteria 1001
561 Ga0207702_10830686 3300026078 Bacteria 914
562 Ga0207702_11135850 3300026078 Bacteria 775
563 Ga0207641_10001519 3300026088 Bacteria 22714
564 Ga0207641_10450787 3300026088 Bacteria 1243
565 Ga0207648_10044039 3300026089 Bacteria 3917
566 Ga0207676_10004236 3300026095 Bacteria 10131
567 Ga0207676_10589015 3300026095 Bacteria 1067
568 Ga0207674_10033769 3300026116 Bacteria 5355
569 Ga0207674_10053258 3300026116 Bacteria 4125
570 Ga0207674_10125804 3300026116 Bacteria 2529
571 Ga0207683_10006613 3300026121 Bacteria 9920
572 Ga0207698_10000039 3300026142 Bacteria 101073
573 Ga0207698_10000059 3300026142 Bacteria 76632
574 Ga0207698_10158037 3300026142 Bacteria 1978
575 Ga0207698_11262558 3300026142 Bacteria 753
576 Ga0207698_11553756 3300026142 Bacteria 677
577 Ga0207698_11952906 3300026142 Bacteria 601
578 Ga0209371_1000923 3300027312 Bacteria 23176
579 Ga0210000_1001373 3300027462 Bacteria 3430
580 Ga0209179_1022000 3300027512 Bacteria 1249
581 Ga0209982_1024772 3300027552 Bacteria 931
582 Ga0209970_1000914 3300027614 Bacteria 5205
583 Ga0209971_1022190 3300027682 Bacteria 1511
584 Ga0209974_10014241 3300027876 Bacteria 2649
585 Ga0268266_10110944 3300028379 Bacteria 2430
586 Ga0268266_10566523 3300028379 Bacteria 1089
587 Ga0268265_11056872 3300028380 Bacteria 804
588 Ga0268264_10000863 3300028381 Bacteria 32143
589 Ga0268264_11332615 3300028381 Bacteria 728
590 Ga0265336_10006401 3300028666 Bacteria 4245
591 Ga0265338_10004125 3300028800 Bacteria 19883
592 Ga0265338_10035290 3300028800 Bacteria 4812
593 Ga0265338_10047348 3300028800 Bacteria 3928
594 Ga0265338_10431349 3300028800 Bacteria 935
595 Ga0265338_10459625 3300028800 Bacteria 900
596 Ga0311000_122265 3300029272 Bacteria 1547
597 Ga0311000_129387 3300029272 Bacteria 519
598 Ga0311008_126459 3300029273 Bacteria 563
599 Ga0311011_109112 3300029280 Bacteria 1922
600 Ga0311003_174330 3300029282 Bacteria 820
601 Ga0310982_141133 3300029283 Bacteria 1262
602 Ga0310982_144591 3300029283 Bacteria 892
603 Ga0265324_10030792 3300029957 Bacteria 1881
604 Ga0265324_10315219 3300029957 Bacteria 533
605 Ga0237817_10115 3300030083 Bacteria 24754
606 Ga0268256_1000773 3300030500 Bacteria 23269
607 Ga0265762_1138664 3300030760 Bacteria 570
608 Ga0265763_1003385 3300030763 Bacteria 1268
609 Ga0265766_1000542 3300030863 Bacteria 1684
610 Ga0265770_1115253 3300030878 Bacteria 560
611 Ga0265776_101371 3300030880 Bacteria 1025
612 Ga0265768_101141 3300030963 Bacteria 1199
613 Ga0265773_1017950 3300031018 Bacteria 674
614 Ga0265760_10112585 3300031090 Bacteria 868
615 Ga0265760_10265096 3300031090 Bacteria 599
616 Ga0265330_10000477 3300031235 Bacteria 26910
617 Ga0265330_10058036 3300031235 Bacteria 1687
618 Ga0265330_10072295 3300031235 Bacteria 1492
619 Ga0265330_10079798 3300031235 Bacteria 1410
620 Ga0265330_10098418 3300031235 Bacteria 1253
621 Ga0265330_10149159 3300031235 Bacteria 994
622 Ga0265330_10156967 3300031235 Bacteria 966
623 Ga0265332_10136639 3300031238 Bacteria 1027
624 Ga0265332_10235545 3300031238 Bacteria 758
625 Ga0265332_10248435 3300031238 Bacteria 736
626 Ga0265328_10008680 3300031239 Bacteria 4174
627 Ga0265328_10024645 3300031239 Bacteria 2270
628 Ga0265328_10035367 3300031239 Bacteria 1847
629 Ga0265320_10130533 3300031240 Bacteria 1142
630 Ga0265320_10177775 3300031240 Bacteria 954
631 Ga0265320_10445431 3300031240 Bacteria 572
632 Ga0265320_10545725 3300031240 Bacteria 512
633 Ga0265325_10003065 3300031241 Bacteria 11039
634 Ga0265325_10012258 3300031241 Bacteria 4906
635 Ga0265325_10049305 3300031241 Bacteria 2173
636 Ga0265325_10170027 3300031241 Bacteria 1020
637 Ga0265325_10295415 3300031241 Bacteria 724
638 Ga0265340_10010369 3300031247 Bacteria 4985
639 Ga0265340_10019409 3300031247 Bacteria 3501
640 Ga0265340_10049224 3300031247 Bacteria 2047
641 Ga0265340_10346071 3300031247 Bacteria 657
642 Ga0265340_10429413 3300031247 Bacteria 582
643 Ga0265339_10000029 3300031249 Bacteria 139089
644 Ga0265339_10000921 3300031249 Bacteria 22618
645 Ga0265339_10021757 3300031249 Bacteria 3724
646 Ga0265339_10021831 3300031249 Bacteria 3716
647 Ga0265339_10048938 3300031249 Bacteria 2316
648 Ga0265339_10078311 3300031249 Bacteria 1750
649 Ga0265339_10140738 3300031249 Bacteria 1227
650 Ga0265339_10172672 3300031249 Bacteria 1081
651 Ga0265331_10023806 3300031250 Bacteria 3105
652 Ga0265327_10330699 3300031251 Bacteria 667
653 Ga0265316_10006934 3300031344 Bacteria 10744
654 Ga0265316_10007872 3300031344 Bacteria 9973
655 Ga0265316_10013957 3300031344 Bacteria 7104
656 Ga0265316_10015244 3300031344 Bacteria 6728
657 Ga0265316_10030435 3300031344 Bacteria 4424
658 Ga0265316_10033589 3300031344 Bacteria 4176
659 Ga0265316_10039682 3300031344 Bacteria 3780
660 Ga0265316_10165624 3300031344 Bacteria 1651
661 Ga0265316_10180534 3300031344 Bacteria 1572
662 Ga0265316_10260504 3300031344 Bacteria 1272
663 Ga0265316_10301472 3300031344 Bacteria 1167
664 Ga0265316_10344478 3300031344 Bacteria 1080
665 Ga0265316_10507230 3300031344 Bacteria 861
666 Ga0265316_10782106 3300031344 Bacteria 670
667 Ga0265316_10936993 3300031344 Bacteria 604
668 Ga0307408_100003263 3300031548 Bacteria 11155
669 Ga0307408_100021999 3300031548 Bacteria 4325
670 Ga0307408_100125708 3300031548 Bacteria 1994
671 Ga0307408_101718723 3300031548 Bacteria 598
672 Ga0265313_10016184 3300031595 Bacteria 4299
673 Ga0265313_10034221 3300031595 Bacteria 2571
674 Ga0265313_10050332 3300031595 Bacteria 2000
675 Ga0265313_10070860 3300031595 Bacteria 1605
676 Ga0265314_10001691 3300031711 Bacteria 24008
677 Ga0265314_10019867 3300031711 Bacteria 5195
678 Ga0265314_10041833 3300031711 Bacteria 3275
679 Ga0265314_10073151 3300031711 Bacteria 2286
680 Ga0265314_10585754 3300031711 Bacteria 576
681 Ga0265342_10000307 3300031712 Bacteria 55504
682 Ga0265342_10008915 3300031712 Bacteria 7128
683 Ga0265342_10011411 3300031712 Bacteria 6084
684 Ga0265342_10023693 3300031712 Bacteria 3881
685 Ga0265342_10054842 3300031712 Bacteria 2367
686 Ga0265342_10056084 3300031712 Bacteria 2336
687 Ga0265342_10068984 3300031712 Bacteria 2065
688 Ga0265342_10080695 3300031712 Bacteria 1879
689 Ga0265342_10113043 3300031712 Bacteria 1535
690 Ga0265342_10282902 3300031712 Bacteria 877
691 Ga0265342_10550085 3300031712 Bacteria 585
692 Ga0316578_10262150 3300031728 Unclassified 1036
693 Ga0316577_10586530 3300031733 Bacteria 634
694 Ga0307413_10512676 3300031824 Bacteria 965
695 Ga0307410_10091988 3300031852 Bacteria 2155
696 Ga0307407_10623276 3300031903 Bacteria 805
697 Ga0307412_10020619 3300031911 Bacteria 4015
698 Ga0307409_100002336 3300031995 Bacteria 9855
699 Ga0307409_100007174 3300031995 Bacteria 6641
700 Ga0307409_100822098 3300031995 Bacteria 938
701 Ga0307416_100007104 3300032002 Bacteria 7078
702 Ga0307416_100170833 3300032002 Bacteria 2023
703 Ga0307416_100203113 3300032002 Bacteria 1882
704 Ga0307416_101860606 3300032002 Bacteria 705
705 Ga0307415_101082758 3300032126 Bacteria 749
706 Ga0307415_102023252 3300032126 Bacteria 561
707 Ga0316596_1068366 3300033541 Unclassified 950
708 Ga0316215_1000833 3300033544 Bacteria 3078
709 Ga0373929_0241408 3300035085 Bacteria 521
710 Ga0373934_0357625 3300035086 Bacteria 608
711 Ga0373940_0294540 3300035088 Bacteria 557
712 Ga0373923_0264395 3300035111 Bacteria 808
713 Ga0373953_0240072 3300035117 Bacteria 787
714 Ga0373954_0027849 3300035118 Bacteria 2596
715 Ga0373956_0490424 3300035119 Bacteria 586
716 Ga0373957_0473770 3300035120 Bacteria 543
717 Ga0373943_0517005 3300035170 Bacteria 699
718 Ga0373955_0131727 3300035172 Bacteria 1460
719 Ga0373955_0352630 3300035172 Bacteria 891
720 Ga0373961_0061503 3300035241 Bacteria 1141
721 Ga0373931_0020821 3300035691 Bacteria 3284
722 Ga0373931_0496784 3300035691 Bacteria 786
723 Ga0373935_1187046 3300035692 Bacteria 569
724 Ga0373935_1377227 3300035692 Bacteria 527
725 Ga0373933_0041165 3300035724 Bacteria 2726
726 Ga0373933_0323080 3300035724 Bacteria 1001
727 Ga0373937_0027753 3300036401 Bacteria 5122
728 Ga0373937_0049903 3300036401 Bacteria 3832
729 Ga0373937_0351741 3300036401 Bacteria 1396
730 Ga0373937_1060536 3300036401 Bacteria 759
731 Ga0373937_1136810 3300036401 Bacteria 730
732 Ga0265778_051585 3300036457 Bacteria 564
733 Ga0316584_0008199 3300036712 Bacteria 7187
734 Ga0316584_0153084 3300036712 Bacteria 1716
735 Ga0373925_1406404 3300037068 Bacteria 571
736 Ga0395899_0203176 3300037312 Bacteria 1380
737 Ga0395899_0270279 3300037312 Bacteria 1160
738 Ga0395899_0387442 3300037312 Bacteria 927
739 Ga0395900_0234286 3300037418 Bacteria 1845
740 Ga0395900_0411933 3300037418 Bacteria 1314
741 Ga0395900_1547859 3300037418 Bacteria 575
742 Ga0395898_0428885 3300037466 Bacteria 1260
743 Ga0395898_0582816 3300037466 Bacteria 1061
744 Ga0395898_0775795 3300037466 Bacteria 899
745 Ga0395898_0851716 3300037466 Bacteria 851
746 Ga0395898_1223796 3300037466 Bacteria 682
747 Ga0395905_0573972 3300037471 Bacteria 1029
748 Ga0395901_0624307 3300038443 Bacteria 1084
749 Ga0395901_0962277 3300038443 Bacteria 832
750 Ga0395901_1417306 3300038443 Bacteria 653
751 Ga0237819_00239 3300038705 Bacteria 20080
752 Ga0436365_0559080 3300039437 Bacteria 1890
753 Ga0436365_1532164 3300039437 Bacteria 826
754 Ga0436360_0240674 3300039438 Bacteria 848
755 Ga0436360_0343285 3300039438 Bacteria 1087
756 Ga0436363_0991670 3300039450 Bacteria 1217
757 Ga0436363_1358816 3300039450 Bacteria 558
758 Ga0436362_0143704 3300039453 Bacteria 1099
759 Ga0439436_0002304 3300041404 Bacteria 5726
760 Ga0439439_0000103 3300041406 Bacteria 11384
761 Ga0439439_0003260 3300041406 Bacteria 3566
762 Ga0439453_0114324 3300041408 Bacteria 613
763 Ga0451855_0403959 3300041511 Bacteria 550
764 Ga0451855_0452095 3300041511 Bacteria 548
765 Ga0451855_0548201 3300041511 Bacteria 1185
766 Ga0451853_1007767 3300041512 Bacteria 523
767 Ga0439433_0002523 3300041999 Bacteria 3886
768 Ga0439433_0005396 3300041999 Bacteria 2746
769 Ga0439433_0217922 3300041999 Bacteria 508
770 Ga0439449_0000074 3300042007 Bacteria 31794
771 Ga0439449_0006536 3300042007 Bacteria 4455
772 Ga0439457_013262 3300042014 Bacteria 1853
773 Ga0439462_0004039 3300042015 Bacteria 3558
774 Ga0439462_0008776 3300042015 Bacteria 2555
775 Ga0450906_043496 3300042145 Bacteria 793
776 Ga0466969_0001060 3300044656 Bacteria 14842
777 Ga0466972_0077452 3300044658 Bacteria 1584
778 Ga0466965_0125423 3300044683 Bacteria 1328
779 Ga0466966_0298382 3300044684 Bacteria 968
780 Ga0466963_0003181 3300044694 Bacteria 9324
781 Ga0466963_0767058 3300044694 Bacteria 680
782 Ga0466963_1308113 3300044694 Bacteria 509
783 Ga0466968_0002977 3300044735 Bacteria 6255
784 Ga0466970_0031453 3300044765 Bacteria 2803
785 Ga0466970_0224164 3300044765 Bacteria 1050
786 Ga0466957_0691587 3300044842 Bacteria 719
787 Ga0466957_0991121 3300044842 Bacteria 603
788 Ga0466957_1077645 3300044842 Bacteria 579
789 Ga0466959_0186586 3300045049 Bacteria 1448
790 Ga0466958_0031906 3300045836 Bacteria 3132
791 Ga0466958_0837702 3300045836 Bacteria 600
792 Ga0466967_0000327 3300045976 Bacteria 21715
793 Ga0466967_0140642 3300045976 Bacteria 2248
794 Ga0466967_1023902 3300045976 Bacteria 822
795 Ga0466967_1031363 3300045976 Bacteria 819
796 Ga0495627_018408 3300046453 Bacteria 2356
797 Ga0495627_040568 3300046453 Bacteria 1433
798 Ga0495592_0276481 3300046454 Bacteria 1100
799 Ga0495603_0005187 3300046455 Bacteria 7778
800 Ga0495590_0042229 3300046457 Bacteria 1590
801 Ga0495590_0131097 3300046457 Bacteria 901
802 Ga0495590_0226889 3300046457 Bacteria 691
803 Ga0495591_028162 3300046458 Bacteria 1722
804 Ga0495591_096034 3300046458 Bacteria 739
805 Ga0495629_0072119 3300046459 Bacteria 2410
806 Ga0495651_0917238 3300046462 Bacteria 535
807 Ga0495580_0083130 3300046472 Bacteria 2231
808 Ga0495580_0198771 3300046472 Bacteria 1382
809 Ga0495582_0106361 3300046473 Bacteria 1574
810 Ga0495582_0499130 3300046473 Bacteria 703
811 Ga0495605_0025905 3300046474 Bacteria 3052
812 Ga0495605_0075252 3300046474 Bacteria 1588
813 Ga0495639_0023957 3300046475 Bacteria 2685
814 Ga0495584_0024667 3300046491 Bacteria 3049
815 Ga0495584_0209109 3300046491 Bacteria 992
816 Ga0495585_0001321 3300046492 Bacteria 19698
817 Ga0495607_0038465 3300046501 Bacteria 2866
818 Ga0495607_0161401 3300046501 Bacteria 1139
819 Ga0495606_0035724 3300046507 Bacteria 3394
820 Ga0495606_0093700 3300046507 Bacteria 1842
821 Ga0495606_0269138 3300046507 Bacteria 937
822 Ga0495608_0322977 3300046511 Bacteria 953
823 Ga0495608_0584883 3300046511 Bacteria 671
824 Ga0495608_0921658 3300046511 Bacteria 511
825 Ga0495610_0204571 3300046512 Bacteria 806
826 Ga0495618_0747651 3300046514 Bacteria 572
827 Ga0495620_0023267 3300046515 Bacteria 2966
828 Ga0495628_0161928 3300046516 Bacteria 1700
829 Ga0495630_0738023 3300046517 Bacteria 753
830 Ga0495630_0769949 3300046517 Bacteria 735
831 Ga0495637_0088472 3300046520 Bacteria 1225
832 Ga0495637_0142359 3300046520 Bacteria 909
833 Ga0495637_0174808 3300046520 Bacteria 799
834 Ga0495643_0031759 3300046522 Bacteria 2936
835 Ga0495652_0026891 3300046529 Bacteria 5076
836 Ga0495654_0015505 3300046530 Bacteria 4045
837 Ga0495654_0251932 3300046530 Bacteria 735
838 Ga0495665_0073755 3300046531 Bacteria 1797
839 Ga0495586_0129583 3300046535 Bacteria 1412
840 Ga0495587_0047822 3300046536 Bacteria 2536
841 Ga0495609_0055641 3300046538 Bacteria 1755
842 Ga0495621_0479869 3300046539 Bacteria 535
843 Ga0495597_0091528 3300046542 Bacteria 1291
844 Ga0495645_0046981 3300046543 Bacteria 3146
845 Ga0495645_0347104 3300046543 Bacteria 957
846 Ga0495622_0027467 3300046557 Bacteria 2656
847 Ga0495622_0064067 3300046557 Bacteria 1700
848 Ga0495633_0027955 3300046558 Bacteria 2751
849 Ga0495633_0065769 3300046558 Bacteria 1694
850 Ga0495667_0312819 3300046559 Bacteria 994
851 Ga0495668_0044828 3300046616 Bacteria 2458
852 Ga0495634_0101729 3300046642 Bacteria 1856
853 Ga0495611_0078881 3300046648 Bacteria 1512
854 Ga0495635_0209063 3300046663 Bacteria 1322
855 Ga0495661_0013338 3300046665 Bacteria 5523
856 Ga0495661_0020024 3300046665 Bacteria 4375
857 Ga0495661_0085148 3300046665 Bacteria 1812
858 Ga0495661_0455518 3300046665 Bacteria 615
859 Ga0495588_0044206 3300046674 Bacteria 2281
860 Ga0495657_0376623 3300046675 Bacteria 838
861 Ga0495599_0059726 3300046678 Bacteria 2385
862 Ga0495623_0130813 3300046679 Bacteria 1503
863 Ga0495623_0332872 3300046679 Bacteria 831
864 Ga0495623_0609679 3300046679 Bacteria 566
865 Ga0495646_0516509 3300046680 Bacteria 612
866 Ga0495647_0294951 3300046681 Bacteria 730
867 Ga0495658_0882969 3300046683 Bacteria 572
868 Ga0495669_0069731 3300046684 Bacteria 1600
869 Ga0495613_0342299 3300046689 Bacteria 1028
870 Ga0495613_0403249 3300046689 Bacteria 932
871 Ga0495613_0687720 3300046689 Bacteria 674
872 Ga0495670_0045580 3300046691 Bacteria 2189
873 Ga0495670_0172272 3300046691 Bacteria 1140
874 Ga0495670_0243336 3300046691 Bacteria 958
875 Ga0495649_0030798 3300046694 Bacteria 2961
876 Ga0495649_0083659 3300046694 Bacteria 1705
877 Ga0495649_0278784 3300046694 Bacteria 854
878 Ga0495649_0588002 3300046694 Bacteria 550
879 Ga0495589_0076252 3300046794 Bacteria 1635
880 Ga0495589_0107725 3300046794 Bacteria 1346
881 Ga0495600_0154968 3300046809 Bacteria 1482
882 Ga0495660_0004825 3300046810 Bacteria 8134
883 Ga0495660_0017884 3300046810 Bacteria 4077
884 Ga0495581_0054294 3300047315 Bacteria 2313
885 Ga0495604_0266968 3300047317 Bacteria 1161
886 Ga0495636_0136155 3300047318 Bacteria 1095
887 Ga0495636_0456330 3300047318 Bacteria 614
888 Ga0495676_0052043 3300047321 Bacteria 3272
889 Ga0495676_0133814 3300047321 Bacteria 1786
890 Ga0495680_0347683 3300047322 Bacteria 1033
891 Ga0495683_0005075 3300047323 Bacteria 7366
892 Ga0495687_033682 3300047443 Bacteria 2321
893 Ga0495675_0253268 3300047444 Bacteria 1057
894 Ga0495681_0048530 3300047470 Bacteria 2012
895 Ga0495681_0101906 3300047470 Bacteria 1254
896 Ga0495684_0269316 3300047471 Bacteria 1233
897 Ga0495686_0000545 3300047472 Bacteria 53866
898 Ga0495686_0012601 3300047472 Bacteria 5910
899 Ga0495686_0152425 3300047472 Bacteria 1356
900 Ga0495686_0230526 3300047472 Bacteria 1049
901 Ga0495602_0206155 3300048088 Bacteria 1496
902 Ga0495602_0415439 3300048088 Bacteria 956
903 Ga0495626_0006526 3300048091 Bacteria 6630
904 Ga0495626_0133338 3300048091 Bacteria 1059
905 Ga0496100_0001314 3300048903 Bacteria 12148
906 Ga0496100_0133827 3300048903 Bacteria 1749
907 Ga0496100_0284782 3300048903 Bacteria 1233
908 Ga0496100_0679634 3300048903 Bacteria 803
909 Ga0496100_1033025 3300048903 Bacteria 647
910 Ga0496101_0000972 3300048904 Bacteria 16923
911 Ga0496101_0088730 3300048904 Bacteria 2297
912 Ga0496101_0907534 3300048904 Bacteria 694
913 Ga0496101_1081780 3300048904 Bacteria 630
914 Ga0496101_1364296 3300048904 Bacteria 553
915 Ga0496102_0002206 3300048905 Bacteria 16718
916 Ga0496102_0011196 3300048905 Bacteria 7725
917 Ga0496102_0099351 3300048905 Bacteria 2701
918 Ga0496102_0629539 3300048905 Bacteria 996
919 Ga0496102_0704145 3300048905 Bacteria 933
920 Ga0496102_0852601 3300048905 Bacteria 833
921 Ga0496103_0001955 3300048906 Bacteria 13326
922 Ga0496103_0047911 3300048906 Bacteria 2641
923 Ga0496103_0276565 3300048906 Bacteria 1080
924 Ga0496103_0883260 3300048906 Bacteria 561
925 Ga0496104_0001658 3300048907 Bacteria 19228
926 Ga0496104_0005618 3300048907 Bacteria 10979
927 Ga0496104_0166573 3300048907 Bacteria 2113
928 Ga0496104_0208553 3300048907 Bacteria 1866
929 Ga0496104_0305470 3300048907 Bacteria 1503
930 Ga0496104_0308297 3300048907 Bacteria 1496
931 Ga0496104_0348085 3300048907 Bacteria 1395
932 Ga0496105_0002080 3300048908 Bacteria 14485
933 Ga0496105_0317361 3300048908 Bacteria 1250
934 Ga0496105_0509692 3300048908 Bacteria 943
935 Ga0496105_0605966 3300048908 Bacteria 849
936 Ga0496106_0002267 3300048909 Bacteria 14349
937 Ga0496106_0649413 3300048909 Bacteria 843
938 Ga0496107_0003223 3300048910 Bacteria 10859
939 Ga0496107_0058466 3300048910 Bacteria 2788
940 Ga0496107_0215509 3300048910 Bacteria 1428
941 Ga0496107_0313297 3300048910 Bacteria 1168
942 Ga0496107_0370851 3300048910 Bacteria 1065
943 Ga0496107_1316712 3300048910 Bacteria 516
944 Ga0496108_0000443 3300048911 Bacteria 33208
945 Ga0496108_1067083 3300048911 Bacteria 688
946 Ga0496108_1279353 3300048911 Bacteria 618
947 Ga0496109_0000778 3300048912 Bacteria 26502
948 Ga0496109_0087437 3300048912 Bacteria 2879
949 Ga0496109_0367538 3300048912 Bacteria 1359
950 Ga0496110_0001837 3300048913 Bacteria 15653
951 Ga0496110_0003743 3300048913 Bacteria 11715
952 Ga0496110_0016232 3300048913 Bacteria 6212
953 Ga0496110_0031404 3300048913 Bacteria 4583
954 Ga0496110_0311758 3300048913 Bacteria 1433
955 Ga0496110_0419582 3300048913 Bacteria 1220
956 Ga0496110_0774598 3300048913 Bacteria 863
957 Ga0496111_0000191 3300048914 Bacteria 28382
958 Ga0496111_0005358 3300048914 Bacteria 8202
959 Ga0496111_0061966 3300048914 Bacteria 2712
960 Ga0496111_0600530 3300048914 Bacteria 806
961 Ga0496111_0896146 3300048914 Bacteria 639
962 Ga0496112_0007183 3300048915 Bacteria 9864
963 Ga0496112_0264091 3300048915 Bacteria 1670
964 Ga0496112_1292253 3300048915 Bacteria 645
965 Ga0496112_1365161 3300048915 Bacteria 624
966 Ga0496113_0001361 3300048916 Bacteria 13543
967 Ga0496113_0413632 3300048916 Bacteria 1083
968 Ga0496113_1509949 3300048916 Bacteria 518
969 Ga0496114_0298516 3300048917 Bacteria 1422
970 Ga0496114_0738336 3300048917 Bacteria 861
971 Ga0496115_0056383 3300048918 Bacteria 3158
972 Ga0496115_0149438 3300048918 Bacteria 1928
973 Ga0496115_0194088 3300048918 Bacteria 1678
974 Ga0496115_0303564 3300048918 Bacteria 1308
975 Ga0496115_1322984 3300048918 Bacteria 536
976 Ga0496116_0007551 3300048919 Bacteria 9617
977 Ga0496116_0012406 3300048919 Bacteria 6966
978 Ga0496116_0012853 3300048919 Bacteria 6803
979 Ga0496116_0014267 3300048919 Bacteria 6355
980 Ga0496116_0017257 3300048919 Bacteria 5612
981 Ga0496116_0057218 3300048919 Bacteria 2551
982 Ga0496116_0064776 3300048919 Bacteria 2348
983 Ga0496117_0005823 3300048920 Bacteria 12765
984 Ga0496117_0016085 3300048920 Bacteria 6332
985 Ga0496118_0012842 3300048921 Bacteria 7990
986 Ga0496118_0144058 3300048921 Bacteria 1504
987 Ga0496119_0000469 3300048922 Bacteria 54992
988 Ga0496119_0003362 3300048922 Bacteria 16656
989 Ga0496119_0006713 3300048922 Bacteria 10576
990 Ga0496119_0547553 3300048922 Bacteria 532
991 Ga0496120_0001942 3300048923 Bacteria 22686
992 Ga0496120_0035325 3300048923 Bacteria 2986
993 Ga0496120_0102753 3300048923 Bacteria 1507
994 Ga0496121_0045806 3300048924 Bacteria 3753
995 Ga0496121_0108049 3300048924 Bacteria 2129
996 Ga0496121_0150400 3300048924 Bacteria 1714
997 Ga0496121_0219653 3300048924 Bacteria 1339
998 Ga0496121_0426928 3300048924 Bacteria 861
999 Ga0496121_0436053 3300048924 Bacteria 848
1000 Ga0496122_0006458 3300048925 Bacteria 13447
1001 Ga0496122_0007540 3300048925 Bacteria 12058
1002 Ga0496122_0028610 3300048925 Bacteria 4722
1003 Ga0496122_0031689 3300048925 Bacteria 4391
1004 Ga0496122_0051949 3300048925 Bacteria 3108
1005 Ga0496122_0057163 3300048925 Bacteria 2900
1006 Ga0496122_0075908 3300048925 Bacteria 2368
1007 Ga0496122_0083192 3300048925 Bacteria 2220
1008 Ga0496122_0199829 3300048925 Bacteria 1170
1009 Ga0496122_0459341 3300048925 Bacteria 629
1010 Ga0496122_0495917 3300048925 Bacteria 594
1011 Ga0496123_0004233 3300048926 Bacteria 15295
1012 Ga0496123_0009386 3300048926 Bacteria 8818
1013 Ga0496123_0010929 3300048926 Bacteria 7942
1014 Ga0496123_0023113 3300048926 Bacteria 4768
1015 Ga0496123_0126496 3300048926 Bacteria 1425
1016 Ga0496124_0000697 3300048927 Bacteria 55040
1017 Ga0496124_0001155 3300048927 Bacteria 41411
1018 Ga0496124_0012311 3300048927 Bacteria 8450
1019 Ga0496124_0022419 3300048927 Bacteria 5788
1020 Ga0496124_0162139 3300048927 Bacteria 1741
1021 Ga0496125_0001385 3300048928 Bacteria 35466
1022 Ga0496125_0001389 3300048928 Bacteria 35441
1023 Ga0496125_0006886 3300048928 Bacteria 12173
1024 Ga0496125_0059770 3300048928 Bacteria 3068
1025 Ga0496125_0253782 3300048928 Bacteria 1107
1026 Ga0496125_0531426 3300048928 Bacteria 655
1027 Ga0496126_0000005 3300048929 Bacteria 891906
1028 Ga0496126_0008264 3300048929 Bacteria 11239
1029 Ga0496126_0059816 3300048929 Bacteria 3430
1030 Ga0496126_0125265 3300048929 Bacteria 2224
1031 Ga0496126_0508493 3300048929 Bacteria 962
1032 Ga0496126_0577285 3300048929 Bacteria 889
1033 Ga0496126_1118387 3300048929 Bacteria 584
1034 Ga0501306_000002 3300049127 Bacteria 15788
1035 Ga0501306_000030 3300049127 Bacteria 8097
1036 Ga0501306_000071 3300049127 Bacteria 5331
1037 Ga0501306_000079 3300049127 Bacteria 5183
1038 Ga0501306_000138 3300049127 Bacteria 4465
1039 Ga0501306_000200 3300049127 Bacteria 4039
1040 Ga0501306_003109 3300049127 Bacteria 1763
1041 Ga0501306_003694 3300049127 Bacteria 1665
1042 Ga0501306_003974 3300049127 Bacteria 1630
1043 Ga0501306_004132 3300049127 Bacteria 1609
1044 Ga0501306_005368 3300049127 Bacteria 1467
1045 Ga0501306_006747 3300049127 Bacteria 1357
1046 Ga0501306_021343 3300049127 Bacteria 906
1047 Ga0501306_025599 3300049127 Bacteria 850
1048 Ga0501306_096613 3300049127 Bacteria 524
1049 Ga0501308_000057 3300049128 Bacteria 4639
1050 Ga0501308_000086 3300049128 Bacteria 4141
1051 Ga0501308_000106 3300049128 Bacteria 3961
1052 Ga0501308_000127 3300049128 Bacteria 3778
1053 Ga0501308_000694 3300049128 Bacteria 2340
1054 Ga0501308_000735 3300049128 Bacteria 2305
1055 Ga0501308_003239 3300049128 Bacteria 1495
1056 Ga0501308_011238 3300049128 Bacteria 1006
1057 Ga0501308_028028 3300049128 Bacteria 742
1058 Ga0501309_000001 3300049129 Bacteria 14958
1059 Ga0501309_000144 3300049129 Bacteria 4525
1060 Ga0501309_000417 3300049129 Bacteria 3337
1061 Ga0501309_001669 3300049129 Bacteria 2239
1062 Ga0501309_003421 3300049129 Bacteria 1795
1063 Ga0501309_004736 3300049129 Bacteria 1595
1064 Ga0501309_020612 3300049129 Bacteria 923
1065 Ga0501310_000312 3300049130 Bacteria 4473
1066 Ga0501310_000940 3300049130 Bacteria 2590
1067 Ga0501310_002051 3300049130 Bacteria 1887
1068 Ga0501310_003009 3300049130 Bacteria 1632
1069 Ga0501310_003439 3300049130 Bacteria 1546
1070 Ga0501310_003997 3300049130 Bacteria 1461
1071 Ga0501310_017305 3300049130 Bacteria 871
1072 Ga0501310_019702 3300049130 Bacteria 832
1073 Ga0501310_043872 3300049130 Bacteria 630
1074 Ga0501341_00014 3300049131 Bacteria 5842
1075 Ga0501341_00024 3300049131 Bacteria 4362
1076 Ga0501341_00076 3300049131 Bacteria 2969
1077 Ga0501341_00193 3300049131 Bacteria 2190
1078 Ga0501341_00222 3300049131 Bacteria 2112
1079 Ga0501341_01598 3300049131 Bacteria 1151
1080 Ga0501343_000098 3300049132 Bacteria 3744
1081 Ga0501343_000383 3300049132 Bacteria 2528
1082 Ga0501343_000392 3300049132 Bacteria 2500
1083 Ga0501343_000491 3300049132 Bacteria 2319
1084 Ga0501343_000591 3300049132 Bacteria 2192
1085 Ga0501343_000794 3300049132 Bacteria 1979
1086 Ga0501343_001442 3300049132 Bacteria 1615
1087 Ga0501343_001896 3300049132 Bacteria 1457
1088 Ga0501343_002494 3300049132 Bacteria 1312
1089 Ga0501343_004576 3300049132 Bacteria 1042
1090 Ga0501343_008265 3300049132 Bacteria 830
1091 Ga0501343_012006 3300049132 Bacteria 717
1092 Ga0501344_00011 3300049133 Bacteria 4536
1093 Ga0501344_00013 3300049133 Bacteria 4354
1094 Ga0501344_00016 3300049133 Bacteria 4204
1095 Ga0501344_00060 3300049133 Bacteria 3139
1096 Ga0501344_00166 3300049133 Bacteria 2343
1097 Ga0501344_00605 3300049133 Bacteria 1549
1098 Ga0501344_00857 3300049133 Bacteria 1379
1099 Ga0501344_01780 3300049133 Bacteria 1069
1100 Ga0501345_00004 3300049134 Bacteria 5201
1101 Ga0501345_00405 3300049134 Bacteria 1424
1102 Ga0501345_02481 3300049134 Bacteria 763
1103 Ga0501304_000046 3300049160 Bacteria 4246
1104 Ga0501304_000047 3300049160 Bacteria 4168
1105 Ga0501304_000119 3300049160 Bacteria 3077
1106 Ga0501304_000494 3300049160 Bacteria 2070
1107 Ga0501304_002674 3300049160 Bacteria 1256
1108 Ga0501304_002783 3300049160 Bacteria 1240
1109 Ga0501305_000003 3300049161 Bacteria 16860
1110 Ga0501305_000005 3300049161 Bacteria 12832
1111 Ga0501305_000007 3300049161 Bacteria 11997
1112 Ga0501305_000135 3300049161 Bacteria 4788
1113 Ga0501305_000838 3300049161 Bacteria 2741
1114 Ga0501305_001024 3300049161 Bacteria 2597
1115 Ga0501305_001780 3300049161 Bacteria 2195
1116 Ga0501305_002856 3300049161 Bacteria 1906
1117 Ga0501305_003944 3300049161 Bacteria 1714
1118 Ga0501305_030135 3300049161 Bacteria 842
1119 Ga0501305_033886 3300049161 Bacteria 808
1120 Ga0501305_046588 3300049161 Bacteria 718
1121 Ga0501305_087126 3300049161 Bacteria 567
1122 Ga0501307_000002 3300049162 Bacteria 10580
1123 Ga0501307_000008 3300049162 Bacteria 7231
1124 Ga0501307_000011 3300049162 Bacteria 6472
1125 Ga0501307_000049 3300049162 Bacteria 4646
1126 Ga0501307_000155 3300049162 Bacteria 3645
1127 Ga0501307_000338 3300049162 Bacteria 2981
1128 Ga0501307_000603 3300049162 Bacteria 2572
1129 Ga0501307_000770 3300049162 Bacteria 2406
1130 Ga0501307_004127 3300049162 Bacteria 1466
1131 Ga0501307_008353 3300049162 Bacteria 1161
1132 Ga0501307_026040 3300049162 Bacteria 789
1133 Ga0501342_00056 3300049163 Bacteria 2311
1134 Ga0501342_00155 3300049163 Bacteria 1595
1135 Ga0501342_00181 3300049163 Bacteria 1522
1136 Ga0501342_03148 3300049163 Bacteria 578
1137 Ga0495682_0075125 3300049460 Bacteria 1216
1138 Ga0495682_0213792 3300049460 Bacteria 683
1139 Ga0501290_005720 3300049513 Bacteria 1551
1140 Ga0501291_048567 3300049514 Bacteria 766
1141 Ga0501295_018328 3300049518 Bacteria 1242
1142 Ga0501299_084095 3300049522 Bacteria 712
1143 Ga0501300_006882 3300049523 Bacteria 1669
1144 Ga0501311_000001 3300049527 Bacteria 13401
1145 Ga0501311_000006 3300049527 Bacteria 9157
1146 Ga0501311_000029 3300049527 Bacteria 5700
1147 Ga0501311_000061 3300049527 Bacteria 4751
1148 Ga0501311_000124 3300049527 Bacteria 3927
1149 Ga0501311_000152 3300049527 Bacteria 3775
1150 Ga0501311_000226 3300049527 Bacteria 3395
1151 Ga0501311_000359 3300049527 Bacteria 3038
1152 Ga0501311_005953 3300049527 Bacteria 1357
1153 Ga0501311_009822 3300049527 Bacteria 1150
1154 Ga0501311_031246 3300049527 Bacteria 772
1155 Ga0501311_073433 3300049527 Bacteria 571
1156 Ga0501312_000002 3300049528 Bacteria 17365
1157 Ga0501312_000004 3300049528 Bacteria 15088
1158 Ga0501312_000005 3300049528 Bacteria 12788
1159 Ga0501312_000019 3300049528 Bacteria 9134
1160 Ga0501312_000056 3300049528 Bacteria 6519
1161 Ga0501312_000171 3300049528 Bacteria 4337
1162 Ga0501312_000289 3300049528 Bacteria 3708
1163 Ga0501312_000439 3300049528 Bacteria 3315
1164 Ga0501312_000739 3300049528 Bacteria 2829
1165 Ga0501312_001758 3300049528 Bacteria 2212
1166 Ga0501312_009171 3300049528 Bacteria 1299
1167 Ga0501312_009722 3300049528 Bacteria 1273
1168 Ga0501312_033896 3300049528 Bacteria 812
1169 Ga0501312_047192 3300049528 Bacteria 718
1170 Ga0501312_085805 3300049528 Bacteria 575
1171 Ga0501312_120533 3300049528 Bacteria 507
1172 Ga0501313_000001 3300049529 Bacteria 19566
1173 Ga0501313_000003 3300049529 Bacteria 10446
1174 Ga0501313_000034 3300049529 Bacteria 6338
1175 Ga0501313_000081 3300049529 Bacteria 4439
1176 Ga0501313_000101 3300049529 Bacteria 4186
1177 Ga0501313_000156 3300049529 Bacteria 3685
1178 Ga0501313_000177 3300049529 Bacteria 3577
1179 Ga0501313_000360 3300049529 Bacteria 2976
1180 Ga0501313_000781 3300049529 Bacteria 2416
1181 Ga0501313_002469 3300049529 Bacteria 1755
1182 Ga0501313_009688 3300049529 Bacteria 1088
1183 Ga0501313_066252 3300049529 Bacteria 518
1184 Ga0501314_000067 3300049530 Bacteria 4577
1185 Ga0501314_000087 3300049530 Bacteria 4125
1186 Ga0501314_000447 3300049530 Bacteria 2571
1187 Ga0501314_000773 3300049530 Bacteria 2110
1188 Ga0501314_000973 3300049530 Bacteria 1944
1189 Ga0501314_002612 3300049530 Bacteria 1405
1190 Ga0501314_002668 3300049530 Bacteria 1394
1191 Ga0501314_011785 3300049530 Bacteria 831
1192 Ga0501314_025086 3300049530 Bacteria 639
1193 Ga0501315_000001 3300049531 Bacteria 13474
1194 Ga0501315_000002 3300049531 Bacteria 12594
1195 Ga0501315_000006 3300049531 Bacteria 10500
1196 Ga0501315_000069 3300049531 Bacteria 4729
1197 Ga0501315_000072 3300049531 Bacteria 4669
1198 Ga0501315_000123 3300049531 Bacteria 4189
1199 Ga0501315_004000 3300049531 Bacteria 1513
1200 Ga0501315_004080 3300049531 Bacteria 1505
1201 Ga0501315_006378 3300049531 Bacteria 1310
1202 Ga0501315_009053 3300049531 Bacteria 1170
1203 Ga0501315_009362 3300049531 Bacteria 1157
1204 Ga0501315_013906 3300049531 Bacteria 1014
1205 Ga0501315_019745 3300049531 Bacteria 899
1206 Ga0501315_022770 3300049531 Bacteria 856
1207 Ga0501315_034859 3300049531 Bacteria 740
1208 Ga0501316_000001 3300049532 Bacteria 15173
1209 Ga0501316_000045 3300049532 Bacteria 5250
1210 Ga0501316_000072 3300049532 Bacteria 4671
1211 Ga0501316_000081 3300049532 Bacteria 4529
1212 Ga0501316_000137 3300049532 Bacteria 3921
1213 Ga0501316_000268 3300049532 Bacteria 3268
1214 Ga0501316_002234 3300049532 Bacteria 1771
1215 Ga0501316_002272 3300049532 Bacteria 1762
1216 Ga0501316_003240 3300049532 Bacteria 1568
1217 Ga0501316_004064 3300049532 Bacteria 1452
1218 Ga0501316_005266 3300049532 Bacteria 1335
1219 Ga0501316_008561 3300049532 Bacteria 1132
1220 Ga0501316_023237 3300049532 Bacteria 795
1221 Ga0501316_026938 3300049532 Bacteria 754
1222 Ga0501316_032052 3300049532 Bacteria 707
1223 Ga0501316_037393 3300049532 Bacteria 668
1224 Ga0501317_000001 3300049533 Bacteria 21405
1225 Ga0501317_000003 3300049533 Bacteria 13878
1226 Ga0501317_000202 3300049533 Bacteria 3611
1227 Ga0501317_000414 3300049533 Bacteria 2936
1228 Ga0501317_000954 3300049533 Bacteria 2319
1229 Ga0501317_001025 3300049533 Bacteria 2270
1230 Ga0501317_002411 3300049533 Bacteria 1763
1231 Ga0501317_003838 3300049533 Bacteria 1527
1232 Ga0501317_005267 3300049533 Bacteria 1378
1233 Ga0501317_007181 3300049533 Bacteria 1249
1234 Ga0501317_026345 3300049533 Bacteria 820
1235 Ga0501317_030482 3300049533 Bacteria 780
1236 Ga0501317_031804 3300049533 Bacteria 769
1237 Ga0501317_043089 3300049533 Bacteria 696
1238 Ga0501318_000003 3300049534 Bacteria 10033
1239 Ga0501318_000052 3300049534 Bacteria 4702
1240 Ga0501318_000116 3300049534 Bacteria 3718
1241 Ga0501318_000386 3300049534 Bacteria 2719
1242 Ga0501318_002401 3300049534 Bacteria 1616
1243 Ga0501318_002638 3300049534 Bacteria 1576
1244 Ga0501318_003615 3300049534 Bacteria 1430
1245 Ga0501318_005761 3300049534 Bacteria 1242
1246 Ga0501318_009165 3300049534 Bacteria 1074
1247 Ga0501318_011919 3300049534 Bacteria 989
1248 Ga0501318_020816 3300049534 Bacteria 829
1249 Ga0501318_081964 3300049534 Bacteria 524
1250 Ga0501319_000003 3300049535 Bacteria 10442
1251 Ga0501319_000033 3300049535 Bacteria 4602
1252 Ga0501319_000047 3300049535 Bacteria 3949
1253 Ga0501319_000098 3300049535 Bacteria 3052
1254 Ga0501319_000238 3300049535 Bacteria 2328
1255 Ga0501319_000326 3300049535 Bacteria 2128
1256 Ga0501319_000845 3300049535 Bacteria 1612
1257 Ga0501319_002515 3300049535 Bacteria 1167
1258 Ga0501319_003450 3300049535 Bacteria 1057
1259 Ga0501320_000001 3300049536 Bacteria 15372
1260 Ga0501320_000002 3300049536 Bacteria 13169
1261 Ga0501320_000012 3300049536 Bacteria 8841
1262 Ga0501320_000063 3300049536 Bacteria 4821
1263 Ga0501320_000070 3300049536 Bacteria 4546
1264 Ga0501320_000071 3300049536 Bacteria 4538
1265 Ga0501320_000079 3300049536 Bacteria 4310
1266 Ga0501320_000092 3300049536 Bacteria 3944
1267 Ga0501320_001821 3300049536 Bacteria 1622
1268 Ga0501320_005312 3300049536 Bacteria 1169
1269 Ga0501320_025684 3300049536 Bacteria 707
1270 Ga0501321_000002 3300049537 Bacteria 13305
1271 Ga0501321_000023 3300049537 Bacteria 8227
1272 Ga0501321_000066 3300049537 Bacteria 4711
1273 Ga0501321_000083 3300049537 Bacteria 4326
1274 Ga0501321_000088 3300049537 Bacteria 4285
1275 Ga0501321_000089 3300049537 Bacteria 4280
1276 Ga0501321_000092 3300049537 Bacteria 4252
1277 Ga0501321_000225 3300049537 Bacteria 3248
1278 Ga0501321_002044 3300049537 Bacteria 1699
1279 Ga0501321_004287 3300049537 Bacteria 1357
1280 Ga0501321_009246 3300049537 Bacteria 1060
1281 Ga0501321_018443 3300049537 Bacteria 847
1282 Ga0501321_025183 3300049537 Bacteria 766
1283 Ga0501321_069210 3300049537 Bacteria 546
1284 Ga0501321_085769 3300049537 Bacteria 508
1285 Ga0501322_000007 3300049538 Bacteria 8971
1286 Ga0501322_000024 3300049538 Bacteria 7026
1287 Ga0501322_000043 3300049538 Bacteria 4891
1288 Ga0501322_000335 3300049538 Bacteria 2117
1289 Ga0501322_000404 3300049538 Bacteria 1996
1290 Ga0501322_003380 3300049538 Bacteria 1033
1291 Ga0501322_006340 3300049538 Bacteria 840
1292 Ga0501322_007924 3300049538 Bacteria 781
1293 Ga0501323_000005 3300049539 Bacteria 11153
1294 Ga0501323_000091 3300049539 Bacteria 4739
1295 Ga0501323_000116 3300049539 Bacteria 4416
1296 Ga0501323_000294 3300049539 Bacteria 3460
1297 Ga0501323_000308 3300049539 Bacteria 3416
1298 Ga0501323_000825 3300049539 Bacteria 2495
1299 Ga0501323_002710 3300049539 Bacteria 1745
1300 Ga0501323_004989 3300049539 Bacteria 1432
1301 Ga0501323_023914 3300049539 Bacteria 823
1302 Ga0501323_026259 3300049539 Bacteria 797
1303 Ga0501323_033552 3300049539 Bacteria 730
1304 Ga0501323_059398 3300049539 Bacteria 594
1305 Ga0501324_000001 3300049540 Bacteria 20831
1306 Ga0501324_000003 3300049540 Bacteria 13684
1307 Ga0501324_000076 3300049540 Bacteria 3543
1308 Ga0501324_000141 3300049540 Bacteria 3051
1309 Ga0501324_000153 3300049540 Bacteria 3001
1310 Ga0501324_000373 3300049540 Bacteria 2352
1311 Ga0501324_000408 3300049540 Bacteria 2275
1312 Ga0501324_002064 3300049540 Bacteria 1419
1313 Ga0501324_002534 3300049540 Bacteria 1330
1314 Ga0501324_003211 3300049540 Bacteria 1241
1315 Ga0501324_011962 3300049540 Bacteria 808
1316 Ga0501324_016729 3300049540 Bacteria 721
1317 Ga0501324_025677 3300049540 Bacteria 622
1318 Ga0501325_000006 3300049541 Bacteria 7014
1319 Ga0501325_010003 3300049541 Bacteria 852
1320 Ga0501325_047372 3300049541 Bacteria 539
1321 Ga0501326_00006 3300049542 Bacteria 8815
1322 Ga0501326_00033 3300049542 Bacteria 4407
1323 Ga0501326_00045 3300049542 Bacteria 3869
1324 Ga0501326_00113 3300049542 Bacteria 2596
1325 Ga0501326_00177 3300049542 Bacteria 2247
1326 Ga0501326_00291 3300049542 Bacteria 1884
1327 Ga0501326_03359 3300049542 Bacteria 818
1328 Ga0501327_00035 3300049543 Bacteria 4032
1329 Ga0501327_00036 3300049543 Bacteria 4030
1330 Ga0501327_00038 3300049543 Bacteria 4022
1331 Ga0501327_00062 3300049543 Bacteria 3238
1332 Ga0501327_00389 3300049543 Bacteria 1710
1333 Ga0501327_03039 3300049543 Bacteria 904
1334 Ga0501327_05531 3300049543 Bacteria 748
1335 Ga0501327_07490 3300049543 Bacteria 681
1336 Ga0501328_00011 3300049544 Bacteria 4464
1337 Ga0501328_00014 3300049544 Bacteria 4034
1338 Ga0501328_00064 3300049544 Bacteria 2493
1339 Ga0501328_00078 3300049544 Bacteria 2316
1340 Ga0501328_00270 3300049544 Bacteria 1610
1341 Ga0501328_00524 3300049544 Bacteria 1315
1342 Ga0501328_00940 3300049544 Bacteria 1085
1343 Ga0501328_05377 3300049544 Bacteria 643
1344 Ga0501329_00109 3300049545 Bacteria 2070
1345 Ga0501329_00157 3300049545 Bacteria 1886
1346 Ga0501329_00619 3300049545 Bacteria 1325
1347 Ga0501329_00684 3300049545 Bacteria 1287
1348 Ga0501329_03934 3300049545 Bacteria 775
1349 Ga0501330_000009 3300049546 Bacteria 5707
1350 Ga0501330_000038 3300049546 Bacteria 3323
1351 Ga0501330_000049 3300049546 Bacteria 3151
1352 Ga0501330_000139 3300049546 Bacteria 2405
1353 Ga0501330_000148 3300049546 Bacteria 2358
1354 Ga0501330_000288 3300049546 Bacteria 1963
1355 Ga0501330_000341 3300049546 Bacteria 1877
1356 Ga0501330_004276 3300049546 Bacteria 879
1357 Ga0501330_010335 3300049546 Bacteria 661
1358 Ga0501331_00009 3300049547 Bacteria 7351
1359 Ga0501331_00023 3300049547 Bacteria 4468
1360 Ga0501331_00073 3300049547 Bacteria 2981
1361 Ga0501331_00179 3300049547 Bacteria 2269
1362 Ga0501331_04401 3300049547 Bacteria 784
1363 Ga0501331_04852 3300049547 Bacteria 758
1364 Ga0501331_07867 3300049547 Bacteria 639
1365 Ga0501332_00052 3300049548 Bacteria 3335
1366 Ga0501332_00070 3300049548 Bacteria 3010
1367 Ga0501332_00114 3300049548 Bacteria 2627
1368 Ga0501332_00147 3300049548 Bacteria 2461
1369 Ga0501332_00490 3300049548 Bacteria 1741
1370 Ga0501332_00546 3300049548 Bacteria 1688
1371 Ga0501332_00671 3300049548 Bacteria 1589
1372 Ga0501332_01061 3300049548 Bacteria 1372
1373 Ga0501332_07606 3300049548 Bacteria 693
1374 Ga0501332_12791 3300049548 Bacteria 579
1375 Ga0501333_000018 3300049549 Bacteria 4669
1376 Ga0501333_000173 3300049549 Bacteria 2529
1377 Ga0501333_001147 3300049549 Bacteria 1385
1378 Ga0501333_001361 3300049549 Bacteria 1311
1379 Ga0501333_001637 3300049549 Bacteria 1237
1380 Ga0501333_006626 3300049549 Bacteria 774
1381 Ga0501333_018569 3300049549 Bacteria 544
1382 Ga0501334_00014 3300049550 Bacteria 5746
1383 Ga0501334_00103 3300049550 Bacteria 2834
1384 Ga0501334_00634 3300049550 Bacteria 1695
1385 Ga0501334_00670 3300049550 Bacteria 1657
1386 Ga0501334_00728 3300049550 Bacteria 1623
1387 Ga0501334_05436 3300049550 Bacteria 841
1388 Ga0501334_06574 3300049550 Bacteria 787
1389 Ga0501335_000067 3300049551 Bacteria 4406
1390 Ga0501335_000116 3300049551 Bacteria 3814
1391 Ga0501335_000229 3300049551 Bacteria 3163
1392 Ga0501335_000692 3300049551 Bacteria 2301
1393 Ga0501335_001159 3300049551 Bacteria 1968
1394 Ga0501335_001571 3300049551 Bacteria 1766
1395 Ga0501335_002088 3300049551 Bacteria 1596
1396 Ga0501335_003479 3300049551 Bacteria 1336
1397 Ga0501335_003699 3300049551 Bacteria 1308
1398 Ga0501335_019322 3300049551 Bacteria 718
1399 Ga0501335_037724 3300049551 Bacteria 563
1400 Ga0501335_037801 3300049551 Bacteria 562
1401 Ga0501336_000153 3300049552 Bacteria 2818
1402 Ga0501336_000332 3300049552 Bacteria 2220
1403 Ga0501336_000441 3300049552 Bacteria 2054
1404 Ga0501336_000875 3300049552 Bacteria 1664
1405 Ga0501336_008578 3300049552 Bacteria 793
1406 Ga0501336_015660 3300049552 Bacteria 652
1407 Ga0501336_024727 3300049552 Bacteria 564
1408 Ga0501337_000050 3300049553 Bacteria 4082
1409 Ga0501337_000067 3300049553 Bacteria 3692
1410 Ga0501337_000117 3300049553 Bacteria 3085
1411 Ga0501337_000129 3300049553 Bacteria 2985
1412 Ga0501337_000210 3300049553 Bacteria 2561
1413 Ga0501337_000366 3300049553 Bacteria 2148
1414 Ga0501337_000430 3300049553 Bacteria 2043
1415 Ga0501337_000441 3300049553 Bacteria 2028
1416 Ga0501337_001638 3300049553 Bacteria 1298
1417 Ga0501337_002599 3300049553 Bacteria 1114
1418 Ga0501337_003887 3300049553 Bacteria 963
1419 Ga0501338_00021 3300049554 Bacteria 4344
1420 Ga0501338_00230 3300049554 Bacteria 2293
1421 Ga0501338_00355 3300049554 Bacteria 1984
1422 Ga0501338_00393 3300049554 Bacteria 1919
1423 Ga0501338_00890 3300049554 Bacteria 1489
1424 Ga0501338_01217 3300049554 Bacteria 1343
1425 Ga0501338_01946 3300049554 Bacteria 1149
1426 Ga0501338_10168 3300049554 Bacteria 632
1427 Ga0501339_00012 3300049555 Bacteria 2260
1428 Ga0501339_00086 3300049555 Bacteria 1322
1429 Ga0501339_00171 3300049555 Bacteria 1117
1430 Ga0501340_000004 3300049556 Bacteria 7126
1431 Ga0501340_000016 3300049556 Bacteria 4372
1432 Ga0501340_000079 3300049556 Bacteria 2964
1433 Ga0501340_001704 3300049556 Bacteria 1216
1434 Ga0501036_1689582 3300049572 Bacteria 510
1435 Ga0501040_0507174 3300049576 Bacteria 870
1436 Ga0501041_0249557 3300049577 Bacteria 1116
1437 Ga0501041_0883091 3300049577 Bacteria 574
1438 Ga0501069_0210701 3300049585 Bacteria 1128
1439 Ga0501070_0119413 3300049586 Bacteria 2179
1440 Ga0501071_0290387 3300049587 Bacteria 1238
1441 Ga0501074_0192033 3300049590 Bacteria 1456
1442 Ga0501202_022556 3300049652 Bacteria 1265
1443 Ga0501216_070041 3300049660 Bacteria 723
1444 Ga0501217_012050 3300049661 Bacteria 1920
1445 Ga0501217_015074 3300049661 Bacteria 1755
1446 Ga0501217_287719 3300049661 Bacteria 539
1447 Ga0501217_343473 3300049661 Bacteria 501
1448 Ga0501224_053640 3300049664 Bacteria 621
1449 Ga0501227_012962 3300049665 Bacteria 1831
1450 Ga0501228_002303 3300049666 Bacteria 1485
1451 Ga0501230_097915 3300049667 Bacteria 630
1452 Ga0501233_007708 3300049668 Bacteria 2056
1453 Ga0501233_145156 3300049668 Bacteria 658
1454 Ga0501243_022949 3300049675 Bacteria 1036
1455 Ga0501252_020433 3300049682 Bacteria 861
1456 Ga0501252_081246 3300049682 Bacteria 537
1457 Ga0501260_023599 3300049689 Bacteria 678
1458 Ga0501221_089407 3300049704 Bacteria 751
1459 Ga0501225_0027148 3300049705 Bacteria 1575
1460 Ga0501234_002810 3300049707 Bacteria 2739
1461 Ga0501234_106616 3300049707 Bacteria 513
1462 Ga0501080_0504979 3300049742 Bacteria 1080
1463 Ga0501083_0323354 3300049744 Bacteria 1003
1464 Ga0501083_0827020 3300049744 Bacteria 603
1465 Ga0501232_007698 3300049757 Bacteria 1142
1466 Ga0501265_069563 3300049762 Bacteria 592
1467 Ga0501266_006221 3300049763 Bacteria 1486
1468 Ga0501270_012080 3300049767 Bacteria 1171
1469 Ga0501271_044575 3300049768 Bacteria 587
1470 Ga0501283_084321 3300049779 Bacteria 602
1471 Ga0501212_018124 3300049851 Bacteria 1070
1472 nmdc:mga00v17_210410_c1 3300050491 Bacteria 1258
1473 nmdc:mga05p37_2088575_c1 3300050507 Bacteria 531
1474 nmdc:mga09592_810971_c1 3300050508 Bacteria 791
1475 Ga0495601_0280867 3300053077 Bacteria 1085
1476 Ga0495612_0116498 3300053078 Bacteria 1147
1477 Ga0495619_0209672 3300053085 Bacteria 1349
1478 Ga0500559_0070899 3300053136 Bacteria 1569
1479 Ga0501084_0281749 3300054114 Bacteria 1404
1480 Ga0587084_000095 3300059477 Bacteria 4738
1481 Ga0587084_012948 3300059477 Bacteria 1139
1482 Ga0587084_045642 3300059477 Bacteria 759
1483 Ga0587066_094474 3300059490 Bacteria 669
1484 Ga0587070_000002 3300059491 Bacteria 12188
1485 Ga0587077_068645 3300059493 Bacteria 787
1486 Ga0587080_000328 3300059503 Bacteria 3733
1487 Ga0587080_008939 3300059503 Bacteria 1446
1488 Ga0587082_000432 3300059504 Bacteria 3459
1489 Ga0587082_099346 3300059504 Bacteria 632
1490 Ga0587083_0000091 3300059505 Bacteria 5311
1491 Ga0587083_0000526 3300059505 Bacteria 3491
1492 Ga0587083_0000533 3300059505 Bacteria 3476
1493 Ga0587088_067862 3300059508 Bacteria 737
1494 Ga0587098_007400 3300059604 Bacteria 1142
1495 Ga0587098_031131 3300059604 Bacteria 735
1496 Ga0587098_095429 3300059604 Bacteria 512
1497 Ga0587106_013355 3300059605 Bacteria 1115
1498 Ga0587106_016970 3300059605 Bacteria 1036
1499 Ga0587106_055808 3300059605 Bacteria 713
1500 Ga0587099_017892 3300059622 Bacteria 778
1501 Ga0587117_112854 3300059627 Bacteria 530
1502 Ga0587067_000283 3300059640 Bacteria 4105
1503 Ga0587067_001715 3300059640 Bacteria 2449
1504 Ga0587067_002029 3300059640 Bacteria 2324
1505 Ga0587067_003704 3300059640 Bacteria 1931
1506 Ga0587067_004378 3300059640 Bacteria 1837
1507 Ga0587067_011104 3300059640 Bacteria 1381
1508 Ga0587067_039947 3300059640 Bacteria 907
1509 Ga0587067_060736 3300059640 Bacteria 791
1510 Ga0587068_000132 3300059641 Bacteria 5110
1511 Ga0587068_106966 3300059641 Bacteria 593
1512 Ga0587068_126383 3300059641 Bacteria 559
1513 Ga0587072_000119 3300059643 Bacteria 6451
1514 Ga0587072_003946 3300059643 Bacteria 2120
1515 Ga0587072_009490 3300059643 Bacteria 1556
1516 Ga0587072_042549 3300059643 Bacteria 887
1517 Ga0587072_055571 3300059643 Bacteria 804
1518 Ga0587072_061289 3300059643 Bacteria 775
1519 Ga0587072_075731 3300059643 Bacteria 718
1520 Ga0587072_116821 3300059643 Bacteria 614
1521 Ga0587072_141659 3300059643 Bacteria 574
1522 Ga0587075_046622 3300059644 Bacteria 744
1523 Ga0587075_079649 3300059644 Bacteria 623
1524 Ga0587076_000045 3300059645 Bacteria 6063
1525 Ga0587076_008511 3300059645 Bacteria 1434
1526 Ga0587076_010133 3300059645 Bacteria 1354
1527 Ga0587076_076164 3300059645 Bacteria 707
1528 Ga0587076_110746 3300059645 Bacteria 625
1529 Ga0587079_000002 3300059647 Bacteria 12575
1530 Ga0587079_008968 3300059647 Bacteria 1544
1531 Ga0587079_011374 3300059647 Bacteria 1432
1532 Ga0587079_042551 3300059647 Bacteria 923
1533 Ga0587114_044794 3300059655 Bacteria 729
1534 Ga0587060_000803 3300060243 Bacteria 1889
1535 Ga0587060_001840 3300060243 Bacteria 1431
1536 Ga0587111_0257428 3300060346 Bacteria 519
1537 Ga0501082_1104744 3300060353 Bacteria 693
1538 2511180936 2510917027 Bacteria 5287437
1539 2511698003 2511231119 Bacteria 4019861
1540 2512736526 2512564039 Bacteria 8739048
1541 2524190000 2524023129 Bacteria 6762600
1542 2545559758 2545555800 Bacteria 4222588
1543 2550903220 2548877040 Bacteria 7507281
1544 2555470884 2554235283 Bacteria 3683090
1545 2556065794 2554235469 Bacteria 3590176
1546 2563930192 2563366752 Bacteria 4961801
1547 2571530807 2571042143 Bacteria 6986194
1548 2573041366 2571042588 Bacteria 5045676
1549 2578338884 2576861424 Bacteria 5270569
1550 2578930715 2576861599 Bacteria 4217202
1551 2580930507 2579778775 Bacteria 5360914
1552 2587744072 2585428059 Bacteria 8696589
1553 2595092271 2593339131 Bacteria 5116855
1554 2595320872 2593339198 Bacteria 7267884
1555 2601641757 2600255286 Bacteria 5390125
1556 2621273296 2619619294 Bacteria 5575484
1557 2631982461 2630968484 Bacteria 3876276
1558 2643738842 2643221543 Bacteria 6628015
1559 2644424492 2643221676 Bacteria 8119172
1560 2644705730 2643221729 Bacteria 6621700
1561 2644713251 2643221730 Bacteria 6523787
1562 2644721340 2643221731 Bacteria 5623886
1563 2644723325 2643221732 Bacteria 5756404
1564 2644741862 2643221735 Bacteria 3676263
1565 2651530326 2648501850 Bacteria 3975476
1566 2672333589 2671180330 Bacteria 5521719
1567 2673821722 2671180694 Bacteria 7506943
1568 2674421119 2671180844 Bacteria 4164150
1569 2685148207 2684622632 Bacteria 5380049
1570 2686995326 2684623153 Bacteria 3878815
1571 2687496575 2687453109 Bacteria 3860091
1572 2695629923 2695420354 Bacteria 3922431
1573 2698319633 2695420987 Bacteria 6152737
1574 2705992008 2703719227 Bacteria 5631989
1575 2712198868 2711768088 Bacteria 3195027
1576 2717918178 2716884898 Bacteria 3928789
1577 2721503436 2718218445 Bacteria 5113413
1578 2723606194 2721755693 Bacteria 6126117
1579 2728529894 2728368933 Bacteria 7044283
1580 2730136817 2728369359 Bacteria 5621728
1581 2738817103 2738541295 Bacteria 5730091
1582 2739160165 2738541358 Bacteria 5932299
1583 2739212639 2738543006 Bacteria 5904091
1584 2739234635 2738543010 Bacteria 5583595
1585 2739271692 2738543017 Bacteria 4271950
1586 2753813080 2751185905 Bacteria 6142767
1587 2757568906 2757320391 Bacteria 4746095
1588 2777764209 2775507177 Bacteria 4384303
1589 2777837284 2775507192 Bacteria 4622234
1590 2793182071 2791355222 Bacteria 5898266
1591 2802440724 2802428803 Bacteria 5806948
1592 2809057184 2808606399 Bacteria 4021018
1593 2812314465 2811994870 Bacteria 3776934
1594 2816866378 2816332186 Bacteria 5331395
1595 2817478191 2816332295 Bacteria 4352468
1596 2819571031 2818991441 Bacteria 5062707
1597 2819585037 2818991443 Bacteria 6598732
1598 2819676101 2818991459 Bacteria 8736032
1599 2819711999 2818991465 Bacteria 5388835
1600 2819726066 2818991468 Bacteria 3723169
1601 2821118321 2821111986 Bacteria 6894338
1602 2823526418 2823526263 Bacteria 3765752
1603 2842688276 2842682962 Bacteria 5589973
1604 2842887723 2842882022 Bacteria 6158489
1605 2849144970 2849139964 Bacteria 5613304
1606 2857460103 2857453340 Bacteria 8090534
1607 2857478327 2857472729 Bacteria 6568124
1608 2857586482 2857581216 Bacteria 5522813
1609 2857590956 2857586860 Bacteria 4354574
1610 2857608869 2857604169 Bacteria 5111450
1611 2860837582 2860837431 Bacteria 4202080
1612 2864738871 2864733723 Bacteria 6770668
1613 2865002024 2864997549 Bacteria 5139696
1614 2865007641 2865002811 Bacteria 6333767
1615 2877768801 2877768649 Bacteria 3957164
1616 2880169743 2880169592 Bacteria 3900066
1617 2881639977 2881636855 Bacteria 5205297
1618 2881646638 2881644220 Bacteria 5302661
1619 2885529915 2885526491 Bacteria 7164189
1620 2888584461 2888578766 Bacteria 6743310
1621 2889048009 2889042446 Bacteria 7618936
1622 2889053093 2889049205 Bacteria 7524325
1623 2889276747 2889276214 Bacteria 5979355
1624 2889298944 2889295896 Bacteria 4704906
1625 2897109770 2897109615 Bacteria 4009619
1626 2904168154 2904162308 Bacteria 7086713
1627 2904496949 2904490793 Bacteria 7046938
1628 2904530167 2904524088 Bacteria 5887454
1629 2904564592 2904560550 Bacteria 4029838
1630 2904600780 2904595352 Bacteria 6124848
1631 2904755673 2904755435 Bacteria 7986759
1632 2907208199 2907202186 Bacteria 6632024
1633 2908669317 2908665501 Bacteria 3678115
1634 2915610001 2915606848 Bacteria 6032732
1635 2919097075 2919093281 Bacteria 3660974
1636 2919149636 2919143609 Bacteria 6219228
1637 2919166248 2919160200 Bacteria 6929020
1638 2919419355 2919414237 Bacteria 5429133
1639 2919432412 2919425241 Bacteria 8055701
1640 2919523191 2919517244 Bacteria 5858162
1641 2919726412 2919720352 Bacteria 5986006
1642 2919730768 2919726948 Bacteria 3696050
1643 2925332838 2925326138 Bacteria 9652120
1644 2928099915 2928093941 Bacteria 5965005
1645 2929009902 2929004312 Bacteria 5678476
1646 2929211882 2929206907 Bacteria 5918291
1647 2929233263 2929233124 Bacteria 5948380
1648 2929298371 2929297113 Bacteria 3141306
1649 2931385115 2931384279 Bacteria 7299545
1650 2936343059 2936340661 Bacteria 5139038
1651 2936363694 2936361878 Bacteria 5632809
1652 2938653387 2938649242 Bacteria 7118381
1653 2938917433 2938917290 Bacteria 5914775
1654 2939685123 2939679117 Bacteria 6921672
1655 2939707603 2939702853 Bacteria 5139229
1656 2945996262 2945991243 Bacteria 7008369
1657 2946058952 2946053406 Bacteria 6978655
1658 2947426731 2947426588 Bacteria 5357194
1659 2954776078 2954773129 Bacteria 3741715
1660 2956900798 2956897341 Bacteria 5447711
1661 2960324283 2960319331 Bacteria 5502575
1662 2960378894 2960375949 Bacteria 5361395
1663 2962290793 2962290636 Bacteria 4072939
1664 2965761265 2965761152 Bacteria 5806513
1665 2968562363 2968558590 Bacteria 6956864
1666 2969137000 2969136845 Bacteria 3923176
1667 2969141169 2969141011 Bacteria 4118468
1668 2969766251 2969765954 Bacteria 4216713
1669 2969774919 2969770375 Bacteria 4271280
1670 2971406755 2971403814 Bacteria 7370929
1671 2971410928 2971410472 Bacteria 8311090
1672 2971513789 2971511577 Bacteria 5404012
1673 2971893530 2971893375 Bacteria 3929648
1674 2977254693 2977254563 Bacteria 4828420
1675 2979083741 2979083700 Bacteria 5894929
1676 2980128575 2980125574 Bacteria 5567337
1677 2980179442 2980176882 Bacteria 5397533
1678 2980186830 2980182181 Bacteria 9454109
1679 2980492744 2980492589 Bacteria 4072961
1680 2981289522 2981284811 Bacteria 4641497
1681 2981294459 2981289755 Bacteria 4641509
1682 2981985115 2981980479 Bacteria 4641628
1683 2981990046 2981985349 Bacteria 4641497
1684 2984531161 2984527788 Bacteria 5288478
1685 2984537270 2984532647 Bacteria 5288506
1686 2988229870 2988225383 Bacteria 7221625
1687 2990275696 2990275345 Bacteria 4887158
1688 2996636942 2996632988 Bacteria 6921523
1689 2996707485 2996706504 Bacteria 5757485
1690 3001271875 3001267043 Bacteria 4823521
1691 3001275961 3001272096 Bacteria 4729684
1692 3001898794 3001892409 Bacteria 6328293
1693 3006858519 3006858327 Bacteria 4317835
1694 3006883631 3006879489 Bacteria 4064221
1695 3006980026 3006978542 Bacteria 5328100
1696 648172187 648028048 Bacteria 5394884
1697 8002318133 8002317523 Bacteria 8051857
1698 8022621217 8022621104 Bacteria 5241040
1699 8022631638 8022630665 Bacteria 3886130
1700 8022655880 8022653035 Bacteria 4035078
1701 8022799056 8022792930 Bacteria 5693794
1702 8022893435 8022893055 Bacteria 5300455
1703 8022917915 8022914991 Bacteria 5584517
1704 8023439812 8023438354 Bacteria 5779374
1705 8023447391 8023444577 Bacteria 5661597
1706 8046991300 8046991243 Bacteria 8497463
1707 8051956513 8051952484 Bacteria 3926774
1708 8052174989 8052174270 Bacteria 3881265
1709 8054282865 8054280661 Bacteria 4232245
1710 8054471310 8054465665 Bacteria 7323556
1711 8054801995 8054795415 Bacteria 9785225
1712 8055634017 8055632911 Bacteria 5283357
1713 8056535609 8056533031 Bacteria 8964429
1714 8057473381 8057473075 Bacteria 5892720
1715 8057582798 8057582654 Bacteria 5218944
1716 8057632288 8057632132 Bacteria 4726859
1717 8057735139 8057733483 Bacteria 6578323
1718 8057979872 8057977335 Bacteria 5694872
1719 Ga0496116_0003454
1720 SwRhRL2b_contig_213193
1721 JGI24736J21556_1046494
1722 JGI24740J21852_10082807
1723 JGI24743J22301_10016305
1724 JGI24033J26618_1020881
1725 JGI25151J46595_10000678
1726 JGI25151J46595_10000735
1727 JGI25151J46595_10009543
1728 JGI25151J46595_10009794
1729 JGI25151J46595_10012392
1730 JGI25151J46595_10136169
1731 JGI25165J46597_1016815
1732 rootH1_10000848
1733 rootH2_10053907
1734 rootL2_10000406
1735 rootL2_10015753
1736 Ga0006554J51385_1033852
1737 Ga0006562J51391_1000046
1738 Ga0006562J51391_1000361
1739 Ga0006562J51391_1000677
1740 Ga0006562J51391_1015323
1741 Ga0055538_1000286
1742 Ga0055532_1000266
1743 Ga0055532_1003438
1744 Ga0055532_1028664
1745 Ga0055535_1000913
1746 Ga0055536_1032063
1747 Ga0055528_1000586
1748 Ga0055541_1000319
1749 Ga0055541_1001260
1750 Ga0055541_1001864
1751 Ga0055541_1024461
1752 Ga0058692_1040989
1753 Ga0058863_10038888
1754 Ga0058863_11363707
1755 Ga0058863_11799934
1756 Ga0058861_11402842
1757 Ga0058861_12067592
1758 Ga0058862_12871386
1759 Ga0065165_1062104
1760 Ga0065704_10156589
1761 Ga0070658_10010767
1762 Ga0070658_10028665
1763 Ga0070658_10113875
1764 Ga0070658_10530949
1765 Ga0070676_10003937
1766 Ga0070676_10038362
1767 Ga0070683_100007295
1768 Ga0070683_100055839
1769 Ga0070683_100218692
1770 Ga0070683_100292648
1771 Ga0070683_100671922
1772 Ga0070683_101593584
1773 Ga0070670_100003586
1774 Ga0070670_100005012
1775 Ga0070670_100076604
1776 Ga0068869_100012179
1777 Ga0068869_100035406
1778 Ga0070666_10026243
1779 Ga0070666_10030632
1780 Ga0070666_10433297
1781 Ga0070680_100002604
1782 Ga0070680_100137049
1783 Ga0070680_100185617
1784 Ga0070680_100315371
1785 Ga0070680_101874588
1786 Ga0070682_100139157
1787 Ga0070682_101285441
1788 Ga0068868_100001679
1789 Ga0068868_100015707
1790 Ga0068868_100038932
1791 Ga0070660_100486432
1792 Ga0070660_100619230
1793 Ga0070660_100790164
1794 Ga0070691_10991025
1795 Ga0070661_100025903
1796 Ga0070661_100107733
1797 Ga0070661_100438434
1798 Ga0070668_100741717
1799 Ga0070668_101017090
1800 Ga0070669_100014591
1801 Ga0070669_100298492
1802 Ga0070675_100012859
1803 Ga0070675_100035195
1804 Ga0070675_101599526
1805 Ga0070671_100003263
1806 Ga0070671_100014943
1807 Ga0070671_100191065
1808 Ga0070673_100013868
1809 Ga0070659_100094581
1810 Ga0070659_100762408
1811 Ga0070659_102027902
1812 Ga0070667_100001517
1813 Ga0070667_100027341
1814 Ga0070709_10947728
1815 Ga0070709_11124461
1816 Ga0070709_11366420
1817 Ga0070709_11453456
1818 Ga0070714_100418659
1819 Ga0070714_101925157
1820 Ga0070713_100069410
1821 Ga0070713_100113217
1822 Ga0070713_100622588
1823 Ga0070710_10463050
1824 Ga0070710_10670491
1825 Ga0070711_100115645
1826 Ga0070711_100479857
1827 Ga0070708_100327370
1828 Ga0070663_100443489
1829 Ga0070663_101619885
1830 Ga0070663_102002259
1831 Ga0070678_100033078
1832 Ga0070681_10001062
1833 Ga0070681_10113171
1834 Ga0070681_10289580
1835 Ga0070681_10646948
1836 Ga0070681_11010173
1837 Ga0068867_100145111
1838 Ga0070706_100200060
1839 Ga0070707_100147928
1840 Ga0070698_100384297
1841 Ga0070699_100237826
1842 Ga0070679_100060017
1843 Ga0070679_100066127
1844 Ga0070679_100067206
1845 Ga0070679_100294226
1846 Ga0070679_101671013
1847 Ga0070684_100043376
1848 Ga0070684_100082885
1849 Ga0070684_100495127
1850 Ga0070684_100937542
1851 Ga0070684_100960489
1852 Ga0070697_100310175
1853 Ga0068853_100001096
1854 Ga0068853_100133809
1855 Ga0068853_100142757
1856 Ga0068853_100364943
1857 Ga0068853_100983581
1858 Ga0070672_100168746
1859 Ga0070672_100223348
1860 Ga0070665_100015044
1861 Ga0070665_100065929
1862 Ga0070665_100092190
1863 Ga0070704_101856817
1864 Ga0068855_100000642
1865 Ga0068855_100005786
1866 Ga0068855_100019267
1867 Ga0068855_100077022
1868 Ga0068855_100146849
1869 Ga0068855_100433886
1870 Ga0068855_100540482
1871 Ga0070664_100070029
1872 Ga0070664_100769851
1873 Ga0068857_100024212
1874 Ga0068857_100154377
1875 Ga0068857_100237069
1876 Ga0068857_100519894
1877 Ga0068854_100081038
1878 Ga0068854_100311965
1879 Ga0068854_100902952
1880 Ga0068856_100010942
1881 Ga0068856_100018870
1882 Ga0068856_100104028
1883 Ga0068856_100511850
1884 Ga0068856_100805980
1885 Ga0068856_101150623
1886 Ga0068856_101505192
1887 Ga0068856_101591523
1888 Ga0068852_100024674
1889 Ga0068852_100054705
1890 Ga0068852_100220948
1891 Ga0068852_100315455
1892 Ga0068852_100355062
1893 Ga0068852_100674498
1894 Ga0068852_100845663
1895 Ga0068852_100869877
1896 Ga0068859_100022836
1897 Ga0068864_100005797
1898 Ga0068864_100071645
1899 Ga0068851_10018984
1900 Ga0068851_10034554
1901 Ga0068851_10375856
1902 Ga0068851_10381747
1903 Ga0068851_10729687
1904 Ga0068870_10034626
1905 Ga0068863_100005496
1906 Ga0068858_100047133
1907 Ga0068858_100057329
1908 Ga0068860_100000786
1909 Ga0068860_100545493
1910 Ga0068862_100808179
1911 Ga0068862_101712281
1912 Ga0070717_10045133
1913 Ga0070717_10275992
1914 Ga0070717_12045167
1915 Ga0070715_10360263
1916 Ga0070712_100369334
1917 Ga0070712_100369860
1918 Ga0070712_101438966
1919 Ga0070712_101537332
1920 Ga0075367_10998897
1921 Ga0097621_100005101
1922 Ga0097621_100109961
1923 Ga0075370_10747646
1924 Ga0068871_100004090
1925 Ga0068871_100018858
1926 Ga0075430_101041394
1927 Ga0075429_100640588
1928 Ga0068865_100390365
1929 Ga0097620_100022837
1930 Ga0105251_10002306
1931 Ga0105251_10077887
1932 Ga0105251_10241236
1933 Ga0105244_10012810
1934 Ga0105244_10041217
1935 Ga0105244_10062257
1936 Ga0105244_10445696
1937 Ga0105244_10527490
1938 Ga0105250_10059344
1939 Ga0105240_10020515
1940 Ga0105240_10023114
1941 Ga0105240_10032555
1942 Ga0105240_10050651
1943 Ga0105240_10057620
1944 Ga0105240_10257917
1945 Ga0105240_10293798
1946 Ga0105240_10907968
1947 Ga0105240_12347450
1948 Ga0105240_12536730
1949 Ga0105245_10000731
1950 Ga0105245_10007135
1951 Ga0105245_10191213
1952 Ga0105245_10244214
1953 Ga0105245_11387320
1954 Ga0105247_10000354
1955 Ga0105247_10054318
1956 Ga0105247_10303362
1957 Ga0105247_10955169
1958 Ga0114129_12927940
1959 Ga0114129_13214632
1960 Ga0105243_10000301
1961 Ga0105243_11045142
1962 Ga0105241_10003327
1963 Ga0105241_10019071
1964 Ga0105241_10046891
1965 Ga0105241_10283985
1966 Ga0105242_10003155
1967 Ga0105242_11651624
1968 Ga0105248_10002627
1969 Ga0105248_10006787
1970 Ga0105248_10740796
1971 Ga0105248_12095466
1972 Ga0105248_12344769
1973 Ga0105237_10036030
1974 Ga0105237_10036694
1975 Ga0105237_10184786
1976 Ga0105237_10388491
1977 Ga0105237_10949913
1978 Ga0105237_11496270
1979 Ga0105238_10010551
1980 Ga0105238_10031377
1981 Ga0105238_10196265
1982 Ga0105238_10230359
1983 Ga0105238_10494404
1984 Ga0105238_11386598
1985 Ga0105238_11461412
1986 Ga0105238_11929273
1987 Ga0105249_10087450
1988 Ga0105249_10267104
1989 Ga0105239_10009258
1990 Ga0105239_10014845
1991 Ga0105239_10018959
1992 Ga0105239_10428367
1993 Ga0105239_10770450
1994 Ga0105239_11111053
1995 Ga0105239_11447239
1996 Ga0105246_10000077
1997 Ga0105246_10004133
1998 Ga0105246_10025174
1999 Ga0105246_10082771
2000 Ga0157373_10107156
2001 Ga0157373_10272511
2002 Ga0157373_10709039
2003 Ga0157371_10156861
2004 Ga0157371_10252764
2005 Ga0157371_10626220
2006 Ga0157370_10001390
2007 Ga0157370_10006622
2008 Ga0157370_10127454
2009 Ga0157370_10526723
2010 Ga0157370_10642220
2011 Ga0157370_10864940
2012 Ga0157369_10004351
2013 Ga0157369_10008438
2014 Ga0157369_10013194
2015 Ga0157369_10069033
2016 Ga0157369_10234339
2017 Ga0157369_10257505
2018 Ga0157369_10549164
2019 Ga0157369_10696510
2020 Ga0157369_11186870
2021 Ga0157369_11625291
2022 Ga0157369_11925178
2023 Ga0157374_10002988
2024 Ga0157374_10010090
2025 Ga0157374_10043454
2026 Ga0157374_10045280
2027 Ga0157374_10070986
2028 Ga0157374_10267053
2029 Ga0157374_10636731
2030 Ga0157374_10656450
2031 Ga0157378_10000237
2032 Ga0157378_10019987
2033 Ga0157378_10020240
2034 Ga0157378_10030845
2035 Ga0157378_10039530
2036 Ga0163162_10031415
2037 Ga0163162_10120074
2038 Ga0163162_13486915
2039 Ga0157372_10000424
2040 Ga0157372_10065708
2041 Ga0157372_10092295
2042 Ga0157372_10128758
2043 Ga0157372_10130936
2044 Ga0157372_10313368
2045 Ga0157372_10528821
2046 Ga0157372_10593241
2047 Ga0157372_11394363
2048 Ga0157372_11485178
2049 Ga0157372_12288291
2050 Ga0157375_10024173
2051 Ga0157375_10083448
2052 Ga0157375_10084569
2053 Ga0163163_10008178
2054 Ga0163163_10101857
2055 Ga0182008_10050838
2056 Ga0157377_10000299
2057 Ga0157379_10007463
2058 Ga0157379_10072913
2059 Ga0157379_10339244
2060 Ga0157379_11775534
2061 Ga0157376_10001057
2062 Ga0157376_10004748
2063 Ga0157376_10027401
2064 Ga0157376_10584539
2065 Ga0157376_10598071
2066 Ga0163161_10831402
2067 Ga0197907_10927678
2068 Ga0197907_11334415
2069 Ga0206356_10096944
2070 Ga0206351_10499662
2071 Ga0206352_10848511
2072 Ga0206352_11344399
2073 Ga0206350_10067152
2074 Ga0206350_11376406
2075 Ga0206353_10888394
2076 Ga0206353_11437168
2077 Ga0206353_11689256
2078 Ga0213876_10401832
2079 Ga0224712_10009206
2080 Ga0224712_10042705
2081 Ga0224712_10463267
2082 Ga0256744_107106
2083 Ga0209784_100141
2084 Ga0209784_104860
2085 Ga0209566_100221
2086 Ga0209566_100273
2087 Ga0209566_100512
2088 Ga0209566_103758
2089 Ga0209147_100198
2090 Ga0209147_100385
2091 Ga0209147_101980
2092 Ga0209147_107627
2093 Ga0209437_100331
2094 Ga0209437_106937
2095 Ga0209258_100927
2096 Ga0209233_1002003
2097 Ga0209673_1001330
2098 Ga0209130_1014791
2099 Ga0209130_1015250
2100 Ga0209130_1053714
2101 Ga0209130_1057683
2102 Ga0209675_1004714
2103 Ga0209675_1035822
2104 Ga0209675_1041839
2105 Ga0209676_1000745
2106 Ga0209025_1000639
2107 Ga0209025_1000976
2108 Ga0209025_1001421
2109 Ga0209025_1010512
2110 Ga0209025_1014524
2111 Ga0209025_1015652
2112 Ga0209025_1045113
2113 Ga0209025_1049611
2114 Ga0209025_1055754
2115 Ga0209025_1083683
2116 Ga0207426_1023848
2117 Ga0207426_1161456
2118 Ga0207697_10017259
2119 Ga0207656_10087909
2120 Ga0207656_10212377
2121 Ga0207696_1000471
2122 Ga0207696_1001142
2123 Ga0207655_1000971
2124 Ga0207655_1001486
2125 Ga0207655_1039477
2126 Ga0207655_1130267
2127 Ga0207655_1197922
2128 Ga0207655_1215894
2129 Ga0207655_1229809
2130 Ga0207713_1000405
2131 Ga0207713_1007861
2132 Ga0207713_1012576
2133 Ga0207692_10425061
2134 Ga0207692_10816738
2135 Ga0207710_10000981
2136 Ga0207710_10006009
2137 Ga0207688_10525463
2138 Ga0207680_10040705
2139 Ga0207680_10114336
2140 Ga0207680_10286564
2141 Ga0207647_10004892
2142 Ga0207647_10020423
2143 Ga0207685_10529278
2144 Ga0207685_10538842
2145 Ga0207699_10380011
2146 Ga0207699_10752201
2147 Ga0207645_10007324
2148 Ga0207645_10024412
2149 Ga0207643_10071627
2150 Ga0207705_10035811
2151 Ga0207705_10049624
2152 Ga0207705_10514440
2153 Ga0207705_10542378
2154 Ga0207705_10651369
2155 Ga0207684_10019216
2156 Ga0207654_10001818
2157 Ga0207654_10013381
2158 Ga0207654_10049266
2159 Ga0207654_10335367
2160 Ga0207707_10000624
2161 Ga0207707_10233542
2162 Ga0207707_10593043
2163 Ga0207695_10000379
2164 Ga0207695_10000384
2165 Ga0207695_10001178
2166 Ga0207695_10003215
2167 Ga0207695_10189409
2168 Ga0207695_10193386
2169 Ga0207695_10448132
2170 Ga0207695_10549223
2171 Ga0207695_10860868
2172 Ga0207671_10000071
2173 Ga0207671_10000503
2174 Ga0207671_10029151
2175 Ga0207671_10968842
2176 Ga0207671_11301378
2177 Ga0207693_10021027
2178 Ga0207693_10374482
2179 Ga0207663_10195780
2180 Ga0207663_10366822
2181 Ga0207660_10003099
2182 Ga0207660_10274908
2183 Ga0207660_10411650
2184 Ga0207660_10927792
2185 Ga0207657_10495943
2186 Ga0207657_10609434
2187 Ga0207657_10667096
2188 Ga0207657_11331646
2189 Ga0207649_10007836
2190 Ga0207649_10037634
2191 Ga0207649_10072355
2192 Ga0207649_11483743
2193 Ga0207652_10049501
2194 Ga0207652_10406320
2195 Ga0207652_10439917
2196 Ga0207652_10511347
2197 Ga0207646_10151361
2198 Ga0207681_10039956
2199 Ga0207681_10534366
2200 Ga0207694_10000247
2201 Ga0207694_10001290
2202 Ga0207694_10049671
2203 Ga0207694_10104531
2204 Ga0207650_10032901
2205 Ga0207650_10144626
2206 Ga0207650_10448961
2207 Ga0207650_10562968
2208 Ga0207659_10035540
2209 Ga0207659_11132187
2210 Ga0207687_10004776
2211 Ga0207687_10023510
2212 Ga0207687_10172618
2213 Ga0207687_10230870
2214 Ga0207700_10010087
2215 Ga0207700_10076852
2216 Ga0207700_10738709
2217 Ga0207664_10218061
2218 Ga0207664_10575276
2219 Ga0207644_10002812
2220 Ga0207644_10008147
2221 Ga0207644_10085502
2222 Ga0207690_10153599
2223 Ga0207690_10524240
2224 Ga0207706_10003090
2225 Ga0207686_10004531
2226 Ga0207709_10000416
2227 Ga0207709_10026556
2228 Ga0207669_10584370
2229 Ga0207704_10232777
2230 Ga0207665_10100583
2231 Ga0207665_10217896
2232 Ga0207665_10930120
2233 Ga0207691_10008111
2234 Ga0207691_10354977
2235 Ga0207711_10027616
2236 Ga0207711_10045923
2237 Ga0207711_10087252
2238 Ga0207711_10252906
2239 Ga0207711_10448790
2240 Ga0207711_11685084
2241 Ga0207689_10000502
2242 Ga0207689_10007888
2243 Ga0207661_10029458
2244 Ga0207661_10072040
2245 Ga0207661_10137450
2246 Ga0207661_10167167
2247 Ga0207661_10246633
2248 Ga0207679_10023401
2249 Ga0207679_10351814
2250 Ga0207667_10006951
2251 Ga0207667_10008805
2252 Ga0207667_10014641
2253 Ga0207667_10060987
2254 Ga0207667_10371585
2255 Ga0207667_10919072
2256 Ga0207667_11448986
2257 Ga0207667_11485453
2258 Ga0207651_10416249
2259 Ga0207712_10226277
2260 Ga0207668_10204145
2261 Ga0207640_10782303
2262 Ga0207640_10807724
2263 Ga0207658_10000267
2264 Ga0207658_10184464
2265 Ga0207677_10000115
2266 Ga0207677_10129298
2267 Ga0207677_10241466
2268 Ga0207703_10041774
2269 Ga0207703_10051602
2270 Ga0207639_10000868
2271 Ga0207639_10188656
2272 Ga0207639_10208644
2273 Ga0207678_10147456
2274 Ga0207678_10443503
2275 Ga0207702_10001589
2276 Ga0207702_10003889
2277 Ga0207702_10047957
2278 Ga0207702_10696570
2279 Ga0207702_10830686
2280 Ga0207702_11135850
2281 Ga0207641_10001519
2282 Ga0207641_10450787
2283 Ga0207648_10044039
2284 Ga0207676_10004236
2285 Ga0207676_10589015
2286 Ga0207674_10033769
2287 Ga0207674_10053258
2288 Ga0207674_10125804
2289 Ga0207683_10006613
2290 Ga0207698_10000039
2291 Ga0207698_10000059
2292 Ga0207698_10158037
2293 Ga0207698_11262558
2294 Ga0207698_11553756
2295 Ga0207698_11952906
2296 Ga0209371_1000923
2297 Ga0210000_1001373
2298 Ga0209179_1022000
2299 Ga0209982_1024772
2300 Ga0209970_1000914
2301 Ga0209971_1022190
2302 Ga0209974_10014241
2303 Ga0268266_10110944
2304 Ga0268266_10566523
2305 Ga0268265_11056872
2306 Ga0268264_10000863
2307 Ga0268264_11332615
2308 Ga0265336_10006401
2309 Ga0265338_10004125
2310 Ga0265338_10035290
2311 Ga0265338_10047348
2312 Ga0265338_10431349
2313 Ga0265338_10459625
2314 Ga0311000_122265
2315 Ga0311000_129387
2316 Ga0311008_126459
2317 Ga0311011_109112
2318 Ga0311003_174330
2319 Ga0310982_141133
2320 Ga0310982_144591
2321 Ga0265324_10030792
2322 Ga0265324_10315219
2323 Ga0237817_10115
2324 Ga0268256_1000773
2325 Ga0265762_1138664
2326 Ga0265763_1003385
2327 Ga0265766_1000542
2328 Ga0265770_1115253
2329 Ga0265776_101371
2330 Ga0265768_101141
2331 Ga0265773_1017950
2332 Ga0265760_10112585
2333 Ga0265760_10265096
2334 Ga0265330_10000477
2335 Ga0265330_10058036
2336 Ga0265330_10072295
2337 Ga0265330_10079798
2338 Ga0265330_10098418
2339 Ga0265330_10149159
2340 Ga0265330_10156967
2341 Ga0265332_10136639
2342 Ga0265332_10235545
2343 Ga0265332_10248435
2344 Ga0265328_10008680
2345 Ga0265328_10024645
2346 Ga0265328_10035367
2347 Ga0265320_10130533
2348 Ga0265320_10177775
2349 Ga0265320_10445431
2350 Ga0265320_10545725
2351 Ga0265325_10003065
2352 Ga0265325_10012258
2353 Ga0265325_10049305
2354 Ga0265325_10170027
2355 Ga0265325_10295415
2356 Ga0265340_10010369
2357 Ga0265340_10019409
2358 Ga0265340_10049224
2359 Ga0265340_10346071
2360 Ga0265340_10429413
2361 Ga0265339_10000029
2362 Ga0265339_10000921
2363 Ga0265339_10021757
2364 Ga0265339_10021831
2365 Ga0265339_10048938
2366 Ga0265339_10078311
2367 Ga0265339_10140738
2368 Ga0265339_10172672
2369 Ga0265331_10023806
2370 Ga0265327_10330699
2371 Ga0265316_10006934
2372 Ga0265316_10007872
2373 Ga0265316_10013957
2374 Ga0265316_10015244
2375 Ga0265316_10030435
2376 Ga0265316_10033589
2377 Ga0265316_10039682
2378 Ga0265316_10165624
2379 Ga0265316_10180534
2380 Ga0265316_10260504
2381 Ga0265316_10301472
2382 Ga0265316_10344478
2383 Ga0265316_10507230
2384 Ga0265316_10782106
2385 Ga0265316_10936993
2386 Ga0307408_100003263
2387 Ga0307408_100021999
2388 Ga0307408_100125708
2389 Ga0307408_101718723
2390 Ga0265313_10016184
2391 Ga0265313_10034221
2392 Ga0265313_10050332
2393 Ga0265313_10070860
2394 Ga0265314_10001691
2395 Ga0265314_10019867
2396 Ga0265314_10041833
2397 Ga0265314_10073151
2398 Ga0265314_10585754
2399 Ga0265342_10000307
2400 Ga0265342_10008915
2401 Ga0265342_10011411
2402 Ga0265342_10023693
2403 Ga0265342_10054842
2404 Ga0265342_10056084
2405 Ga0265342_10068984
2406 Ga0265342_10080695
2407 Ga0265342_10113043
2408 Ga0265342_10282902
2409 Ga0265342_10550085
2410 Ga0316578_10262150
2411 Ga0316577_10586530
2412 Ga0307413_10512676
2413 Ga0307410_10091988
2414 Ga0307407_10623276
2415 Ga0307412_10020619
2416 Ga0307409_100002336
2417 Ga0307409_100007174
2418 Ga0307409_100822098
2419 Ga0307416_100007104
2420 Ga0307416_100170833
2421 Ga0307416_100203113
2422 Ga0307416_101860606
2423 Ga0307415_101082758
2424 Ga0307415_102023252
2425 Ga0316596_1068366
2426 Ga0316215_1000833
2427 Ga0373929_0241408
2428 Ga0373934_0357625
2429 Ga0373940_0294540
2430 Ga0373923_0264395
2431 Ga0373953_0240072
2432 Ga0373954_0027849
2433 Ga0373956_0490424
2434 Ga0373957_0473770
2435 Ga0373943_0517005
2436 Ga0373955_0131727
2437 Ga0373955_0352630
2438 Ga0373961_0061503
2439 Ga0373931_0020821
2440 Ga0373931_0496784
2441 Ga0373935_1187046
2442 Ga0373935_1377227
2443 Ga0373933_0041165
2444 Ga0373933_0323080
2445 Ga0373937_0027753
2446 Ga0373937_0049903
2447 Ga0373937_0351741
2448 Ga0373937_1060536
2449 Ga0373937_1136810
2450 Ga0265778_051585
2451 Ga0316584_0008199
2452 Ga0316584_0153084
2453 Ga0373925_1406404
2454 Ga0395899_0203176
2455 Ga0395899_0270279
2456 Ga0395899_0387442
2457 Ga0395900_0234286
2458 Ga0395900_0411933
2459 Ga0395900_1547859
2460 Ga0395898_0428885
2461 Ga0395898_0582816
2462 Ga0395898_0775795
2463 Ga0395898_0851716
2464 Ga0395898_1223796
2465 Ga0395905_0573972
2466 Ga0395901_0624307
2467 Ga0395901_0962277
2468 Ga0395901_1417306
2469 Ga0237819_00239
2470 Ga0436365_0559080
2471 Ga0436365_1532164
2472 Ga0436360_0240674
2473 Ga0436360_0343285
2474 Ga0436363_0991670
2475 Ga0436363_1358816
2476 Ga0436362_0143704
2477 Ga0439436_0002304
2478 Ga0439439_0000103
2479 Ga0439439_0003260
2480 Ga0439453_0114324
2481 Ga0451855_0403959
2482 Ga0451855_0452095
2483 Ga0451855_0548201
2484 Ga0451853_1007767
2485 Ga0439433_0002523
2486 Ga0439433_0005396
2487 Ga0439433_0217922
2488 Ga0439449_0000074
2489 Ga0439449_0006536
2490 Ga0439457_013262
2491 Ga0439462_0004039
2492 Ga0439462_0008776
2493 Ga0450906_043496
2494 Ga0466969_0001060
2495 Ga0466972_0077452
2496 Ga0466965_0125423
2497 Ga0466966_0298382
2498 Ga0466963_0003181
2499 Ga0466963_0767058
2500 Ga0466963_1308113
2501 Ga0466968_0002977
2502 Ga0466970_0031453
2503 Ga0466970_0224164
2504 Ga0466957_0691587
2505 Ga0466957_0991121
2506 Ga0466957_1077645
2507 Ga0466959_0186586
2508 Ga0466958_0031906
2509 Ga0466958_0837702
2510 Ga0466967_0000327
2511 Ga0466967_0140642
2512 Ga0466967_1023902
2513 Ga0466967_1031363
2514 Ga0495627_018408
2515 Ga0495627_040568
2516 Ga0495592_0276481
2517 Ga0495603_0005187
2518 Ga0495590_0042229
2519 Ga0495590_0131097
2520 Ga0495590_0226889
2521 Ga0495591_028162
2522 Ga0495591_096034
2523 Ga0495629_0072119
2524 Ga0495651_0917238
2525 Ga0495580_0083130
2526 Ga0495580_0198771
2527 Ga0495582_0106361
2528 Ga0495582_0499130
2529 Ga0495605_0025905
2530 Ga0495605_0075252
2531 Ga0495639_0023957
2532 Ga0495584_0024667
2533 Ga0495584_0209109
2534 Ga0495585_0001321
2535 Ga0495607_0038465
2536 Ga0495607_0161401
2537 Ga0495606_0035724
2538 Ga0495606_0093700
2539 Ga0495606_0269138
2540 Ga0495608_0322977
2541 Ga0495608_0584883
2542 Ga0495608_0921658
2543 Ga0495610_0204571
2544 Ga0495618_0747651
2545 Ga0495620_0023267
2546 Ga0495628_0161928
2547 Ga0495630_0738023
2548 Ga0495630_0769949
2549 Ga0495637_0088472
2550 Ga0495637_0142359
2551 Ga0495637_0174808
2552 Ga0495643_0031759
2553 Ga0495652_0026891
2554 Ga0495654_0015505
2555 Ga0495654_0251932
2556 Ga0495665_0073755
2557 Ga0495586_0129583
2558 Ga0495587_0047822
2559 Ga0495609_0055641
2560 Ga0495621_0479869
2561 Ga0495597_0091528
2562 Ga0495645_0046981
2563 Ga0495645_0347104
2564 Ga0495622_0027467
2565 Ga0495622_0064067
2566 Ga0495633_0027955
2567 Ga0495633_0065769
2568 Ga0495667_0312819
2569 Ga0495668_0044828
2570 Ga0495634_0101729
2571 Ga0495611_0078881
2572 Ga0495635_0209063
2573 Ga0495661_0013338
2574 Ga0495661_0020024
2575 Ga0495661_0085148
2576 Ga0495661_0455518
2577 Ga0495588_0044206
2578 Ga0495657_0376623
2579 Ga0495599_0059726
2580 Ga0495623_0130813
2581 Ga0495623_0332872
2582 Ga0495623_0609679
2583 Ga0495646_0516509
2584 Ga0495647_0294951
2585 Ga0495658_0882969
2586 Ga0495669_0069731
2587 Ga0495613_0342299
2588 Ga0495613_0403249
2589 Ga0495613_0687720
2590 Ga0495670_0045580
2591 Ga0495670_0172272
2592 Ga0495670_0243336
2593 Ga0495649_0030798
2594 Ga0495649_0083659
2595 Ga0495649_0278784
2596 Ga0495649_0588002
2597 Ga0495589_0076252
2598 Ga0495589_0107725
2599 Ga0495600_0154968
2600 Ga0495660_0004825
2601 Ga0495660_0017884
2602 Ga0495581_0054294
2603 Ga0495604_0266968
2604 Ga0495636_0136155
2605 Ga0495636_0456330
2606 Ga0495676_0052043
2607 Ga0495676_0133814
2608 Ga0495680_0347683
2609 Ga0495683_0005075
2610 Ga0495687_033682
2611 Ga0495675_0253268
2612 Ga0495681_0048530
2613 Ga0495681_0101906
2614 Ga0495684_0269316
2615 Ga0495686_0000545
2616 Ga0495686_0012601
2617 Ga0495686_0152425
2618 Ga0495686_0230526
2619 Ga0495602_0206155
2620 Ga0495602_0415439
2621 Ga0495626_0006526
2622 Ga0495626_0133338
2623 Ga0496100_0001314
2624 Ga0496100_0133827
2625 Ga0496100_0284782
2626 Ga0496100_0679634
2627 Ga0496100_1033025
2628 Ga0496101_0000972
2629 Ga0496101_0088730
2630 Ga0496101_0907534
2631 Ga0496101_1081780
2632 Ga0496101_1364296
2633 Ga0496102_0002206
2634 Ga0496102_0011196
2635 Ga0496102_0099351
2636 Ga0496102_0629539
2637 Ga0496102_0704145
2638 Ga0496102_0852601
2639 Ga0496103_0001955
2640 Ga0496103_0047911
2641 Ga0496103_0276565
2642 Ga0496103_0883260
2643 Ga0496104_0001658
2644 Ga0496104_0005618
2645 Ga0496104_0166573
2646 Ga0496104_0208553
2647 Ga0496104_0305470
2648 Ga0496104_0308297
2649 Ga0496104_0348085
2650 Ga0496105_0002080
2651 Ga0496105_0317361
2652 Ga0496105_0509692
2653 Ga0496105_0605966
2654 Ga0496106_0002267
2655 Ga0496106_0649413
2656 Ga0496107_0003223
2657 Ga0496107_0058466
2658 Ga0496107_0215509
2659 Ga0496107_0313297
2660 Ga0496107_0370851
2661 Ga0496107_1316712
2662 Ga0496108_0000443
2663 Ga0496108_1067083
2664 Ga0496108_1279353
2665 Ga0496109_0000778
2666 Ga0496109_0087437
2667 Ga0496109_0367538
2668 Ga0496110_0001837
2669 Ga0496110_0003743
2670 Ga0496110_0016232
2671 Ga0496110_0031404
2672 Ga0496110_0311758
2673 Ga0496110_0419582
2674 Ga0496110_0774598
2675 Ga0496111_0000191
2676 Ga0496111_0005358
2677 Ga0496111_0061966
2678 Ga0496111_0600530
2679 Ga0496111_0896146
2680 Ga0496112_0007183
2681 Ga0496112_0264091
2682 Ga0496112_1292253
2683 Ga0496112_1365161
2684 Ga0496113_0001361
2685 Ga0496113_0413632
2686 Ga0496113_1509949
2687 Ga0496114_0298516
2688 Ga0496114_0738336
2689 Ga0496115_0056383
2690 Ga0496115_0149438
2691 Ga0496115_0194088
2692 Ga0496115_0303564
2693 Ga0496115_1322984
2694 Ga0496116_0007551
2695 Ga0496116_0012406
2696 Ga0496116_0012853
2697 Ga0496116_0014267
2698 Ga0496116_0017257
2699 Ga0496116_0057218
2700 Ga0496116_0064776
2701 Ga0496117_0005823
2702 Ga0496117_0016085
2703 Ga0496118_0012842
2704 Ga0496118_0144058
2705 Ga0496119_0000469
2706 Ga0496119_0003362
2707 Ga0496119_0006713
2708 Ga0496119_0547553
2709 Ga0496120_0001942
2710 Ga0496120_0035325
2711 Ga0496120_0102753
2712 Ga0496121_0045806
2713 Ga0496121_0108049
2714 Ga0496121_0150400
2715 Ga0496121_0219653
2716 Ga0496121_0426928
2717 Ga0496121_0436053
2718 Ga0496122_0006458
2719 Ga0496122_0007540
2720 Ga0496122_0028610
2721 Ga0496122_0031689
2722 Ga0496122_0051949
2723 Ga0496122_0057163
2724 Ga0496122_0075908
2725 Ga0496122_0083192
2726 Ga0496122_0199829
2727 Ga0496122_0459341
2728 Ga0496122_0495917
2729 Ga0496123_0004233
2730 Ga0496123_0009386
2731 Ga0496123_0010929
2732 Ga0496123_0023113
2733 Ga0496123_0126496
2734 Ga0496124_0000697
2735 Ga0496124_0001155
2736 Ga0496124_0012311
2737 Ga0496124_0022419
2738 Ga0496124_0162139
2739 Ga0496125_0001385
2740 Ga0496125_0001389
2741 Ga0496125_0006886
2742 Ga0496125_0059770
2743 Ga0496125_0253782
2744 Ga0496125_0531426
2745 Ga0496126_0000005
2746 Ga0496126_0008264
2747 Ga0496126_0059816
2748 Ga0496126_0125265
2749 Ga0496126_0508493
2750 Ga0496126_0577285
2751 Ga0496126_1118387
2752 Ga0501306_000002
2753 Ga0501306_000030
2754 Ga0501306_000071
2755 Ga0501306_000079
2756 Ga0501306_000138
2757 Ga0501306_000200
2758 Ga0501306_003109
2759 Ga0501306_003694
2760 Ga0501306_003974
2761 Ga0501306_004132
2762 Ga0501306_005368
2763 Ga0501306_006747
2764 Ga0501306_021343
2765 Ga0501306_025599
2766 Ga0501306_096613
2767 Ga0501308_000057
2768 Ga0501308_000086
2769 Ga0501308_000106
2770 Ga0501308_000127
2771 Ga0501308_000694
2772 Ga0501308_000735
2773 Ga0501308_003239
2774 Ga0501308_011238
2775 Ga0501308_028028
2776 Ga0501309_000001
2777 Ga0501309_000144
2778 Ga0501309_000417
2779 Ga0501309_001669
2780 Ga0501309_003421
2781 Ga0501309_004736
2782 Ga0501309_020612
2783 Ga0501310_000312
2784 Ga0501310_000940
2785 Ga0501310_002051
2786 Ga0501310_003009
2787 Ga0501310_003439
2788 Ga0501310_003997
2789 Ga0501310_017305
2790 Ga0501310_019702
2791 Ga0501310_043872
2792 Ga0501341_00014
2793 Ga0501341_00024
2794 Ga0501341_00076
2795 Ga0501341_00193
2796 Ga0501341_00222
2797 Ga0501341_01598
2798 Ga0501343_000098
2799 Ga0501343_000383
2800 Ga0501343_000392
2801 Ga0501343_000491
2802 Ga0501343_000591
2803 Ga0501343_000794
2804 Ga0501343_001442
2805 Ga0501343_001896
2806 Ga0501343_002494
2807 Ga0501343_004576
2808 Ga0501343_008265
2809 Ga0501343_012006
2810 Ga0501344_00011
2811 Ga0501344_00013
2812 Ga0501344_00016
2813 Ga0501344_00060
2814 Ga0501344_00166
2815 Ga0501344_00605
2816 Ga0501344_00857
2817 Ga0501344_01780
2818 Ga0501345_00004
2819 Ga0501345_00405
2820 Ga0501345_02481
2821 Ga0501304_000046
2822 Ga0501304_000047
2823 Ga0501304_000119
2824 Ga0501304_000494
2825 Ga0501304_002674
2826 Ga0501304_002783
2827 Ga0501305_000003
2828 Ga0501305_000005
2829 Ga0501305_000007
2830 Ga0501305_000135
2831 Ga0501305_000838
2832 Ga0501305_001024
2833 Ga0501305_001780
2834 Ga0501305_002856
2835 Ga0501305_003944
2836 Ga0501305_030135
2837 Ga0501305_033886
2838 Ga0501305_046588
2839 Ga0501305_087126
2840 Ga0501307_000002
2841 Ga0501307_000008
2842 Ga0501307_000011
2843 Ga0501307_000049
2844 Ga0501307_000155
2845 Ga0501307_000338
2846 Ga0501307_000603
2847 Ga0501307_000770
2848 Ga0501307_004127
2849 Ga0501307_008353
2850 Ga0501307_026040
2851 Ga0501342_00056
2852 Ga0501342_00155
2853 Ga0501342_00181
2854 Ga0501342_03148
2855 Ga0495682_0075125
2856 Ga0495682_0213792
2857 Ga0501290_005720
2858 Ga0501291_048567
2859 Ga0501295_018328
2860 Ga0501299_084095
2861 Ga0501300_006882
2862 Ga0501311_000001
2863 Ga0501311_000006
2864 Ga0501311_000029
2865 Ga0501311_000061
2866 Ga0501311_000124
2867 Ga0501311_000152
2868 Ga0501311_000226
2869 Ga0501311_000359
2870 Ga0501311_005953
2871 Ga0501311_009822
2872 Ga0501311_031246
2873 Ga0501311_073433
2874 Ga0501312_000002
2875 Ga0501312_000004
2876 Ga0501312_000005
2877 Ga0501312_000019
2878 Ga0501312_000056
2879 Ga0501312_000171
2880 Ga0501312_000289
2881 Ga0501312_000439
2882 Ga0501312_000739
2883 Ga0501312_001758
2884 Ga0501312_009171
2885 Ga0501312_009722
2886 Ga0501312_033896
2887 Ga0501312_047192
2888 Ga0501312_085805
2889 Ga0501312_120533
2890 Ga0501313_000001
2891 Ga0501313_000003
2892 Ga0501313_000034
2893 Ga0501313_000081
2894 Ga0501313_000101
2895 Ga0501313_000156
2896 Ga0501313_000177
2897 Ga0501313_000360
2898 Ga0501313_000781
2899 Ga0501313_002469
2900 Ga0501313_009688
2901 Ga0501313_066252
2902 Ga0501314_000067
2903 Ga0501314_000087
2904 Ga0501314_000447
2905 Ga0501314_000773
2906 Ga0501314_000973
2907 Ga0501314_002612
2908 Ga0501314_002668
2909 Ga0501314_011785
2910 Ga0501314_025086
2911 Ga0501315_000001
2912 Ga0501315_000002
2913 Ga0501315_000006
2914 Ga0501315_000069
2915 Ga0501315_000072
2916 Ga0501315_000123
2917 Ga0501315_004000
2918 Ga0501315_004080
2919 Ga0501315_006378
2920 Ga0501315_009053
2921 Ga0501315_009362
2922 Ga0501315_013906
2923 Ga0501315_019745
2924 Ga0501315_022770
2925 Ga0501315_034859
2926 Ga0501316_000001
2927 Ga0501316_000045
2928 Ga0501316_000072
2929 Ga0501316_000081
2930 Ga0501316_000137
2931 Ga0501316_000268
2932 Ga0501316_002234
2933 Ga0501316_002272
2934 Ga0501316_003240
2935 Ga0501316_004064
2936 Ga0501316_005266
2937 Ga0501316_008561
2938 Ga0501316_023237
2939 Ga0501316_026938
2940 Ga0501316_032052
2941 Ga0501316_037393
2942 Ga0501317_000001
2943 Ga0501317_000003
2944 Ga0501317_000202
2945 Ga0501317_000414
2946 Ga0501317_000954
2947 Ga0501317_001025
2948 Ga0501317_002411
2949 Ga0501317_003838
2950 Ga0501317_005267
2951 Ga0501317_007181
2952 Ga0501317_026345
2953 Ga0501317_030482
2954 Ga0501317_031804
2955 Ga0501317_043089
2956 Ga0501318_000003
2957 Ga0501318_000052
2958 Ga0501318_000116
2959 Ga0501318_000386
2960 Ga0501318_002401
2961 Ga0501318_002638
2962 Ga0501318_003615
2963 Ga0501318_005761
2964 Ga0501318_009165
2965 Ga0501318_011919
2966 Ga0501318_020816
2967 Ga0501318_081964
2968 Ga0501319_000003
2969 Ga0501319_000033
2970 Ga0501319_000047
2971 Ga0501319_000098
2972 Ga0501319_000238
2973 Ga0501319_000326
2974 Ga0501319_000845
2975 Ga0501319_002515
2976 Ga0501319_003450
2977 Ga0501320_000001
2978 Ga0501320_000002
2979 Ga0501320_000012
2980 Ga0501320_000063
2981 Ga0501320_000070
2982 Ga0501320_000071
2983 Ga0501320_000079
2984 Ga0501320_000092
2985 Ga0501320_001821
2986 Ga0501320_005312
2987 Ga0501320_025684
2988 Ga0501321_000002
2989 Ga0501321_000023
2990 Ga0501321_000066
2991 Ga0501321_000083
2992 Ga0501321_000088
2993 Ga0501321_000089
2994 Ga0501321_000092
2995 Ga0501321_000225
2996 Ga0501321_002044
2997 Ga0501321_004287
2998 Ga0501321_009246
2999 Ga0501321_018443
3000 Ga0501321_025183
3001 Ga0501321_069210
3002 Ga0501321_085769
3003 Ga0501322_000007
3004 Ga0501322_000024
3005 Ga0501322_000043
3006 Ga0501322_000335
3007 Ga0501322_000404
3008 Ga0501322_003380
3009 Ga0501322_006340
3010 Ga0501322_007924
3011 Ga0501323_000005
3012 Ga0501323_000091
3013 Ga0501323_000116
3014 Ga0501323_000294
3015 Ga0501323_000308
3016 Ga0501323_000825
3017 Ga0501323_002710
3018 Ga0501323_004989
3019 Ga0501323_023914
3020 Ga0501323_026259
3021 Ga0501323_033552
3022 Ga0501323_059398
3023 Ga0501324_000001
3024 Ga0501324_000003
3025 Ga0501324_000076
3026 Ga0501324_000141
3027 Ga0501324_000153
3028 Ga0501324_000373
3029 Ga0501324_000408
3030 Ga0501324_002064
3031 Ga0501324_002534
3032 Ga0501324_003211
3033 Ga0501324_011962
3034 Ga0501324_016729
3035 Ga0501324_025677
3036 Ga0501325_000006
3037 Ga0501325_010003
3038 Ga0501325_047372
3039 Ga0501326_00006
3040 Ga0501326_00033
3041 Ga0501326_00045
3042 Ga0501326_00113
3043 Ga0501326_00177
3044 Ga0501326_00291
3045 Ga0501326_03359
3046 Ga0501327_00035
3047 Ga0501327_00036
3048 Ga0501327_00038
3049 Ga0501327_00062
3050 Ga0501327_00389
3051 Ga0501327_03039
3052 Ga0501327_05531
3053 Ga0501327_07490
3054 Ga0501328_00011
3055 Ga0501328_00014
3056 Ga0501328_00064
3057 Ga0501328_00078
3058 Ga0501328_00270
3059 Ga0501328_00524
3060 Ga0501328_00940
3061 Ga0501328_05377
3062 Ga0501329_00109
3063 Ga0501329_00157
3064 Ga0501329_00619
3065 Ga0501329_00684
3066 Ga0501329_03934
3067 Ga0501330_000009
3068 Ga0501330_000038
3069 Ga0501330_000049
3070 Ga0501330_000139
3071 Ga0501330_000148
3072 Ga0501330_000288
3073 Ga0501330_000341
3074 Ga0501330_004276
3075 Ga0501330_010335
3076 Ga0501331_00009
3077 Ga0501331_00023
3078 Ga0501331_00073
3079 Ga0501331_00179
3080 Ga0501331_04401
3081 Ga0501331_04852
3082 Ga0501331_07867
3083 Ga0501332_00052
3084 Ga0501332_00070
3085 Ga0501332_00114
3086 Ga0501332_00147
3087 Ga0501332_00490
3088 Ga0501332_00546
3089 Ga0501332_00671
3090 Ga0501332_01061
3091 Ga0501332_07606
3092 Ga0501332_12791
3093 Ga0501333_000018
3094 Ga0501333_000173
3095 Ga0501333_001147
3096 Ga0501333_001361
3097 Ga0501333_001637
3098 Ga0501333_006626
3099 Ga0501333_018569
3100 Ga0501334_00014
3101 Ga0501334_00103
3102 Ga0501334_00634
3103 Ga0501334_00670
3104 Ga0501334_00728
3105 Ga0501334_05436
3106 Ga0501334_06574
3107 Ga0501335_000067
3108 Ga0501335_000116
3109 Ga0501335_000229
3110 Ga0501335_000692
3111 Ga0501335_001159
3112 Ga0501335_001571
3113 Ga0501335_002088
3114 Ga0501335_003479
3115 Ga0501335_003699
3116 Ga0501335_019322
3117 Ga0501335_037724
3118 Ga0501335_037801
3119 Ga0501336_000153
3120 Ga0501336_000332
3121 Ga0501336_000441
3122 Ga0501336_000875
3123 Ga0501336_008578
3124 Ga0501336_015660
3125 Ga0501336_024727
3126 Ga0501337_000050
3127 Ga0501337_000067
3128 Ga0501337_000117
3129 Ga0501337_000129
3130 Ga0501337_000210
3131 Ga0501337_000366
3132 Ga0501337_000430
3133 Ga0501337_000441
3134 Ga0501337_001638
3135 Ga0501337_002599
3136 Ga0501337_003887
3137 Ga0501338_00021
3138 Ga0501338_00230
3139 Ga0501338_00355
3140 Ga0501338_00393
3141 Ga0501338_00890
3142 Ga0501338_01217
3143 Ga0501338_01946
3144 Ga0501338_10168
3145 Ga0501339_00012
3146 Ga0501339_00086
3147 Ga0501339_00171
3148 Ga0501340_000004
3149 Ga0501340_000016
3150 Ga0501340_000079
3151 Ga0501340_001704
3152 Ga0501036_1689582
3153 Ga0501040_0507174
3154 Ga0501041_0249557
3155 Ga0501041_0883091
3156 Ga0501069_0210701
3157 Ga0501070_0119413
3158 Ga0501071_0290387
3159 Ga0501074_0192033
3160 Ga0501202_022556
3161 Ga0501216_070041
3162 Ga0501217_012050
3163 Ga0501217_015074
3164 Ga0501217_287719
3165 Ga0501217_343473
3166 Ga0501224_053640
3167 Ga0501227_012962
3168 Ga0501228_002303
3169 Ga0501230_097915
3170 Ga0501233_007708
3171 Ga0501233_145156
3172 Ga0501243_022949
3173 Ga0501252_020433
3174 Ga0501252_081246
3175 Ga0501260_023599
3176 Ga0501221_089407
3177 Ga0501225_0027148
3178 Ga0501234_002810
3179 Ga0501234_106616
3180 Ga0501080_0504979
3181 Ga0501083_0323354
3182 Ga0501083_0827020
3183 Ga0501232_007698
3184 Ga0501265_069563
3185 Ga0501266_006221
3186 Ga0501270_012080
3187 Ga0501271_044575
3188 Ga0501283_084321
3189 Ga0501212_018124
3190 nmdc:mga00v17_210410_c1
3191 nmdc:mga05p37_2088575_c1
3192 nmdc:mga09592_810971_c1
3193 Ga0495601_0280867
3194 Ga0495612_0116498
3195 Ga0495619_0209672
3196 Ga0500559_0070899
3197 Ga0501084_0281749
3198 Ga0587084_000095
3199 Ga0587084_012948
3200 Ga0587084_045642
3201 Ga0587066_094474
3202 Ga0587070_000002
3203 Ga0587077_068645
3204 Ga0587080_000328
3205 Ga0587080_008939
3206 Ga0587082_000432
3207 Ga0587082_099346
3208 Ga0587083_0000091
3209 Ga0587083_0000526
3210 Ga0587083_0000533
3211 Ga0587088_067862
3212 Ga0587098_007400
3213 Ga0587098_031131
3214 Ga0587098_095429
3215 Ga0587106_013355
3216 Ga0587106_016970
3217 Ga0587106_055808
3218 Ga0587099_017892
3219 Ga0587117_112854
3220 Ga0587067_000283
3221 Ga0587067_001715
3222 Ga0587067_002029
3223 Ga0587067_003704
3224 Ga0587067_004378
3225 Ga0587067_011104
3226 Ga0587067_039947
3227 Ga0587067_060736
3228 Ga0587068_000132
3229 Ga0587068_106966
3230 Ga0587068_126383
3231 Ga0587072_000119
3232 Ga0587072_003946
3233 Ga0587072_009490
3234 Ga0587072_042549
3235 Ga0587072_055571
3236 Ga0587072_061289
3237 Ga0587072_075731
3238 Ga0587072_116821
3239 Ga0587072_141659
3240 Ga0587075_046622
3241 Ga0587075_079649
3242 Ga0587076_000045
3243 Ga0587076_008511
3244 Ga0587076_010133
3245 Ga0587076_076164
3246 Ga0587076_110746
3247 Ga0587079_000002
3248 Ga0587079_008968
3249 Ga0587079_011374
3250 Ga0587079_042551
3251 Ga0587114_044794
3252 Ga0587060_000803
3253 Ga0587060_001840
3254 Ga0587111_0257428
3255 Ga0501082_1104744
3256 2511180936
3257 2511698003
3258 2512736526
3259 2524190000
3260 2545559758
3261 2550903220
3262 2555470884
3263 2556065794
3264 2563930192
3265 2571530807
3266 2573041366
3267 2578338884
3268 2578930715
3269 2580930507
3270 2587744072
3271 2595092271
3272 2595320872
3273 2601641757
3274 2621273296
3275 2631982461
3276 2643738842
3277 2644424492
3278 2644705730
3279 2644713251
3280 2644721340
3281 2644723325
3282 2644741862
3283 2651530326
3284 2672333589
3285 2673821722
3286 2674421119
3287 2685148207
3288 2686995326
3289 2687496575
3290 2695629923
3291 2698319633
3292 2705992008
3293 2712198868
3294 2717918178
3295 2721503436
3296 2723606194
3297 2728529894
3298 2730136817
3299 2738817103
3300 2739160165
3301 2739212639
3302 2739234635
3303 2739271692
3304 2753813080
3305 2757568906
3306 2777764209
3307 2777837284
3308 2793182071
3309 2802440724
3310 2809057184
3311 2812314465
3312 2816866378
3313 2817478191
3314 2819571031
3315 2819585037
3316 2819676101
3317 2819711999
3318 2819726066
3319 2821118321
3320 2823526418
3321 2842688276
3322 2842887723
3323 2849144970
3324 2857460103
3325 2857478327
3326 2857586482
3327 2857590956
3328 2857608869
3329 2860837582
3330 2864738871
3331 2865002024
3332 2865007641
3333 2877768801
3334 2880169743
3335 2881639977
3336 2881646638
3337 2885529915
3338 2888584461
3339 2889048009
3340 2889053093
3341 2889276747
3342 2889298944
3343 2897109770
3344 2904168154
3345 2904496949
3346 2904530167
3347 2904564592
3348 2904600780
3349 2904755673
3350 2907208199
3351 2908669317
3352 2915610001
3353 2919097075
3354 2919149636
3355 2919166248
3356 2919419355
3357 2919432412
3358 2919523191
3359 2919726412
3360 2919730768
3361 2925332838
3362 2928099915
3363 2929009902
3364 2929211882
3365 2929233263
3366 2929298371
3367 2931385115
3368 2936343059
3369 2936363694
3370 2938653387
3371 2938917433
3372 2939685123
3373 2939707603
3374 2945996262
3375 2946058952
3376 2947426731
3377 2954776078
3378 2956900798
3379 2960324283
3380 2960378894
3381 2962290793
3382 2965761265
3383 2968562363
3384 2969137000
3385 2969141169
3386 2969766251
3387 2969774919
3388 2971406755
3389 2971410928
3390 2971513789
3391 2971893530
3392 2977254693
3393 2979083741
3394 2980128575
3395 2980179442
3396 2980186830
3397 2980492744
3398 2981289522
3399 2981294459
3400 2981985115
3401 2981990046
3402 2984531161
3403 2984537270
3404 2988229870
3405 2990275696
3406 2996636942
3407 2996707485
3408 3001271875
3409 3001275961
3410 3001898794
3411 3006858519
3412 3006883631
3413 3006980026
3414 648172187
3415 8002318133
3416 8022621217
3417 8022631638
3418 8022655880
3419 8022799056
3420 8022893435
3421 8022917915
3422 8023439812
3423 8023447391
3424 8046991300
3425 8051956513
3426 8052174989
3427 8054282865
3428 8054471310
3429 8054801995
3430 8055634017
3431 8056535609
3432 8057473381
3433 8057582798
3434 8057632288
3435 8057735139
3436 8057979872

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00203

Ribosomal_S19

Ribosomal protein S19

16

96

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
4v48-assembly1.cif.gz_BS real space refined coordinates of the 30s and 50s subunits fitted into the low resolution cryo-em map of the initiation-like state of e. coli 70s ribosome 0.9631 12 76
4v48-assembly1.cif.gz_BS real space refined coordinates of the 30s and 50s subunits fitted into the low resolution cryo-em map of the initiation-like state of e. coli 70s ribosome 0.949 12 76
5mmm-assembly1.cif.gz_s structure of the 70s chloroplast ribosome 0.9323 6 83
5mmm-assembly1.cif.gz_s structure of the 70s chloroplast ribosome 0.921 6 83
8a98-assembly1.cif.gz_SW cryo-em structure of leishmania major 80s ribosome : snorna mutant 0.9208 12 78
ID Description Score Start End Superfamily
4kj2S00 Alpha Beta;2-Layer Sandwich;30s Ribosomal Protein S19; Chain A;Ribosomal protein S19/S15 0.9064 3 81 3.30.860.10
2y0uS00 Alpha Beta;2-Layer Sandwich;30s Ribosomal Protein S19; Chain A;Ribosomal protein S19/S15 0.9023 4 81 3.30.860.10
2qbbS00 Alpha Beta;2-Layer Sandwich;30s Ribosomal Protein S19; Chain A;Ribosomal protein S19/S15 0.8962 3 81 3.30.860.10
af_P54018_6_152_3.30.860.10 Alpha Beta;2-Layer Sandwich;30s Ribosomal Protein S19; Chain A;Ribosomal protein S19/S15 0.8959 13 85 3.30.860.10
4kj2S00 Alpha Beta;2-Layer Sandwich;30s Ribosomal Protein S19; Chain A;Ribosomal protein S19/S15 0.8958 3 81 3.30.860.10
ID Description Score Start End GO Terms
AF-H6T3U6-F1-model_v4 Small ribosomal subunit protein uS19c (30S ribosomal protein S19, chloroplastic) 0.9225 5 84 GO:0000028
GO:0003735
GO:0005763
GO:0006412
GO:0009536
GO:0019843
AF-A0A410P9S4-F1-model_v4 Small ribosomal subunit protein uS19c 0.9161 1 81 GO:0000028
GO:0003735
GO:0005763
GO:0006412
GO:0009507
GO:0019843
AF-X1L935-F1-model_v4 Large ribosomal subunit protein uL2 C-terminal domain-containing protein 0.911 1 84 GO:0002181
GO:0003723
GO:0003735
GO:0005737
GO:0015935
AF-A0A5D0IVM7-F1-model_v4 Small ribosomal subunit protein uS19 (30S ribosomal protein S19) 0.9091 6 86 GO:0000028
GO:0003735
GO:0005737
GO:0006412
GO:0015935
GO:0019843
AF-Q36807-F1-model_v4 Small ribosomal subunit protein uS19c 0.909 1 80 GO:0003735
GO:0006412
GO:0009507
GO:0015935
GO:0019843

Map