F495462
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1718 | 690 | 3436 | 94 |
Family's Representative Sequence
| Representative Sequence | 3300048919|Ga0496116_0003454|Ga0496116_0003454_11792_12112 |
| Length | 106 |
| Sequence | MSRASAYVKGGTHMGRSLKKGPFIDGYLLKKVEDLNETNKKVVIKTWSRRSTIFPQFIGHTFAVYDGRKHVPVYVTEDMVGHKLGEFAPTRTYKGHASDDKKTGRR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 4 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 5 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 6 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 7 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 8 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 9 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 10 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 11 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 12 | 3300003567 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_04_fullP_mix3_d1 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 13 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 14 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 15 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 16 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 17 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 18 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 19 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 20 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 21 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 22 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 23 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 24 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 25 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 26 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 31 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 35 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 55 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 60 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 63 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 67 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 69 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 70 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 71 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 72 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 73 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 74 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 75 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 76 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 77 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 78 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 79 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 80 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 82 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 83 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 84 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 86 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 87 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 88 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 89 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 90 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 118 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 123 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 124 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 125 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 126 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 127 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 128 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 129 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 130 | 3300023309 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.ctcc.R1 | Metatranscriptome | Rhizosphere |
| 131 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 138 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 140 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 218 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 219 | 3300029272 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B1.ctno.R1 | Metatranscriptome | Rhizosphere |
| 220 | 3300029273 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B1.stno.R1 | Metatranscriptome | Rhizosphere |
| 221 | 3300029280 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stcc.R1 | Metatranscriptome | Rhizosphere |
| 222 | 3300029282 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B1.stcc.R1 | Metatranscriptome | Rhizosphere |
| 223 | 3300029283 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.ctno.R1 | Metatranscriptome | Rhizosphere |
| 224 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 225 | 3300030083 | Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 | Metagenome | Unclassified |
| 226 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 227 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 228 | 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 229 | 3300030863 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 230 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 231 | 3300030880 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 232 | 3300030963 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 233 | 3300031018 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 234 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 235 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 236 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 237 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 238 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 239 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 240 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 241 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 242 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 243 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 244 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 245 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 246 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 247 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 248 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 249 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 250 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 251 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 252 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 253 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 254 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 255 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 256 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 257 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 258 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 259 | 3300033544 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 | Metagenome | Unclassified |
| 260 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 261 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 262 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 263 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 264 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 265 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 266 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 267 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 268 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 269 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 270 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 271 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 272 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 273 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 274 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 275 | 3300036457 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 276 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 277 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 278 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 279 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 280 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 281 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 282 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 283 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 284 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 285 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 286 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 287 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 288 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 289 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 290 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 291 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 292 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 293 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 294 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 295 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 296 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 297 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 298 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 299 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 300 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 301 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 302 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 303 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 304 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 305 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 306 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 307 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 308 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 309 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 377 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 378 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 379 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 380 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 381 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 382 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 383 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 384 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 385 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 386 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 387 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 388 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 389 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 390 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 391 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 392 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 393 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 394 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 395 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 396 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 397 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 398 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 399 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 400 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 401 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 402 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 403 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 404 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 405 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 406 | 3300049131 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 407 | 3300049132 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 408 | 3300049133 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 409 | 3300049134 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 410 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 411 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 412 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 413 | 3300049163 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 414 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 416 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 417 | 3300049518 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control | Metagenome | Rhizosphere |
| 418 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 419 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 420 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 421 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 422 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 423 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 424 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 425 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 426 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 427 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 428 | 3300049535 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 429 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 430 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 431 | 3300049538 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 432 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 433 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 434 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 435 | 3300049542 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 436 | 3300049543 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 437 | 3300049544 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 438 | 3300049545 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 439 | 3300049546 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 440 | 3300049547 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 441 | 3300049548 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 442 | 3300049549 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 443 | 3300049550 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 444 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 445 | 3300049552 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 446 | 3300049553 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 447 | 3300049554 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 448 | 3300049555 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 449 | 3300049556 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 450 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 451 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 452 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 453 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 454 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 455 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 456 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 457 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 458 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 459 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 460 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 461 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 462 | 3300049666 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control | Metagenome | Rhizosphere |
| 463 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 464 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 465 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 466 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 467 | 3300049689 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought | Metagenome | Rhizosphere |
| 468 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 469 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 470 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 471 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 472 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 473 | 3300049757 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control | Metagenome | Rhizosphere |
| 474 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 475 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 476 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 477 | 3300049768 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought | Metagenome | Rhizosphere |
| 478 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 479 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 480 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 481 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 482 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 483 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 484 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 485 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 486 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 487 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 488 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 489 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 490 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 491 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 492 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 493 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 494 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 495 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 496 | 3300059604 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 497 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 498 | 3300059622 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 499 | 3300059627 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 500 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 501 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 502 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 503 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 504 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 505 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 506 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 507 | 3300060243 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 1R_CW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 508 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 509 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 510 | 2510917027 | Brevibacillus sp. CF112 | Isolate | Rhizosphere |
| 511 | 2511231119 | Bacillus velezensis CAU B946 | Isolate | Rhizosphere |
| 512 | 2512564039 | Paenibacillus mucilaginosus 3016 | Isolate | Rhizosphere |
| 513 | 2524023129 | Paenibacillus pinihumi DSM 23905 | Isolate | Rhizosphere |
| 514 | 2545555800 | Bacillus amyloliquefaciens EGD-AQ14 | Isolate | Rhizosphere |
| 515 | 2548877040 | Paenibacillus sonchi X19-5 | Isolate | Rhizosphere |
| 516 | 2554235283 | Bacillus safensis VK | Isolate | Rhizosphere |
| 517 | 2554235469 | Sporolactobacillus laevolacticus DSM 442 | Isolate | Rhizosphere |
| 518 | 2563366752 | Paenibacillus pini JCM 16418 | Isolate | Rhizosphere |
| 519 | 2571042143 | Paenibacillus graminis RSA19 | Isolate | Unclassified |
| 520 | 2571042588 | Paenibacillus zanthoxyli JH29 | Isolate | Unclassified |
| 521 | 2576861424 | Paenibacillus sabinae T27 | Isolate | Rhizosphere |
| 522 | 2576861599 | Bacillus amyloliquefaciens EGD-AQ14 | Isolate | Rhizosphere |
| 523 | 2579778775 | Paenibacillus durus P3L-5 | Isolate | Unclassified |
| 524 | 2585428059 | Paenibacillus chondroitinus OK414 | Isolate | Rhizosphere |
| 525 | 2593339131 | Bacillus sp. UNCCL81 | Isolate | Unclassified |
| 526 | 2593339198 | Paenibacillus sp. UNCCL117 | Isolate | Unclassified |
| 527 | 2600255286 | Paenibacillus sp. NFR01 | Isolate | Rhizoplane |
| 528 | 2619619294 | Paenibacillus durus ATCC 35681 | Isolate | Unclassified |
| 529 | 2630968484 | Bacillus methylotrophicus KACC 13105 | Isolate | Rhizosphere |
| 530 | 2643221543 | Paenibacillus sp. Root52 | Isolate | Unclassified |
| 531 | 2643221676 | Paenibacillus sp. Root444D2 | Isolate | Unclassified |
| 532 | 2643221729 | Bacillus sp. Root11 | Isolate | Unclassified |
| 533 | 2643221730 | Bacillus sp. Root131 | Isolate | Unclassified |
| 534 | 2643221731 | Bacillus sp. Root147 | Isolate | Unclassified |
| 535 | 2643221732 | Bacillus sp. Root239 | Isolate | Unclassified |
| 536 | 2643221735 | Bacillus sp. Root920 | Isolate | Unclassified |
| 537 | 2648501850 | Bacillus amyloliquefaciens RHNK22 | Isolate | Rhizosphere |
| 538 | 2671180330 | Peribacillus simplex SH-B26 | Isolate | Unclassified |
| 539 | 2671180694 | Paenibacillus sp. A3 | Isolate | Unclassified |
| 540 | 2671180844 | Bacillus amyloliquefaciens Bs006 | Isolate | Unclassified |
| 541 | 2684622632 | Bacillus cereus 905 | Isolate | Unclassified |
| 542 | 2684623153 | Bacillus pumilus SH-B9 | Isolate | Unclassified |
| 543 | 2687453109 | Bacillus pumilus SH-B11 | Isolate | Unclassified |
| 544 | 2695420354 | Bacillus sp. Co1-6 | Isolate | Unclassified |
| 545 | 2695420987 | Bacillus thuringiensis KNU-07 | Isolate | Unclassified |
| 546 | 2703719227 | Bacillus mycoides GOE6 | Isolate | Rhizosphere |
| 547 | 2711768088 | Sporolactobacillus terrae DSM 11697 | Isolate | Rhizosphere |
| 548 | 2716884898 | Bacillus methylotrophicus FKM10 | Isolate | Rhizosphere |
| 549 | 2718218445 | Bacillus sp. B25(2016b) | Isolate | Rhizosphere |
| 550 | 2721755693 | Paenibacillus polymyxa YC0573 | Isolate | Rhizosphere |
| 551 | 2728368933 | Paenibacillus jilunlii DSM 23019 | Isolate | Rhizosphere |
| 552 | 2728369359 | Paenibacillus polymyxa YC0136 | Isolate | Rhizosphere |
| 553 | 2738541295 | Bacillus sp. OK085 | Isolate | Unclassified |
| 554 | 2738541358 | Bacillus sp. OV752 | Isolate | Unclassified |
| 555 | 2738543006 | Bacillus sp. OK077 | Isolate | Unclassified |
| 556 | 2738543010 | Bacillus sp. YR335 | Isolate | Unclassified |
| 557 | 2738543017 | Bacillus sp. OV186 | Isolate | Unclassified |
| 558 | 2751185905 | Paenibacillus kribbensis 6hRe76 | Isolate | Unclassified |
| 559 | 2757320391 | Bacillus sp. NFR08 | Isolate | Rhizoplane |
| 560 | 2775507177 | Bacillus sp. AFS055030 | Isolate | Unclassified |
| 561 | 2775507192 | Bacillus sp. AFS041924 | Isolate | Unclassified |
| 562 | 2791355222 | Paenibacillus oryzae 1DrF-4 | Isolate | Unclassified |
| 563 | 2802428803 | Paenibacillus peoriae NMA1017 | Isolate | Rhizosphere |
| 564 | 2808606399 | Bacillus sp. SJZ110 | Isolate | Rhizosphere |
| 565 | 2811994870 | Bacillus sp. JB4 | Isolate | Unclassified |
| 566 | 2816332186 | Peribacillus frigoritolerans 3612 | Isolate | Unclassified |
| 567 | 2816332295 | Bacillus paralicheniformis MDJK30 | Isolate | Rhizosphere |
| 568 | 2818991441 | Niallia circulans 3243 | Isolate | Rhizosphere |
| 569 | 2818991443 | Bacillus thuringiensis 1230 | Isolate | Unclassified |
| 570 | 2818991459 | Paenibacillus sp. 597 | Isolate | Unclassified |
| 571 | 2818991465 | Priestia megaterium 3291 | Isolate | Rhizosphere |
| 572 | 2818991468 | Bacillus safensis 3300 | Isolate | Rhizosphere |
| 573 | 2821111986 | Paenibacillus illinoisensis 582 | Isolate | Unclassified |
| 574 | 2823526263 | Bacillus altitudinis P-10 | Isolate | Unclassified |
| 575 | 2842682962 | Bacillus sp. R-72492 | Isolate | Unclassified |
| 576 | 2842882022 | Bacillus sp. R-71893 | Isolate | Unclassified |
| 577 | 2849139964 | Bacillus sp. R-71875 | Isolate | Unclassified |
| 578 | 2857453340 | Paenibacillus sp. R-74130 | Isolate | Unclassified |
| 579 | 2857472729 | Cohnella sp. R-74144 | Isolate | Unclassified |
| 580 | 2857581216 | Bacillus sp. R-71922 | Isolate | Unclassified |
| 581 | 2857586860 | Bacillus sp. R-71935 | Isolate | Unclassified |
| 582 | 2857604169 | Domibacillus sp. R-71921 | Isolate | Unclassified |
| 583 | 2860837431 | Bacillus sp. WR11 | Isolate | Unclassified |
| 584 | 2864733723 | Paenibacillus sp. JGP012 | Isolate | Rhizosphere |
| 585 | 2864997549 | Paenibacillus sp. R-72005 | Isolate | Unclassified |
| 586 | 2865002811 | Paenibacillus sp. R-74131 | Isolate | Unclassified |
| 587 | 2877768649 | Bacillus amyloliquefaciens Y14 | Isolate | Rhizosphere |
| 588 | 2880169592 | Bacillus velezensis T20E-257 | Isolate | Unclassified |
| 589 | 2881636855 | Paenibacillus sp. 7197 | Isolate | Rhizosphere |
| 590 | 2881644220 | Siminovitchia terrae LMG 29736 | Isolate | Rhizosphere |
| 591 | 2885526491 | Paenibacillus sp. LK1 | Isolate | Rhizosphere |
| 592 | 2888578766 | Paenibacillus lycopersici 12200R-189 | Isolate | Rhizosphere |
| 593 | 2889042446 | Paenibacillus sp. 37 | Isolate | Rhizosphere |
| 594 | 2889049205 | Paenibacillus rhizovicinus 14171R-81 | Isolate | Rhizosphere |
| 595 | 2889276214 | Paenibacillus sp. PvR133 | Isolate | Rhizosphere |
| 596 | 2889295896 | Paenibacillus sp. PvR098 | Isolate | Rhizosphere |
| 597 | 2897109615 | Bacillus amyloliquefaciens YP6 | Isolate | Unclassified |
| 598 | 2904162308 | Paenibacillus sp. AD87 | Isolate | Unclassified |
| 599 | 2904490793 | Paenibacillus sp. 1295 | Isolate | Rhizosphere |
| 600 | 2904524088 | Priestia megaterium 1428 | Isolate | Rhizosphere |
| 601 | 2904560550 | Bacillus velezensis 1780 | Isolate | Rhizosphere |
| 602 | 2904595352 | Paenibacillus sp. 1182 | Isolate | Unclassified |
| 603 | 2904755435 | Paenibacillus aceris KACC 19194 | Isolate | Rhizosphere |
| 604 | 2907202186 | Paenibacillus sp. HJL G12 | Isolate | Unclassified |
| 605 | 2908665501 | Bacillus pumilus 1391 | Isolate | Rhizosphere |
| 606 | 2915606848 | Brevibacillus sp. HD1.4A | Isolate | Rhizosphere |
| 607 | 2919093281 | Bacillus safensis 1383 | Isolate | Rhizosphere |
| 608 | 2919143609 | Priestia megaterium 1751 | Isolate | Rhizosphere |
| 609 | 2919160200 | Paenibacillus sp. 2003 | Isolate | Unclassified |
| 610 | 2919414237 | Neobacillus niacini 3240 | Isolate | Rhizosphere |
| 611 | 2919425241 | Bacillus sp. 3255 | Isolate | Rhizosphere |
| 612 | 2919517244 | Priestia aryabhattai 3820 | Isolate | Unclassified |
| 613 | 2919720352 | Priestia megaterium 4340 | Isolate | Unclassified |
| 614 | 2919726948 | Bacillus pumilus 4489 | Isolate | Unclassified |
| 615 | 2925326138 | Paenibacillus hemerocallicola KCTC 33185 | Isolate | Unclassified |
| 616 | 2928093941 | Priestia aryabhattai 1389 | Isolate | Rhizosphere |
| 617 | 2929004312 | Priestia megaterium 1104 | Isolate | Unclassified |
| 618 | 2929206907 | Paenibacillus sp. R-74146 Hybrid assembly | Isolate | Unclassified |
| 619 | 2929233124 | Bacillus sp. R-74298 Hybrid assembly | Isolate | Unclassified |
| 620 | 2929297113 | Heliophilum fasciatum MTM | Isolate | Rhizosphere |
| 621 | 2931384279 | Paenibacillus sp. DR312 | Isolate | Rhizosphere |
| 622 | 2936340661 | Gottfriedia acidiceleris 1-17 | Isolate | Rhizosphere |
| 623 | 2936361878 | Neobacillus endophyticus BRMEA1 | Isolate | Unclassified |
| 624 | 2938649242 | Paenibacillus helianthi P26E | Isolate | Rhizosphere |
| 625 | 2938917290 | Bacillus sp. CR71 | Isolate | Unclassified |
| 626 | 2939679117 | Paenibacillus sp. 4624 | Isolate | Rhizosphere |
| 627 | 2939702853 | Paenibacillus sp. PvR008 | Isolate | Rhizosphere |
| 628 | 2945991243 | Paenibacillus sp. B21a W2I17 | Isolate | Rhizosphere |
| 629 | 2946053406 | Paenibacillus sp. W4I10 | Isolate | Rhizosphere |
| 630 | 2947426588 | Bacillus sp. RZ2MS9 | Isolate | Rhizosphere |
| 631 | 2954773129 | Bacillus sp. TBS-096 | Isolate | Rhizosphere |
| 632 | 2956897341 | Ectobacillus funiculus W18-2 | Isolate | Rhizosphere |
| 633 | 2960319331 | Priestia megaterium AFS057444 | Isolate | Unclassified |
| 634 | 2960375949 | Priestia megaterium AFS067084 | Isolate | Unclassified |
| 635 | 2962290636 | Bacillus subtilis TLO3 | Isolate | Rhizosphere |
| 636 | 2965761152 | Bacillus sp. COPE52 | Isolate | Unclassified |
| 637 | 2968558590 | Paenibacillus sp. P3E | Isolate | Rhizosphere |
| 638 | 2969136845 | Bacillus subtilis TLO3 | Isolate | Rhizosphere |
| 639 | 2969141011 | Bacillus velezensis MH25 | Isolate | Unclassified |
| 640 | 2969765954 | Bacillus intestinalis GM2 | Isolate | Rhizosphere |
| 641 | 2969770375 | Bacillus subtilis GM5 | Isolate | Rhizosphere |
| 642 | 2971403814 | Paenibacillus tritici LMG 29502 | Isolate | Unclassified |
| 643 | 2971410472 | Paenibacillus oryzisoli 1ZS3-15 | Isolate | Unclassified |
| 644 | 2971511577 | Paenibacillus apii 7124 | Isolate | Rhizosphere |
| 645 | 2971893375 | Bacillus sp. HNA3 | Isolate | Rhizosphere |
| 646 | 2977254563 | Bacillus sp. SORGH_AS 510 | Isolate | Unclassified |
| 647 | 2979083700 | Bacillus toyonensis SORGH_AS 407 | Isolate | Unclassified |
| 648 | 2980125574 | Paenibacillus sp. tmac-D7 | Isolate | Unclassified |
| 649 | 2980176882 | Paenibacillus apii 7028 | Isolate | Rhizosphere |
| 650 | 2980182181 | Paenibacillus cymbidii R196 | Isolate | Unclassified |
| 651 | 2980492589 | Bacillus subtilis GQJK2 | Isolate | Rhizosphere |
| 652 | 2981284811 | Paenibacillus sp. PvR052 | Isolate | Rhizosphere |
| 653 | 2981289755 | Paenibacillus sp. PvR148 | Isolate | Rhizosphere |
| 654 | 2981980479 | Paenibacillus sp. PvR018 | Isolate | Rhizosphere |
| 655 | 2981985349 | Paenibacillus sp. PvR053 | Isolate | Rhizosphere |
| 656 | 2984527788 | Paenibacillus sp. SORGH_AS306 | Isolate | Aerial Root |
| 657 | 2984532647 | Paenibacillus sp. SORGH_AS338 | Isolate | Aerial Root |
| 658 | 2988225383 | Paenibacillus sp. P46E | Isolate | Rhizosphere |
| 659 | 2990275345 | Bacillus sp. SLBN-46 | Isolate | Unclassified |
| 660 | 2996632988 | Paenibacillus sp. P32E | Isolate | Rhizosphere |
| 661 | 2996706504 | Paenibacillus sp. OT2-17 | Isolate | Rhizosphere |
| 662 | 3001267043 | Bacillus sp. FJAT-49870 | Isolate | Rhizosphere |
| 663 | 3001272096 | Lederbergia citrisecunda FJAT-49732 | Isolate | Rhizosphere |
| 664 | 3001892409 | Neobacillus rhizophilus FJAT-49825 | Isolate | Rhizosphere |
| 665 | 3006858327 | Bacillus paralicheniformis SUBG0010 | Isolate | Unclassified |
| 666 | 3006879489 | Bacillus atrophaeus UCMB-5137 | Isolate | Rhizosphere |
| 667 | 3006978542 | Bacillus sp. FJAT-49705 | Isolate | Rhizosphere |
| 668 | 648028048 | Paenibacillus polymyxa E681 | Isolate | Rhizosphere |
| 669 | 8002317523 | Cohnella sp. GbtcB17 | Isolate | Unclassified |
| 670 | 8022621104 | Bacillus sp. PIC28 | Isolate | Rhizosphere |
| 671 | 8022630665 | Bacillus sp. PW192 | Isolate | Rhizosphere |
| 672 | 8022653035 | Bacillus sp. Rc4 | Isolate | Unclassified |
| 673 | 8022792930 | Bacillus sp. Xin | Isolate | Rhizosphere |
| 674 | 8022893055 | Bacillus aryabhattai AFS007213 | Isolate | Unclassified |
| 675 | 8022914991 | Bacillus aryabhattai SQU-R12 | Isolate | Unclassified |
| 676 | 8023438354 | Bacillus sp. BH2 | Isolate | Unclassified |
| 677 | 8023444577 | Bacillus sp. BH32 | Isolate | Unclassified |
| 678 | 8046991243 | Cohnella rhizosphaerae DSM 28161 | Isolate | Rhizosphere |
| 679 | 8051952484 | Bacillus amyloliquefaciens K2 | Isolate | Rhizosphere |
| 680 | 8052174270 | Bacillus velezensis CH13 | Isolate | Rhizosphere |
| 681 | 8054280661 | Metabacillus kandeliae GX 13764 | Isolate | Rhizosphere |
| 682 | 8054465665 | Paenibacillus sonchi IIRRBNF1 | Isolate | Rhizosphere |
| 683 | 8054795415 | Paenibacillus periandrae PM10 | Isolate | Nodule |
| 684 | 8055632911 | Paenibacillus radicibacter N1-5-1-14 | Isolate | Unclassified |
| 685 | 8056533031 | Paenibacillus qinlingensis TEGT-2 | Isolate | Unclassified |
| 686 | 8057473075 | Paenibacillus endoradicis T3-5-0-4 | Isolate | Unclassified |
| 687 | 8057582654 | Bacillus arachidis YX15 | Isolate | Rhizosphere |
| 688 | 8057632132 | Cytobacillus kochii RZ2 | Isolate | Rhizosphere |
| 689 | 8057733483 | Paenibacillus apiarius MW-14 | Isolate | Rhizosphere |
| 690 | 8057977335 | Paenibacillus oenotherae DT7-4 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 60.71 |
| Metatranscriptomes | 28.75 |
| Isolates | 10.54 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.12 |
| Bulb | 0 |
| Endosphere | 3.38 |
| Nodule | 0.06 |
| Rhizoplane | 4.25 |
| Rhizosphere | 82.71 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.12 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0496116_0003454 | 3300048919 | Bacteria | 15588 |
| 2 | SwRhRL2b_contig_213193 | 2162886007 | Bacteria | 929 |
| 3 | JGI24736J21556_1046494 | 3300001904 | Bacteria | 667 |
| 4 | JGI24740J21852_10082807 | 3300001979 | Bacteria | 838 |
| 5 | JGI24743J22301_10016305 | 3300001991 | Bacteria | 1385 |
| 6 | JGI24033J26618_1020881 | 3300002155 | Bacteria | 838 |
| 7 | JGI25151J46595_10000678 | 3300003187 | Bacteria | 28776 |
| 8 | JGI25151J46595_10000735 | 3300003187 | Bacteria | 26974 |
| 9 | JGI25151J46595_10009543 | 3300003187 | Bacteria | 4581 |
| 10 | JGI25151J46595_10009794 | 3300003187 | Bacteria | 4511 |
| 11 | JGI25151J46595_10012392 | 3300003187 | Bacteria | 3882 |
| 12 | JGI25151J46595_10136169 | 3300003187 | Bacteria | 605 |
| 13 | JGI25165J46597_1016815 | 3300003214 | Bacteria | 979 |
| 14 | rootH1_10000848 | 3300003316 | Bacteria | 58943 |
| 15 | rootH2_10053907 | 3300003320 | Bacteria | 2237 |
| 16 | rootL2_10000406 | 3300003322 | Bacteria | 26536 |
| 17 | rootL2_10015753 | 3300003322 | Bacteria | 1798 |
| 18 | Ga0006554J51385_1033852 | 3300003567 | Bacteria | 1337 |
| 19 | Ga0006562J51391_1000046 | 3300003578 | Bacteria | 48312 |
| 20 | Ga0006562J51391_1000361 | 3300003578 | Bacteria | 31803 |
| 21 | Ga0006562J51391_1000677 | 3300003578 | Bacteria | 45519 |
| 22 | Ga0006562J51391_1015323 | 3300003578 | Bacteria | 6111 |
| 23 | Ga0055538_1000286 | 3300003751 | Bacteria | 25743 |
| 24 | Ga0055532_1000266 | 3300003758 | Bacteria | 34080 |
| 25 | Ga0055532_1003438 | 3300003758 | Bacteria | 2711 |
| 26 | Ga0055532_1028664 | 3300003758 | Bacteria | 529 |
| 27 | Ga0055535_1000913 | 3300003761 | Bacteria | 19960 |
| 28 | Ga0055536_1032063 | 3300003781 | Bacteria | 1365 |
| 29 | Ga0055528_1000586 | 3300003790 | Bacteria | 27486 |
| 30 | Ga0055541_1000319 | 3300003841 | Bacteria | 15656 |
| 31 | Ga0055541_1001260 | 3300003841 | Bacteria | 5586 |
| 32 | Ga0055541_1001864 | 3300003841 | Bacteria | 4395 |
| 33 | Ga0055541_1024461 | 3300003841 | Bacteria | 663 |
| 34 | Ga0058692_1040989 | 3300003856 | Bacteria | 812 |
| 35 | Ga0058863_10038888 | 3300004799 | Bacteria | 4963 |
| 36 | Ga0058863_11363707 | 3300004799 | Bacteria | 986 |
| 37 | Ga0058863_11799934 | 3300004799 | Bacteria | 550 |
| 38 | Ga0058861_11402842 | 3300004800 | Bacteria | 865 |
| 39 | Ga0058861_12067592 | 3300004800 | Bacteria | 1532 |
| 40 | Ga0058862_12871386 | 3300004803 | Bacteria | 1374 |
| 41 | Ga0065165_1062104 | 3300005262 | Bacteria | 1020 |
| 42 | Ga0065704_10156589 | 3300005289 | Bacteria | 1386 |
| 43 | Ga0070658_10010767 | 3300005327 | Bacteria | 7331 |
| 44 | Ga0070658_10028665 | 3300005327 | Bacteria | 4471 |
| 45 | Ga0070658_10113875 | 3300005327 | Bacteria | 2242 |
| 46 | Ga0070658_10530949 | 3300005327 | Bacteria | 1018 |
| 47 | Ga0070676_10003937 | 3300005328 | Bacteria | 7793 |
| 48 | Ga0070676_10038362 | 3300005328 | Bacteria | 2767 |
| 49 | Ga0070683_100007295 | 3300005329 | Bacteria | 9327 |
| 50 | Ga0070683_100055839 | 3300005329 | Bacteria | 3665 |
| 51 | Ga0070683_100218692 | 3300005329 | Bacteria | 1810 |
| 52 | Ga0070683_100292648 | 3300005329 | Bacteria | 1549 |
| 53 | Ga0070683_100671922 | 3300005329 | Bacteria | 992 |
| 54 | Ga0070683_101593584 | 3300005329 | Bacteria | 628 |
| 55 | Ga0070670_100003586 | 3300005331 | Bacteria | 12920 |
| 56 | Ga0070670_100005012 | 3300005331 | Bacteria | 11141 |
| 57 | Ga0070670_100076604 | 3300005331 | Bacteria | 2874 |
| 58 | Ga0068869_100012179 | 3300005334 | Bacteria | 5673 |
| 59 | Ga0068869_100035406 | 3300005334 | Bacteria | 3537 |
| 60 | Ga0070666_10026243 | 3300005335 | Bacteria | 3803 |
| 61 | Ga0070666_10030632 | 3300005335 | Bacteria | 3546 |
| 62 | Ga0070666_10433297 | 3300005335 | Bacteria | 948 |
| 63 | Ga0070680_100002604 | 3300005336 | Bacteria | 13361 |
| 64 | Ga0070680_100137049 | 3300005336 | Bacteria | 2051 |
| 65 | Ga0070680_100185617 | 3300005336 | Bacteria | 1752 |
| 66 | Ga0070680_100315371 | 3300005336 | Bacteria | 1327 |
| 67 | Ga0070680_101874588 | 3300005336 | Bacteria | 520 |
| 68 | Ga0070682_100139157 | 3300005337 | Bacteria | 1652 |
| 69 | Ga0070682_101285441 | 3300005337 | Bacteria | 621 |
| 70 | Ga0068868_100001679 | 3300005338 | Bacteria | 15136 |
| 71 | Ga0068868_100015707 | 3300005338 | Bacteria | 5608 |
| 72 | Ga0068868_100038932 | 3300005338 | Bacteria | 3691 |
| 73 | Ga0070660_100486432 | 3300005339 | Bacteria | 1026 |
| 74 | Ga0070660_100619230 | 3300005339 | Bacteria | 906 |
| 75 | Ga0070660_100790164 | 3300005339 | Bacteria | 798 |
| 76 | Ga0070691_10991025 | 3300005341 | Bacteria | 524 |
| 77 | Ga0070661_100025903 | 3300005344 | Bacteria | 4215 |
| 78 | Ga0070661_100107733 | 3300005344 | Bacteria | 2078 |
| 79 | Ga0070661_100438434 | 3300005344 | Bacteria | 1038 |
| 80 | Ga0070668_100741717 | 3300005347 | Bacteria | 869 |
| 81 | Ga0070668_101017090 | 3300005347 | Bacteria | 745 |
| 82 | Ga0070669_100014591 | 3300005353 | Bacteria | 5591 |
| 83 | Ga0070669_100298492 | 3300005353 | Bacteria | 1295 |
| 84 | Ga0070675_100012859 | 3300005354 | Bacteria | 6567 |
| 85 | Ga0070675_100035195 | 3300005354 | Bacteria | 4068 |
| 86 | Ga0070675_101599526 | 3300005354 | Bacteria | 601 |
| 87 | Ga0070671_100003263 | 3300005355 | Bacteria | 12656 |
| 88 | Ga0070671_100014943 | 3300005355 | Bacteria | 6271 |
| 89 | Ga0070671_100191065 | 3300005355 | Bacteria | 1735 |
| 90 | Ga0070673_100013868 | 3300005364 | Bacteria | 5594 |
| 91 | Ga0070659_100094581 | 3300005366 | Bacteria | 2400 |
| 92 | Ga0070659_100762408 | 3300005366 | Bacteria | 840 |
| 93 | Ga0070659_102027902 | 3300005366 | Bacteria | 517 |
| 94 | Ga0070667_100001517 | 3300005367 | Bacteria | 20776 |
| 95 | Ga0070667_100027341 | 3300005367 | Bacteria | 4745 |
| 96 | Ga0070709_10947728 | 3300005434 | Bacteria | 683 |
| 97 | Ga0070709_11124461 | 3300005434 | Bacteria | 629 |
| 98 | Ga0070709_11366420 | 3300005434 | Bacteria | 573 |
| 99 | Ga0070709_11453456 | 3300005434 | Bacteria | 556 |
| 100 | Ga0070714_100418659 | 3300005435 | Bacteria | 1269 |
| 101 | Ga0070714_101925157 | 3300005435 | Bacteria | 577 |
| 102 | Ga0070713_100069410 | 3300005436 | Bacteria | 2972 |
| 103 | Ga0070713_100113217 | 3300005436 | Bacteria | 2368 |
| 104 | Ga0070713_100622588 | 3300005436 | Bacteria | 1026 |
| 105 | Ga0070710_10463050 | 3300005437 | Bacteria | 861 |
| 106 | Ga0070710_10670491 | 3300005437 | Bacteria | 729 |
| 107 | Ga0070711_100115645 | 3300005439 | Bacteria | 1975 |
| 108 | Ga0070711_100479857 | 3300005439 | Bacteria | 1022 |
| 109 | Ga0070708_100327370 | 3300005445 | Bacteria | 1443 |
| 110 | Ga0070663_100443489 | 3300005455 | Bacteria | 1069 |
| 111 | Ga0070663_101619885 | 3300005455 | Bacteria | 577 |
| 112 | Ga0070663_102002259 | 3300005455 | Bacteria | 521 |
| 113 | Ga0070678_100033078 | 3300005456 | Bacteria | 3586 |
| 114 | Ga0070681_10001062 | 3300005458 | Bacteria | 23407 |
| 115 | Ga0070681_10113171 | 3300005458 | Bacteria | 2653 |
| 116 | Ga0070681_10289580 | 3300005458 | Bacteria | 1548 |
| 117 | Ga0070681_10646948 | 3300005458 | Bacteria | 972 |
| 118 | Ga0070681_11010173 | 3300005458 | Bacteria | 752 |
| 119 | Ga0068867_100145111 | 3300005459 | Bacteria | 1859 |
| 120 | Ga0070706_100200060 | 3300005467 | Bacteria | 1866 |
| 121 | Ga0070707_100147928 | 3300005468 | Bacteria | 2286 |
| 122 | Ga0070698_100384297 | 3300005471 | Bacteria | 1336 |
| 123 | Ga0070699_100237826 | 3300005518 | Bacteria | 1625 |
| 124 | Ga0070679_100060017 | 3300005530 | Bacteria | 3790 |
| 125 | Ga0070679_100066127 | 3300005530 | Bacteria | 3603 |
| 126 | Ga0070679_100067206 | 3300005530 | Bacteria | 3574 |
| 127 | Ga0070679_100294226 | 3300005530 | Bacteria | 1575 |
| 128 | Ga0070679_101671013 | 3300005530 | Bacteria | 585 |
| 129 | Ga0070684_100043376 | 3300005535 | Bacteria | 3883 |
| 130 | Ga0070684_100082885 | 3300005535 | Bacteria | 2841 |
| 131 | Ga0070684_100495127 | 3300005535 | Bacteria | 1132 |
| 132 | Ga0070684_100937542 | 3300005535 | Bacteria | 812 |
| 133 | Ga0070684_100960489 | 3300005535 | Bacteria | 801 |
| 134 | Ga0070697_100310175 | 3300005536 | Bacteria | 1357 |
| 135 | Ga0068853_100001096 | 3300005539 | Bacteria | 19171 |
| 136 | Ga0068853_100133809 | 3300005539 | Bacteria | 2221 |
| 137 | Ga0068853_100142757 | 3300005539 | Bacteria | 2150 |
| 138 | Ga0068853_100364943 | 3300005539 | Bacteria | 1346 |
| 139 | Ga0068853_100983581 | 3300005539 | Bacteria | 812 |
| 140 | Ga0070672_100168746 | 3300005543 | Bacteria | 1819 |
| 141 | Ga0070672_100223348 | 3300005543 | Bacteria | 1580 |
| 142 | Ga0070665_100015044 | 3300005548 | Bacteria | 7766 |
| 143 | Ga0070665_100065929 | 3300005548 | Bacteria | 3632 |
| 144 | Ga0070665_100092190 | 3300005548 | Bacteria | 3034 |
| 145 | Ga0070704_101856817 | 3300005549 | Bacteria | 558 |
| 146 | Ga0068855_100000642 | 3300005563 | Bacteria | 42759 |
| 147 | Ga0068855_100005786 | 3300005563 | Bacteria | 15090 |
| 148 | Ga0068855_100019267 | 3300005563 | Bacteria | 8202 |
| 149 | Ga0068855_100077022 | 3300005563 | Bacteria | 3869 |
| 150 | Ga0068855_100146849 | 3300005563 | Bacteria | 2684 |
| 151 | Ga0068855_100433886 | 3300005563 | Bacteria | 1436 |
| 152 | Ga0068855_100540482 | 3300005563 | Bacteria | 1262 |
| 153 | Ga0070664_100070029 | 3300005564 | Bacteria | 3003 |
| 154 | Ga0070664_100769851 | 3300005564 | Bacteria | 899 |
| 155 | Ga0068857_100024212 | 3300005577 | Bacteria | 5343 |
| 156 | Ga0068857_100154377 | 3300005577 | Bacteria | 2081 |
| 157 | Ga0068857_100237069 | 3300005577 | Bacteria | 1669 |
| 158 | Ga0068857_100519894 | 3300005577 | Bacteria | 1118 |
| 159 | Ga0068854_100081038 | 3300005578 | Bacteria | 2396 |
| 160 | Ga0068854_100311965 | 3300005578 | Bacteria | 1276 |
| 161 | Ga0068854_100902952 | 3300005578 | Bacteria | 776 |
| 162 | Ga0068856_100010942 | 3300005614 | Bacteria | 8804 |
| 163 | Ga0068856_100018870 | 3300005614 | Bacteria | 6688 |
| 164 | Ga0068856_100104028 | 3300005614 | Bacteria | 2832 |
| 165 | Ga0068856_100511850 | 3300005614 | Bacteria | 1221 |
| 166 | Ga0068856_100805980 | 3300005614 | Bacteria | 959 |
| 167 | Ga0068856_101150623 | 3300005614 | Bacteria | 793 |
| 168 | Ga0068856_101505192 | 3300005614 | Bacteria | 687 |
| 169 | Ga0068856_101591523 | 3300005614 | Bacteria | 667 |
| 170 | Ga0068852_100024674 | 3300005616 | Bacteria | 4863 |
| 171 | Ga0068852_100054705 | 3300005616 | Bacteria | 3441 |
| 172 | Ga0068852_100220948 | 3300005616 | Bacteria | 1802 |
| 173 | Ga0068852_100315455 | 3300005616 | Bacteria | 1517 |
| 174 | Ga0068852_100355062 | 3300005616 | Bacteria | 1432 |
| 175 | Ga0068852_100674498 | 3300005616 | Bacteria | 1043 |
| 176 | Ga0068852_100845663 | 3300005616 | Bacteria | 930 |
| 177 | Ga0068852_100869877 | 3300005616 | Bacteria | 917 |
| 178 | Ga0068859_100022836 | 3300005617 | Bacteria | 6272 |
| 179 | Ga0068864_100005797 | 3300005618 | Bacteria | 10134 |
| 180 | Ga0068864_100071645 | 3300005618 | Bacteria | 3019 |
| 181 | Ga0068851_10018984 | 3300005834 | Bacteria | 3320 |
| 182 | Ga0068851_10034554 | 3300005834 | Bacteria | 2524 |
| 183 | Ga0068851_10375856 | 3300005834 | Bacteria | 832 |
| 184 | Ga0068851_10381747 | 3300005834 | Bacteria | 826 |
| 185 | Ga0068851_10729687 | 3300005834 | Bacteria | 611 |
| 186 | Ga0068870_10034626 | 3300005840 | Bacteria | 2585 |
| 187 | Ga0068863_100005496 | 3300005841 | Bacteria | 12472 |
| 188 | Ga0068858_100047133 | 3300005842 | Bacteria | 3996 |
| 189 | Ga0068858_100057329 | 3300005842 | Bacteria | 3600 |
| 190 | Ga0068860_100000786 | 3300005843 | Bacteria | 35473 |
| 191 | Ga0068860_100545493 | 3300005843 | Bacteria | 1161 |
| 192 | Ga0068862_100808179 | 3300005844 | Bacteria | 916 |
| 193 | Ga0068862_101712281 | 3300005844 | Bacteria | 637 |
| 194 | Ga0070717_10045133 | 3300006028 | Bacteria | 3602 |
| 195 | Ga0070717_10275992 | 3300006028 | Bacteria | 1490 |
| 196 | Ga0070717_12045167 | 3300006028 | Bacteria | 516 |
| 197 | Ga0070715_10360263 | 3300006163 | Bacteria | 797 |
| 198 | Ga0070712_100369334 | 3300006175 | Bacteria | 1178 |
| 199 | Ga0070712_100369860 | 3300006175 | Bacteria | 1178 |
| 200 | Ga0070712_101438966 | 3300006175 | Bacteria | 602 |
| 201 | Ga0070712_101537332 | 3300006175 | Bacteria | 582 |
| 202 | Ga0075367_10998897 | 3300006178 | Bacteria | 534 |
| 203 | Ga0097621_100005101 | 3300006237 | Bacteria | 9222 |
| 204 | Ga0097621_100109961 | 3300006237 | Bacteria | 2328 |
| 205 | Ga0075370_10747646 | 3300006353 | Bacteria | 595 |
| 206 | Ga0068871_100004090 | 3300006358 | Bacteria | 10086 |
| 207 | Ga0068871_100018858 | 3300006358 | Bacteria | 5256 |
| 208 | Ga0075430_101041394 | 3300006846 | Bacteria | 674 |
| 209 | Ga0075429_100640588 | 3300006880 | Bacteria | 931 |
| 210 | Ga0068865_100390365 | 3300006881 | Bacteria | 1138 |
| 211 | Ga0097620_100022837 | 3300006931 | Bacteria | 6272 |
| 212 | Ga0105251_10002306 | 3300009011 | Bacteria | 15129 |
| 213 | Ga0105251_10077887 | 3300009011 | Bacteria | 1536 |
| 214 | Ga0105251_10241236 | 3300009011 | Bacteria | 814 |
| 215 | Ga0105244_10012810 | 3300009036 | Bacteria | 4942 |
| 216 | Ga0105244_10041217 | 3300009036 | Bacteria | 2393 |
| 217 | Ga0105244_10062257 | 3300009036 | Bacteria | 1876 |
| 218 | Ga0105244_10445696 | 3300009036 | Bacteria | 595 |
| 219 | Ga0105244_10527490 | 3300009036 | Bacteria | 544 |
| 220 | Ga0105250_10059344 | 3300009092 | Bacteria | 1536 |
| 221 | Ga0105240_10020515 | 3300009093 | Bacteria | 8810 |
| 222 | Ga0105240_10023114 | 3300009093 | Bacteria | 8231 |
| 223 | Ga0105240_10032555 | 3300009093 | Bacteria | 6750 |
| 224 | Ga0105240_10050651 | 3300009093 | Bacteria | 5233 |
| 225 | Ga0105240_10057620 | 3300009093 | Bacteria | 4852 |
| 226 | Ga0105240_10257917 | 3300009093 | Bacteria | 2013 |
| 227 | Ga0105240_10293798 | 3300009093 | Bacteria | 1861 |
| 228 | Ga0105240_10907968 | 3300009093 | Bacteria | 947 |
| 229 | Ga0105240_12347450 | 3300009093 | Bacteria | 552 |
| 230 | Ga0105240_12536730 | 3300009093 | Bacteria | 530 |
| 231 | Ga0105245_10000731 | 3300009098 | Bacteria | 29612 |
| 232 | Ga0105245_10007135 | 3300009098 | Bacteria | 9802 |
| 233 | Ga0105245_10191213 | 3300009098 | Bacteria | 1960 |
| 234 | Ga0105245_10244214 | 3300009098 | Bacteria | 1742 |
| 235 | Ga0105245_11387320 | 3300009098 | Bacteria | 752 |
| 236 | Ga0105247_10000354 | 3300009101 | Bacteria | 39709 |
| 237 | Ga0105247_10054318 | 3300009101 | Bacteria | 2472 |
| 238 | Ga0105247_10303362 | 3300009101 | Bacteria | 1109 |
| 239 | Ga0105247_10955169 | 3300009101 | Bacteria | 666 |
| 240 | Ga0114129_12927940 | 3300009147 | Bacteria | 564 |
| 241 | Ga0114129_13214632 | 3300009147 | Bacteria | 531 |
| 242 | Ga0105243_10000301 | 3300009148 | Bacteria | 54622 |
| 243 | Ga0105243_11045142 | 3300009148 | Bacteria | 822 |
| 244 | Ga0105241_10003327 | 3300009174 | Bacteria | 11961 |
| 245 | Ga0105241_10019071 | 3300009174 | Bacteria | 5058 |
| 246 | Ga0105241_10046891 | 3300009174 | Bacteria | 3283 |
| 247 | Ga0105241_10283985 | 3300009174 | Bacteria | 1415 |
| 248 | Ga0105242_10003155 | 3300009176 | Bacteria | 12872 |
| 249 | Ga0105242_11651624 | 3300009176 | Bacteria | 676 |
| 250 | Ga0105248_10002627 | 3300009177 | Bacteria | 19981 |
| 251 | Ga0105248_10006787 | 3300009177 | Bacteria | 12550 |
| 252 | Ga0105248_10740796 | 3300009177 | Bacteria | 1109 |
| 253 | Ga0105248_12095466 | 3300009177 | Bacteria | 643 |
| 254 | Ga0105248_12344769 | 3300009177 | Bacteria | 608 |
| 255 | Ga0105237_10036030 | 3300009545 | Bacteria | 5005 |
| 256 | Ga0105237_10036694 | 3300009545 | Bacteria | 4960 |
| 257 | Ga0105237_10184786 | 3300009545 | Bacteria | 2085 |
| 258 | Ga0105237_10388491 | 3300009545 | Bacteria | 1400 |
| 259 | Ga0105237_10949913 | 3300009545 | Bacteria | 866 |
| 260 | Ga0105237_11496270 | 3300009545 | Bacteria | 682 |
| 261 | Ga0105238_10010551 | 3300009551 | Bacteria | 9278 |
| 262 | Ga0105238_10031377 | 3300009551 | Bacteria | 5409 |
| 263 | Ga0105238_10196265 | 3300009551 | Bacteria | 1994 |
| 264 | Ga0105238_10230359 | 3300009551 | Bacteria | 1829 |
| 265 | Ga0105238_10494404 | 3300009551 | Bacteria | 1223 |
| 266 | Ga0105238_11386598 | 3300009551 | Bacteria | 730 |
| 267 | Ga0105238_11461412 | 3300009551 | Bacteria | 712 |
| 268 | Ga0105238_11929273 | 3300009551 | Bacteria | 624 |
| 269 | Ga0105249_10087450 | 3300009553 | Bacteria | 2908 |
| 270 | Ga0105249_10267104 | 3300009553 | Bacteria | 1703 |
| 271 | Ga0105239_10009258 | 3300010375 | Bacteria | 11132 |
| 272 | Ga0105239_10014845 | 3300010375 | Bacteria | 8637 |
| 273 | Ga0105239_10018959 | 3300010375 | Bacteria | 7604 |
| 274 | Ga0105239_10428367 | 3300010375 | Bacteria | 1499 |
| 275 | Ga0105239_10770450 | 3300010375 | Bacteria | 1102 |
| 276 | Ga0105239_11111053 | 3300010375 | Bacteria | 910 |
| 277 | Ga0105239_11447239 | 3300010375 | Bacteria | 794 |
| 278 | Ga0105246_10000077 | 3300011119 | Bacteria | 41151 |
| 279 | Ga0105246_10004133 | 3300011119 | Bacteria | 8810 |
| 280 | Ga0105246_10025174 | 3300011119 | Bacteria | 3878 |
| 281 | Ga0105246_10082771 | 3300011119 | Bacteria | 2291 |
| 282 | Ga0157373_10107156 | 3300013100 | Bacteria | 1965 |
| 283 | Ga0157373_10272511 | 3300013100 | Bacteria | 1198 |
| 284 | Ga0157373_10709039 | 3300013100 | Bacteria | 738 |
| 285 | Ga0157371_10156861 | 3300013102 | Bacteria | 1625 |
| 286 | Ga0157371_10252764 | 3300013102 | Bacteria | 1269 |
| 287 | Ga0157371_10626220 | 3300013102 | Bacteria | 802 |
| 288 | Ga0157370_10001390 | 3300013104 | Bacteria | 29988 |
| 289 | Ga0157370_10006622 | 3300013104 | Bacteria | 12731 |
| 290 | Ga0157370_10127454 | 3300013104 | Bacteria | 2376 |
| 291 | Ga0157370_10526723 | 3300013104 | Bacteria | 1084 |
| 292 | Ga0157370_10642220 | 3300013104 | Bacteria | 970 |
| 293 | Ga0157370_10864940 | 3300013104 | Bacteria | 821 |
| 294 | Ga0157369_10004351 | 3300013105 | Bacteria | 16713 |
| 295 | Ga0157369_10008438 | 3300013105 | Bacteria | 11818 |
| 296 | Ga0157369_10013194 | 3300013105 | Bacteria | 9351 |
| 297 | Ga0157369_10069033 | 3300013105 | Bacteria | 3797 |
| 298 | Ga0157369_10234339 | 3300013105 | Bacteria | 1919 |
| 299 | Ga0157369_10257505 | 3300013105 | Bacteria | 1820 |
| 300 | Ga0157369_10549164 | 3300013105 | Bacteria | 1194 |
| 301 | Ga0157369_10696510 | 3300013105 | Bacteria | 1046 |
| 302 | Ga0157369_11186870 | 3300013105 | Bacteria | 779 |
| 303 | Ga0157369_11625291 | 3300013105 | Bacteria | 657 |
| 304 | Ga0157369_11925178 | 3300013105 | Bacteria | 600 |
| 305 | Ga0157374_10002988 | 3300013296 | Bacteria | 14155 |
| 306 | Ga0157374_10010090 | 3300013296 | Bacteria | 8111 |
| 307 | Ga0157374_10043454 | 3300013296 | Bacteria | 4152 |
| 308 | Ga0157374_10045280 | 3300013296 | Bacteria | 4072 |
| 309 | Ga0157374_10070986 | 3300013296 | Bacteria | 3283 |
| 310 | Ga0157374_10267053 | 3300013296 | Bacteria | 1687 |
| 311 | Ga0157374_10636731 | 3300013296 | Bacteria | 1078 |
| 312 | Ga0157374_10656450 | 3300013296 | Bacteria | 1061 |
| 313 | Ga0157378_10000237 | 3300013297 | Bacteria | 53846 |
| 314 | Ga0157378_10019987 | 3300013297 | Bacteria | 5888 |
| 315 | Ga0157378_10020240 | 3300013297 | Bacteria | 5853 |
| 316 | Ga0157378_10030845 | 3300013297 | Bacteria | 4733 |
| 317 | Ga0157378_10039530 | 3300013297 | Bacteria | 4184 |
| 318 | Ga0163162_10031415 | 3300013306 | Bacteria | 5268 |
| 319 | Ga0163162_10120074 | 3300013306 | Bacteria | 2732 |
| 320 | Ga0163162_13486915 | 3300013306 | Bacteria | 500 |
| 321 | Ga0157372_10000424 | 3300013307 | Bacteria | 46469 |
| 322 | Ga0157372_10065708 | 3300013307 | Bacteria | 4074 |
| 323 | Ga0157372_10092295 | 3300013307 | Bacteria | 3444 |
| 324 | Ga0157372_10128758 | 3300013307 | Bacteria | 2911 |
| 325 | Ga0157372_10130936 | 3300013307 | Bacteria | 2886 |
| 326 | Ga0157372_10313368 | 3300013307 | Bacteria | 1826 |
| 327 | Ga0157372_10528821 | 3300013307 | Bacteria | 1375 |
| 328 | Ga0157372_10593241 | 3300013307 | Bacteria | 1291 |
| 329 | Ga0157372_11394363 | 3300013307 | Bacteria | 808 |
| 330 | Ga0157372_11485178 | 3300013307 | Bacteria | 781 |
| 331 | Ga0157372_12288291 | 3300013307 | Bacteria | 621 |
| 332 | Ga0157375_10024173 | 3300013308 | Bacteria | 5620 |
| 333 | Ga0157375_10083448 | 3300013308 | Bacteria | 3240 |
| 334 | Ga0157375_10084569 | 3300013308 | Bacteria | 3222 |
| 335 | Ga0163163_10008178 | 3300014325 | Bacteria | 9278 |
| 336 | Ga0163163_10101857 | 3300014325 | Bacteria | 2894 |
| 337 | Ga0182008_10050838 | 3300014497 | Bacteria | 2057 |
| 338 | Ga0157377_10000299 | 3300014745 | Bacteria | 23241 |
| 339 | Ga0157379_10007463 | 3300014968 | Bacteria | 9468 |
| 340 | Ga0157379_10072913 | 3300014968 | Bacteria | 3073 |
| 341 | Ga0157379_10339244 | 3300014968 | Bacteria | 1374 |
| 342 | Ga0157379_11775534 | 3300014968 | Bacteria | 606 |
| 343 | Ga0157376_10001057 | 3300014969 | Bacteria | 18039 |
| 344 | Ga0157376_10004748 | 3300014969 | Bacteria | 9455 |
| 345 | Ga0157376_10027401 | 3300014969 | Bacteria | 4516 |
| 346 | Ga0157376_10584539 | 3300014969 | Bacteria | 1109 |
| 347 | Ga0157376_10598071 | 3300014969 | Bacteria | 1097 |
| 348 | Ga0163161_10831402 | 3300017792 | Bacteria | 778 |
| 349 | Ga0197907_10927678 | 3300020069 | Bacteria | 535 |
| 350 | Ga0197907_11334415 | 3300020069 | Bacteria | 645 |
| 351 | Ga0206356_10096944 | 3300020070 | Bacteria | 588 |
| 352 | Ga0206351_10499662 | 3300020077 | Bacteria | 628 |
| 353 | Ga0206352_10848511 | 3300020078 | Bacteria | 904 |
| 354 | Ga0206352_11344399 | 3300020078 | Bacteria | 960 |
| 355 | Ga0206350_10067152 | 3300020080 | Bacteria | 592 |
| 356 | Ga0206350_11376406 | 3300020080 | Bacteria | 731 |
| 357 | Ga0206353_10888394 | 3300020082 | Bacteria | 791 |
| 358 | Ga0206353_11437168 | 3300020082 | Bacteria | 1491 |
| 359 | Ga0206353_11689256 | 3300020082 | Bacteria | 1860 |
| 360 | Ga0213876_10401832 | 3300021384 | Bacteria | 729 |
| 361 | Ga0224712_10009206 | 3300022467 | Bacteria | 2964 |
| 362 | Ga0224712_10042705 | 3300022467 | Bacteria | 1720 |
| 363 | Ga0224712_10463267 | 3300022467 | Bacteria | 610 |
| 364 | Ga0256744_107106 | 3300023309 | Bacteria | 749 |
| 365 | Ga0209784_100141 | 3300025224 | Bacteria | 67045 |
| 366 | Ga0209784_104860 | 3300025224 | Bacteria | 901 |
| 367 | Ga0209566_100221 | 3300025225 | Bacteria | 56770 |
| 368 | Ga0209566_100273 | 3300025225 | Bacteria | 48159 |
| 369 | Ga0209566_100512 | 3300025225 | Bacteria | 26820 |
| 370 | Ga0209566_103758 | 3300025225 | Bacteria | 2221 |
| 371 | Ga0209147_100198 | 3300025229 | Bacteria | 67714 |
| 372 | Ga0209147_100385 | 3300025229 | Bacteria | 30752 |
| 373 | Ga0209147_101980 | 3300025229 | Bacteria | 5977 |
| 374 | Ga0209147_107627 | 3300025229 | Bacteria | 1395 |
| 375 | Ga0209437_100331 | 3300025233 | Bacteria | 58796 |
| 376 | Ga0209437_106937 | 3300025233 | Bacteria | 1867 |
| 377 | Ga0209258_100927 | 3300025242 | Bacteria | 14498 |
| 378 | Ga0209233_1002003 | 3300025261 | Bacteria | 7713 |
| 379 | Ga0209673_1001330 | 3300025273 | Bacteria | 24762 |
| 380 | Ga0209130_1014791 | 3300025284 | Bacteria | 1946 |
| 381 | Ga0209130_1015250 | 3300025284 | Bacteria | 1900 |
| 382 | Ga0209130_1053714 | 3300025284 | Bacteria | 723 |
| 383 | Ga0209130_1057683 | 3300025284 | Bacteria | 684 |
| 384 | Ga0209675_1004714 | 3300025291 | Bacteria | 5966 |
| 385 | Ga0209675_1035822 | 3300025291 | Bacteria | 1128 |
| 386 | Ga0209675_1041839 | 3300025291 | Bacteria | 997 |
| 387 | Ga0209676_1000745 | 3300025292 | Bacteria | 44098 |
| 388 | Ga0209025_1000639 | 3300025294 | Bacteria | 61845 |
| 389 | Ga0209025_1000976 | 3300025294 | Bacteria | 42839 |
| 390 | Ga0209025_1001421 | 3300025294 | Bacteria | 31646 |
| 391 | Ga0209025_1010512 | 3300025294 | Bacteria | 6262 |
| 392 | Ga0209025_1014524 | 3300025294 | Bacteria | 4832 |
| 393 | Ga0209025_1015652 | 3300025294 | Bacteria | 4551 |
| 394 | Ga0209025_1045113 | 3300025294 | Bacteria | 1832 |
| 395 | Ga0209025_1049611 | 3300025294 | Bacteria | 1687 |
| 396 | Ga0209025_1055754 | 3300025294 | Bacteria | 1525 |
| 397 | Ga0209025_1083683 | 3300025294 | Bacteria | 1072 |
| 398 | Ga0207426_1023848 | 3300025302 | Bacteria | 2083 |
| 399 | Ga0207426_1161456 | 3300025302 | Bacteria | 513 |
| 400 | Ga0207697_10017259 | 3300025315 | Bacteria | 2967 |
| 401 | Ga0207656_10087909 | 3300025321 | Bacteria | 1406 |
| 402 | Ga0207656_10212377 | 3300025321 | Bacteria | 938 |
| 403 | Ga0207696_1000471 | 3300025711 | Bacteria | 34549 |
| 404 | Ga0207696_1001142 | 3300025711 | Bacteria | 15286 |
| 405 | Ga0207655_1000971 | 3300025728 | Bacteria | 29540 |
| 406 | Ga0207655_1001486 | 3300025728 | Bacteria | 21499 |
| 407 | Ga0207655_1039477 | 3300025728 | Bacteria | 2049 |
| 408 | Ga0207655_1130267 | 3300025728 | Bacteria | 820 |
| 409 | Ga0207655_1197922 | 3300025728 | Bacteria | 602 |
| 410 | Ga0207655_1215894 | 3300025728 | Bacteria | 562 |
| 411 | Ga0207655_1229809 | 3300025728 | Bacteria | 536 |
| 412 | Ga0207713_1000405 | 3300025735 | Bacteria | 46074 |
| 413 | Ga0207713_1007861 | 3300025735 | Bacteria | 6217 |
| 414 | Ga0207713_1012576 | 3300025735 | Bacteria | 4511 |
| 415 | Ga0207692_10425061 | 3300025898 | Bacteria | 832 |
| 416 | Ga0207692_10816738 | 3300025898 | Bacteria | 610 |
| 417 | Ga0207710_10000981 | 3300025900 | Bacteria | 14984 |
| 418 | Ga0207710_10006009 | 3300025900 | Bacteria | 5203 |
| 419 | Ga0207688_10525463 | 3300025901 | Bacteria | 742 |
| 420 | Ga0207680_10040705 | 3300025903 | Bacteria | 2706 |
| 421 | Ga0207680_10114336 | 3300025903 | Bacteria | 1756 |
| 422 | Ga0207680_10286564 | 3300025903 | Bacteria | 1145 |
| 423 | Ga0207647_10004892 | 3300025904 | Bacteria | 9886 |
| 424 | Ga0207647_10020423 | 3300025904 | Bacteria | 4442 |
| 425 | Ga0207685_10529278 | 3300025905 | Bacteria | 624 |
| 426 | Ga0207685_10538842 | 3300025905 | Bacteria | 619 |
| 427 | Ga0207699_10380011 | 3300025906 | Bacteria | 1002 |
| 428 | Ga0207699_10752201 | 3300025906 | Bacteria | 715 |
| 429 | Ga0207645_10007324 | 3300025907 | Bacteria | 7801 |
| 430 | Ga0207645_10024412 | 3300025907 | Bacteria | 3920 |
| 431 | Ga0207643_10071627 | 3300025908 | Bacteria | 1996 |
| 432 | Ga0207705_10035811 | 3300025909 | Bacteria | 3551 |
| 433 | Ga0207705_10049624 | 3300025909 | Bacteria | 3020 |
| 434 | Ga0207705_10514440 | 3300025909 | Bacteria | 930 |
| 435 | Ga0207705_10542378 | 3300025909 | Bacteria | 904 |
| 436 | Ga0207705_10651369 | 3300025909 | Bacteria | 819 |
| 437 | Ga0207684_10019216 | 3300025910 | Bacteria | 5845 |
| 438 | Ga0207654_10001818 | 3300025911 | Bacteria | 11074 |
| 439 | Ga0207654_10013381 | 3300025911 | Bacteria | 4221 |
| 440 | Ga0207654_10049266 | 3300025911 | Bacteria | 2415 |
| 441 | Ga0207654_10335367 | 3300025911 | Bacteria | 1037 |
| 442 | Ga0207707_10000624 | 3300025912 | Bacteria | 35078 |
| 443 | Ga0207707_10233542 | 3300025912 | Bacteria | 1600 |
| 444 | Ga0207707_10593043 | 3300025912 | Bacteria | 938 |
| 445 | Ga0207695_10000379 | 3300025913 | Bacteria | 101331 |
| 446 | Ga0207695_10000384 | 3300025913 | Bacteria | 100121 |
| 447 | Ga0207695_10001178 | 3300025913 | Bacteria | 45089 |
| 448 | Ga0207695_10003215 | 3300025913 | Bacteria | 23264 |
| 449 | Ga0207695_10189409 | 3300025913 | Bacteria | 1975 |
| 450 | Ga0207695_10193386 | 3300025913 | Bacteria | 1951 |
| 451 | Ga0207695_10448132 | 3300025913 | Bacteria | 1174 |
| 452 | Ga0207695_10549223 | 3300025913 | Bacteria | 1037 |
| 453 | Ga0207695_10860868 | 3300025913 | Bacteria | 786 |
| 454 | Ga0207671_10000071 | 3300025914 | Bacteria | 159699 |
| 455 | Ga0207671_10000503 | 3300025914 | Bacteria | 53115 |
| 456 | Ga0207671_10029151 | 3300025914 | Bacteria | 4123 |
| 457 | Ga0207671_10968842 | 3300025914 | Bacteria | 671 |
| 458 | Ga0207671_11301378 | 3300025914 | Bacteria | 566 |
| 459 | Ga0207693_10021027 | 3300025915 | Bacteria | 5188 |
| 460 | Ga0207693_10374482 | 3300025915 | Bacteria | 1114 |
| 461 | Ga0207663_10195780 | 3300025916 | Bacteria | 1455 |
| 462 | Ga0207663_10366822 | 3300025916 | Bacteria | 1094 |
| 463 | Ga0207660_10003099 | 3300025917 | Bacteria | 10867 |
| 464 | Ga0207660_10274908 | 3300025917 | Bacteria | 1335 |
| 465 | Ga0207660_10411650 | 3300025917 | Bacteria | 1090 |
| 466 | Ga0207660_10927792 | 3300025917 | Bacteria | 710 |
| 467 | Ga0207657_10495943 | 3300025919 | Bacteria | 957 |
| 468 | Ga0207657_10609434 | 3300025919 | Bacteria | 852 |
| 469 | Ga0207657_10667096 | 3300025919 | Bacteria | 809 |
| 470 | Ga0207657_11331646 | 3300025919 | Bacteria | 541 |
| 471 | Ga0207649_10007836 | 3300025920 | Bacteria | 5812 |
| 472 | Ga0207649_10037634 | 3300025920 | Bacteria | 2924 |
| 473 | Ga0207649_10072355 | 3300025920 | Bacteria | 2205 |
| 474 | Ga0207649_11483743 | 3300025920 | Bacteria | 537 |
| 475 | Ga0207652_10049501 | 3300025921 | Bacteria | 3597 |
| 476 | Ga0207652_10406320 | 3300025921 | Bacteria | 1229 |
| 477 | Ga0207652_10439917 | 3300025921 | Bacteria | 1175 |
| 478 | Ga0207652_10511347 | 3300025921 | Bacteria | 1081 |
| 479 | Ga0207646_10151361 | 3300025922 | Bacteria | 2092 |
| 480 | Ga0207681_10039956 | 3300025923 | Bacteria | 3118 |
| 481 | Ga0207681_10534366 | 3300025923 | Bacteria | 963 |
| 482 | Ga0207694_10000247 | 3300025924 | Bacteria | 51633 |
| 483 | Ga0207694_10001290 | 3300025924 | Bacteria | 21610 |
| 484 | Ga0207694_10049671 | 3300025924 | Bacteria | 3247 |
| 485 | Ga0207694_10104531 | 3300025924 | Bacteria | 2247 |
| 486 | Ga0207650_10032901 | 3300025925 | Bacteria | 3753 |
| 487 | Ga0207650_10144626 | 3300025925 | Bacteria | 1872 |
| 488 | Ga0207650_10448961 | 3300025925 | Bacteria | 1073 |
| 489 | Ga0207650_10562968 | 3300025925 | Bacteria | 956 |
| 490 | Ga0207659_10035540 | 3300025926 | Bacteria | 3445 |
| 491 | Ga0207659_11132187 | 3300025926 | Bacteria | 673 |
| 492 | Ga0207687_10004776 | 3300025927 | Bacteria | 9015 |
| 493 | Ga0207687_10023510 | 3300025927 | Bacteria | 4109 |
| 494 | Ga0207687_10172618 | 3300025927 | Bacteria | 1669 |
| 495 | Ga0207687_10230870 | 3300025927 | Bacteria | 1462 |
| 496 | Ga0207700_10010087 | 3300025928 | Bacteria | 5939 |
| 497 | Ga0207700_10076852 | 3300025928 | Bacteria | 2592 |
| 498 | Ga0207700_10738709 | 3300025928 | Bacteria | 879 |
| 499 | Ga0207664_10218061 | 3300025929 | Bacteria | 1653 |
| 500 | Ga0207664_10575276 | 3300025929 | Bacteria | 1011 |
| 501 | Ga0207644_10002812 | 3300025931 | Bacteria | 11222 |
| 502 | Ga0207644_10008147 | 3300025931 | Bacteria | 6866 |
| 503 | Ga0207644_10085502 | 3300025931 | Bacteria | 2340 |
| 504 | Ga0207690_10153599 | 3300025932 | Bacteria | 1709 |
| 505 | Ga0207690_10524240 | 3300025932 | Bacteria | 961 |
| 506 | Ga0207706_10003090 | 3300025933 | Bacteria | 15998 |
| 507 | Ga0207686_10004531 | 3300025934 | Bacteria | 7445 |
| 508 | Ga0207709_10000416 | 3300025935 | Bacteria | 41461 |
| 509 | Ga0207709_10026556 | 3300025935 | Bacteria | 3328 |
| 510 | Ga0207669_10584370 | 3300025937 | Bacteria | 906 |
| 511 | Ga0207704_10232777 | 3300025938 | Bacteria | 1371 |
| 512 | Ga0207665_10100583 | 3300025939 | Bacteria | 2017 |
| 513 | Ga0207665_10217896 | 3300025939 | Bacteria | 1397 |
| 514 | Ga0207665_10930120 | 3300025939 | Bacteria | 690 |
| 515 | Ga0207691_10008111 | 3300025940 | Bacteria | 10082 |
| 516 | Ga0207691_10354977 | 3300025940 | Bacteria | 1254 |
| 517 | Ga0207711_10027616 | 3300025941 | Bacteria | 4768 |
| 518 | Ga0207711_10045923 | 3300025941 | Bacteria | 3732 |
| 519 | Ga0207711_10087252 | 3300025941 | Bacteria | 2737 |
| 520 | Ga0207711_10252906 | 3300025941 | Bacteria | 1618 |
| 521 | Ga0207711_10448790 | 3300025941 | Bacteria | 1200 |
| 522 | Ga0207711_11685084 | 3300025941 | Bacteria | 577 |
| 523 | Ga0207689_10000502 | 3300025942 | Bacteria | 36903 |
| 524 | Ga0207689_10007888 | 3300025942 | Bacteria | 9297 |
| 525 | Ga0207661_10029458 | 3300025944 | Bacteria | 4216 |
| 526 | Ga0207661_10072040 | 3300025944 | Bacteria | 2826 |
| 527 | Ga0207661_10137450 | 3300025944 | Bacteria | 2100 |
| 528 | Ga0207661_10167167 | 3300025944 | Bacteria | 1912 |
| 529 | Ga0207661_10246633 | 3300025944 | Bacteria | 1586 |
| 530 | Ga0207679_10023401 | 3300025945 | Bacteria | 4224 |
| 531 | Ga0207679_10351814 | 3300025945 | Bacteria | 1284 |
| 532 | Ga0207667_10006951 | 3300025949 | Bacteria | 13678 |
| 533 | Ga0207667_10008805 | 3300025949 | Bacteria | 11950 |
| 534 | Ga0207667_10014641 | 3300025949 | Bacteria | 8931 |
| 535 | Ga0207667_10060987 | 3300025949 | Bacteria | 3947 |
| 536 | Ga0207667_10371585 | 3300025949 | Bacteria | 1457 |
| 537 | Ga0207667_10919072 | 3300025949 | Bacteria | 866 |
| 538 | Ga0207667_11448986 | 3300025949 | Bacteria | 659 |
| 539 | Ga0207667_11485453 | 3300025949 | Bacteria | 649 |
| 540 | Ga0207651_10416249 | 3300025960 | Bacteria | 1146 |
| 541 | Ga0207712_10226277 | 3300025961 | Bacteria | 1498 |
| 542 | Ga0207668_10204145 | 3300025972 | Bacteria | 1576 |
| 543 | Ga0207640_10782303 | 3300025981 | Bacteria | 825 |
| 544 | Ga0207640_10807724 | 3300025981 | Bacteria | 813 |
| 545 | Ga0207658_10000267 | 3300025986 | Bacteria | 55017 |
| 546 | Ga0207658_10184464 | 3300025986 | Bacteria | 1729 |
| 547 | Ga0207677_10000115 | 3300026023 | Bacteria | 65569 |
| 548 | Ga0207677_10129298 | 3300026023 | Bacteria | 1914 |
| 549 | Ga0207677_10241466 | 3300026023 | Bacteria | 1462 |
| 550 | Ga0207703_10041774 | 3300026035 | Bacteria | 3676 |
| 551 | Ga0207703_10051602 | 3300026035 | Bacteria | 3334 |
| 552 | Ga0207639_10000868 | 3300026041 | Bacteria | 20542 |
| 553 | Ga0207639_10188656 | 3300026041 | Bacteria | 1759 |
| 554 | Ga0207639_10208644 | 3300026041 | Bacteria | 1680 |
| 555 | Ga0207678_10147456 | 3300026067 | Bacteria | 2008 |
| 556 | Ga0207678_10443503 | 3300026067 | Bacteria | 1128 |
| 557 | Ga0207702_10001589 | 3300026078 | Bacteria | 22475 |
| 558 | Ga0207702_10003889 | 3300026078 | Bacteria | 13450 |
| 559 | Ga0207702_10047957 | 3300026078 | Bacteria | 3601 |
| 560 | Ga0207702_10696570 | 3300026078 | Bacteria | 1001 |
| 561 | Ga0207702_10830686 | 3300026078 | Bacteria | 914 |
| 562 | Ga0207702_11135850 | 3300026078 | Bacteria | 775 |
| 563 | Ga0207641_10001519 | 3300026088 | Bacteria | 22714 |
| 564 | Ga0207641_10450787 | 3300026088 | Bacteria | 1243 |
| 565 | Ga0207648_10044039 | 3300026089 | Bacteria | 3917 |
| 566 | Ga0207676_10004236 | 3300026095 | Bacteria | 10131 |
| 567 | Ga0207676_10589015 | 3300026095 | Bacteria | 1067 |
| 568 | Ga0207674_10033769 | 3300026116 | Bacteria | 5355 |
| 569 | Ga0207674_10053258 | 3300026116 | Bacteria | 4125 |
| 570 | Ga0207674_10125804 | 3300026116 | Bacteria | 2529 |
| 571 | Ga0207683_10006613 | 3300026121 | Bacteria | 9920 |
| 572 | Ga0207698_10000039 | 3300026142 | Bacteria | 101073 |
| 573 | Ga0207698_10000059 | 3300026142 | Bacteria | 76632 |
| 574 | Ga0207698_10158037 | 3300026142 | Bacteria | 1978 |
| 575 | Ga0207698_11262558 | 3300026142 | Bacteria | 753 |
| 576 | Ga0207698_11553756 | 3300026142 | Bacteria | 677 |
| 577 | Ga0207698_11952906 | 3300026142 | Bacteria | 601 |
| 578 | Ga0209371_1000923 | 3300027312 | Bacteria | 23176 |
| 579 | Ga0210000_1001373 | 3300027462 | Bacteria | 3430 |
| 580 | Ga0209179_1022000 | 3300027512 | Bacteria | 1249 |
| 581 | Ga0209982_1024772 | 3300027552 | Bacteria | 931 |
| 582 | Ga0209970_1000914 | 3300027614 | Bacteria | 5205 |
| 583 | Ga0209971_1022190 | 3300027682 | Bacteria | 1511 |
| 584 | Ga0209974_10014241 | 3300027876 | Bacteria | 2649 |
| 585 | Ga0268266_10110944 | 3300028379 | Bacteria | 2430 |
| 586 | Ga0268266_10566523 | 3300028379 | Bacteria | 1089 |
| 587 | Ga0268265_11056872 | 3300028380 | Bacteria | 804 |
| 588 | Ga0268264_10000863 | 3300028381 | Bacteria | 32143 |
| 589 | Ga0268264_11332615 | 3300028381 | Bacteria | 728 |
| 590 | Ga0265336_10006401 | 3300028666 | Bacteria | 4245 |
| 591 | Ga0265338_10004125 | 3300028800 | Bacteria | 19883 |
| 592 | Ga0265338_10035290 | 3300028800 | Bacteria | 4812 |
| 593 | Ga0265338_10047348 | 3300028800 | Bacteria | 3928 |
| 594 | Ga0265338_10431349 | 3300028800 | Bacteria | 935 |
| 595 | Ga0265338_10459625 | 3300028800 | Bacteria | 900 |
| 596 | Ga0311000_122265 | 3300029272 | Bacteria | 1547 |
| 597 | Ga0311000_129387 | 3300029272 | Bacteria | 519 |
| 598 | Ga0311008_126459 | 3300029273 | Bacteria | 563 |
| 599 | Ga0311011_109112 | 3300029280 | Bacteria | 1922 |
| 600 | Ga0311003_174330 | 3300029282 | Bacteria | 820 |
| 601 | Ga0310982_141133 | 3300029283 | Bacteria | 1262 |
| 602 | Ga0310982_144591 | 3300029283 | Bacteria | 892 |
| 603 | Ga0265324_10030792 | 3300029957 | Bacteria | 1881 |
| 604 | Ga0265324_10315219 | 3300029957 | Bacteria | 533 |
| 605 | Ga0237817_10115 | 3300030083 | Bacteria | 24754 |
| 606 | Ga0268256_1000773 | 3300030500 | Bacteria | 23269 |
| 607 | Ga0265762_1138664 | 3300030760 | Bacteria | 570 |
| 608 | Ga0265763_1003385 | 3300030763 | Bacteria | 1268 |
| 609 | Ga0265766_1000542 | 3300030863 | Bacteria | 1684 |
| 610 | Ga0265770_1115253 | 3300030878 | Bacteria | 560 |
| 611 | Ga0265776_101371 | 3300030880 | Bacteria | 1025 |
| 612 | Ga0265768_101141 | 3300030963 | Bacteria | 1199 |
| 613 | Ga0265773_1017950 | 3300031018 | Bacteria | 674 |
| 614 | Ga0265760_10112585 | 3300031090 | Bacteria | 868 |
| 615 | Ga0265760_10265096 | 3300031090 | Bacteria | 599 |
| 616 | Ga0265330_10000477 | 3300031235 | Bacteria | 26910 |
| 617 | Ga0265330_10058036 | 3300031235 | Bacteria | 1687 |
| 618 | Ga0265330_10072295 | 3300031235 | Bacteria | 1492 |
| 619 | Ga0265330_10079798 | 3300031235 | Bacteria | 1410 |
| 620 | Ga0265330_10098418 | 3300031235 | Bacteria | 1253 |
| 621 | Ga0265330_10149159 | 3300031235 | Bacteria | 994 |
| 622 | Ga0265330_10156967 | 3300031235 | Bacteria | 966 |
| 623 | Ga0265332_10136639 | 3300031238 | Bacteria | 1027 |
| 624 | Ga0265332_10235545 | 3300031238 | Bacteria | 758 |
| 625 | Ga0265332_10248435 | 3300031238 | Bacteria | 736 |
| 626 | Ga0265328_10008680 | 3300031239 | Bacteria | 4174 |
| 627 | Ga0265328_10024645 | 3300031239 | Bacteria | 2270 |
| 628 | Ga0265328_10035367 | 3300031239 | Bacteria | 1847 |
| 629 | Ga0265320_10130533 | 3300031240 | Bacteria | 1142 |
| 630 | Ga0265320_10177775 | 3300031240 | Bacteria | 954 |
| 631 | Ga0265320_10445431 | 3300031240 | Bacteria | 572 |
| 632 | Ga0265320_10545725 | 3300031240 | Bacteria | 512 |
| 633 | Ga0265325_10003065 | 3300031241 | Bacteria | 11039 |
| 634 | Ga0265325_10012258 | 3300031241 | Bacteria | 4906 |
| 635 | Ga0265325_10049305 | 3300031241 | Bacteria | 2173 |
| 636 | Ga0265325_10170027 | 3300031241 | Bacteria | 1020 |
| 637 | Ga0265325_10295415 | 3300031241 | Bacteria | 724 |
| 638 | Ga0265340_10010369 | 3300031247 | Bacteria | 4985 |
| 639 | Ga0265340_10019409 | 3300031247 | Bacteria | 3501 |
| 640 | Ga0265340_10049224 | 3300031247 | Bacteria | 2047 |
| 641 | Ga0265340_10346071 | 3300031247 | Bacteria | 657 |
| 642 | Ga0265340_10429413 | 3300031247 | Bacteria | 582 |
| 643 | Ga0265339_10000029 | 3300031249 | Bacteria | 139089 |
| 644 | Ga0265339_10000921 | 3300031249 | Bacteria | 22618 |
| 645 | Ga0265339_10021757 | 3300031249 | Bacteria | 3724 |
| 646 | Ga0265339_10021831 | 3300031249 | Bacteria | 3716 |
| 647 | Ga0265339_10048938 | 3300031249 | Bacteria | 2316 |
| 648 | Ga0265339_10078311 | 3300031249 | Bacteria | 1750 |
| 649 | Ga0265339_10140738 | 3300031249 | Bacteria | 1227 |
| 650 | Ga0265339_10172672 | 3300031249 | Bacteria | 1081 |
| 651 | Ga0265331_10023806 | 3300031250 | Bacteria | 3105 |
| 652 | Ga0265327_10330699 | 3300031251 | Bacteria | 667 |
| 653 | Ga0265316_10006934 | 3300031344 | Bacteria | 10744 |
| 654 | Ga0265316_10007872 | 3300031344 | Bacteria | 9973 |
| 655 | Ga0265316_10013957 | 3300031344 | Bacteria | 7104 |
| 656 | Ga0265316_10015244 | 3300031344 | Bacteria | 6728 |
| 657 | Ga0265316_10030435 | 3300031344 | Bacteria | 4424 |
| 658 | Ga0265316_10033589 | 3300031344 | Bacteria | 4176 |
| 659 | Ga0265316_10039682 | 3300031344 | Bacteria | 3780 |
| 660 | Ga0265316_10165624 | 3300031344 | Bacteria | 1651 |
| 661 | Ga0265316_10180534 | 3300031344 | Bacteria | 1572 |
| 662 | Ga0265316_10260504 | 3300031344 | Bacteria | 1272 |
| 663 | Ga0265316_10301472 | 3300031344 | Bacteria | 1167 |
| 664 | Ga0265316_10344478 | 3300031344 | Bacteria | 1080 |
| 665 | Ga0265316_10507230 | 3300031344 | Bacteria | 861 |
| 666 | Ga0265316_10782106 | 3300031344 | Bacteria | 670 |
| 667 | Ga0265316_10936993 | 3300031344 | Bacteria | 604 |
| 668 | Ga0307408_100003263 | 3300031548 | Bacteria | 11155 |
| 669 | Ga0307408_100021999 | 3300031548 | Bacteria | 4325 |
| 670 | Ga0307408_100125708 | 3300031548 | Bacteria | 1994 |
| 671 | Ga0307408_101718723 | 3300031548 | Bacteria | 598 |
| 672 | Ga0265313_10016184 | 3300031595 | Bacteria | 4299 |
| 673 | Ga0265313_10034221 | 3300031595 | Bacteria | 2571 |
| 674 | Ga0265313_10050332 | 3300031595 | Bacteria | 2000 |
| 675 | Ga0265313_10070860 | 3300031595 | Bacteria | 1605 |
| 676 | Ga0265314_10001691 | 3300031711 | Bacteria | 24008 |
| 677 | Ga0265314_10019867 | 3300031711 | Bacteria | 5195 |
| 678 | Ga0265314_10041833 | 3300031711 | Bacteria | 3275 |
| 679 | Ga0265314_10073151 | 3300031711 | Bacteria | 2286 |
| 680 | Ga0265314_10585754 | 3300031711 | Bacteria | 576 |
| 681 | Ga0265342_10000307 | 3300031712 | Bacteria | 55504 |
| 682 | Ga0265342_10008915 | 3300031712 | Bacteria | 7128 |
| 683 | Ga0265342_10011411 | 3300031712 | Bacteria | 6084 |
| 684 | Ga0265342_10023693 | 3300031712 | Bacteria | 3881 |
| 685 | Ga0265342_10054842 | 3300031712 | Bacteria | 2367 |
| 686 | Ga0265342_10056084 | 3300031712 | Bacteria | 2336 |
| 687 | Ga0265342_10068984 | 3300031712 | Bacteria | 2065 |
| 688 | Ga0265342_10080695 | 3300031712 | Bacteria | 1879 |
| 689 | Ga0265342_10113043 | 3300031712 | Bacteria | 1535 |
| 690 | Ga0265342_10282902 | 3300031712 | Bacteria | 877 |
| 691 | Ga0265342_10550085 | 3300031712 | Bacteria | 585 |
| 692 | Ga0316578_10262150 | 3300031728 | Unclassified | 1036 |
| 693 | Ga0316577_10586530 | 3300031733 | Bacteria | 634 |
| 694 | Ga0307413_10512676 | 3300031824 | Bacteria | 965 |
| 695 | Ga0307410_10091988 | 3300031852 | Bacteria | 2155 |
| 696 | Ga0307407_10623276 | 3300031903 | Bacteria | 805 |
| 697 | Ga0307412_10020619 | 3300031911 | Bacteria | 4015 |
| 698 | Ga0307409_100002336 | 3300031995 | Bacteria | 9855 |
| 699 | Ga0307409_100007174 | 3300031995 | Bacteria | 6641 |
| 700 | Ga0307409_100822098 | 3300031995 | Bacteria | 938 |
| 701 | Ga0307416_100007104 | 3300032002 | Bacteria | 7078 |
| 702 | Ga0307416_100170833 | 3300032002 | Bacteria | 2023 |
| 703 | Ga0307416_100203113 | 3300032002 | Bacteria | 1882 |
| 704 | Ga0307416_101860606 | 3300032002 | Bacteria | 705 |
| 705 | Ga0307415_101082758 | 3300032126 | Bacteria | 749 |
| 706 | Ga0307415_102023252 | 3300032126 | Bacteria | 561 |
| 707 | Ga0316596_1068366 | 3300033541 | Unclassified | 950 |
| 708 | Ga0316215_1000833 | 3300033544 | Bacteria | 3078 |
| 709 | Ga0373929_0241408 | 3300035085 | Bacteria | 521 |
| 710 | Ga0373934_0357625 | 3300035086 | Bacteria | 608 |
| 711 | Ga0373940_0294540 | 3300035088 | Bacteria | 557 |
| 712 | Ga0373923_0264395 | 3300035111 | Bacteria | 808 |
| 713 | Ga0373953_0240072 | 3300035117 | Bacteria | 787 |
| 714 | Ga0373954_0027849 | 3300035118 | Bacteria | 2596 |
| 715 | Ga0373956_0490424 | 3300035119 | Bacteria | 586 |
| 716 | Ga0373957_0473770 | 3300035120 | Bacteria | 543 |
| 717 | Ga0373943_0517005 | 3300035170 | Bacteria | 699 |
| 718 | Ga0373955_0131727 | 3300035172 | Bacteria | 1460 |
| 719 | Ga0373955_0352630 | 3300035172 | Bacteria | 891 |
| 720 | Ga0373961_0061503 | 3300035241 | Bacteria | 1141 |
| 721 | Ga0373931_0020821 | 3300035691 | Bacteria | 3284 |
| 722 | Ga0373931_0496784 | 3300035691 | Bacteria | 786 |
| 723 | Ga0373935_1187046 | 3300035692 | Bacteria | 569 |
| 724 | Ga0373935_1377227 | 3300035692 | Bacteria | 527 |
| 725 | Ga0373933_0041165 | 3300035724 | Bacteria | 2726 |
| 726 | Ga0373933_0323080 | 3300035724 | Bacteria | 1001 |
| 727 | Ga0373937_0027753 | 3300036401 | Bacteria | 5122 |
| 728 | Ga0373937_0049903 | 3300036401 | Bacteria | 3832 |
| 729 | Ga0373937_0351741 | 3300036401 | Bacteria | 1396 |
| 730 | Ga0373937_1060536 | 3300036401 | Bacteria | 759 |
| 731 | Ga0373937_1136810 | 3300036401 | Bacteria | 730 |
| 732 | Ga0265778_051585 | 3300036457 | Bacteria | 564 |
| 733 | Ga0316584_0008199 | 3300036712 | Bacteria | 7187 |
| 734 | Ga0316584_0153084 | 3300036712 | Bacteria | 1716 |
| 735 | Ga0373925_1406404 | 3300037068 | Bacteria | 571 |
| 736 | Ga0395899_0203176 | 3300037312 | Bacteria | 1380 |
| 737 | Ga0395899_0270279 | 3300037312 | Bacteria | 1160 |
| 738 | Ga0395899_0387442 | 3300037312 | Bacteria | 927 |
| 739 | Ga0395900_0234286 | 3300037418 | Bacteria | 1845 |
| 740 | Ga0395900_0411933 | 3300037418 | Bacteria | 1314 |
| 741 | Ga0395900_1547859 | 3300037418 | Bacteria | 575 |
| 742 | Ga0395898_0428885 | 3300037466 | Bacteria | 1260 |
| 743 | Ga0395898_0582816 | 3300037466 | Bacteria | 1061 |
| 744 | Ga0395898_0775795 | 3300037466 | Bacteria | 899 |
| 745 | Ga0395898_0851716 | 3300037466 | Bacteria | 851 |
| 746 | Ga0395898_1223796 | 3300037466 | Bacteria | 682 |
| 747 | Ga0395905_0573972 | 3300037471 | Bacteria | 1029 |
| 748 | Ga0395901_0624307 | 3300038443 | Bacteria | 1084 |
| 749 | Ga0395901_0962277 | 3300038443 | Bacteria | 832 |
| 750 | Ga0395901_1417306 | 3300038443 | Bacteria | 653 |
| 751 | Ga0237819_00239 | 3300038705 | Bacteria | 20080 |
| 752 | Ga0436365_0559080 | 3300039437 | Bacteria | 1890 |
| 753 | Ga0436365_1532164 | 3300039437 | Bacteria | 826 |
| 754 | Ga0436360_0240674 | 3300039438 | Bacteria | 848 |
| 755 | Ga0436360_0343285 | 3300039438 | Bacteria | 1087 |
| 756 | Ga0436363_0991670 | 3300039450 | Bacteria | 1217 |
| 757 | Ga0436363_1358816 | 3300039450 | Bacteria | 558 |
| 758 | Ga0436362_0143704 | 3300039453 | Bacteria | 1099 |
| 759 | Ga0439436_0002304 | 3300041404 | Bacteria | 5726 |
| 760 | Ga0439439_0000103 | 3300041406 | Bacteria | 11384 |
| 761 | Ga0439439_0003260 | 3300041406 | Bacteria | 3566 |
| 762 | Ga0439453_0114324 | 3300041408 | Bacteria | 613 |
| 763 | Ga0451855_0403959 | 3300041511 | Bacteria | 550 |
| 764 | Ga0451855_0452095 | 3300041511 | Bacteria | 548 |
| 765 | Ga0451855_0548201 | 3300041511 | Bacteria | 1185 |
| 766 | Ga0451853_1007767 | 3300041512 | Bacteria | 523 |
| 767 | Ga0439433_0002523 | 3300041999 | Bacteria | 3886 |
| 768 | Ga0439433_0005396 | 3300041999 | Bacteria | 2746 |
| 769 | Ga0439433_0217922 | 3300041999 | Bacteria | 508 |
| 770 | Ga0439449_0000074 | 3300042007 | Bacteria | 31794 |
| 771 | Ga0439449_0006536 | 3300042007 | Bacteria | 4455 |
| 772 | Ga0439457_013262 | 3300042014 | Bacteria | 1853 |
| 773 | Ga0439462_0004039 | 3300042015 | Bacteria | 3558 |
| 774 | Ga0439462_0008776 | 3300042015 | Bacteria | 2555 |
| 775 | Ga0450906_043496 | 3300042145 | Bacteria | 793 |
| 776 | Ga0466969_0001060 | 3300044656 | Bacteria | 14842 |
| 777 | Ga0466972_0077452 | 3300044658 | Bacteria | 1584 |
| 778 | Ga0466965_0125423 | 3300044683 | Bacteria | 1328 |
| 779 | Ga0466966_0298382 | 3300044684 | Bacteria | 968 |
| 780 | Ga0466963_0003181 | 3300044694 | Bacteria | 9324 |
| 781 | Ga0466963_0767058 | 3300044694 | Bacteria | 680 |
| 782 | Ga0466963_1308113 | 3300044694 | Bacteria | 509 |
| 783 | Ga0466968_0002977 | 3300044735 | Bacteria | 6255 |
| 784 | Ga0466970_0031453 | 3300044765 | Bacteria | 2803 |
| 785 | Ga0466970_0224164 | 3300044765 | Bacteria | 1050 |
| 786 | Ga0466957_0691587 | 3300044842 | Bacteria | 719 |
| 787 | Ga0466957_0991121 | 3300044842 | Bacteria | 603 |
| 788 | Ga0466957_1077645 | 3300044842 | Bacteria | 579 |
| 789 | Ga0466959_0186586 | 3300045049 | Bacteria | 1448 |
| 790 | Ga0466958_0031906 | 3300045836 | Bacteria | 3132 |
| 791 | Ga0466958_0837702 | 3300045836 | Bacteria | 600 |
| 792 | Ga0466967_0000327 | 3300045976 | Bacteria | 21715 |
| 793 | Ga0466967_0140642 | 3300045976 | Bacteria | 2248 |
| 794 | Ga0466967_1023902 | 3300045976 | Bacteria | 822 |
| 795 | Ga0466967_1031363 | 3300045976 | Bacteria | 819 |
| 796 | Ga0495627_018408 | 3300046453 | Bacteria | 2356 |
| 797 | Ga0495627_040568 | 3300046453 | Bacteria | 1433 |
| 798 | Ga0495592_0276481 | 3300046454 | Bacteria | 1100 |
| 799 | Ga0495603_0005187 | 3300046455 | Bacteria | 7778 |
| 800 | Ga0495590_0042229 | 3300046457 | Bacteria | 1590 |
| 801 | Ga0495590_0131097 | 3300046457 | Bacteria | 901 |
| 802 | Ga0495590_0226889 | 3300046457 | Bacteria | 691 |
| 803 | Ga0495591_028162 | 3300046458 | Bacteria | 1722 |
| 804 | Ga0495591_096034 | 3300046458 | Bacteria | 739 |
| 805 | Ga0495629_0072119 | 3300046459 | Bacteria | 2410 |
| 806 | Ga0495651_0917238 | 3300046462 | Bacteria | 535 |
| 807 | Ga0495580_0083130 | 3300046472 | Bacteria | 2231 |
| 808 | Ga0495580_0198771 | 3300046472 | Bacteria | 1382 |
| 809 | Ga0495582_0106361 | 3300046473 | Bacteria | 1574 |
| 810 | Ga0495582_0499130 | 3300046473 | Bacteria | 703 |
| 811 | Ga0495605_0025905 | 3300046474 | Bacteria | 3052 |
| 812 | Ga0495605_0075252 | 3300046474 | Bacteria | 1588 |
| 813 | Ga0495639_0023957 | 3300046475 | Bacteria | 2685 |
| 814 | Ga0495584_0024667 | 3300046491 | Bacteria | 3049 |
| 815 | Ga0495584_0209109 | 3300046491 | Bacteria | 992 |
| 816 | Ga0495585_0001321 | 3300046492 | Bacteria | 19698 |
| 817 | Ga0495607_0038465 | 3300046501 | Bacteria | 2866 |
| 818 | Ga0495607_0161401 | 3300046501 | Bacteria | 1139 |
| 819 | Ga0495606_0035724 | 3300046507 | Bacteria | 3394 |
| 820 | Ga0495606_0093700 | 3300046507 | Bacteria | 1842 |
| 821 | Ga0495606_0269138 | 3300046507 | Bacteria | 937 |
| 822 | Ga0495608_0322977 | 3300046511 | Bacteria | 953 |
| 823 | Ga0495608_0584883 | 3300046511 | Bacteria | 671 |
| 824 | Ga0495608_0921658 | 3300046511 | Bacteria | 511 |
| 825 | Ga0495610_0204571 | 3300046512 | Bacteria | 806 |
| 826 | Ga0495618_0747651 | 3300046514 | Bacteria | 572 |
| 827 | Ga0495620_0023267 | 3300046515 | Bacteria | 2966 |
| 828 | Ga0495628_0161928 | 3300046516 | Bacteria | 1700 |
| 829 | Ga0495630_0738023 | 3300046517 | Bacteria | 753 |
| 830 | Ga0495630_0769949 | 3300046517 | Bacteria | 735 |
| 831 | Ga0495637_0088472 | 3300046520 | Bacteria | 1225 |
| 832 | Ga0495637_0142359 | 3300046520 | Bacteria | 909 |
| 833 | Ga0495637_0174808 | 3300046520 | Bacteria | 799 |
| 834 | Ga0495643_0031759 | 3300046522 | Bacteria | 2936 |
| 835 | Ga0495652_0026891 | 3300046529 | Bacteria | 5076 |
| 836 | Ga0495654_0015505 | 3300046530 | Bacteria | 4045 |
| 837 | Ga0495654_0251932 | 3300046530 | Bacteria | 735 |
| 838 | Ga0495665_0073755 | 3300046531 | Bacteria | 1797 |
| 839 | Ga0495586_0129583 | 3300046535 | Bacteria | 1412 |
| 840 | Ga0495587_0047822 | 3300046536 | Bacteria | 2536 |
| 841 | Ga0495609_0055641 | 3300046538 | Bacteria | 1755 |
| 842 | Ga0495621_0479869 | 3300046539 | Bacteria | 535 |
| 843 | Ga0495597_0091528 | 3300046542 | Bacteria | 1291 |
| 844 | Ga0495645_0046981 | 3300046543 | Bacteria | 3146 |
| 845 | Ga0495645_0347104 | 3300046543 | Bacteria | 957 |
| 846 | Ga0495622_0027467 | 3300046557 | Bacteria | 2656 |
| 847 | Ga0495622_0064067 | 3300046557 | Bacteria | 1700 |
| 848 | Ga0495633_0027955 | 3300046558 | Bacteria | 2751 |
| 849 | Ga0495633_0065769 | 3300046558 | Bacteria | 1694 |
| 850 | Ga0495667_0312819 | 3300046559 | Bacteria | 994 |
| 851 | Ga0495668_0044828 | 3300046616 | Bacteria | 2458 |
| 852 | Ga0495634_0101729 | 3300046642 | Bacteria | 1856 |
| 853 | Ga0495611_0078881 | 3300046648 | Bacteria | 1512 |
| 854 | Ga0495635_0209063 | 3300046663 | Bacteria | 1322 |
| 855 | Ga0495661_0013338 | 3300046665 | Bacteria | 5523 |
| 856 | Ga0495661_0020024 | 3300046665 | Bacteria | 4375 |
| 857 | Ga0495661_0085148 | 3300046665 | Bacteria | 1812 |
| 858 | Ga0495661_0455518 | 3300046665 | Bacteria | 615 |
| 859 | Ga0495588_0044206 | 3300046674 | Bacteria | 2281 |
| 860 | Ga0495657_0376623 | 3300046675 | Bacteria | 838 |
| 861 | Ga0495599_0059726 | 3300046678 | Bacteria | 2385 |
| 862 | Ga0495623_0130813 | 3300046679 | Bacteria | 1503 |
| 863 | Ga0495623_0332872 | 3300046679 | Bacteria | 831 |
| 864 | Ga0495623_0609679 | 3300046679 | Bacteria | 566 |
| 865 | Ga0495646_0516509 | 3300046680 | Bacteria | 612 |
| 866 | Ga0495647_0294951 | 3300046681 | Bacteria | 730 |
| 867 | Ga0495658_0882969 | 3300046683 | Bacteria | 572 |
| 868 | Ga0495669_0069731 | 3300046684 | Bacteria | 1600 |
| 869 | Ga0495613_0342299 | 3300046689 | Bacteria | 1028 |
| 870 | Ga0495613_0403249 | 3300046689 | Bacteria | 932 |
| 871 | Ga0495613_0687720 | 3300046689 | Bacteria | 674 |
| 872 | Ga0495670_0045580 | 3300046691 | Bacteria | 2189 |
| 873 | Ga0495670_0172272 | 3300046691 | Bacteria | 1140 |
| 874 | Ga0495670_0243336 | 3300046691 | Bacteria | 958 |
| 875 | Ga0495649_0030798 | 3300046694 | Bacteria | 2961 |
| 876 | Ga0495649_0083659 | 3300046694 | Bacteria | 1705 |
| 877 | Ga0495649_0278784 | 3300046694 | Bacteria | 854 |
| 878 | Ga0495649_0588002 | 3300046694 | Bacteria | 550 |
| 879 | Ga0495589_0076252 | 3300046794 | Bacteria | 1635 |
| 880 | Ga0495589_0107725 | 3300046794 | Bacteria | 1346 |
| 881 | Ga0495600_0154968 | 3300046809 | Bacteria | 1482 |
| 882 | Ga0495660_0004825 | 3300046810 | Bacteria | 8134 |
| 883 | Ga0495660_0017884 | 3300046810 | Bacteria | 4077 |
| 884 | Ga0495581_0054294 | 3300047315 | Bacteria | 2313 |
| 885 | Ga0495604_0266968 | 3300047317 | Bacteria | 1161 |
| 886 | Ga0495636_0136155 | 3300047318 | Bacteria | 1095 |
| 887 | Ga0495636_0456330 | 3300047318 | Bacteria | 614 |
| 888 | Ga0495676_0052043 | 3300047321 | Bacteria | 3272 |
| 889 | Ga0495676_0133814 | 3300047321 | Bacteria | 1786 |
| 890 | Ga0495680_0347683 | 3300047322 | Bacteria | 1033 |
| 891 | Ga0495683_0005075 | 3300047323 | Bacteria | 7366 |
| 892 | Ga0495687_033682 | 3300047443 | Bacteria | 2321 |
| 893 | Ga0495675_0253268 | 3300047444 | Bacteria | 1057 |
| 894 | Ga0495681_0048530 | 3300047470 | Bacteria | 2012 |
| 895 | Ga0495681_0101906 | 3300047470 | Bacteria | 1254 |
| 896 | Ga0495684_0269316 | 3300047471 | Bacteria | 1233 |
| 897 | Ga0495686_0000545 | 3300047472 | Bacteria | 53866 |
| 898 | Ga0495686_0012601 | 3300047472 | Bacteria | 5910 |
| 899 | Ga0495686_0152425 | 3300047472 | Bacteria | 1356 |
| 900 | Ga0495686_0230526 | 3300047472 | Bacteria | 1049 |
| 901 | Ga0495602_0206155 | 3300048088 | Bacteria | 1496 |
| 902 | Ga0495602_0415439 | 3300048088 | Bacteria | 956 |
| 903 | Ga0495626_0006526 | 3300048091 | Bacteria | 6630 |
| 904 | Ga0495626_0133338 | 3300048091 | Bacteria | 1059 |
| 905 | Ga0496100_0001314 | 3300048903 | Bacteria | 12148 |
| 906 | Ga0496100_0133827 | 3300048903 | Bacteria | 1749 |
| 907 | Ga0496100_0284782 | 3300048903 | Bacteria | 1233 |
| 908 | Ga0496100_0679634 | 3300048903 | Bacteria | 803 |
| 909 | Ga0496100_1033025 | 3300048903 | Bacteria | 647 |
| 910 | Ga0496101_0000972 | 3300048904 | Bacteria | 16923 |
| 911 | Ga0496101_0088730 | 3300048904 | Bacteria | 2297 |
| 912 | Ga0496101_0907534 | 3300048904 | Bacteria | 694 |
| 913 | Ga0496101_1081780 | 3300048904 | Bacteria | 630 |
| 914 | Ga0496101_1364296 | 3300048904 | Bacteria | 553 |
| 915 | Ga0496102_0002206 | 3300048905 | Bacteria | 16718 |
| 916 | Ga0496102_0011196 | 3300048905 | Bacteria | 7725 |
| 917 | Ga0496102_0099351 | 3300048905 | Bacteria | 2701 |
| 918 | Ga0496102_0629539 | 3300048905 | Bacteria | 996 |
| 919 | Ga0496102_0704145 | 3300048905 | Bacteria | 933 |
| 920 | Ga0496102_0852601 | 3300048905 | Bacteria | 833 |
| 921 | Ga0496103_0001955 | 3300048906 | Bacteria | 13326 |
| 922 | Ga0496103_0047911 | 3300048906 | Bacteria | 2641 |
| 923 | Ga0496103_0276565 | 3300048906 | Bacteria | 1080 |
| 924 | Ga0496103_0883260 | 3300048906 | Bacteria | 561 |
| 925 | Ga0496104_0001658 | 3300048907 | Bacteria | 19228 |
| 926 | Ga0496104_0005618 | 3300048907 | Bacteria | 10979 |
| 927 | Ga0496104_0166573 | 3300048907 | Bacteria | 2113 |
| 928 | Ga0496104_0208553 | 3300048907 | Bacteria | 1866 |
| 929 | Ga0496104_0305470 | 3300048907 | Bacteria | 1503 |
| 930 | Ga0496104_0308297 | 3300048907 | Bacteria | 1496 |
| 931 | Ga0496104_0348085 | 3300048907 | Bacteria | 1395 |
| 932 | Ga0496105_0002080 | 3300048908 | Bacteria | 14485 |
| 933 | Ga0496105_0317361 | 3300048908 | Bacteria | 1250 |
| 934 | Ga0496105_0509692 | 3300048908 | Bacteria | 943 |
| 935 | Ga0496105_0605966 | 3300048908 | Bacteria | 849 |
| 936 | Ga0496106_0002267 | 3300048909 | Bacteria | 14349 |
| 937 | Ga0496106_0649413 | 3300048909 | Bacteria | 843 |
| 938 | Ga0496107_0003223 | 3300048910 | Bacteria | 10859 |
| 939 | Ga0496107_0058466 | 3300048910 | Bacteria | 2788 |
| 940 | Ga0496107_0215509 | 3300048910 | Bacteria | 1428 |
| 941 | Ga0496107_0313297 | 3300048910 | Bacteria | 1168 |
| 942 | Ga0496107_0370851 | 3300048910 | Bacteria | 1065 |
| 943 | Ga0496107_1316712 | 3300048910 | Bacteria | 516 |
| 944 | Ga0496108_0000443 | 3300048911 | Bacteria | 33208 |
| 945 | Ga0496108_1067083 | 3300048911 | Bacteria | 688 |
| 946 | Ga0496108_1279353 | 3300048911 | Bacteria | 618 |
| 947 | Ga0496109_0000778 | 3300048912 | Bacteria | 26502 |
| 948 | Ga0496109_0087437 | 3300048912 | Bacteria | 2879 |
| 949 | Ga0496109_0367538 | 3300048912 | Bacteria | 1359 |
| 950 | Ga0496110_0001837 | 3300048913 | Bacteria | 15653 |
| 951 | Ga0496110_0003743 | 3300048913 | Bacteria | 11715 |
| 952 | Ga0496110_0016232 | 3300048913 | Bacteria | 6212 |
| 953 | Ga0496110_0031404 | 3300048913 | Bacteria | 4583 |
| 954 | Ga0496110_0311758 | 3300048913 | Bacteria | 1433 |
| 955 | Ga0496110_0419582 | 3300048913 | Bacteria | 1220 |
| 956 | Ga0496110_0774598 | 3300048913 | Bacteria | 863 |
| 957 | Ga0496111_0000191 | 3300048914 | Bacteria | 28382 |
| 958 | Ga0496111_0005358 | 3300048914 | Bacteria | 8202 |
| 959 | Ga0496111_0061966 | 3300048914 | Bacteria | 2712 |
| 960 | Ga0496111_0600530 | 3300048914 | Bacteria | 806 |
| 961 | Ga0496111_0896146 | 3300048914 | Bacteria | 639 |
| 962 | Ga0496112_0007183 | 3300048915 | Bacteria | 9864 |
| 963 | Ga0496112_0264091 | 3300048915 | Bacteria | 1670 |
| 964 | Ga0496112_1292253 | 3300048915 | Bacteria | 645 |
| 965 | Ga0496112_1365161 | 3300048915 | Bacteria | 624 |
| 966 | Ga0496113_0001361 | 3300048916 | Bacteria | 13543 |
| 967 | Ga0496113_0413632 | 3300048916 | Bacteria | 1083 |
| 968 | Ga0496113_1509949 | 3300048916 | Bacteria | 518 |
| 969 | Ga0496114_0298516 | 3300048917 | Bacteria | 1422 |
| 970 | Ga0496114_0738336 | 3300048917 | Bacteria | 861 |
| 971 | Ga0496115_0056383 | 3300048918 | Bacteria | 3158 |
| 972 | Ga0496115_0149438 | 3300048918 | Bacteria | 1928 |
| 973 | Ga0496115_0194088 | 3300048918 | Bacteria | 1678 |
| 974 | Ga0496115_0303564 | 3300048918 | Bacteria | 1308 |
| 975 | Ga0496115_1322984 | 3300048918 | Bacteria | 536 |
| 976 | Ga0496116_0007551 | 3300048919 | Bacteria | 9617 |
| 977 | Ga0496116_0012406 | 3300048919 | Bacteria | 6966 |
| 978 | Ga0496116_0012853 | 3300048919 | Bacteria | 6803 |
| 979 | Ga0496116_0014267 | 3300048919 | Bacteria | 6355 |
| 980 | Ga0496116_0017257 | 3300048919 | Bacteria | 5612 |
| 981 | Ga0496116_0057218 | 3300048919 | Bacteria | 2551 |
| 982 | Ga0496116_0064776 | 3300048919 | Bacteria | 2348 |
| 983 | Ga0496117_0005823 | 3300048920 | Bacteria | 12765 |
| 984 | Ga0496117_0016085 | 3300048920 | Bacteria | 6332 |
| 985 | Ga0496118_0012842 | 3300048921 | Bacteria | 7990 |
| 986 | Ga0496118_0144058 | 3300048921 | Bacteria | 1504 |
| 987 | Ga0496119_0000469 | 3300048922 | Bacteria | 54992 |
| 988 | Ga0496119_0003362 | 3300048922 | Bacteria | 16656 |
| 989 | Ga0496119_0006713 | 3300048922 | Bacteria | 10576 |
| 990 | Ga0496119_0547553 | 3300048922 | Bacteria | 532 |
| 991 | Ga0496120_0001942 | 3300048923 | Bacteria | 22686 |
| 992 | Ga0496120_0035325 | 3300048923 | Bacteria | 2986 |
| 993 | Ga0496120_0102753 | 3300048923 | Bacteria | 1507 |
| 994 | Ga0496121_0045806 | 3300048924 | Bacteria | 3753 |
| 995 | Ga0496121_0108049 | 3300048924 | Bacteria | 2129 |
| 996 | Ga0496121_0150400 | 3300048924 | Bacteria | 1714 |
| 997 | Ga0496121_0219653 | 3300048924 | Bacteria | 1339 |
| 998 | Ga0496121_0426928 | 3300048924 | Bacteria | 861 |
| 999 | Ga0496121_0436053 | 3300048924 | Bacteria | 848 |
| 1000 | Ga0496122_0006458 | 3300048925 | Bacteria | 13447 |
| 1001 | Ga0496122_0007540 | 3300048925 | Bacteria | 12058 |
| 1002 | Ga0496122_0028610 | 3300048925 | Bacteria | 4722 |
| 1003 | Ga0496122_0031689 | 3300048925 | Bacteria | 4391 |
| 1004 | Ga0496122_0051949 | 3300048925 | Bacteria | 3108 |
| 1005 | Ga0496122_0057163 | 3300048925 | Bacteria | 2900 |
| 1006 | Ga0496122_0075908 | 3300048925 | Bacteria | 2368 |
| 1007 | Ga0496122_0083192 | 3300048925 | Bacteria | 2220 |
| 1008 | Ga0496122_0199829 | 3300048925 | Bacteria | 1170 |
| 1009 | Ga0496122_0459341 | 3300048925 | Bacteria | 629 |
| 1010 | Ga0496122_0495917 | 3300048925 | Bacteria | 594 |
| 1011 | Ga0496123_0004233 | 3300048926 | Bacteria | 15295 |
| 1012 | Ga0496123_0009386 | 3300048926 | Bacteria | 8818 |
| 1013 | Ga0496123_0010929 | 3300048926 | Bacteria | 7942 |
| 1014 | Ga0496123_0023113 | 3300048926 | Bacteria | 4768 |
| 1015 | Ga0496123_0126496 | 3300048926 | Bacteria | 1425 |
| 1016 | Ga0496124_0000697 | 3300048927 | Bacteria | 55040 |
| 1017 | Ga0496124_0001155 | 3300048927 | Bacteria | 41411 |
| 1018 | Ga0496124_0012311 | 3300048927 | Bacteria | 8450 |
| 1019 | Ga0496124_0022419 | 3300048927 | Bacteria | 5788 |
| 1020 | Ga0496124_0162139 | 3300048927 | Bacteria | 1741 |
| 1021 | Ga0496125_0001385 | 3300048928 | Bacteria | 35466 |
| 1022 | Ga0496125_0001389 | 3300048928 | Bacteria | 35441 |
| 1023 | Ga0496125_0006886 | 3300048928 | Bacteria | 12173 |
| 1024 | Ga0496125_0059770 | 3300048928 | Bacteria | 3068 |
| 1025 | Ga0496125_0253782 | 3300048928 | Bacteria | 1107 |
| 1026 | Ga0496125_0531426 | 3300048928 | Bacteria | 655 |
| 1027 | Ga0496126_0000005 | 3300048929 | Bacteria | 891906 |
| 1028 | Ga0496126_0008264 | 3300048929 | Bacteria | 11239 |
| 1029 | Ga0496126_0059816 | 3300048929 | Bacteria | 3430 |
| 1030 | Ga0496126_0125265 | 3300048929 | Bacteria | 2224 |
| 1031 | Ga0496126_0508493 | 3300048929 | Bacteria | 962 |
| 1032 | Ga0496126_0577285 | 3300048929 | Bacteria | 889 |
| 1033 | Ga0496126_1118387 | 3300048929 | Bacteria | 584 |
| 1034 | Ga0501306_000002 | 3300049127 | Bacteria | 15788 |
| 1035 | Ga0501306_000030 | 3300049127 | Bacteria | 8097 |
| 1036 | Ga0501306_000071 | 3300049127 | Bacteria | 5331 |
| 1037 | Ga0501306_000079 | 3300049127 | Bacteria | 5183 |
| 1038 | Ga0501306_000138 | 3300049127 | Bacteria | 4465 |
| 1039 | Ga0501306_000200 | 3300049127 | Bacteria | 4039 |
| 1040 | Ga0501306_003109 | 3300049127 | Bacteria | 1763 |
| 1041 | Ga0501306_003694 | 3300049127 | Bacteria | 1665 |
| 1042 | Ga0501306_003974 | 3300049127 | Bacteria | 1630 |
| 1043 | Ga0501306_004132 | 3300049127 | Bacteria | 1609 |
| 1044 | Ga0501306_005368 | 3300049127 | Bacteria | 1467 |
| 1045 | Ga0501306_006747 | 3300049127 | Bacteria | 1357 |
| 1046 | Ga0501306_021343 | 3300049127 | Bacteria | 906 |
| 1047 | Ga0501306_025599 | 3300049127 | Bacteria | 850 |
| 1048 | Ga0501306_096613 | 3300049127 | Bacteria | 524 |
| 1049 | Ga0501308_000057 | 3300049128 | Bacteria | 4639 |
| 1050 | Ga0501308_000086 | 3300049128 | Bacteria | 4141 |
| 1051 | Ga0501308_000106 | 3300049128 | Bacteria | 3961 |
| 1052 | Ga0501308_000127 | 3300049128 | Bacteria | 3778 |
| 1053 | Ga0501308_000694 | 3300049128 | Bacteria | 2340 |
| 1054 | Ga0501308_000735 | 3300049128 | Bacteria | 2305 |
| 1055 | Ga0501308_003239 | 3300049128 | Bacteria | 1495 |
| 1056 | Ga0501308_011238 | 3300049128 | Bacteria | 1006 |
| 1057 | Ga0501308_028028 | 3300049128 | Bacteria | 742 |
| 1058 | Ga0501309_000001 | 3300049129 | Bacteria | 14958 |
| 1059 | Ga0501309_000144 | 3300049129 | Bacteria | 4525 |
| 1060 | Ga0501309_000417 | 3300049129 | Bacteria | 3337 |
| 1061 | Ga0501309_001669 | 3300049129 | Bacteria | 2239 |
| 1062 | Ga0501309_003421 | 3300049129 | Bacteria | 1795 |
| 1063 | Ga0501309_004736 | 3300049129 | Bacteria | 1595 |
| 1064 | Ga0501309_020612 | 3300049129 | Bacteria | 923 |
| 1065 | Ga0501310_000312 | 3300049130 | Bacteria | 4473 |
| 1066 | Ga0501310_000940 | 3300049130 | Bacteria | 2590 |
| 1067 | Ga0501310_002051 | 3300049130 | Bacteria | 1887 |
| 1068 | Ga0501310_003009 | 3300049130 | Bacteria | 1632 |
| 1069 | Ga0501310_003439 | 3300049130 | Bacteria | 1546 |
| 1070 | Ga0501310_003997 | 3300049130 | Bacteria | 1461 |
| 1071 | Ga0501310_017305 | 3300049130 | Bacteria | 871 |
| 1072 | Ga0501310_019702 | 3300049130 | Bacteria | 832 |
| 1073 | Ga0501310_043872 | 3300049130 | Bacteria | 630 |
| 1074 | Ga0501341_00014 | 3300049131 | Bacteria | 5842 |
| 1075 | Ga0501341_00024 | 3300049131 | Bacteria | 4362 |
| 1076 | Ga0501341_00076 | 3300049131 | Bacteria | 2969 |
| 1077 | Ga0501341_00193 | 3300049131 | Bacteria | 2190 |
| 1078 | Ga0501341_00222 | 3300049131 | Bacteria | 2112 |
| 1079 | Ga0501341_01598 | 3300049131 | Bacteria | 1151 |
| 1080 | Ga0501343_000098 | 3300049132 | Bacteria | 3744 |
| 1081 | Ga0501343_000383 | 3300049132 | Bacteria | 2528 |
| 1082 | Ga0501343_000392 | 3300049132 | Bacteria | 2500 |
| 1083 | Ga0501343_000491 | 3300049132 | Bacteria | 2319 |
| 1084 | Ga0501343_000591 | 3300049132 | Bacteria | 2192 |
| 1085 | Ga0501343_000794 | 3300049132 | Bacteria | 1979 |
| 1086 | Ga0501343_001442 | 3300049132 | Bacteria | 1615 |
| 1087 | Ga0501343_001896 | 3300049132 | Bacteria | 1457 |
| 1088 | Ga0501343_002494 | 3300049132 | Bacteria | 1312 |
| 1089 | Ga0501343_004576 | 3300049132 | Bacteria | 1042 |
| 1090 | Ga0501343_008265 | 3300049132 | Bacteria | 830 |
| 1091 | Ga0501343_012006 | 3300049132 | Bacteria | 717 |
| 1092 | Ga0501344_00011 | 3300049133 | Bacteria | 4536 |
| 1093 | Ga0501344_00013 | 3300049133 | Bacteria | 4354 |
| 1094 | Ga0501344_00016 | 3300049133 | Bacteria | 4204 |
| 1095 | Ga0501344_00060 | 3300049133 | Bacteria | 3139 |
| 1096 | Ga0501344_00166 | 3300049133 | Bacteria | 2343 |
| 1097 | Ga0501344_00605 | 3300049133 | Bacteria | 1549 |
| 1098 | Ga0501344_00857 | 3300049133 | Bacteria | 1379 |
| 1099 | Ga0501344_01780 | 3300049133 | Bacteria | 1069 |
| 1100 | Ga0501345_00004 | 3300049134 | Bacteria | 5201 |
| 1101 | Ga0501345_00405 | 3300049134 | Bacteria | 1424 |
| 1102 | Ga0501345_02481 | 3300049134 | Bacteria | 763 |
| 1103 | Ga0501304_000046 | 3300049160 | Bacteria | 4246 |
| 1104 | Ga0501304_000047 | 3300049160 | Bacteria | 4168 |
| 1105 | Ga0501304_000119 | 3300049160 | Bacteria | 3077 |
| 1106 | Ga0501304_000494 | 3300049160 | Bacteria | 2070 |
| 1107 | Ga0501304_002674 | 3300049160 | Bacteria | 1256 |
| 1108 | Ga0501304_002783 | 3300049160 | Bacteria | 1240 |
| 1109 | Ga0501305_000003 | 3300049161 | Bacteria | 16860 |
| 1110 | Ga0501305_000005 | 3300049161 | Bacteria | 12832 |
| 1111 | Ga0501305_000007 | 3300049161 | Bacteria | 11997 |
| 1112 | Ga0501305_000135 | 3300049161 | Bacteria | 4788 |
| 1113 | Ga0501305_000838 | 3300049161 | Bacteria | 2741 |
| 1114 | Ga0501305_001024 | 3300049161 | Bacteria | 2597 |
| 1115 | Ga0501305_001780 | 3300049161 | Bacteria | 2195 |
| 1116 | Ga0501305_002856 | 3300049161 | Bacteria | 1906 |
| 1117 | Ga0501305_003944 | 3300049161 | Bacteria | 1714 |
| 1118 | Ga0501305_030135 | 3300049161 | Bacteria | 842 |
| 1119 | Ga0501305_033886 | 3300049161 | Bacteria | 808 |
| 1120 | Ga0501305_046588 | 3300049161 | Bacteria | 718 |
| 1121 | Ga0501305_087126 | 3300049161 | Bacteria | 567 |
| 1122 | Ga0501307_000002 | 3300049162 | Bacteria | 10580 |
| 1123 | Ga0501307_000008 | 3300049162 | Bacteria | 7231 |
| 1124 | Ga0501307_000011 | 3300049162 | Bacteria | 6472 |
| 1125 | Ga0501307_000049 | 3300049162 | Bacteria | 4646 |
| 1126 | Ga0501307_000155 | 3300049162 | Bacteria | 3645 |
| 1127 | Ga0501307_000338 | 3300049162 | Bacteria | 2981 |
| 1128 | Ga0501307_000603 | 3300049162 | Bacteria | 2572 |
| 1129 | Ga0501307_000770 | 3300049162 | Bacteria | 2406 |
| 1130 | Ga0501307_004127 | 3300049162 | Bacteria | 1466 |
| 1131 | Ga0501307_008353 | 3300049162 | Bacteria | 1161 |
| 1132 | Ga0501307_026040 | 3300049162 | Bacteria | 789 |
| 1133 | Ga0501342_00056 | 3300049163 | Bacteria | 2311 |
| 1134 | Ga0501342_00155 | 3300049163 | Bacteria | 1595 |
| 1135 | Ga0501342_00181 | 3300049163 | Bacteria | 1522 |
| 1136 | Ga0501342_03148 | 3300049163 | Bacteria | 578 |
| 1137 | Ga0495682_0075125 | 3300049460 | Bacteria | 1216 |
| 1138 | Ga0495682_0213792 | 3300049460 | Bacteria | 683 |
| 1139 | Ga0501290_005720 | 3300049513 | Bacteria | 1551 |
| 1140 | Ga0501291_048567 | 3300049514 | Bacteria | 766 |
| 1141 | Ga0501295_018328 | 3300049518 | Bacteria | 1242 |
| 1142 | Ga0501299_084095 | 3300049522 | Bacteria | 712 |
| 1143 | Ga0501300_006882 | 3300049523 | Bacteria | 1669 |
| 1144 | Ga0501311_000001 | 3300049527 | Bacteria | 13401 |
| 1145 | Ga0501311_000006 | 3300049527 | Bacteria | 9157 |
| 1146 | Ga0501311_000029 | 3300049527 | Bacteria | 5700 |
| 1147 | Ga0501311_000061 | 3300049527 | Bacteria | 4751 |
| 1148 | Ga0501311_000124 | 3300049527 | Bacteria | 3927 |
| 1149 | Ga0501311_000152 | 3300049527 | Bacteria | 3775 |
| 1150 | Ga0501311_000226 | 3300049527 | Bacteria | 3395 |
| 1151 | Ga0501311_000359 | 3300049527 | Bacteria | 3038 |
| 1152 | Ga0501311_005953 | 3300049527 | Bacteria | 1357 |
| 1153 | Ga0501311_009822 | 3300049527 | Bacteria | 1150 |
| 1154 | Ga0501311_031246 | 3300049527 | Bacteria | 772 |
| 1155 | Ga0501311_073433 | 3300049527 | Bacteria | 571 |
| 1156 | Ga0501312_000002 | 3300049528 | Bacteria | 17365 |
| 1157 | Ga0501312_000004 | 3300049528 | Bacteria | 15088 |
| 1158 | Ga0501312_000005 | 3300049528 | Bacteria | 12788 |
| 1159 | Ga0501312_000019 | 3300049528 | Bacteria | 9134 |
| 1160 | Ga0501312_000056 | 3300049528 | Bacteria | 6519 |
| 1161 | Ga0501312_000171 | 3300049528 | Bacteria | 4337 |
| 1162 | Ga0501312_000289 | 3300049528 | Bacteria | 3708 |
| 1163 | Ga0501312_000439 | 3300049528 | Bacteria | 3315 |
| 1164 | Ga0501312_000739 | 3300049528 | Bacteria | 2829 |
| 1165 | Ga0501312_001758 | 3300049528 | Bacteria | 2212 |
| 1166 | Ga0501312_009171 | 3300049528 | Bacteria | 1299 |
| 1167 | Ga0501312_009722 | 3300049528 | Bacteria | 1273 |
| 1168 | Ga0501312_033896 | 3300049528 | Bacteria | 812 |
| 1169 | Ga0501312_047192 | 3300049528 | Bacteria | 718 |
| 1170 | Ga0501312_085805 | 3300049528 | Bacteria | 575 |
| 1171 | Ga0501312_120533 | 3300049528 | Bacteria | 507 |
| 1172 | Ga0501313_000001 | 3300049529 | Bacteria | 19566 |
| 1173 | Ga0501313_000003 | 3300049529 | Bacteria | 10446 |
| 1174 | Ga0501313_000034 | 3300049529 | Bacteria | 6338 |
| 1175 | Ga0501313_000081 | 3300049529 | Bacteria | 4439 |
| 1176 | Ga0501313_000101 | 3300049529 | Bacteria | 4186 |
| 1177 | Ga0501313_000156 | 3300049529 | Bacteria | 3685 |
| 1178 | Ga0501313_000177 | 3300049529 | Bacteria | 3577 |
| 1179 | Ga0501313_000360 | 3300049529 | Bacteria | 2976 |
| 1180 | Ga0501313_000781 | 3300049529 | Bacteria | 2416 |
| 1181 | Ga0501313_002469 | 3300049529 | Bacteria | 1755 |
| 1182 | Ga0501313_009688 | 3300049529 | Bacteria | 1088 |
| 1183 | Ga0501313_066252 | 3300049529 | Bacteria | 518 |
| 1184 | Ga0501314_000067 | 3300049530 | Bacteria | 4577 |
| 1185 | Ga0501314_000087 | 3300049530 | Bacteria | 4125 |
| 1186 | Ga0501314_000447 | 3300049530 | Bacteria | 2571 |
| 1187 | Ga0501314_000773 | 3300049530 | Bacteria | 2110 |
| 1188 | Ga0501314_000973 | 3300049530 | Bacteria | 1944 |
| 1189 | Ga0501314_002612 | 3300049530 | Bacteria | 1405 |
| 1190 | Ga0501314_002668 | 3300049530 | Bacteria | 1394 |
| 1191 | Ga0501314_011785 | 3300049530 | Bacteria | 831 |
| 1192 | Ga0501314_025086 | 3300049530 | Bacteria | 639 |
| 1193 | Ga0501315_000001 | 3300049531 | Bacteria | 13474 |
| 1194 | Ga0501315_000002 | 3300049531 | Bacteria | 12594 |
| 1195 | Ga0501315_000006 | 3300049531 | Bacteria | 10500 |
| 1196 | Ga0501315_000069 | 3300049531 | Bacteria | 4729 |
| 1197 | Ga0501315_000072 | 3300049531 | Bacteria | 4669 |
| 1198 | Ga0501315_000123 | 3300049531 | Bacteria | 4189 |
| 1199 | Ga0501315_004000 | 3300049531 | Bacteria | 1513 |
| 1200 | Ga0501315_004080 | 3300049531 | Bacteria | 1505 |
| 1201 | Ga0501315_006378 | 3300049531 | Bacteria | 1310 |
| 1202 | Ga0501315_009053 | 3300049531 | Bacteria | 1170 |
| 1203 | Ga0501315_009362 | 3300049531 | Bacteria | 1157 |
| 1204 | Ga0501315_013906 | 3300049531 | Bacteria | 1014 |
| 1205 | Ga0501315_019745 | 3300049531 | Bacteria | 899 |
| 1206 | Ga0501315_022770 | 3300049531 | Bacteria | 856 |
| 1207 | Ga0501315_034859 | 3300049531 | Bacteria | 740 |
| 1208 | Ga0501316_000001 | 3300049532 | Bacteria | 15173 |
| 1209 | Ga0501316_000045 | 3300049532 | Bacteria | 5250 |
| 1210 | Ga0501316_000072 | 3300049532 | Bacteria | 4671 |
| 1211 | Ga0501316_000081 | 3300049532 | Bacteria | 4529 |
| 1212 | Ga0501316_000137 | 3300049532 | Bacteria | 3921 |
| 1213 | Ga0501316_000268 | 3300049532 | Bacteria | 3268 |
| 1214 | Ga0501316_002234 | 3300049532 | Bacteria | 1771 |
| 1215 | Ga0501316_002272 | 3300049532 | Bacteria | 1762 |
| 1216 | Ga0501316_003240 | 3300049532 | Bacteria | 1568 |
| 1217 | Ga0501316_004064 | 3300049532 | Bacteria | 1452 |
| 1218 | Ga0501316_005266 | 3300049532 | Bacteria | 1335 |
| 1219 | Ga0501316_008561 | 3300049532 | Bacteria | 1132 |
| 1220 | Ga0501316_023237 | 3300049532 | Bacteria | 795 |
| 1221 | Ga0501316_026938 | 3300049532 | Bacteria | 754 |
| 1222 | Ga0501316_032052 | 3300049532 | Bacteria | 707 |
| 1223 | Ga0501316_037393 | 3300049532 | Bacteria | 668 |
| 1224 | Ga0501317_000001 | 3300049533 | Bacteria | 21405 |
| 1225 | Ga0501317_000003 | 3300049533 | Bacteria | 13878 |
| 1226 | Ga0501317_000202 | 3300049533 | Bacteria | 3611 |
| 1227 | Ga0501317_000414 | 3300049533 | Bacteria | 2936 |
| 1228 | Ga0501317_000954 | 3300049533 | Bacteria | 2319 |
| 1229 | Ga0501317_001025 | 3300049533 | Bacteria | 2270 |
| 1230 | Ga0501317_002411 | 3300049533 | Bacteria | 1763 |
| 1231 | Ga0501317_003838 | 3300049533 | Bacteria | 1527 |
| 1232 | Ga0501317_005267 | 3300049533 | Bacteria | 1378 |
| 1233 | Ga0501317_007181 | 3300049533 | Bacteria | 1249 |
| 1234 | Ga0501317_026345 | 3300049533 | Bacteria | 820 |
| 1235 | Ga0501317_030482 | 3300049533 | Bacteria | 780 |
| 1236 | Ga0501317_031804 | 3300049533 | Bacteria | 769 |
| 1237 | Ga0501317_043089 | 3300049533 | Bacteria | 696 |
| 1238 | Ga0501318_000003 | 3300049534 | Bacteria | 10033 |
| 1239 | Ga0501318_000052 | 3300049534 | Bacteria | 4702 |
| 1240 | Ga0501318_000116 | 3300049534 | Bacteria | 3718 |
| 1241 | Ga0501318_000386 | 3300049534 | Bacteria | 2719 |
| 1242 | Ga0501318_002401 | 3300049534 | Bacteria | 1616 |
| 1243 | Ga0501318_002638 | 3300049534 | Bacteria | 1576 |
| 1244 | Ga0501318_003615 | 3300049534 | Bacteria | 1430 |
| 1245 | Ga0501318_005761 | 3300049534 | Bacteria | 1242 |
| 1246 | Ga0501318_009165 | 3300049534 | Bacteria | 1074 |
| 1247 | Ga0501318_011919 | 3300049534 | Bacteria | 989 |
| 1248 | Ga0501318_020816 | 3300049534 | Bacteria | 829 |
| 1249 | Ga0501318_081964 | 3300049534 | Bacteria | 524 |
| 1250 | Ga0501319_000003 | 3300049535 | Bacteria | 10442 |
| 1251 | Ga0501319_000033 | 3300049535 | Bacteria | 4602 |
| 1252 | Ga0501319_000047 | 3300049535 | Bacteria | 3949 |
| 1253 | Ga0501319_000098 | 3300049535 | Bacteria | 3052 |
| 1254 | Ga0501319_000238 | 3300049535 | Bacteria | 2328 |
| 1255 | Ga0501319_000326 | 3300049535 | Bacteria | 2128 |
| 1256 | Ga0501319_000845 | 3300049535 | Bacteria | 1612 |
| 1257 | Ga0501319_002515 | 3300049535 | Bacteria | 1167 |
| 1258 | Ga0501319_003450 | 3300049535 | Bacteria | 1057 |
| 1259 | Ga0501320_000001 | 3300049536 | Bacteria | 15372 |
| 1260 | Ga0501320_000002 | 3300049536 | Bacteria | 13169 |
| 1261 | Ga0501320_000012 | 3300049536 | Bacteria | 8841 |
| 1262 | Ga0501320_000063 | 3300049536 | Bacteria | 4821 |
| 1263 | Ga0501320_000070 | 3300049536 | Bacteria | 4546 |
| 1264 | Ga0501320_000071 | 3300049536 | Bacteria | 4538 |
| 1265 | Ga0501320_000079 | 3300049536 | Bacteria | 4310 |
| 1266 | Ga0501320_000092 | 3300049536 | Bacteria | 3944 |
| 1267 | Ga0501320_001821 | 3300049536 | Bacteria | 1622 |
| 1268 | Ga0501320_005312 | 3300049536 | Bacteria | 1169 |
| 1269 | Ga0501320_025684 | 3300049536 | Bacteria | 707 |
| 1270 | Ga0501321_000002 | 3300049537 | Bacteria | 13305 |
| 1271 | Ga0501321_000023 | 3300049537 | Bacteria | 8227 |
| 1272 | Ga0501321_000066 | 3300049537 | Bacteria | 4711 |
| 1273 | Ga0501321_000083 | 3300049537 | Bacteria | 4326 |
| 1274 | Ga0501321_000088 | 3300049537 | Bacteria | 4285 |
| 1275 | Ga0501321_000089 | 3300049537 | Bacteria | 4280 |
| 1276 | Ga0501321_000092 | 3300049537 | Bacteria | 4252 |
| 1277 | Ga0501321_000225 | 3300049537 | Bacteria | 3248 |
| 1278 | Ga0501321_002044 | 3300049537 | Bacteria | 1699 |
| 1279 | Ga0501321_004287 | 3300049537 | Bacteria | 1357 |
| 1280 | Ga0501321_009246 | 3300049537 | Bacteria | 1060 |
| 1281 | Ga0501321_018443 | 3300049537 | Bacteria | 847 |
| 1282 | Ga0501321_025183 | 3300049537 | Bacteria | 766 |
| 1283 | Ga0501321_069210 | 3300049537 | Bacteria | 546 |
| 1284 | Ga0501321_085769 | 3300049537 | Bacteria | 508 |
| 1285 | Ga0501322_000007 | 3300049538 | Bacteria | 8971 |
| 1286 | Ga0501322_000024 | 3300049538 | Bacteria | 7026 |
| 1287 | Ga0501322_000043 | 3300049538 | Bacteria | 4891 |
| 1288 | Ga0501322_000335 | 3300049538 | Bacteria | 2117 |
| 1289 | Ga0501322_000404 | 3300049538 | Bacteria | 1996 |
| 1290 | Ga0501322_003380 | 3300049538 | Bacteria | 1033 |
| 1291 | Ga0501322_006340 | 3300049538 | Bacteria | 840 |
| 1292 | Ga0501322_007924 | 3300049538 | Bacteria | 781 |
| 1293 | Ga0501323_000005 | 3300049539 | Bacteria | 11153 |
| 1294 | Ga0501323_000091 | 3300049539 | Bacteria | 4739 |
| 1295 | Ga0501323_000116 | 3300049539 | Bacteria | 4416 |
| 1296 | Ga0501323_000294 | 3300049539 | Bacteria | 3460 |
| 1297 | Ga0501323_000308 | 3300049539 | Bacteria | 3416 |
| 1298 | Ga0501323_000825 | 3300049539 | Bacteria | 2495 |
| 1299 | Ga0501323_002710 | 3300049539 | Bacteria | 1745 |
| 1300 | Ga0501323_004989 | 3300049539 | Bacteria | 1432 |
| 1301 | Ga0501323_023914 | 3300049539 | Bacteria | 823 |
| 1302 | Ga0501323_026259 | 3300049539 | Bacteria | 797 |
| 1303 | Ga0501323_033552 | 3300049539 | Bacteria | 730 |
| 1304 | Ga0501323_059398 | 3300049539 | Bacteria | 594 |
| 1305 | Ga0501324_000001 | 3300049540 | Bacteria | 20831 |
| 1306 | Ga0501324_000003 | 3300049540 | Bacteria | 13684 |
| 1307 | Ga0501324_000076 | 3300049540 | Bacteria | 3543 |
| 1308 | Ga0501324_000141 | 3300049540 | Bacteria | 3051 |
| 1309 | Ga0501324_000153 | 3300049540 | Bacteria | 3001 |
| 1310 | Ga0501324_000373 | 3300049540 | Bacteria | 2352 |
| 1311 | Ga0501324_000408 | 3300049540 | Bacteria | 2275 |
| 1312 | Ga0501324_002064 | 3300049540 | Bacteria | 1419 |
| 1313 | Ga0501324_002534 | 3300049540 | Bacteria | 1330 |
| 1314 | Ga0501324_003211 | 3300049540 | Bacteria | 1241 |
| 1315 | Ga0501324_011962 | 3300049540 | Bacteria | 808 |
| 1316 | Ga0501324_016729 | 3300049540 | Bacteria | 721 |
| 1317 | Ga0501324_025677 | 3300049540 | Bacteria | 622 |
| 1318 | Ga0501325_000006 | 3300049541 | Bacteria | 7014 |
| 1319 | Ga0501325_010003 | 3300049541 | Bacteria | 852 |
| 1320 | Ga0501325_047372 | 3300049541 | Bacteria | 539 |
| 1321 | Ga0501326_00006 | 3300049542 | Bacteria | 8815 |
| 1322 | Ga0501326_00033 | 3300049542 | Bacteria | 4407 |
| 1323 | Ga0501326_00045 | 3300049542 | Bacteria | 3869 |
| 1324 | Ga0501326_00113 | 3300049542 | Bacteria | 2596 |
| 1325 | Ga0501326_00177 | 3300049542 | Bacteria | 2247 |
| 1326 | Ga0501326_00291 | 3300049542 | Bacteria | 1884 |
| 1327 | Ga0501326_03359 | 3300049542 | Bacteria | 818 |
| 1328 | Ga0501327_00035 | 3300049543 | Bacteria | 4032 |
| 1329 | Ga0501327_00036 | 3300049543 | Bacteria | 4030 |
| 1330 | Ga0501327_00038 | 3300049543 | Bacteria | 4022 |
| 1331 | Ga0501327_00062 | 3300049543 | Bacteria | 3238 |
| 1332 | Ga0501327_00389 | 3300049543 | Bacteria | 1710 |
| 1333 | Ga0501327_03039 | 3300049543 | Bacteria | 904 |
| 1334 | Ga0501327_05531 | 3300049543 | Bacteria | 748 |
| 1335 | Ga0501327_07490 | 3300049543 | Bacteria | 681 |
| 1336 | Ga0501328_00011 | 3300049544 | Bacteria | 4464 |
| 1337 | Ga0501328_00014 | 3300049544 | Bacteria | 4034 |
| 1338 | Ga0501328_00064 | 3300049544 | Bacteria | 2493 |
| 1339 | Ga0501328_00078 | 3300049544 | Bacteria | 2316 |
| 1340 | Ga0501328_00270 | 3300049544 | Bacteria | 1610 |
| 1341 | Ga0501328_00524 | 3300049544 | Bacteria | 1315 |
| 1342 | Ga0501328_00940 | 3300049544 | Bacteria | 1085 |
| 1343 | Ga0501328_05377 | 3300049544 | Bacteria | 643 |
| 1344 | Ga0501329_00109 | 3300049545 | Bacteria | 2070 |
| 1345 | Ga0501329_00157 | 3300049545 | Bacteria | 1886 |
| 1346 | Ga0501329_00619 | 3300049545 | Bacteria | 1325 |
| 1347 | Ga0501329_00684 | 3300049545 | Bacteria | 1287 |
| 1348 | Ga0501329_03934 | 3300049545 | Bacteria | 775 |
| 1349 | Ga0501330_000009 | 3300049546 | Bacteria | 5707 |
| 1350 | Ga0501330_000038 | 3300049546 | Bacteria | 3323 |
| 1351 | Ga0501330_000049 | 3300049546 | Bacteria | 3151 |
| 1352 | Ga0501330_000139 | 3300049546 | Bacteria | 2405 |
| 1353 | Ga0501330_000148 | 3300049546 | Bacteria | 2358 |
| 1354 | Ga0501330_000288 | 3300049546 | Bacteria | 1963 |
| 1355 | Ga0501330_000341 | 3300049546 | Bacteria | 1877 |
| 1356 | Ga0501330_004276 | 3300049546 | Bacteria | 879 |
| 1357 | Ga0501330_010335 | 3300049546 | Bacteria | 661 |
| 1358 | Ga0501331_00009 | 3300049547 | Bacteria | 7351 |
| 1359 | Ga0501331_00023 | 3300049547 | Bacteria | 4468 |
| 1360 | Ga0501331_00073 | 3300049547 | Bacteria | 2981 |
| 1361 | Ga0501331_00179 | 3300049547 | Bacteria | 2269 |
| 1362 | Ga0501331_04401 | 3300049547 | Bacteria | 784 |
| 1363 | Ga0501331_04852 | 3300049547 | Bacteria | 758 |
| 1364 | Ga0501331_07867 | 3300049547 | Bacteria | 639 |
| 1365 | Ga0501332_00052 | 3300049548 | Bacteria | 3335 |
| 1366 | Ga0501332_00070 | 3300049548 | Bacteria | 3010 |
| 1367 | Ga0501332_00114 | 3300049548 | Bacteria | 2627 |
| 1368 | Ga0501332_00147 | 3300049548 | Bacteria | 2461 |
| 1369 | Ga0501332_00490 | 3300049548 | Bacteria | 1741 |
| 1370 | Ga0501332_00546 | 3300049548 | Bacteria | 1688 |
| 1371 | Ga0501332_00671 | 3300049548 | Bacteria | 1589 |
| 1372 | Ga0501332_01061 | 3300049548 | Bacteria | 1372 |
| 1373 | Ga0501332_07606 | 3300049548 | Bacteria | 693 |
| 1374 | Ga0501332_12791 | 3300049548 | Bacteria | 579 |
| 1375 | Ga0501333_000018 | 3300049549 | Bacteria | 4669 |
| 1376 | Ga0501333_000173 | 3300049549 | Bacteria | 2529 |
| 1377 | Ga0501333_001147 | 3300049549 | Bacteria | 1385 |
| 1378 | Ga0501333_001361 | 3300049549 | Bacteria | 1311 |
| 1379 | Ga0501333_001637 | 3300049549 | Bacteria | 1237 |
| 1380 | Ga0501333_006626 | 3300049549 | Bacteria | 774 |
| 1381 | Ga0501333_018569 | 3300049549 | Bacteria | 544 |
| 1382 | Ga0501334_00014 | 3300049550 | Bacteria | 5746 |
| 1383 | Ga0501334_00103 | 3300049550 | Bacteria | 2834 |
| 1384 | Ga0501334_00634 | 3300049550 | Bacteria | 1695 |
| 1385 | Ga0501334_00670 | 3300049550 | Bacteria | 1657 |
| 1386 | Ga0501334_00728 | 3300049550 | Bacteria | 1623 |
| 1387 | Ga0501334_05436 | 3300049550 | Bacteria | 841 |
| 1388 | Ga0501334_06574 | 3300049550 | Bacteria | 787 |
| 1389 | Ga0501335_000067 | 3300049551 | Bacteria | 4406 |
| 1390 | Ga0501335_000116 | 3300049551 | Bacteria | 3814 |
| 1391 | Ga0501335_000229 | 3300049551 | Bacteria | 3163 |
| 1392 | Ga0501335_000692 | 3300049551 | Bacteria | 2301 |
| 1393 | Ga0501335_001159 | 3300049551 | Bacteria | 1968 |
| 1394 | Ga0501335_001571 | 3300049551 | Bacteria | 1766 |
| 1395 | Ga0501335_002088 | 3300049551 | Bacteria | 1596 |
| 1396 | Ga0501335_003479 | 3300049551 | Bacteria | 1336 |
| 1397 | Ga0501335_003699 | 3300049551 | Bacteria | 1308 |
| 1398 | Ga0501335_019322 | 3300049551 | Bacteria | 718 |
| 1399 | Ga0501335_037724 | 3300049551 | Bacteria | 563 |
| 1400 | Ga0501335_037801 | 3300049551 | Bacteria | 562 |
| 1401 | Ga0501336_000153 | 3300049552 | Bacteria | 2818 |
| 1402 | Ga0501336_000332 | 3300049552 | Bacteria | 2220 |
| 1403 | Ga0501336_000441 | 3300049552 | Bacteria | 2054 |
| 1404 | Ga0501336_000875 | 3300049552 | Bacteria | 1664 |
| 1405 | Ga0501336_008578 | 3300049552 | Bacteria | 793 |
| 1406 | Ga0501336_015660 | 3300049552 | Bacteria | 652 |
| 1407 | Ga0501336_024727 | 3300049552 | Bacteria | 564 |
| 1408 | Ga0501337_000050 | 3300049553 | Bacteria | 4082 |
| 1409 | Ga0501337_000067 | 3300049553 | Bacteria | 3692 |
| 1410 | Ga0501337_000117 | 3300049553 | Bacteria | 3085 |
| 1411 | Ga0501337_000129 | 3300049553 | Bacteria | 2985 |
| 1412 | Ga0501337_000210 | 3300049553 | Bacteria | 2561 |
| 1413 | Ga0501337_000366 | 3300049553 | Bacteria | 2148 |
| 1414 | Ga0501337_000430 | 3300049553 | Bacteria | 2043 |
| 1415 | Ga0501337_000441 | 3300049553 | Bacteria | 2028 |
| 1416 | Ga0501337_001638 | 3300049553 | Bacteria | 1298 |
| 1417 | Ga0501337_002599 | 3300049553 | Bacteria | 1114 |
| 1418 | Ga0501337_003887 | 3300049553 | Bacteria | 963 |
| 1419 | Ga0501338_00021 | 3300049554 | Bacteria | 4344 |
| 1420 | Ga0501338_00230 | 3300049554 | Bacteria | 2293 |
| 1421 | Ga0501338_00355 | 3300049554 | Bacteria | 1984 |
| 1422 | Ga0501338_00393 | 3300049554 | Bacteria | 1919 |
| 1423 | Ga0501338_00890 | 3300049554 | Bacteria | 1489 |
| 1424 | Ga0501338_01217 | 3300049554 | Bacteria | 1343 |
| 1425 | Ga0501338_01946 | 3300049554 | Bacteria | 1149 |
| 1426 | Ga0501338_10168 | 3300049554 | Bacteria | 632 |
| 1427 | Ga0501339_00012 | 3300049555 | Bacteria | 2260 |
| 1428 | Ga0501339_00086 | 3300049555 | Bacteria | 1322 |
| 1429 | Ga0501339_00171 | 3300049555 | Bacteria | 1117 |
| 1430 | Ga0501340_000004 | 3300049556 | Bacteria | 7126 |
| 1431 | Ga0501340_000016 | 3300049556 | Bacteria | 4372 |
| 1432 | Ga0501340_000079 | 3300049556 | Bacteria | 2964 |
| 1433 | Ga0501340_001704 | 3300049556 | Bacteria | 1216 |
| 1434 | Ga0501036_1689582 | 3300049572 | Bacteria | 510 |
| 1435 | Ga0501040_0507174 | 3300049576 | Bacteria | 870 |
| 1436 | Ga0501041_0249557 | 3300049577 | Bacteria | 1116 |
| 1437 | Ga0501041_0883091 | 3300049577 | Bacteria | 574 |
| 1438 | Ga0501069_0210701 | 3300049585 | Bacteria | 1128 |
| 1439 | Ga0501070_0119413 | 3300049586 | Bacteria | 2179 |
| 1440 | Ga0501071_0290387 | 3300049587 | Bacteria | 1238 |
| 1441 | Ga0501074_0192033 | 3300049590 | Bacteria | 1456 |
| 1442 | Ga0501202_022556 | 3300049652 | Bacteria | 1265 |
| 1443 | Ga0501216_070041 | 3300049660 | Bacteria | 723 |
| 1444 | Ga0501217_012050 | 3300049661 | Bacteria | 1920 |
| 1445 | Ga0501217_015074 | 3300049661 | Bacteria | 1755 |
| 1446 | Ga0501217_287719 | 3300049661 | Bacteria | 539 |
| 1447 | Ga0501217_343473 | 3300049661 | Bacteria | 501 |
| 1448 | Ga0501224_053640 | 3300049664 | Bacteria | 621 |
| 1449 | Ga0501227_012962 | 3300049665 | Bacteria | 1831 |
| 1450 | Ga0501228_002303 | 3300049666 | Bacteria | 1485 |
| 1451 | Ga0501230_097915 | 3300049667 | Bacteria | 630 |
| 1452 | Ga0501233_007708 | 3300049668 | Bacteria | 2056 |
| 1453 | Ga0501233_145156 | 3300049668 | Bacteria | 658 |
| 1454 | Ga0501243_022949 | 3300049675 | Bacteria | 1036 |
| 1455 | Ga0501252_020433 | 3300049682 | Bacteria | 861 |
| 1456 | Ga0501252_081246 | 3300049682 | Bacteria | 537 |
| 1457 | Ga0501260_023599 | 3300049689 | Bacteria | 678 |
| 1458 | Ga0501221_089407 | 3300049704 | Bacteria | 751 |
| 1459 | Ga0501225_0027148 | 3300049705 | Bacteria | 1575 |
| 1460 | Ga0501234_002810 | 3300049707 | Bacteria | 2739 |
| 1461 | Ga0501234_106616 | 3300049707 | Bacteria | 513 |
| 1462 | Ga0501080_0504979 | 3300049742 | Bacteria | 1080 |
| 1463 | Ga0501083_0323354 | 3300049744 | Bacteria | 1003 |
| 1464 | Ga0501083_0827020 | 3300049744 | Bacteria | 603 |
| 1465 | Ga0501232_007698 | 3300049757 | Bacteria | 1142 |
| 1466 | Ga0501265_069563 | 3300049762 | Bacteria | 592 |
| 1467 | Ga0501266_006221 | 3300049763 | Bacteria | 1486 |
| 1468 | Ga0501270_012080 | 3300049767 | Bacteria | 1171 |
| 1469 | Ga0501271_044575 | 3300049768 | Bacteria | 587 |
| 1470 | Ga0501283_084321 | 3300049779 | Bacteria | 602 |
| 1471 | Ga0501212_018124 | 3300049851 | Bacteria | 1070 |
| 1472 | nmdc:mga00v17_210410_c1 | 3300050491 | Bacteria | 1258 |
| 1473 | nmdc:mga05p37_2088575_c1 | 3300050507 | Bacteria | 531 |
| 1474 | nmdc:mga09592_810971_c1 | 3300050508 | Bacteria | 791 |
| 1475 | Ga0495601_0280867 | 3300053077 | Bacteria | 1085 |
| 1476 | Ga0495612_0116498 | 3300053078 | Bacteria | 1147 |
| 1477 | Ga0495619_0209672 | 3300053085 | Bacteria | 1349 |
| 1478 | Ga0500559_0070899 | 3300053136 | Bacteria | 1569 |
| 1479 | Ga0501084_0281749 | 3300054114 | Bacteria | 1404 |
| 1480 | Ga0587084_000095 | 3300059477 | Bacteria | 4738 |
| 1481 | Ga0587084_012948 | 3300059477 | Bacteria | 1139 |
| 1482 | Ga0587084_045642 | 3300059477 | Bacteria | 759 |
| 1483 | Ga0587066_094474 | 3300059490 | Bacteria | 669 |
| 1484 | Ga0587070_000002 | 3300059491 | Bacteria | 12188 |
| 1485 | Ga0587077_068645 | 3300059493 | Bacteria | 787 |
| 1486 | Ga0587080_000328 | 3300059503 | Bacteria | 3733 |
| 1487 | Ga0587080_008939 | 3300059503 | Bacteria | 1446 |
| 1488 | Ga0587082_000432 | 3300059504 | Bacteria | 3459 |
| 1489 | Ga0587082_099346 | 3300059504 | Bacteria | 632 |
| 1490 | Ga0587083_0000091 | 3300059505 | Bacteria | 5311 |
| 1491 | Ga0587083_0000526 | 3300059505 | Bacteria | 3491 |
| 1492 | Ga0587083_0000533 | 3300059505 | Bacteria | 3476 |
| 1493 | Ga0587088_067862 | 3300059508 | Bacteria | 737 |
| 1494 | Ga0587098_007400 | 3300059604 | Bacteria | 1142 |
| 1495 | Ga0587098_031131 | 3300059604 | Bacteria | 735 |
| 1496 | Ga0587098_095429 | 3300059604 | Bacteria | 512 |
| 1497 | Ga0587106_013355 | 3300059605 | Bacteria | 1115 |
| 1498 | Ga0587106_016970 | 3300059605 | Bacteria | 1036 |
| 1499 | Ga0587106_055808 | 3300059605 | Bacteria | 713 |
| 1500 | Ga0587099_017892 | 3300059622 | Bacteria | 778 |
| 1501 | Ga0587117_112854 | 3300059627 | Bacteria | 530 |
| 1502 | Ga0587067_000283 | 3300059640 | Bacteria | 4105 |
| 1503 | Ga0587067_001715 | 3300059640 | Bacteria | 2449 |
| 1504 | Ga0587067_002029 | 3300059640 | Bacteria | 2324 |
| 1505 | Ga0587067_003704 | 3300059640 | Bacteria | 1931 |
| 1506 | Ga0587067_004378 | 3300059640 | Bacteria | 1837 |
| 1507 | Ga0587067_011104 | 3300059640 | Bacteria | 1381 |
| 1508 | Ga0587067_039947 | 3300059640 | Bacteria | 907 |
| 1509 | Ga0587067_060736 | 3300059640 | Bacteria | 791 |
| 1510 | Ga0587068_000132 | 3300059641 | Bacteria | 5110 |
| 1511 | Ga0587068_106966 | 3300059641 | Bacteria | 593 |
| 1512 | Ga0587068_126383 | 3300059641 | Bacteria | 559 |
| 1513 | Ga0587072_000119 | 3300059643 | Bacteria | 6451 |
| 1514 | Ga0587072_003946 | 3300059643 | Bacteria | 2120 |
| 1515 | Ga0587072_009490 | 3300059643 | Bacteria | 1556 |
| 1516 | Ga0587072_042549 | 3300059643 | Bacteria | 887 |
| 1517 | Ga0587072_055571 | 3300059643 | Bacteria | 804 |
| 1518 | Ga0587072_061289 | 3300059643 | Bacteria | 775 |
| 1519 | Ga0587072_075731 | 3300059643 | Bacteria | 718 |
| 1520 | Ga0587072_116821 | 3300059643 | Bacteria | 614 |
| 1521 | Ga0587072_141659 | 3300059643 | Bacteria | 574 |
| 1522 | Ga0587075_046622 | 3300059644 | Bacteria | 744 |
| 1523 | Ga0587075_079649 | 3300059644 | Bacteria | 623 |
| 1524 | Ga0587076_000045 | 3300059645 | Bacteria | 6063 |
| 1525 | Ga0587076_008511 | 3300059645 | Bacteria | 1434 |
| 1526 | Ga0587076_010133 | 3300059645 | Bacteria | 1354 |
| 1527 | Ga0587076_076164 | 3300059645 | Bacteria | 707 |
| 1528 | Ga0587076_110746 | 3300059645 | Bacteria | 625 |
| 1529 | Ga0587079_000002 | 3300059647 | Bacteria | 12575 |
| 1530 | Ga0587079_008968 | 3300059647 | Bacteria | 1544 |
| 1531 | Ga0587079_011374 | 3300059647 | Bacteria | 1432 |
| 1532 | Ga0587079_042551 | 3300059647 | Bacteria | 923 |
| 1533 | Ga0587114_044794 | 3300059655 | Bacteria | 729 |
| 1534 | Ga0587060_000803 | 3300060243 | Bacteria | 1889 |
| 1535 | Ga0587060_001840 | 3300060243 | Bacteria | 1431 |
| 1536 | Ga0587111_0257428 | 3300060346 | Bacteria | 519 |
| 1537 | Ga0501082_1104744 | 3300060353 | Bacteria | 693 |
| 1538 | 2511180936 | 2510917027 | Bacteria | 5287437 |
| 1539 | 2511698003 | 2511231119 | Bacteria | 4019861 |
| 1540 | 2512736526 | 2512564039 | Bacteria | 8739048 |
| 1541 | 2524190000 | 2524023129 | Bacteria | 6762600 |
| 1542 | 2545559758 | 2545555800 | Bacteria | 4222588 |
| 1543 | 2550903220 | 2548877040 | Bacteria | 7507281 |
| 1544 | 2555470884 | 2554235283 | Bacteria | 3683090 |
| 1545 | 2556065794 | 2554235469 | Bacteria | 3590176 |
| 1546 | 2563930192 | 2563366752 | Bacteria | 4961801 |
| 1547 | 2571530807 | 2571042143 | Bacteria | 6986194 |
| 1548 | 2573041366 | 2571042588 | Bacteria | 5045676 |
| 1549 | 2578338884 | 2576861424 | Bacteria | 5270569 |
| 1550 | 2578930715 | 2576861599 | Bacteria | 4217202 |
| 1551 | 2580930507 | 2579778775 | Bacteria | 5360914 |
| 1552 | 2587744072 | 2585428059 | Bacteria | 8696589 |
| 1553 | 2595092271 | 2593339131 | Bacteria | 5116855 |
| 1554 | 2595320872 | 2593339198 | Bacteria | 7267884 |
| 1555 | 2601641757 | 2600255286 | Bacteria | 5390125 |
| 1556 | 2621273296 | 2619619294 | Bacteria | 5575484 |
| 1557 | 2631982461 | 2630968484 | Bacteria | 3876276 |
| 1558 | 2643738842 | 2643221543 | Bacteria | 6628015 |
| 1559 | 2644424492 | 2643221676 | Bacteria | 8119172 |
| 1560 | 2644705730 | 2643221729 | Bacteria | 6621700 |
| 1561 | 2644713251 | 2643221730 | Bacteria | 6523787 |
| 1562 | 2644721340 | 2643221731 | Bacteria | 5623886 |
| 1563 | 2644723325 | 2643221732 | Bacteria | 5756404 |
| 1564 | 2644741862 | 2643221735 | Bacteria | 3676263 |
| 1565 | 2651530326 | 2648501850 | Bacteria | 3975476 |
| 1566 | 2672333589 | 2671180330 | Bacteria | 5521719 |
| 1567 | 2673821722 | 2671180694 | Bacteria | 7506943 |
| 1568 | 2674421119 | 2671180844 | Bacteria | 4164150 |
| 1569 | 2685148207 | 2684622632 | Bacteria | 5380049 |
| 1570 | 2686995326 | 2684623153 | Bacteria | 3878815 |
| 1571 | 2687496575 | 2687453109 | Bacteria | 3860091 |
| 1572 | 2695629923 | 2695420354 | Bacteria | 3922431 |
| 1573 | 2698319633 | 2695420987 | Bacteria | 6152737 |
| 1574 | 2705992008 | 2703719227 | Bacteria | 5631989 |
| 1575 | 2712198868 | 2711768088 | Bacteria | 3195027 |
| 1576 | 2717918178 | 2716884898 | Bacteria | 3928789 |
| 1577 | 2721503436 | 2718218445 | Bacteria | 5113413 |
| 1578 | 2723606194 | 2721755693 | Bacteria | 6126117 |
| 1579 | 2728529894 | 2728368933 | Bacteria | 7044283 |
| 1580 | 2730136817 | 2728369359 | Bacteria | 5621728 |
| 1581 | 2738817103 | 2738541295 | Bacteria | 5730091 |
| 1582 | 2739160165 | 2738541358 | Bacteria | 5932299 |
| 1583 | 2739212639 | 2738543006 | Bacteria | 5904091 |
| 1584 | 2739234635 | 2738543010 | Bacteria | 5583595 |
| 1585 | 2739271692 | 2738543017 | Bacteria | 4271950 |
| 1586 | 2753813080 | 2751185905 | Bacteria | 6142767 |
| 1587 | 2757568906 | 2757320391 | Bacteria | 4746095 |
| 1588 | 2777764209 | 2775507177 | Bacteria | 4384303 |
| 1589 | 2777837284 | 2775507192 | Bacteria | 4622234 |
| 1590 | 2793182071 | 2791355222 | Bacteria | 5898266 |
| 1591 | 2802440724 | 2802428803 | Bacteria | 5806948 |
| 1592 | 2809057184 | 2808606399 | Bacteria | 4021018 |
| 1593 | 2812314465 | 2811994870 | Bacteria | 3776934 |
| 1594 | 2816866378 | 2816332186 | Bacteria | 5331395 |
| 1595 | 2817478191 | 2816332295 | Bacteria | 4352468 |
| 1596 | 2819571031 | 2818991441 | Bacteria | 5062707 |
| 1597 | 2819585037 | 2818991443 | Bacteria | 6598732 |
| 1598 | 2819676101 | 2818991459 | Bacteria | 8736032 |
| 1599 | 2819711999 | 2818991465 | Bacteria | 5388835 |
| 1600 | 2819726066 | 2818991468 | Bacteria | 3723169 |
| 1601 | 2821118321 | 2821111986 | Bacteria | 6894338 |
| 1602 | 2823526418 | 2823526263 | Bacteria | 3765752 |
| 1603 | 2842688276 | 2842682962 | Bacteria | 5589973 |
| 1604 | 2842887723 | 2842882022 | Bacteria | 6158489 |
| 1605 | 2849144970 | 2849139964 | Bacteria | 5613304 |
| 1606 | 2857460103 | 2857453340 | Bacteria | 8090534 |
| 1607 | 2857478327 | 2857472729 | Bacteria | 6568124 |
| 1608 | 2857586482 | 2857581216 | Bacteria | 5522813 |
| 1609 | 2857590956 | 2857586860 | Bacteria | 4354574 |
| 1610 | 2857608869 | 2857604169 | Bacteria | 5111450 |
| 1611 | 2860837582 | 2860837431 | Bacteria | 4202080 |
| 1612 | 2864738871 | 2864733723 | Bacteria | 6770668 |
| 1613 | 2865002024 | 2864997549 | Bacteria | 5139696 |
| 1614 | 2865007641 | 2865002811 | Bacteria | 6333767 |
| 1615 | 2877768801 | 2877768649 | Bacteria | 3957164 |
| 1616 | 2880169743 | 2880169592 | Bacteria | 3900066 |
| 1617 | 2881639977 | 2881636855 | Bacteria | 5205297 |
| 1618 | 2881646638 | 2881644220 | Bacteria | 5302661 |
| 1619 | 2885529915 | 2885526491 | Bacteria | 7164189 |
| 1620 | 2888584461 | 2888578766 | Bacteria | 6743310 |
| 1621 | 2889048009 | 2889042446 | Bacteria | 7618936 |
| 1622 | 2889053093 | 2889049205 | Bacteria | 7524325 |
| 1623 | 2889276747 | 2889276214 | Bacteria | 5979355 |
| 1624 | 2889298944 | 2889295896 | Bacteria | 4704906 |
| 1625 | 2897109770 | 2897109615 | Bacteria | 4009619 |
| 1626 | 2904168154 | 2904162308 | Bacteria | 7086713 |
| 1627 | 2904496949 | 2904490793 | Bacteria | 7046938 |
| 1628 | 2904530167 | 2904524088 | Bacteria | 5887454 |
| 1629 | 2904564592 | 2904560550 | Bacteria | 4029838 |
| 1630 | 2904600780 | 2904595352 | Bacteria | 6124848 |
| 1631 | 2904755673 | 2904755435 | Bacteria | 7986759 |
| 1632 | 2907208199 | 2907202186 | Bacteria | 6632024 |
| 1633 | 2908669317 | 2908665501 | Bacteria | 3678115 |
| 1634 | 2915610001 | 2915606848 | Bacteria | 6032732 |
| 1635 | 2919097075 | 2919093281 | Bacteria | 3660974 |
| 1636 | 2919149636 | 2919143609 | Bacteria | 6219228 |
| 1637 | 2919166248 | 2919160200 | Bacteria | 6929020 |
| 1638 | 2919419355 | 2919414237 | Bacteria | 5429133 |
| 1639 | 2919432412 | 2919425241 | Bacteria | 8055701 |
| 1640 | 2919523191 | 2919517244 | Bacteria | 5858162 |
| 1641 | 2919726412 | 2919720352 | Bacteria | 5986006 |
| 1642 | 2919730768 | 2919726948 | Bacteria | 3696050 |
| 1643 | 2925332838 | 2925326138 | Bacteria | 9652120 |
| 1644 | 2928099915 | 2928093941 | Bacteria | 5965005 |
| 1645 | 2929009902 | 2929004312 | Bacteria | 5678476 |
| 1646 | 2929211882 | 2929206907 | Bacteria | 5918291 |
| 1647 | 2929233263 | 2929233124 | Bacteria | 5948380 |
| 1648 | 2929298371 | 2929297113 | Bacteria | 3141306 |
| 1649 | 2931385115 | 2931384279 | Bacteria | 7299545 |
| 1650 | 2936343059 | 2936340661 | Bacteria | 5139038 |
| 1651 | 2936363694 | 2936361878 | Bacteria | 5632809 |
| 1652 | 2938653387 | 2938649242 | Bacteria | 7118381 |
| 1653 | 2938917433 | 2938917290 | Bacteria | 5914775 |
| 1654 | 2939685123 | 2939679117 | Bacteria | 6921672 |
| 1655 | 2939707603 | 2939702853 | Bacteria | 5139229 |
| 1656 | 2945996262 | 2945991243 | Bacteria | 7008369 |
| 1657 | 2946058952 | 2946053406 | Bacteria | 6978655 |
| 1658 | 2947426731 | 2947426588 | Bacteria | 5357194 |
| 1659 | 2954776078 | 2954773129 | Bacteria | 3741715 |
| 1660 | 2956900798 | 2956897341 | Bacteria | 5447711 |
| 1661 | 2960324283 | 2960319331 | Bacteria | 5502575 |
| 1662 | 2960378894 | 2960375949 | Bacteria | 5361395 |
| 1663 | 2962290793 | 2962290636 | Bacteria | 4072939 |
| 1664 | 2965761265 | 2965761152 | Bacteria | 5806513 |
| 1665 | 2968562363 | 2968558590 | Bacteria | 6956864 |
| 1666 | 2969137000 | 2969136845 | Bacteria | 3923176 |
| 1667 | 2969141169 | 2969141011 | Bacteria | 4118468 |
| 1668 | 2969766251 | 2969765954 | Bacteria | 4216713 |
| 1669 | 2969774919 | 2969770375 | Bacteria | 4271280 |
| 1670 | 2971406755 | 2971403814 | Bacteria | 7370929 |
| 1671 | 2971410928 | 2971410472 | Bacteria | 8311090 |
| 1672 | 2971513789 | 2971511577 | Bacteria | 5404012 |
| 1673 | 2971893530 | 2971893375 | Bacteria | 3929648 |
| 1674 | 2977254693 | 2977254563 | Bacteria | 4828420 |
| 1675 | 2979083741 | 2979083700 | Bacteria | 5894929 |
| 1676 | 2980128575 | 2980125574 | Bacteria | 5567337 |
| 1677 | 2980179442 | 2980176882 | Bacteria | 5397533 |
| 1678 | 2980186830 | 2980182181 | Bacteria | 9454109 |
| 1679 | 2980492744 | 2980492589 | Bacteria | 4072961 |
| 1680 | 2981289522 | 2981284811 | Bacteria | 4641497 |
| 1681 | 2981294459 | 2981289755 | Bacteria | 4641509 |
| 1682 | 2981985115 | 2981980479 | Bacteria | 4641628 |
| 1683 | 2981990046 | 2981985349 | Bacteria | 4641497 |
| 1684 | 2984531161 | 2984527788 | Bacteria | 5288478 |
| 1685 | 2984537270 | 2984532647 | Bacteria | 5288506 |
| 1686 | 2988229870 | 2988225383 | Bacteria | 7221625 |
| 1687 | 2990275696 | 2990275345 | Bacteria | 4887158 |
| 1688 | 2996636942 | 2996632988 | Bacteria | 6921523 |
| 1689 | 2996707485 | 2996706504 | Bacteria | 5757485 |
| 1690 | 3001271875 | 3001267043 | Bacteria | 4823521 |
| 1691 | 3001275961 | 3001272096 | Bacteria | 4729684 |
| 1692 | 3001898794 | 3001892409 | Bacteria | 6328293 |
| 1693 | 3006858519 | 3006858327 | Bacteria | 4317835 |
| 1694 | 3006883631 | 3006879489 | Bacteria | 4064221 |
| 1695 | 3006980026 | 3006978542 | Bacteria | 5328100 |
| 1696 | 648172187 | 648028048 | Bacteria | 5394884 |
| 1697 | 8002318133 | 8002317523 | Bacteria | 8051857 |
| 1698 | 8022621217 | 8022621104 | Bacteria | 5241040 |
| 1699 | 8022631638 | 8022630665 | Bacteria | 3886130 |
| 1700 | 8022655880 | 8022653035 | Bacteria | 4035078 |
| 1701 | 8022799056 | 8022792930 | Bacteria | 5693794 |
| 1702 | 8022893435 | 8022893055 | Bacteria | 5300455 |
| 1703 | 8022917915 | 8022914991 | Bacteria | 5584517 |
| 1704 | 8023439812 | 8023438354 | Bacteria | 5779374 |
| 1705 | 8023447391 | 8023444577 | Bacteria | 5661597 |
| 1706 | 8046991300 | 8046991243 | Bacteria | 8497463 |
| 1707 | 8051956513 | 8051952484 | Bacteria | 3926774 |
| 1708 | 8052174989 | 8052174270 | Bacteria | 3881265 |
| 1709 | 8054282865 | 8054280661 | Bacteria | 4232245 |
| 1710 | 8054471310 | 8054465665 | Bacteria | 7323556 |
| 1711 | 8054801995 | 8054795415 | Bacteria | 9785225 |
| 1712 | 8055634017 | 8055632911 | Bacteria | 5283357 |
| 1713 | 8056535609 | 8056533031 | Bacteria | 8964429 |
| 1714 | 8057473381 | 8057473075 | Bacteria | 5892720 |
| 1715 | 8057582798 | 8057582654 | Bacteria | 5218944 |
| 1716 | 8057632288 | 8057632132 | Bacteria | 4726859 |
| 1717 | 8057735139 | 8057733483 | Bacteria | 6578323 |
| 1718 | 8057979872 | 8057977335 | Bacteria | 5694872 |
| 1719 | Ga0496116_0003454 | |||
| 1720 | SwRhRL2b_contig_213193 | |||
| 1721 | JGI24736J21556_1046494 | |||
| 1722 | JGI24740J21852_10082807 | |||
| 1723 | JGI24743J22301_10016305 | |||
| 1724 | JGI24033J26618_1020881 | |||
| 1725 | JGI25151J46595_10000678 | |||
| 1726 | JGI25151J46595_10000735 | |||
| 1727 | JGI25151J46595_10009543 | |||
| 1728 | JGI25151J46595_10009794 | |||
| 1729 | JGI25151J46595_10012392 | |||
| 1730 | JGI25151J46595_10136169 | |||
| 1731 | JGI25165J46597_1016815 | |||
| 1732 | rootH1_10000848 | |||
| 1733 | rootH2_10053907 | |||
| 1734 | rootL2_10000406 | |||
| 1735 | rootL2_10015753 | |||
| 1736 | Ga0006554J51385_1033852 | |||
| 1737 | Ga0006562J51391_1000046 | |||
| 1738 | Ga0006562J51391_1000361 | |||
| 1739 | Ga0006562J51391_1000677 | |||
| 1740 | Ga0006562J51391_1015323 | |||
| 1741 | Ga0055538_1000286 | |||
| 1742 | Ga0055532_1000266 | |||
| 1743 | Ga0055532_1003438 | |||
| 1744 | Ga0055532_1028664 | |||
| 1745 | Ga0055535_1000913 | |||
| 1746 | Ga0055536_1032063 | |||
| 1747 | Ga0055528_1000586 | |||
| 1748 | Ga0055541_1000319 | |||
| 1749 | Ga0055541_1001260 | |||
| 1750 | Ga0055541_1001864 | |||
| 1751 | Ga0055541_1024461 | |||
| 1752 | Ga0058692_1040989 | |||
| 1753 | Ga0058863_10038888 | |||
| 1754 | Ga0058863_11363707 | |||
| 1755 | Ga0058863_11799934 | |||
| 1756 | Ga0058861_11402842 | |||
| 1757 | Ga0058861_12067592 | |||
| 1758 | Ga0058862_12871386 | |||
| 1759 | Ga0065165_1062104 | |||
| 1760 | Ga0065704_10156589 | |||
| 1761 | Ga0070658_10010767 | |||
| 1762 | Ga0070658_10028665 | |||
| 1763 | Ga0070658_10113875 | |||
| 1764 | Ga0070658_10530949 | |||
| 1765 | Ga0070676_10003937 | |||
| 1766 | Ga0070676_10038362 | |||
| 1767 | Ga0070683_100007295 | |||
| 1768 | Ga0070683_100055839 | |||
| 1769 | Ga0070683_100218692 | |||
| 1770 | Ga0070683_100292648 | |||
| 1771 | Ga0070683_100671922 | |||
| 1772 | Ga0070683_101593584 | |||
| 1773 | Ga0070670_100003586 | |||
| 1774 | Ga0070670_100005012 | |||
| 1775 | Ga0070670_100076604 | |||
| 1776 | Ga0068869_100012179 | |||
| 1777 | Ga0068869_100035406 | |||
| 1778 | Ga0070666_10026243 | |||
| 1779 | Ga0070666_10030632 | |||
| 1780 | Ga0070666_10433297 | |||
| 1781 | Ga0070680_100002604 | |||
| 1782 | Ga0070680_100137049 | |||
| 1783 | Ga0070680_100185617 | |||
| 1784 | Ga0070680_100315371 | |||
| 1785 | Ga0070680_101874588 | |||
| 1786 | Ga0070682_100139157 | |||
| 1787 | Ga0070682_101285441 | |||
| 1788 | Ga0068868_100001679 | |||
| 1789 | Ga0068868_100015707 | |||
| 1790 | Ga0068868_100038932 | |||
| 1791 | Ga0070660_100486432 | |||
| 1792 | Ga0070660_100619230 | |||
| 1793 | Ga0070660_100790164 | |||
| 1794 | Ga0070691_10991025 | |||
| 1795 | Ga0070661_100025903 | |||
| 1796 | Ga0070661_100107733 | |||
| 1797 | Ga0070661_100438434 | |||
| 1798 | Ga0070668_100741717 | |||
| 1799 | Ga0070668_101017090 | |||
| 1800 | Ga0070669_100014591 | |||
| 1801 | Ga0070669_100298492 | |||
| 1802 | Ga0070675_100012859 | |||
| 1803 | Ga0070675_100035195 | |||
| 1804 | Ga0070675_101599526 | |||
| 1805 | Ga0070671_100003263 | |||
| 1806 | Ga0070671_100014943 | |||
| 1807 | Ga0070671_100191065 | |||
| 1808 | Ga0070673_100013868 | |||
| 1809 | Ga0070659_100094581 | |||
| 1810 | Ga0070659_100762408 | |||
| 1811 | Ga0070659_102027902 | |||
| 1812 | Ga0070667_100001517 | |||
| 1813 | Ga0070667_100027341 | |||
| 1814 | Ga0070709_10947728 | |||
| 1815 | Ga0070709_11124461 | |||
| 1816 | Ga0070709_11366420 | |||
| 1817 | Ga0070709_11453456 | |||
| 1818 | Ga0070714_100418659 | |||
| 1819 | Ga0070714_101925157 | |||
| 1820 | Ga0070713_100069410 | |||
| 1821 | Ga0070713_100113217 | |||
| 1822 | Ga0070713_100622588 | |||
| 1823 | Ga0070710_10463050 | |||
| 1824 | Ga0070710_10670491 | |||
| 1825 | Ga0070711_100115645 | |||
| 1826 | Ga0070711_100479857 | |||
| 1827 | Ga0070708_100327370 | |||
| 1828 | Ga0070663_100443489 | |||
| 1829 | Ga0070663_101619885 | |||
| 1830 | Ga0070663_102002259 | |||
| 1831 | Ga0070678_100033078 | |||
| 1832 | Ga0070681_10001062 | |||
| 1833 | Ga0070681_10113171 | |||
| 1834 | Ga0070681_10289580 | |||
| 1835 | Ga0070681_10646948 | |||
| 1836 | Ga0070681_11010173 | |||
| 1837 | Ga0068867_100145111 | |||
| 1838 | Ga0070706_100200060 | |||
| 1839 | Ga0070707_100147928 | |||
| 1840 | Ga0070698_100384297 | |||
| 1841 | Ga0070699_100237826 | |||
| 1842 | Ga0070679_100060017 | |||
| 1843 | Ga0070679_100066127 | |||
| 1844 | Ga0070679_100067206 | |||
| 1845 | Ga0070679_100294226 | |||
| 1846 | Ga0070679_101671013 | |||
| 1847 | Ga0070684_100043376 | |||
| 1848 | Ga0070684_100082885 | |||
| 1849 | Ga0070684_100495127 | |||
| 1850 | Ga0070684_100937542 | |||
| 1851 | Ga0070684_100960489 | |||
| 1852 | Ga0070697_100310175 | |||
| 1853 | Ga0068853_100001096 | |||
| 1854 | Ga0068853_100133809 | |||
| 1855 | Ga0068853_100142757 | |||
| 1856 | Ga0068853_100364943 | |||
| 1857 | Ga0068853_100983581 | |||
| 1858 | Ga0070672_100168746 | |||
| 1859 | Ga0070672_100223348 | |||
| 1860 | Ga0070665_100015044 | |||
| 1861 | Ga0070665_100065929 | |||
| 1862 | Ga0070665_100092190 | |||
| 1863 | Ga0070704_101856817 | |||
| 1864 | Ga0068855_100000642 | |||
| 1865 | Ga0068855_100005786 | |||
| 1866 | Ga0068855_100019267 | |||
| 1867 | Ga0068855_100077022 | |||
| 1868 | Ga0068855_100146849 | |||
| 1869 | Ga0068855_100433886 | |||
| 1870 | Ga0068855_100540482 | |||
| 1871 | Ga0070664_100070029 | |||
| 1872 | Ga0070664_100769851 | |||
| 1873 | Ga0068857_100024212 | |||
| 1874 | Ga0068857_100154377 | |||
| 1875 | Ga0068857_100237069 | |||
| 1876 | Ga0068857_100519894 | |||
| 1877 | Ga0068854_100081038 | |||
| 1878 | Ga0068854_100311965 | |||
| 1879 | Ga0068854_100902952 | |||
| 1880 | Ga0068856_100010942 | |||
| 1881 | Ga0068856_100018870 | |||
| 1882 | Ga0068856_100104028 | |||
| 1883 | Ga0068856_100511850 | |||
| 1884 | Ga0068856_100805980 | |||
| 1885 | Ga0068856_101150623 | |||
| 1886 | Ga0068856_101505192 | |||
| 1887 | Ga0068856_101591523 | |||
| 1888 | Ga0068852_100024674 | |||
| 1889 | Ga0068852_100054705 | |||
| 1890 | Ga0068852_100220948 | |||
| 1891 | Ga0068852_100315455 | |||
| 1892 | Ga0068852_100355062 | |||
| 1893 | Ga0068852_100674498 | |||
| 1894 | Ga0068852_100845663 | |||
| 1895 | Ga0068852_100869877 | |||
| 1896 | Ga0068859_100022836 | |||
| 1897 | Ga0068864_100005797 | |||
| 1898 | Ga0068864_100071645 | |||
| 1899 | Ga0068851_10018984 | |||
| 1900 | Ga0068851_10034554 | |||
| 1901 | Ga0068851_10375856 | |||
| 1902 | Ga0068851_10381747 | |||
| 1903 | Ga0068851_10729687 | |||
| 1904 | Ga0068870_10034626 | |||
| 1905 | Ga0068863_100005496 | |||
| 1906 | Ga0068858_100047133 | |||
| 1907 | Ga0068858_100057329 | |||
| 1908 | Ga0068860_100000786 | |||
| 1909 | Ga0068860_100545493 | |||
| 1910 | Ga0068862_100808179 | |||
| 1911 | Ga0068862_101712281 | |||
| 1912 | Ga0070717_10045133 | |||
| 1913 | Ga0070717_10275992 | |||
| 1914 | Ga0070717_12045167 | |||
| 1915 | Ga0070715_10360263 | |||
| 1916 | Ga0070712_100369334 | |||
| 1917 | Ga0070712_100369860 | |||
| 1918 | Ga0070712_101438966 | |||
| 1919 | Ga0070712_101537332 | |||
| 1920 | Ga0075367_10998897 | |||
| 1921 | Ga0097621_100005101 | |||
| 1922 | Ga0097621_100109961 | |||
| 1923 | Ga0075370_10747646 | |||
| 1924 | Ga0068871_100004090 | |||
| 1925 | Ga0068871_100018858 | |||
| 1926 | Ga0075430_101041394 | |||
| 1927 | Ga0075429_100640588 | |||
| 1928 | Ga0068865_100390365 | |||
| 1929 | Ga0097620_100022837 | |||
| 1930 | Ga0105251_10002306 | |||
| 1931 | Ga0105251_10077887 | |||
| 1932 | Ga0105251_10241236 | |||
| 1933 | Ga0105244_10012810 | |||
| 1934 | Ga0105244_10041217 | |||
| 1935 | Ga0105244_10062257 | |||
| 1936 | Ga0105244_10445696 | |||
| 1937 | Ga0105244_10527490 | |||
| 1938 | Ga0105250_10059344 | |||
| 1939 | Ga0105240_10020515 | |||
| 1940 | Ga0105240_10023114 | |||
| 1941 | Ga0105240_10032555 | |||
| 1942 | Ga0105240_10050651 | |||
| 1943 | Ga0105240_10057620 | |||
| 1944 | Ga0105240_10257917 | |||
| 1945 | Ga0105240_10293798 | |||
| 1946 | Ga0105240_10907968 | |||
| 1947 | Ga0105240_12347450 | |||
| 1948 | Ga0105240_12536730 | |||
| 1949 | Ga0105245_10000731 | |||
| 1950 | Ga0105245_10007135 | |||
| 1951 | Ga0105245_10191213 | |||
| 1952 | Ga0105245_10244214 | |||
| 1953 | Ga0105245_11387320 | |||
| 1954 | Ga0105247_10000354 | |||
| 1955 | Ga0105247_10054318 | |||
| 1956 | Ga0105247_10303362 | |||
| 1957 | Ga0105247_10955169 | |||
| 1958 | Ga0114129_12927940 | |||
| 1959 | Ga0114129_13214632 | |||
| 1960 | Ga0105243_10000301 | |||
| 1961 | Ga0105243_11045142 | |||
| 1962 | Ga0105241_10003327 | |||
| 1963 | Ga0105241_10019071 | |||
| 1964 | Ga0105241_10046891 | |||
| 1965 | Ga0105241_10283985 | |||
| 1966 | Ga0105242_10003155 | |||
| 1967 | Ga0105242_11651624 | |||
| 1968 | Ga0105248_10002627 | |||
| 1969 | Ga0105248_10006787 | |||
| 1970 | Ga0105248_10740796 | |||
| 1971 | Ga0105248_12095466 | |||
| 1972 | Ga0105248_12344769 | |||
| 1973 | Ga0105237_10036030 | |||
| 1974 | Ga0105237_10036694 | |||
| 1975 | Ga0105237_10184786 | |||
| 1976 | Ga0105237_10388491 | |||
| 1977 | Ga0105237_10949913 | |||
| 1978 | Ga0105237_11496270 | |||
| 1979 | Ga0105238_10010551 | |||
| 1980 | Ga0105238_10031377 | |||
| 1981 | Ga0105238_10196265 | |||
| 1982 | Ga0105238_10230359 | |||
| 1983 | Ga0105238_10494404 | |||
| 1984 | Ga0105238_11386598 | |||
| 1985 | Ga0105238_11461412 | |||
| 1986 | Ga0105238_11929273 | |||
| 1987 | Ga0105249_10087450 | |||
| 1988 | Ga0105249_10267104 | |||
| 1989 | Ga0105239_10009258 | |||
| 1990 | Ga0105239_10014845 | |||
| 1991 | Ga0105239_10018959 | |||
| 1992 | Ga0105239_10428367 | |||
| 1993 | Ga0105239_10770450 | |||
| 1994 | Ga0105239_11111053 | |||
| 1995 | Ga0105239_11447239 | |||
| 1996 | Ga0105246_10000077 | |||
| 1997 | Ga0105246_10004133 | |||
| 1998 | Ga0105246_10025174 | |||
| 1999 | Ga0105246_10082771 | |||
| 2000 | Ga0157373_10107156 | |||
| 2001 | Ga0157373_10272511 | |||
| 2002 | Ga0157373_10709039 | |||
| 2003 | Ga0157371_10156861 | |||
| 2004 | Ga0157371_10252764 | |||
| 2005 | Ga0157371_10626220 | |||
| 2006 | Ga0157370_10001390 | |||
| 2007 | Ga0157370_10006622 | |||
| 2008 | Ga0157370_10127454 | |||
| 2009 | Ga0157370_10526723 | |||
| 2010 | Ga0157370_10642220 | |||
| 2011 | Ga0157370_10864940 | |||
| 2012 | Ga0157369_10004351 | |||
| 2013 | Ga0157369_10008438 | |||
| 2014 | Ga0157369_10013194 | |||
| 2015 | Ga0157369_10069033 | |||
| 2016 | Ga0157369_10234339 | |||
| 2017 | Ga0157369_10257505 | |||
| 2018 | Ga0157369_10549164 | |||
| 2019 | Ga0157369_10696510 | |||
| 2020 | Ga0157369_11186870 | |||
| 2021 | Ga0157369_11625291 | |||
| 2022 | Ga0157369_11925178 | |||
| 2023 | Ga0157374_10002988 | |||
| 2024 | Ga0157374_10010090 | |||
| 2025 | Ga0157374_10043454 | |||
| 2026 | Ga0157374_10045280 | |||
| 2027 | Ga0157374_10070986 | |||
| 2028 | Ga0157374_10267053 | |||
| 2029 | Ga0157374_10636731 | |||
| 2030 | Ga0157374_10656450 | |||
| 2031 | Ga0157378_10000237 | |||
| 2032 | Ga0157378_10019987 | |||
| 2033 | Ga0157378_10020240 | |||
| 2034 | Ga0157378_10030845 | |||
| 2035 | Ga0157378_10039530 | |||
| 2036 | Ga0163162_10031415 | |||
| 2037 | Ga0163162_10120074 | |||
| 2038 | Ga0163162_13486915 | |||
| 2039 | Ga0157372_10000424 | |||
| 2040 | Ga0157372_10065708 | |||
| 2041 | Ga0157372_10092295 | |||
| 2042 | Ga0157372_10128758 | |||
| 2043 | Ga0157372_10130936 | |||
| 2044 | Ga0157372_10313368 | |||
| 2045 | Ga0157372_10528821 | |||
| 2046 | Ga0157372_10593241 | |||
| 2047 | Ga0157372_11394363 | |||
| 2048 | Ga0157372_11485178 | |||
| 2049 | Ga0157372_12288291 | |||
| 2050 | Ga0157375_10024173 | |||
| 2051 | Ga0157375_10083448 | |||
| 2052 | Ga0157375_10084569 | |||
| 2053 | Ga0163163_10008178 | |||
| 2054 | Ga0163163_10101857 | |||
| 2055 | Ga0182008_10050838 | |||
| 2056 | Ga0157377_10000299 | |||
| 2057 | Ga0157379_10007463 | |||
| 2058 | Ga0157379_10072913 | |||
| 2059 | Ga0157379_10339244 | |||
| 2060 | Ga0157379_11775534 | |||
| 2061 | Ga0157376_10001057 | |||
| 2062 | Ga0157376_10004748 | |||
| 2063 | Ga0157376_10027401 | |||
| 2064 | Ga0157376_10584539 | |||
| 2065 | Ga0157376_10598071 | |||
| 2066 | Ga0163161_10831402 | |||
| 2067 | Ga0197907_10927678 | |||
| 2068 | Ga0197907_11334415 | |||
| 2069 | Ga0206356_10096944 | |||
| 2070 | Ga0206351_10499662 | |||
| 2071 | Ga0206352_10848511 | |||
| 2072 | Ga0206352_11344399 | |||
| 2073 | Ga0206350_10067152 | |||
| 2074 | Ga0206350_11376406 | |||
| 2075 | Ga0206353_10888394 | |||
| 2076 | Ga0206353_11437168 | |||
| 2077 | Ga0206353_11689256 | |||
| 2078 | Ga0213876_10401832 | |||
| 2079 | Ga0224712_10009206 | |||
| 2080 | Ga0224712_10042705 | |||
| 2081 | Ga0224712_10463267 | |||
| 2082 | Ga0256744_107106 | |||
| 2083 | Ga0209784_100141 | |||
| 2084 | Ga0209784_104860 | |||
| 2085 | Ga0209566_100221 | |||
| 2086 | Ga0209566_100273 | |||
| 2087 | Ga0209566_100512 | |||
| 2088 | Ga0209566_103758 | |||
| 2089 | Ga0209147_100198 | |||
| 2090 | Ga0209147_100385 | |||
| 2091 | Ga0209147_101980 | |||
| 2092 | Ga0209147_107627 | |||
| 2093 | Ga0209437_100331 | |||
| 2094 | Ga0209437_106937 | |||
| 2095 | Ga0209258_100927 | |||
| 2096 | Ga0209233_1002003 | |||
| 2097 | Ga0209673_1001330 | |||
| 2098 | Ga0209130_1014791 | |||
| 2099 | Ga0209130_1015250 | |||
| 2100 | Ga0209130_1053714 | |||
| 2101 | Ga0209130_1057683 | |||
| 2102 | Ga0209675_1004714 | |||
| 2103 | Ga0209675_1035822 | |||
| 2104 | Ga0209675_1041839 | |||
| 2105 | Ga0209676_1000745 | |||
| 2106 | Ga0209025_1000639 | |||
| 2107 | Ga0209025_1000976 | |||
| 2108 | Ga0209025_1001421 | |||
| 2109 | Ga0209025_1010512 | |||
| 2110 | Ga0209025_1014524 | |||
| 2111 | Ga0209025_1015652 | |||
| 2112 | Ga0209025_1045113 | |||
| 2113 | Ga0209025_1049611 | |||
| 2114 | Ga0209025_1055754 | |||
| 2115 | Ga0209025_1083683 | |||
| 2116 | Ga0207426_1023848 | |||
| 2117 | Ga0207426_1161456 | |||
| 2118 | Ga0207697_10017259 | |||
| 2119 | Ga0207656_10087909 | |||
| 2120 | Ga0207656_10212377 | |||
| 2121 | Ga0207696_1000471 | |||
| 2122 | Ga0207696_1001142 | |||
| 2123 | Ga0207655_1000971 | |||
| 2124 | Ga0207655_1001486 | |||
| 2125 | Ga0207655_1039477 | |||
| 2126 | Ga0207655_1130267 | |||
| 2127 | Ga0207655_1197922 | |||
| 2128 | Ga0207655_1215894 | |||
| 2129 | Ga0207655_1229809 | |||
| 2130 | Ga0207713_1000405 | |||
| 2131 | Ga0207713_1007861 | |||
| 2132 | Ga0207713_1012576 | |||
| 2133 | Ga0207692_10425061 | |||
| 2134 | Ga0207692_10816738 | |||
| 2135 | Ga0207710_10000981 | |||
| 2136 | Ga0207710_10006009 | |||
| 2137 | Ga0207688_10525463 | |||
| 2138 | Ga0207680_10040705 | |||
| 2139 | Ga0207680_10114336 | |||
| 2140 | Ga0207680_10286564 | |||
| 2141 | Ga0207647_10004892 | |||
| 2142 | Ga0207647_10020423 | |||
| 2143 | Ga0207685_10529278 | |||
| 2144 | Ga0207685_10538842 | |||
| 2145 | Ga0207699_10380011 | |||
| 2146 | Ga0207699_10752201 | |||
| 2147 | Ga0207645_10007324 | |||
| 2148 | Ga0207645_10024412 | |||
| 2149 | Ga0207643_10071627 | |||
| 2150 | Ga0207705_10035811 | |||
| 2151 | Ga0207705_10049624 | |||
| 2152 | Ga0207705_10514440 | |||
| 2153 | Ga0207705_10542378 | |||
| 2154 | Ga0207705_10651369 | |||
| 2155 | Ga0207684_10019216 | |||
| 2156 | Ga0207654_10001818 | |||
| 2157 | Ga0207654_10013381 | |||
| 2158 | Ga0207654_10049266 | |||
| 2159 | Ga0207654_10335367 | |||
| 2160 | Ga0207707_10000624 | |||
| 2161 | Ga0207707_10233542 | |||
| 2162 | Ga0207707_10593043 | |||
| 2163 | Ga0207695_10000379 | |||
| 2164 | Ga0207695_10000384 | |||
| 2165 | Ga0207695_10001178 | |||
| 2166 | Ga0207695_10003215 | |||
| 2167 | Ga0207695_10189409 | |||
| 2168 | Ga0207695_10193386 | |||
| 2169 | Ga0207695_10448132 | |||
| 2170 | Ga0207695_10549223 | |||
| 2171 | Ga0207695_10860868 | |||
| 2172 | Ga0207671_10000071 | |||
| 2173 | Ga0207671_10000503 | |||
| 2174 | Ga0207671_10029151 | |||
| 2175 | Ga0207671_10968842 | |||
| 2176 | Ga0207671_11301378 | |||
| 2177 | Ga0207693_10021027 | |||
| 2178 | Ga0207693_10374482 | |||
| 2179 | Ga0207663_10195780 | |||
| 2180 | Ga0207663_10366822 | |||
| 2181 | Ga0207660_10003099 | |||
| 2182 | Ga0207660_10274908 | |||
| 2183 | Ga0207660_10411650 | |||
| 2184 | Ga0207660_10927792 | |||
| 2185 | Ga0207657_10495943 | |||
| 2186 | Ga0207657_10609434 | |||
| 2187 | Ga0207657_10667096 | |||
| 2188 | Ga0207657_11331646 | |||
| 2189 | Ga0207649_10007836 | |||
| 2190 | Ga0207649_10037634 | |||
| 2191 | Ga0207649_10072355 | |||
| 2192 | Ga0207649_11483743 | |||
| 2193 | Ga0207652_10049501 | |||
| 2194 | Ga0207652_10406320 | |||
| 2195 | Ga0207652_10439917 | |||
| 2196 | Ga0207652_10511347 | |||
| 2197 | Ga0207646_10151361 | |||
| 2198 | Ga0207681_10039956 | |||
| 2199 | Ga0207681_10534366 | |||
| 2200 | Ga0207694_10000247 | |||
| 2201 | Ga0207694_10001290 | |||
| 2202 | Ga0207694_10049671 | |||
| 2203 | Ga0207694_10104531 | |||
| 2204 | Ga0207650_10032901 | |||
| 2205 | Ga0207650_10144626 | |||
| 2206 | Ga0207650_10448961 | |||
| 2207 | Ga0207650_10562968 | |||
| 2208 | Ga0207659_10035540 | |||
| 2209 | Ga0207659_11132187 | |||
| 2210 | Ga0207687_10004776 | |||
| 2211 | Ga0207687_10023510 | |||
| 2212 | Ga0207687_10172618 | |||
| 2213 | Ga0207687_10230870 | |||
| 2214 | Ga0207700_10010087 | |||
| 2215 | Ga0207700_10076852 | |||
| 2216 | Ga0207700_10738709 | |||
| 2217 | Ga0207664_10218061 | |||
| 2218 | Ga0207664_10575276 | |||
| 2219 | Ga0207644_10002812 | |||
| 2220 | Ga0207644_10008147 | |||
| 2221 | Ga0207644_10085502 | |||
| 2222 | Ga0207690_10153599 | |||
| 2223 | Ga0207690_10524240 | |||
| 2224 | Ga0207706_10003090 | |||
| 2225 | Ga0207686_10004531 | |||
| 2226 | Ga0207709_10000416 | |||
| 2227 | Ga0207709_10026556 | |||
| 2228 | Ga0207669_10584370 | |||
| 2229 | Ga0207704_10232777 | |||
| 2230 | Ga0207665_10100583 | |||
| 2231 | Ga0207665_10217896 | |||
| 2232 | Ga0207665_10930120 | |||
| 2233 | Ga0207691_10008111 | |||
| 2234 | Ga0207691_10354977 | |||
| 2235 | Ga0207711_10027616 | |||
| 2236 | Ga0207711_10045923 | |||
| 2237 | Ga0207711_10087252 | |||
| 2238 | Ga0207711_10252906 | |||
| 2239 | Ga0207711_10448790 | |||
| 2240 | Ga0207711_11685084 | |||
| 2241 | Ga0207689_10000502 | |||
| 2242 | Ga0207689_10007888 | |||
| 2243 | Ga0207661_10029458 | |||
| 2244 | Ga0207661_10072040 | |||
| 2245 | Ga0207661_10137450 | |||
| 2246 | Ga0207661_10167167 | |||
| 2247 | Ga0207661_10246633 | |||
| 2248 | Ga0207679_10023401 | |||
| 2249 | Ga0207679_10351814 | |||
| 2250 | Ga0207667_10006951 | |||
| 2251 | Ga0207667_10008805 | |||
| 2252 | Ga0207667_10014641 | |||
| 2253 | Ga0207667_10060987 | |||
| 2254 | Ga0207667_10371585 | |||
| 2255 | Ga0207667_10919072 | |||
| 2256 | Ga0207667_11448986 | |||
| 2257 | Ga0207667_11485453 | |||
| 2258 | Ga0207651_10416249 | |||
| 2259 | Ga0207712_10226277 | |||
| 2260 | Ga0207668_10204145 | |||
| 2261 | Ga0207640_10782303 | |||
| 2262 | Ga0207640_10807724 | |||
| 2263 | Ga0207658_10000267 | |||
| 2264 | Ga0207658_10184464 | |||
| 2265 | Ga0207677_10000115 | |||
| 2266 | Ga0207677_10129298 | |||
| 2267 | Ga0207677_10241466 | |||
| 2268 | Ga0207703_10041774 | |||
| 2269 | Ga0207703_10051602 | |||
| 2270 | Ga0207639_10000868 | |||
| 2271 | Ga0207639_10188656 | |||
| 2272 | Ga0207639_10208644 | |||
| 2273 | Ga0207678_10147456 | |||
| 2274 | Ga0207678_10443503 | |||
| 2275 | Ga0207702_10001589 | |||
| 2276 | Ga0207702_10003889 | |||
| 2277 | Ga0207702_10047957 | |||
| 2278 | Ga0207702_10696570 | |||
| 2279 | Ga0207702_10830686 | |||
| 2280 | Ga0207702_11135850 | |||
| 2281 | Ga0207641_10001519 | |||
| 2282 | Ga0207641_10450787 | |||
| 2283 | Ga0207648_10044039 | |||
| 2284 | Ga0207676_10004236 | |||
| 2285 | Ga0207676_10589015 | |||
| 2286 | Ga0207674_10033769 | |||
| 2287 | Ga0207674_10053258 | |||
| 2288 | Ga0207674_10125804 | |||
| 2289 | Ga0207683_10006613 | |||
| 2290 | Ga0207698_10000039 | |||
| 2291 | Ga0207698_10000059 | |||
| 2292 | Ga0207698_10158037 | |||
| 2293 | Ga0207698_11262558 | |||
| 2294 | Ga0207698_11553756 | |||
| 2295 | Ga0207698_11952906 | |||
| 2296 | Ga0209371_1000923 | |||
| 2297 | Ga0210000_1001373 | |||
| 2298 | Ga0209179_1022000 | |||
| 2299 | Ga0209982_1024772 | |||
| 2300 | Ga0209970_1000914 | |||
| 2301 | Ga0209971_1022190 | |||
| 2302 | Ga0209974_10014241 | |||
| 2303 | Ga0268266_10110944 | |||
| 2304 | Ga0268266_10566523 | |||
| 2305 | Ga0268265_11056872 | |||
| 2306 | Ga0268264_10000863 | |||
| 2307 | Ga0268264_11332615 | |||
| 2308 | Ga0265336_10006401 | |||
| 2309 | Ga0265338_10004125 | |||
| 2310 | Ga0265338_10035290 | |||
| 2311 | Ga0265338_10047348 | |||
| 2312 | Ga0265338_10431349 | |||
| 2313 | Ga0265338_10459625 | |||
| 2314 | Ga0311000_122265 | |||
| 2315 | Ga0311000_129387 | |||
| 2316 | Ga0311008_126459 | |||
| 2317 | Ga0311011_109112 | |||
| 2318 | Ga0311003_174330 | |||
| 2319 | Ga0310982_141133 | |||
| 2320 | Ga0310982_144591 | |||
| 2321 | Ga0265324_10030792 | |||
| 2322 | Ga0265324_10315219 | |||
| 2323 | Ga0237817_10115 | |||
| 2324 | Ga0268256_1000773 | |||
| 2325 | Ga0265762_1138664 | |||
| 2326 | Ga0265763_1003385 | |||
| 2327 | Ga0265766_1000542 | |||
| 2328 | Ga0265770_1115253 | |||
| 2329 | Ga0265776_101371 | |||
| 2330 | Ga0265768_101141 | |||
| 2331 | Ga0265773_1017950 | |||
| 2332 | Ga0265760_10112585 | |||
| 2333 | Ga0265760_10265096 | |||
| 2334 | Ga0265330_10000477 | |||
| 2335 | Ga0265330_10058036 | |||
| 2336 | Ga0265330_10072295 | |||
| 2337 | Ga0265330_10079798 | |||
| 2338 | Ga0265330_10098418 | |||
| 2339 | Ga0265330_10149159 | |||
| 2340 | Ga0265330_10156967 | |||
| 2341 | Ga0265332_10136639 | |||
| 2342 | Ga0265332_10235545 | |||
| 2343 | Ga0265332_10248435 | |||
| 2344 | Ga0265328_10008680 | |||
| 2345 | Ga0265328_10024645 | |||
| 2346 | Ga0265328_10035367 | |||
| 2347 | Ga0265320_10130533 | |||
| 2348 | Ga0265320_10177775 | |||
| 2349 | Ga0265320_10445431 | |||
| 2350 | Ga0265320_10545725 | |||
| 2351 | Ga0265325_10003065 | |||
| 2352 | Ga0265325_10012258 | |||
| 2353 | Ga0265325_10049305 | |||
| 2354 | Ga0265325_10170027 | |||
| 2355 | Ga0265325_10295415 | |||
| 2356 | Ga0265340_10010369 | |||
| 2357 | Ga0265340_10019409 | |||
| 2358 | Ga0265340_10049224 | |||
| 2359 | Ga0265340_10346071 | |||
| 2360 | Ga0265340_10429413 | |||
| 2361 | Ga0265339_10000029 | |||
| 2362 | Ga0265339_10000921 | |||
| 2363 | Ga0265339_10021757 | |||
| 2364 | Ga0265339_10021831 | |||
| 2365 | Ga0265339_10048938 | |||
| 2366 | Ga0265339_10078311 | |||
| 2367 | Ga0265339_10140738 | |||
| 2368 | Ga0265339_10172672 | |||
| 2369 | Ga0265331_10023806 | |||
| 2370 | Ga0265327_10330699 | |||
| 2371 | Ga0265316_10006934 | |||
| 2372 | Ga0265316_10007872 | |||
| 2373 | Ga0265316_10013957 | |||
| 2374 | Ga0265316_10015244 | |||
| 2375 | Ga0265316_10030435 | |||
| 2376 | Ga0265316_10033589 | |||
| 2377 | Ga0265316_10039682 | |||
| 2378 | Ga0265316_10165624 | |||
| 2379 | Ga0265316_10180534 | |||
| 2380 | Ga0265316_10260504 | |||
| 2381 | Ga0265316_10301472 | |||
| 2382 | Ga0265316_10344478 | |||
| 2383 | Ga0265316_10507230 | |||
| 2384 | Ga0265316_10782106 | |||
| 2385 | Ga0265316_10936993 | |||
| 2386 | Ga0307408_100003263 | |||
| 2387 | Ga0307408_100021999 | |||
| 2388 | Ga0307408_100125708 | |||
| 2389 | Ga0307408_101718723 | |||
| 2390 | Ga0265313_10016184 | |||
| 2391 | Ga0265313_10034221 | |||
| 2392 | Ga0265313_10050332 | |||
| 2393 | Ga0265313_10070860 | |||
| 2394 | Ga0265314_10001691 | |||
| 2395 | Ga0265314_10019867 | |||
| 2396 | Ga0265314_10041833 | |||
| 2397 | Ga0265314_10073151 | |||
| 2398 | Ga0265314_10585754 | |||
| 2399 | Ga0265342_10000307 | |||
| 2400 | Ga0265342_10008915 | |||
| 2401 | Ga0265342_10011411 | |||
| 2402 | Ga0265342_10023693 | |||
| 2403 | Ga0265342_10054842 | |||
| 2404 | Ga0265342_10056084 | |||
| 2405 | Ga0265342_10068984 | |||
| 2406 | Ga0265342_10080695 | |||
| 2407 | Ga0265342_10113043 | |||
| 2408 | Ga0265342_10282902 | |||
| 2409 | Ga0265342_10550085 | |||
| 2410 | Ga0316578_10262150 | |||
| 2411 | Ga0316577_10586530 | |||
| 2412 | Ga0307413_10512676 | |||
| 2413 | Ga0307410_10091988 | |||
| 2414 | Ga0307407_10623276 | |||
| 2415 | Ga0307412_10020619 | |||
| 2416 | Ga0307409_100002336 | |||
| 2417 | Ga0307409_100007174 | |||
| 2418 | Ga0307409_100822098 | |||
| 2419 | Ga0307416_100007104 | |||
| 2420 | Ga0307416_100170833 | |||
| 2421 | Ga0307416_100203113 | |||
| 2422 | Ga0307416_101860606 | |||
| 2423 | Ga0307415_101082758 | |||
| 2424 | Ga0307415_102023252 | |||
| 2425 | Ga0316596_1068366 | |||
| 2426 | Ga0316215_1000833 | |||
| 2427 | Ga0373929_0241408 | |||
| 2428 | Ga0373934_0357625 | |||
| 2429 | Ga0373940_0294540 | |||
| 2430 | Ga0373923_0264395 | |||
| 2431 | Ga0373953_0240072 | |||
| 2432 | Ga0373954_0027849 | |||
| 2433 | Ga0373956_0490424 | |||
| 2434 | Ga0373957_0473770 | |||
| 2435 | Ga0373943_0517005 | |||
| 2436 | Ga0373955_0131727 | |||
| 2437 | Ga0373955_0352630 | |||
| 2438 | Ga0373961_0061503 | |||
| 2439 | Ga0373931_0020821 | |||
| 2440 | Ga0373931_0496784 | |||
| 2441 | Ga0373935_1187046 | |||
| 2442 | Ga0373935_1377227 | |||
| 2443 | Ga0373933_0041165 | |||
| 2444 | Ga0373933_0323080 | |||
| 2445 | Ga0373937_0027753 | |||
| 2446 | Ga0373937_0049903 | |||
| 2447 | Ga0373937_0351741 | |||
| 2448 | Ga0373937_1060536 | |||
| 2449 | Ga0373937_1136810 | |||
| 2450 | Ga0265778_051585 | |||
| 2451 | Ga0316584_0008199 | |||
| 2452 | Ga0316584_0153084 | |||
| 2453 | Ga0373925_1406404 | |||
| 2454 | Ga0395899_0203176 | |||
| 2455 | Ga0395899_0270279 | |||
| 2456 | Ga0395899_0387442 | |||
| 2457 | Ga0395900_0234286 | |||
| 2458 | Ga0395900_0411933 | |||
| 2459 | Ga0395900_1547859 | |||
| 2460 | Ga0395898_0428885 | |||
| 2461 | Ga0395898_0582816 | |||
| 2462 | Ga0395898_0775795 | |||
| 2463 | Ga0395898_0851716 | |||
| 2464 | Ga0395898_1223796 | |||
| 2465 | Ga0395905_0573972 | |||
| 2466 | Ga0395901_0624307 | |||
| 2467 | Ga0395901_0962277 | |||
| 2468 | Ga0395901_1417306 | |||
| 2469 | Ga0237819_00239 | |||
| 2470 | Ga0436365_0559080 | |||
| 2471 | Ga0436365_1532164 | |||
| 2472 | Ga0436360_0240674 | |||
| 2473 | Ga0436360_0343285 | |||
| 2474 | Ga0436363_0991670 | |||
| 2475 | Ga0436363_1358816 | |||
| 2476 | Ga0436362_0143704 | |||
| 2477 | Ga0439436_0002304 | |||
| 2478 | Ga0439439_0000103 | |||
| 2479 | Ga0439439_0003260 | |||
| 2480 | Ga0439453_0114324 | |||
| 2481 | Ga0451855_0403959 | |||
| 2482 | Ga0451855_0452095 | |||
| 2483 | Ga0451855_0548201 | |||
| 2484 | Ga0451853_1007767 | |||
| 2485 | Ga0439433_0002523 | |||
| 2486 | Ga0439433_0005396 | |||
| 2487 | Ga0439433_0217922 | |||
| 2488 | Ga0439449_0000074 | |||
| 2489 | Ga0439449_0006536 | |||
| 2490 | Ga0439457_013262 | |||
| 2491 | Ga0439462_0004039 | |||
| 2492 | Ga0439462_0008776 | |||
| 2493 | Ga0450906_043496 | |||
| 2494 | Ga0466969_0001060 | |||
| 2495 | Ga0466972_0077452 | |||
| 2496 | Ga0466965_0125423 | |||
| 2497 | Ga0466966_0298382 | |||
| 2498 | Ga0466963_0003181 | |||
| 2499 | Ga0466963_0767058 | |||
| 2500 | Ga0466963_1308113 | |||
| 2501 | Ga0466968_0002977 | |||
| 2502 | Ga0466970_0031453 | |||
| 2503 | Ga0466970_0224164 | |||
| 2504 | Ga0466957_0691587 | |||
| 2505 | Ga0466957_0991121 | |||
| 2506 | Ga0466957_1077645 | |||
| 2507 | Ga0466959_0186586 | |||
| 2508 | Ga0466958_0031906 | |||
| 2509 | Ga0466958_0837702 | |||
| 2510 | Ga0466967_0000327 | |||
| 2511 | Ga0466967_0140642 | |||
| 2512 | Ga0466967_1023902 | |||
| 2513 | Ga0466967_1031363 | |||
| 2514 | Ga0495627_018408 | |||
| 2515 | Ga0495627_040568 | |||
| 2516 | Ga0495592_0276481 | |||
| 2517 | Ga0495603_0005187 | |||
| 2518 | Ga0495590_0042229 | |||
| 2519 | Ga0495590_0131097 | |||
| 2520 | Ga0495590_0226889 | |||
| 2521 | Ga0495591_028162 | |||
| 2522 | Ga0495591_096034 | |||
| 2523 | Ga0495629_0072119 | |||
| 2524 | Ga0495651_0917238 | |||
| 2525 | Ga0495580_0083130 | |||
| 2526 | Ga0495580_0198771 | |||
| 2527 | Ga0495582_0106361 | |||
| 2528 | Ga0495582_0499130 | |||
| 2529 | Ga0495605_0025905 | |||
| 2530 | Ga0495605_0075252 | |||
| 2531 | Ga0495639_0023957 | |||
| 2532 | Ga0495584_0024667 | |||
| 2533 | Ga0495584_0209109 | |||
| 2534 | Ga0495585_0001321 | |||
| 2535 | Ga0495607_0038465 | |||
| 2536 | Ga0495607_0161401 | |||
| 2537 | Ga0495606_0035724 | |||
| 2538 | Ga0495606_0093700 | |||
| 2539 | Ga0495606_0269138 | |||
| 2540 | Ga0495608_0322977 | |||
| 2541 | Ga0495608_0584883 | |||
| 2542 | Ga0495608_0921658 | |||
| 2543 | Ga0495610_0204571 | |||
| 2544 | Ga0495618_0747651 | |||
| 2545 | Ga0495620_0023267 | |||
| 2546 | Ga0495628_0161928 | |||
| 2547 | Ga0495630_0738023 | |||
| 2548 | Ga0495630_0769949 | |||
| 2549 | Ga0495637_0088472 | |||
| 2550 | Ga0495637_0142359 | |||
| 2551 | Ga0495637_0174808 | |||
| 2552 | Ga0495643_0031759 | |||
| 2553 | Ga0495652_0026891 | |||
| 2554 | Ga0495654_0015505 | |||
| 2555 | Ga0495654_0251932 | |||
| 2556 | Ga0495665_0073755 | |||
| 2557 | Ga0495586_0129583 | |||
| 2558 | Ga0495587_0047822 | |||
| 2559 | Ga0495609_0055641 | |||
| 2560 | Ga0495621_0479869 | |||
| 2561 | Ga0495597_0091528 | |||
| 2562 | Ga0495645_0046981 | |||
| 2563 | Ga0495645_0347104 | |||
| 2564 | Ga0495622_0027467 | |||
| 2565 | Ga0495622_0064067 | |||
| 2566 | Ga0495633_0027955 | |||
| 2567 | Ga0495633_0065769 | |||
| 2568 | Ga0495667_0312819 | |||
| 2569 | Ga0495668_0044828 | |||
| 2570 | Ga0495634_0101729 | |||
| 2571 | Ga0495611_0078881 | |||
| 2572 | Ga0495635_0209063 | |||
| 2573 | Ga0495661_0013338 | |||
| 2574 | Ga0495661_0020024 | |||
| 2575 | Ga0495661_0085148 | |||
| 2576 | Ga0495661_0455518 | |||
| 2577 | Ga0495588_0044206 | |||
| 2578 | Ga0495657_0376623 | |||
| 2579 | Ga0495599_0059726 | |||
| 2580 | Ga0495623_0130813 | |||
| 2581 | Ga0495623_0332872 | |||
| 2582 | Ga0495623_0609679 | |||
| 2583 | Ga0495646_0516509 | |||
| 2584 | Ga0495647_0294951 | |||
| 2585 | Ga0495658_0882969 | |||
| 2586 | Ga0495669_0069731 | |||
| 2587 | Ga0495613_0342299 | |||
| 2588 | Ga0495613_0403249 | |||
| 2589 | Ga0495613_0687720 | |||
| 2590 | Ga0495670_0045580 | |||
| 2591 | Ga0495670_0172272 | |||
| 2592 | Ga0495670_0243336 | |||
| 2593 | Ga0495649_0030798 | |||
| 2594 | Ga0495649_0083659 | |||
| 2595 | Ga0495649_0278784 | |||
| 2596 | Ga0495649_0588002 | |||
| 2597 | Ga0495589_0076252 | |||
| 2598 | Ga0495589_0107725 | |||
| 2599 | Ga0495600_0154968 | |||
| 2600 | Ga0495660_0004825 | |||
| 2601 | Ga0495660_0017884 | |||
| 2602 | Ga0495581_0054294 | |||
| 2603 | Ga0495604_0266968 | |||
| 2604 | Ga0495636_0136155 | |||
| 2605 | Ga0495636_0456330 | |||
| 2606 | Ga0495676_0052043 | |||
| 2607 | Ga0495676_0133814 | |||
| 2608 | Ga0495680_0347683 | |||
| 2609 | Ga0495683_0005075 | |||
| 2610 | Ga0495687_033682 | |||
| 2611 | Ga0495675_0253268 | |||
| 2612 | Ga0495681_0048530 | |||
| 2613 | Ga0495681_0101906 | |||
| 2614 | Ga0495684_0269316 | |||
| 2615 | Ga0495686_0000545 | |||
| 2616 | Ga0495686_0012601 | |||
| 2617 | Ga0495686_0152425 | |||
| 2618 | Ga0495686_0230526 | |||
| 2619 | Ga0495602_0206155 | |||
| 2620 | Ga0495602_0415439 | |||
| 2621 | Ga0495626_0006526 | |||
| 2622 | Ga0495626_0133338 | |||
| 2623 | Ga0496100_0001314 | |||
| 2624 | Ga0496100_0133827 | |||
| 2625 | Ga0496100_0284782 | |||
| 2626 | Ga0496100_0679634 | |||
| 2627 | Ga0496100_1033025 | |||
| 2628 | Ga0496101_0000972 | |||
| 2629 | Ga0496101_0088730 | |||
| 2630 | Ga0496101_0907534 | |||
| 2631 | Ga0496101_1081780 | |||
| 2632 | Ga0496101_1364296 | |||
| 2633 | Ga0496102_0002206 | |||
| 2634 | Ga0496102_0011196 | |||
| 2635 | Ga0496102_0099351 | |||
| 2636 | Ga0496102_0629539 | |||
| 2637 | Ga0496102_0704145 | |||
| 2638 | Ga0496102_0852601 | |||
| 2639 | Ga0496103_0001955 | |||
| 2640 | Ga0496103_0047911 | |||
| 2641 | Ga0496103_0276565 | |||
| 2642 | Ga0496103_0883260 | |||
| 2643 | Ga0496104_0001658 | |||
| 2644 | Ga0496104_0005618 | |||
| 2645 | Ga0496104_0166573 | |||
| 2646 | Ga0496104_0208553 | |||
| 2647 | Ga0496104_0305470 | |||
| 2648 | Ga0496104_0308297 | |||
| 2649 | Ga0496104_0348085 | |||
| 2650 | Ga0496105_0002080 | |||
| 2651 | Ga0496105_0317361 | |||
| 2652 | Ga0496105_0509692 | |||
| 2653 | Ga0496105_0605966 | |||
| 2654 | Ga0496106_0002267 | |||
| 2655 | Ga0496106_0649413 | |||
| 2656 | Ga0496107_0003223 | |||
| 2657 | Ga0496107_0058466 | |||
| 2658 | Ga0496107_0215509 | |||
| 2659 | Ga0496107_0313297 | |||
| 2660 | Ga0496107_0370851 | |||
| 2661 | Ga0496107_1316712 | |||
| 2662 | Ga0496108_0000443 | |||
| 2663 | Ga0496108_1067083 | |||
| 2664 | Ga0496108_1279353 | |||
| 2665 | Ga0496109_0000778 | |||
| 2666 | Ga0496109_0087437 | |||
| 2667 | Ga0496109_0367538 | |||
| 2668 | Ga0496110_0001837 | |||
| 2669 | Ga0496110_0003743 | |||
| 2670 | Ga0496110_0016232 | |||
| 2671 | Ga0496110_0031404 | |||
| 2672 | Ga0496110_0311758 | |||
| 2673 | Ga0496110_0419582 | |||
| 2674 | Ga0496110_0774598 | |||
| 2675 | Ga0496111_0000191 | |||
| 2676 | Ga0496111_0005358 | |||
| 2677 | Ga0496111_0061966 | |||
| 2678 | Ga0496111_0600530 | |||
| 2679 | Ga0496111_0896146 | |||
| 2680 | Ga0496112_0007183 | |||
| 2681 | Ga0496112_0264091 | |||
| 2682 | Ga0496112_1292253 | |||
| 2683 | Ga0496112_1365161 | |||
| 2684 | Ga0496113_0001361 | |||
| 2685 | Ga0496113_0413632 | |||
| 2686 | Ga0496113_1509949 | |||
| 2687 | Ga0496114_0298516 | |||
| 2688 | Ga0496114_0738336 | |||
| 2689 | Ga0496115_0056383 | |||
| 2690 | Ga0496115_0149438 | |||
| 2691 | Ga0496115_0194088 | |||
| 2692 | Ga0496115_0303564 | |||
| 2693 | Ga0496115_1322984 | |||
| 2694 | Ga0496116_0007551 | |||
| 2695 | Ga0496116_0012406 | |||
| 2696 | Ga0496116_0012853 | |||
| 2697 | Ga0496116_0014267 | |||
| 2698 | Ga0496116_0017257 | |||
| 2699 | Ga0496116_0057218 | |||
| 2700 | Ga0496116_0064776 | |||
| 2701 | Ga0496117_0005823 | |||
| 2702 | Ga0496117_0016085 | |||
| 2703 | Ga0496118_0012842 | |||
| 2704 | Ga0496118_0144058 | |||
| 2705 | Ga0496119_0000469 | |||
| 2706 | Ga0496119_0003362 | |||
| 2707 | Ga0496119_0006713 | |||
| 2708 | Ga0496119_0547553 | |||
| 2709 | Ga0496120_0001942 | |||
| 2710 | Ga0496120_0035325 | |||
| 2711 | Ga0496120_0102753 | |||
| 2712 | Ga0496121_0045806 | |||
| 2713 | Ga0496121_0108049 | |||
| 2714 | Ga0496121_0150400 | |||
| 2715 | Ga0496121_0219653 | |||
| 2716 | Ga0496121_0426928 | |||
| 2717 | Ga0496121_0436053 | |||
| 2718 | Ga0496122_0006458 | |||
| 2719 | Ga0496122_0007540 | |||
| 2720 | Ga0496122_0028610 | |||
| 2721 | Ga0496122_0031689 | |||
| 2722 | Ga0496122_0051949 | |||
| 2723 | Ga0496122_0057163 | |||
| 2724 | Ga0496122_0075908 | |||
| 2725 | Ga0496122_0083192 | |||
| 2726 | Ga0496122_0199829 | |||
| 2727 | Ga0496122_0459341 | |||
| 2728 | Ga0496122_0495917 | |||
| 2729 | Ga0496123_0004233 | |||
| 2730 | Ga0496123_0009386 | |||
| 2731 | Ga0496123_0010929 | |||
| 2732 | Ga0496123_0023113 | |||
| 2733 | Ga0496123_0126496 | |||
| 2734 | Ga0496124_0000697 | |||
| 2735 | Ga0496124_0001155 | |||
| 2736 | Ga0496124_0012311 | |||
| 2737 | Ga0496124_0022419 | |||
| 2738 | Ga0496124_0162139 | |||
| 2739 | Ga0496125_0001385 | |||
| 2740 | Ga0496125_0001389 | |||
| 2741 | Ga0496125_0006886 | |||
| 2742 | Ga0496125_0059770 | |||
| 2743 | Ga0496125_0253782 | |||
| 2744 | Ga0496125_0531426 | |||
| 2745 | Ga0496126_0000005 | |||
| 2746 | Ga0496126_0008264 | |||
| 2747 | Ga0496126_0059816 | |||
| 2748 | Ga0496126_0125265 | |||
| 2749 | Ga0496126_0508493 | |||
| 2750 | Ga0496126_0577285 | |||
| 2751 | Ga0496126_1118387 | |||
| 2752 | Ga0501306_000002 | |||
| 2753 | Ga0501306_000030 | |||
| 2754 | Ga0501306_000071 | |||
| 2755 | Ga0501306_000079 | |||
| 2756 | Ga0501306_000138 | |||
| 2757 | Ga0501306_000200 | |||
| 2758 | Ga0501306_003109 | |||
| 2759 | Ga0501306_003694 | |||
| 2760 | Ga0501306_003974 | |||
| 2761 | Ga0501306_004132 | |||
| 2762 | Ga0501306_005368 | |||
| 2763 | Ga0501306_006747 | |||
| 2764 | Ga0501306_021343 | |||
| 2765 | Ga0501306_025599 | |||
| 2766 | Ga0501306_096613 | |||
| 2767 | Ga0501308_000057 | |||
| 2768 | Ga0501308_000086 | |||
| 2769 | Ga0501308_000106 | |||
| 2770 | Ga0501308_000127 | |||
| 2771 | Ga0501308_000694 | |||
| 2772 | Ga0501308_000735 | |||
| 2773 | Ga0501308_003239 | |||
| 2774 | Ga0501308_011238 | |||
| 2775 | Ga0501308_028028 | |||
| 2776 | Ga0501309_000001 | |||
| 2777 | Ga0501309_000144 | |||
| 2778 | Ga0501309_000417 | |||
| 2779 | Ga0501309_001669 | |||
| 2780 | Ga0501309_003421 | |||
| 2781 | Ga0501309_004736 | |||
| 2782 | Ga0501309_020612 | |||
| 2783 | Ga0501310_000312 | |||
| 2784 | Ga0501310_000940 | |||
| 2785 | Ga0501310_002051 | |||
| 2786 | Ga0501310_003009 | |||
| 2787 | Ga0501310_003439 | |||
| 2788 | Ga0501310_003997 | |||
| 2789 | Ga0501310_017305 | |||
| 2790 | Ga0501310_019702 | |||
| 2791 | Ga0501310_043872 | |||
| 2792 | Ga0501341_00014 | |||
| 2793 | Ga0501341_00024 | |||
| 2794 | Ga0501341_00076 | |||
| 2795 | Ga0501341_00193 | |||
| 2796 | Ga0501341_00222 | |||
| 2797 | Ga0501341_01598 | |||
| 2798 | Ga0501343_000098 | |||
| 2799 | Ga0501343_000383 | |||
| 2800 | Ga0501343_000392 | |||
| 2801 | Ga0501343_000491 | |||
| 2802 | Ga0501343_000591 | |||
| 2803 | Ga0501343_000794 | |||
| 2804 | Ga0501343_001442 | |||
| 2805 | Ga0501343_001896 | |||
| 2806 | Ga0501343_002494 | |||
| 2807 | Ga0501343_004576 | |||
| 2808 | Ga0501343_008265 | |||
| 2809 | Ga0501343_012006 | |||
| 2810 | Ga0501344_00011 | |||
| 2811 | Ga0501344_00013 | |||
| 2812 | Ga0501344_00016 | |||
| 2813 | Ga0501344_00060 | |||
| 2814 | Ga0501344_00166 | |||
| 2815 | Ga0501344_00605 | |||
| 2816 | Ga0501344_00857 | |||
| 2817 | Ga0501344_01780 | |||
| 2818 | Ga0501345_00004 | |||
| 2819 | Ga0501345_00405 | |||
| 2820 | Ga0501345_02481 | |||
| 2821 | Ga0501304_000046 | |||
| 2822 | Ga0501304_000047 | |||
| 2823 | Ga0501304_000119 | |||
| 2824 | Ga0501304_000494 | |||
| 2825 | Ga0501304_002674 | |||
| 2826 | Ga0501304_002783 | |||
| 2827 | Ga0501305_000003 | |||
| 2828 | Ga0501305_000005 | |||
| 2829 | Ga0501305_000007 | |||
| 2830 | Ga0501305_000135 | |||
| 2831 | Ga0501305_000838 | |||
| 2832 | Ga0501305_001024 | |||
| 2833 | Ga0501305_001780 | |||
| 2834 | Ga0501305_002856 | |||
| 2835 | Ga0501305_003944 | |||
| 2836 | Ga0501305_030135 | |||
| 2837 | Ga0501305_033886 | |||
| 2838 | Ga0501305_046588 | |||
| 2839 | Ga0501305_087126 | |||
| 2840 | Ga0501307_000002 | |||
| 2841 | Ga0501307_000008 | |||
| 2842 | Ga0501307_000011 | |||
| 2843 | Ga0501307_000049 | |||
| 2844 | Ga0501307_000155 | |||
| 2845 | Ga0501307_000338 | |||
| 2846 | Ga0501307_000603 | |||
| 2847 | Ga0501307_000770 | |||
| 2848 | Ga0501307_004127 | |||
| 2849 | Ga0501307_008353 | |||
| 2850 | Ga0501307_026040 | |||
| 2851 | Ga0501342_00056 | |||
| 2852 | Ga0501342_00155 | |||
| 2853 | Ga0501342_00181 | |||
| 2854 | Ga0501342_03148 | |||
| 2855 | Ga0495682_0075125 | |||
| 2856 | Ga0495682_0213792 | |||
| 2857 | Ga0501290_005720 | |||
| 2858 | Ga0501291_048567 | |||
| 2859 | Ga0501295_018328 | |||
| 2860 | Ga0501299_084095 | |||
| 2861 | Ga0501300_006882 | |||
| 2862 | Ga0501311_000001 | |||
| 2863 | Ga0501311_000006 | |||
| 2864 | Ga0501311_000029 | |||
| 2865 | Ga0501311_000061 | |||
| 2866 | Ga0501311_000124 | |||
| 2867 | Ga0501311_000152 | |||
| 2868 | Ga0501311_000226 | |||
| 2869 | Ga0501311_000359 | |||
| 2870 | Ga0501311_005953 | |||
| 2871 | Ga0501311_009822 | |||
| 2872 | Ga0501311_031246 | |||
| 2873 | Ga0501311_073433 | |||
| 2874 | Ga0501312_000002 | |||
| 2875 | Ga0501312_000004 | |||
| 2876 | Ga0501312_000005 | |||
| 2877 | Ga0501312_000019 | |||
| 2878 | Ga0501312_000056 | |||
| 2879 | Ga0501312_000171 | |||
| 2880 | Ga0501312_000289 | |||
| 2881 | Ga0501312_000439 | |||
| 2882 | Ga0501312_000739 | |||
| 2883 | Ga0501312_001758 | |||
| 2884 | Ga0501312_009171 | |||
| 2885 | Ga0501312_009722 | |||
| 2886 | Ga0501312_033896 | |||
| 2887 | Ga0501312_047192 | |||
| 2888 | Ga0501312_085805 | |||
| 2889 | Ga0501312_120533 | |||
| 2890 | Ga0501313_000001 | |||
| 2891 | Ga0501313_000003 | |||
| 2892 | Ga0501313_000034 | |||
| 2893 | Ga0501313_000081 | |||
| 2894 | Ga0501313_000101 | |||
| 2895 | Ga0501313_000156 | |||
| 2896 | Ga0501313_000177 | |||
| 2897 | Ga0501313_000360 | |||
| 2898 | Ga0501313_000781 | |||
| 2899 | Ga0501313_002469 | |||
| 2900 | Ga0501313_009688 | |||
| 2901 | Ga0501313_066252 | |||
| 2902 | Ga0501314_000067 | |||
| 2903 | Ga0501314_000087 | |||
| 2904 | Ga0501314_000447 | |||
| 2905 | Ga0501314_000773 | |||
| 2906 | Ga0501314_000973 | |||
| 2907 | Ga0501314_002612 | |||
| 2908 | Ga0501314_002668 | |||
| 2909 | Ga0501314_011785 | |||
| 2910 | Ga0501314_025086 | |||
| 2911 | Ga0501315_000001 | |||
| 2912 | Ga0501315_000002 | |||
| 2913 | Ga0501315_000006 | |||
| 2914 | Ga0501315_000069 | |||
| 2915 | Ga0501315_000072 | |||
| 2916 | Ga0501315_000123 | |||
| 2917 | Ga0501315_004000 | |||
| 2918 | Ga0501315_004080 | |||
| 2919 | Ga0501315_006378 | |||
| 2920 | Ga0501315_009053 | |||
| 2921 | Ga0501315_009362 | |||
| 2922 | Ga0501315_013906 | |||
| 2923 | Ga0501315_019745 | |||
| 2924 | Ga0501315_022770 | |||
| 2925 | Ga0501315_034859 | |||
| 2926 | Ga0501316_000001 | |||
| 2927 | Ga0501316_000045 | |||
| 2928 | Ga0501316_000072 | |||
| 2929 | Ga0501316_000081 | |||
| 2930 | Ga0501316_000137 | |||
| 2931 | Ga0501316_000268 | |||
| 2932 | Ga0501316_002234 | |||
| 2933 | Ga0501316_002272 | |||
| 2934 | Ga0501316_003240 | |||
| 2935 | Ga0501316_004064 | |||
| 2936 | Ga0501316_005266 | |||
| 2937 | Ga0501316_008561 | |||
| 2938 | Ga0501316_023237 | |||
| 2939 | Ga0501316_026938 | |||
| 2940 | Ga0501316_032052 | |||
| 2941 | Ga0501316_037393 | |||
| 2942 | Ga0501317_000001 | |||
| 2943 | Ga0501317_000003 | |||
| 2944 | Ga0501317_000202 | |||
| 2945 | Ga0501317_000414 | |||
| 2946 | Ga0501317_000954 | |||
| 2947 | Ga0501317_001025 | |||
| 2948 | Ga0501317_002411 | |||
| 2949 | Ga0501317_003838 | |||
| 2950 | Ga0501317_005267 | |||
| 2951 | Ga0501317_007181 | |||
| 2952 | Ga0501317_026345 | |||
| 2953 | Ga0501317_030482 | |||
| 2954 | Ga0501317_031804 | |||
| 2955 | Ga0501317_043089 | |||
| 2956 | Ga0501318_000003 | |||
| 2957 | Ga0501318_000052 | |||
| 2958 | Ga0501318_000116 | |||
| 2959 | Ga0501318_000386 | |||
| 2960 | Ga0501318_002401 | |||
| 2961 | Ga0501318_002638 | |||
| 2962 | Ga0501318_003615 | |||
| 2963 | Ga0501318_005761 | |||
| 2964 | Ga0501318_009165 | |||
| 2965 | Ga0501318_011919 | |||
| 2966 | Ga0501318_020816 | |||
| 2967 | Ga0501318_081964 | |||
| 2968 | Ga0501319_000003 | |||
| 2969 | Ga0501319_000033 | |||
| 2970 | Ga0501319_000047 | |||
| 2971 | Ga0501319_000098 | |||
| 2972 | Ga0501319_000238 | |||
| 2973 | Ga0501319_000326 | |||
| 2974 | Ga0501319_000845 | |||
| 2975 | Ga0501319_002515 | |||
| 2976 | Ga0501319_003450 | |||
| 2977 | Ga0501320_000001 | |||
| 2978 | Ga0501320_000002 | |||
| 2979 | Ga0501320_000012 | |||
| 2980 | Ga0501320_000063 | |||
| 2981 | Ga0501320_000070 | |||
| 2982 | Ga0501320_000071 | |||
| 2983 | Ga0501320_000079 | |||
| 2984 | Ga0501320_000092 | |||
| 2985 | Ga0501320_001821 | |||
| 2986 | Ga0501320_005312 | |||
| 2987 | Ga0501320_025684 | |||
| 2988 | Ga0501321_000002 | |||
| 2989 | Ga0501321_000023 | |||
| 2990 | Ga0501321_000066 | |||
| 2991 | Ga0501321_000083 | |||
| 2992 | Ga0501321_000088 | |||
| 2993 | Ga0501321_000089 | |||
| 2994 | Ga0501321_000092 | |||
| 2995 | Ga0501321_000225 | |||
| 2996 | Ga0501321_002044 | |||
| 2997 | Ga0501321_004287 | |||
| 2998 | Ga0501321_009246 | |||
| 2999 | Ga0501321_018443 | |||
| 3000 | Ga0501321_025183 | |||
| 3001 | Ga0501321_069210 | |||
| 3002 | Ga0501321_085769 | |||
| 3003 | Ga0501322_000007 | |||
| 3004 | Ga0501322_000024 | |||
| 3005 | Ga0501322_000043 | |||
| 3006 | Ga0501322_000335 | |||
| 3007 | Ga0501322_000404 | |||
| 3008 | Ga0501322_003380 | |||
| 3009 | Ga0501322_006340 | |||
| 3010 | Ga0501322_007924 | |||
| 3011 | Ga0501323_000005 | |||
| 3012 | Ga0501323_000091 | |||
| 3013 | Ga0501323_000116 | |||
| 3014 | Ga0501323_000294 | |||
| 3015 | Ga0501323_000308 | |||
| 3016 | Ga0501323_000825 | |||
| 3017 | Ga0501323_002710 | |||
| 3018 | Ga0501323_004989 | |||
| 3019 | Ga0501323_023914 | |||
| 3020 | Ga0501323_026259 | |||
| 3021 | Ga0501323_033552 | |||
| 3022 | Ga0501323_059398 | |||
| 3023 | Ga0501324_000001 | |||
| 3024 | Ga0501324_000003 | |||
| 3025 | Ga0501324_000076 | |||
| 3026 | Ga0501324_000141 | |||
| 3027 | Ga0501324_000153 | |||
| 3028 | Ga0501324_000373 | |||
| 3029 | Ga0501324_000408 | |||
| 3030 | Ga0501324_002064 | |||
| 3031 | Ga0501324_002534 | |||
| 3032 | Ga0501324_003211 | |||
| 3033 | Ga0501324_011962 | |||
| 3034 | Ga0501324_016729 | |||
| 3035 | Ga0501324_025677 | |||
| 3036 | Ga0501325_000006 | |||
| 3037 | Ga0501325_010003 | |||
| 3038 | Ga0501325_047372 | |||
| 3039 | Ga0501326_00006 | |||
| 3040 | Ga0501326_00033 | |||
| 3041 | Ga0501326_00045 | |||
| 3042 | Ga0501326_00113 | |||
| 3043 | Ga0501326_00177 | |||
| 3044 | Ga0501326_00291 | |||
| 3045 | Ga0501326_03359 | |||
| 3046 | Ga0501327_00035 | |||
| 3047 | Ga0501327_00036 | |||
| 3048 | Ga0501327_00038 | |||
| 3049 | Ga0501327_00062 | |||
| 3050 | Ga0501327_00389 | |||
| 3051 | Ga0501327_03039 | |||
| 3052 | Ga0501327_05531 | |||
| 3053 | Ga0501327_07490 | |||
| 3054 | Ga0501328_00011 | |||
| 3055 | Ga0501328_00014 | |||
| 3056 | Ga0501328_00064 | |||
| 3057 | Ga0501328_00078 | |||
| 3058 | Ga0501328_00270 | |||
| 3059 | Ga0501328_00524 | |||
| 3060 | Ga0501328_00940 | |||
| 3061 | Ga0501328_05377 | |||
| 3062 | Ga0501329_00109 | |||
| 3063 | Ga0501329_00157 | |||
| 3064 | Ga0501329_00619 | |||
| 3065 | Ga0501329_00684 | |||
| 3066 | Ga0501329_03934 | |||
| 3067 | Ga0501330_000009 | |||
| 3068 | Ga0501330_000038 | |||
| 3069 | Ga0501330_000049 | |||
| 3070 | Ga0501330_000139 | |||
| 3071 | Ga0501330_000148 | |||
| 3072 | Ga0501330_000288 | |||
| 3073 | Ga0501330_000341 | |||
| 3074 | Ga0501330_004276 | |||
| 3075 | Ga0501330_010335 | |||
| 3076 | Ga0501331_00009 | |||
| 3077 | Ga0501331_00023 | |||
| 3078 | Ga0501331_00073 | |||
| 3079 | Ga0501331_00179 | |||
| 3080 | Ga0501331_04401 | |||
| 3081 | Ga0501331_04852 | |||
| 3082 | Ga0501331_07867 | |||
| 3083 | Ga0501332_00052 | |||
| 3084 | Ga0501332_00070 | |||
| 3085 | Ga0501332_00114 | |||
| 3086 | Ga0501332_00147 | |||
| 3087 | Ga0501332_00490 | |||
| 3088 | Ga0501332_00546 | |||
| 3089 | Ga0501332_00671 | |||
| 3090 | Ga0501332_01061 | |||
| 3091 | Ga0501332_07606 | |||
| 3092 | Ga0501332_12791 | |||
| 3093 | Ga0501333_000018 | |||
| 3094 | Ga0501333_000173 | |||
| 3095 | Ga0501333_001147 | |||
| 3096 | Ga0501333_001361 | |||
| 3097 | Ga0501333_001637 | |||
| 3098 | Ga0501333_006626 | |||
| 3099 | Ga0501333_018569 | |||
| 3100 | Ga0501334_00014 | |||
| 3101 | Ga0501334_00103 | |||
| 3102 | Ga0501334_00634 | |||
| 3103 | Ga0501334_00670 | |||
| 3104 | Ga0501334_00728 | |||
| 3105 | Ga0501334_05436 | |||
| 3106 | Ga0501334_06574 | |||
| 3107 | Ga0501335_000067 | |||
| 3108 | Ga0501335_000116 | |||
| 3109 | Ga0501335_000229 | |||
| 3110 | Ga0501335_000692 | |||
| 3111 | Ga0501335_001159 | |||
| 3112 | Ga0501335_001571 | |||
| 3113 | Ga0501335_002088 | |||
| 3114 | Ga0501335_003479 | |||
| 3115 | Ga0501335_003699 | |||
| 3116 | Ga0501335_019322 | |||
| 3117 | Ga0501335_037724 | |||
| 3118 | Ga0501335_037801 | |||
| 3119 | Ga0501336_000153 | |||
| 3120 | Ga0501336_000332 | |||
| 3121 | Ga0501336_000441 | |||
| 3122 | Ga0501336_000875 | |||
| 3123 | Ga0501336_008578 | |||
| 3124 | Ga0501336_015660 | |||
| 3125 | Ga0501336_024727 | |||
| 3126 | Ga0501337_000050 | |||
| 3127 | Ga0501337_000067 | |||
| 3128 | Ga0501337_000117 | |||
| 3129 | Ga0501337_000129 | |||
| 3130 | Ga0501337_000210 | |||
| 3131 | Ga0501337_000366 | |||
| 3132 | Ga0501337_000430 | |||
| 3133 | Ga0501337_000441 | |||
| 3134 | Ga0501337_001638 | |||
| 3135 | Ga0501337_002599 | |||
| 3136 | Ga0501337_003887 | |||
| 3137 | Ga0501338_00021 | |||
| 3138 | Ga0501338_00230 | |||
| 3139 | Ga0501338_00355 | |||
| 3140 | Ga0501338_00393 | |||
| 3141 | Ga0501338_00890 | |||
| 3142 | Ga0501338_01217 | |||
| 3143 | Ga0501338_01946 | |||
| 3144 | Ga0501338_10168 | |||
| 3145 | Ga0501339_00012 | |||
| 3146 | Ga0501339_00086 | |||
| 3147 | Ga0501339_00171 | |||
| 3148 | Ga0501340_000004 | |||
| 3149 | Ga0501340_000016 | |||
| 3150 | Ga0501340_000079 | |||
| 3151 | Ga0501340_001704 | |||
| 3152 | Ga0501036_1689582 | |||
| 3153 | Ga0501040_0507174 | |||
| 3154 | Ga0501041_0249557 | |||
| 3155 | Ga0501041_0883091 | |||
| 3156 | Ga0501069_0210701 | |||
| 3157 | Ga0501070_0119413 | |||
| 3158 | Ga0501071_0290387 | |||
| 3159 | Ga0501074_0192033 | |||
| 3160 | Ga0501202_022556 | |||
| 3161 | Ga0501216_070041 | |||
| 3162 | Ga0501217_012050 | |||
| 3163 | Ga0501217_015074 | |||
| 3164 | Ga0501217_287719 | |||
| 3165 | Ga0501217_343473 | |||
| 3166 | Ga0501224_053640 | |||
| 3167 | Ga0501227_012962 | |||
| 3168 | Ga0501228_002303 | |||
| 3169 | Ga0501230_097915 | |||
| 3170 | Ga0501233_007708 | |||
| 3171 | Ga0501233_145156 | |||
| 3172 | Ga0501243_022949 | |||
| 3173 | Ga0501252_020433 | |||
| 3174 | Ga0501252_081246 | |||
| 3175 | Ga0501260_023599 | |||
| 3176 | Ga0501221_089407 | |||
| 3177 | Ga0501225_0027148 | |||
| 3178 | Ga0501234_002810 | |||
| 3179 | Ga0501234_106616 | |||
| 3180 | Ga0501080_0504979 | |||
| 3181 | Ga0501083_0323354 | |||
| 3182 | Ga0501083_0827020 | |||
| 3183 | Ga0501232_007698 | |||
| 3184 | Ga0501265_069563 | |||
| 3185 | Ga0501266_006221 | |||
| 3186 | Ga0501270_012080 | |||
| 3187 | Ga0501271_044575 | |||
| 3188 | Ga0501283_084321 | |||
| 3189 | Ga0501212_018124 | |||
| 3190 | nmdc:mga00v17_210410_c1 | |||
| 3191 | nmdc:mga05p37_2088575_c1 | |||
| 3192 | nmdc:mga09592_810971_c1 | |||
| 3193 | Ga0495601_0280867 | |||
| 3194 | Ga0495612_0116498 | |||
| 3195 | Ga0495619_0209672 | |||
| 3196 | Ga0500559_0070899 | |||
| 3197 | Ga0501084_0281749 | |||
| 3198 | Ga0587084_000095 | |||
| 3199 | Ga0587084_012948 | |||
| 3200 | Ga0587084_045642 | |||
| 3201 | Ga0587066_094474 | |||
| 3202 | Ga0587070_000002 | |||
| 3203 | Ga0587077_068645 | |||
| 3204 | Ga0587080_000328 | |||
| 3205 | Ga0587080_008939 | |||
| 3206 | Ga0587082_000432 | |||
| 3207 | Ga0587082_099346 | |||
| 3208 | Ga0587083_0000091 | |||
| 3209 | Ga0587083_0000526 | |||
| 3210 | Ga0587083_0000533 | |||
| 3211 | Ga0587088_067862 | |||
| 3212 | Ga0587098_007400 | |||
| 3213 | Ga0587098_031131 | |||
| 3214 | Ga0587098_095429 | |||
| 3215 | Ga0587106_013355 | |||
| 3216 | Ga0587106_016970 | |||
| 3217 | Ga0587106_055808 | |||
| 3218 | Ga0587099_017892 | |||
| 3219 | Ga0587117_112854 | |||
| 3220 | Ga0587067_000283 | |||
| 3221 | Ga0587067_001715 | |||
| 3222 | Ga0587067_002029 | |||
| 3223 | Ga0587067_003704 | |||
| 3224 | Ga0587067_004378 | |||
| 3225 | Ga0587067_011104 | |||
| 3226 | Ga0587067_039947 | |||
| 3227 | Ga0587067_060736 | |||
| 3228 | Ga0587068_000132 | |||
| 3229 | Ga0587068_106966 | |||
| 3230 | Ga0587068_126383 | |||
| 3231 | Ga0587072_000119 | |||
| 3232 | Ga0587072_003946 | |||
| 3233 | Ga0587072_009490 | |||
| 3234 | Ga0587072_042549 | |||
| 3235 | Ga0587072_055571 | |||
| 3236 | Ga0587072_061289 | |||
| 3237 | Ga0587072_075731 | |||
| 3238 | Ga0587072_116821 | |||
| 3239 | Ga0587072_141659 | |||
| 3240 | Ga0587075_046622 | |||
| 3241 | Ga0587075_079649 | |||
| 3242 | Ga0587076_000045 | |||
| 3243 | Ga0587076_008511 | |||
| 3244 | Ga0587076_010133 | |||
| 3245 | Ga0587076_076164 | |||
| 3246 | Ga0587076_110746 | |||
| 3247 | Ga0587079_000002 | |||
| 3248 | Ga0587079_008968 | |||
| 3249 | Ga0587079_011374 | |||
| 3250 | Ga0587079_042551 | |||
| 3251 | Ga0587114_044794 | |||
| 3252 | Ga0587060_000803 | |||
| 3253 | Ga0587060_001840 | |||
| 3254 | Ga0587111_0257428 | |||
| 3255 | Ga0501082_1104744 | |||
| 3256 | 2511180936 | |||
| 3257 | 2511698003 | |||
| 3258 | 2512736526 | |||
| 3259 | 2524190000 | |||
| 3260 | 2545559758 | |||
| 3261 | 2550903220 | |||
| 3262 | 2555470884 | |||
| 3263 | 2556065794 | |||
| 3264 | 2563930192 | |||
| 3265 | 2571530807 | |||
| 3266 | 2573041366 | |||
| 3267 | 2578338884 | |||
| 3268 | 2578930715 | |||
| 3269 | 2580930507 | |||
| 3270 | 2587744072 | |||
| 3271 | 2595092271 | |||
| 3272 | 2595320872 | |||
| 3273 | 2601641757 | |||
| 3274 | 2621273296 | |||
| 3275 | 2631982461 | |||
| 3276 | 2643738842 | |||
| 3277 | 2644424492 | |||
| 3278 | 2644705730 | |||
| 3279 | 2644713251 | |||
| 3280 | 2644721340 | |||
| 3281 | 2644723325 | |||
| 3282 | 2644741862 | |||
| 3283 | 2651530326 | |||
| 3284 | 2672333589 | |||
| 3285 | 2673821722 | |||
| 3286 | 2674421119 | |||
| 3287 | 2685148207 | |||
| 3288 | 2686995326 | |||
| 3289 | 2687496575 | |||
| 3290 | 2695629923 | |||
| 3291 | 2698319633 | |||
| 3292 | 2705992008 | |||
| 3293 | 2712198868 | |||
| 3294 | 2717918178 | |||
| 3295 | 2721503436 | |||
| 3296 | 2723606194 | |||
| 3297 | 2728529894 | |||
| 3298 | 2730136817 | |||
| 3299 | 2738817103 | |||
| 3300 | 2739160165 | |||
| 3301 | 2739212639 | |||
| 3302 | 2739234635 | |||
| 3303 | 2739271692 | |||
| 3304 | 2753813080 | |||
| 3305 | 2757568906 | |||
| 3306 | 2777764209 | |||
| 3307 | 2777837284 | |||
| 3308 | 2793182071 | |||
| 3309 | 2802440724 | |||
| 3310 | 2809057184 | |||
| 3311 | 2812314465 | |||
| 3312 | 2816866378 | |||
| 3313 | 2817478191 | |||
| 3314 | 2819571031 | |||
| 3315 | 2819585037 | |||
| 3316 | 2819676101 | |||
| 3317 | 2819711999 | |||
| 3318 | 2819726066 | |||
| 3319 | 2821118321 | |||
| 3320 | 2823526418 | |||
| 3321 | 2842688276 | |||
| 3322 | 2842887723 | |||
| 3323 | 2849144970 | |||
| 3324 | 2857460103 | |||
| 3325 | 2857478327 | |||
| 3326 | 2857586482 | |||
| 3327 | 2857590956 | |||
| 3328 | 2857608869 | |||
| 3329 | 2860837582 | |||
| 3330 | 2864738871 | |||
| 3331 | 2865002024 | |||
| 3332 | 2865007641 | |||
| 3333 | 2877768801 | |||
| 3334 | 2880169743 | |||
| 3335 | 2881639977 | |||
| 3336 | 2881646638 | |||
| 3337 | 2885529915 | |||
| 3338 | 2888584461 | |||
| 3339 | 2889048009 | |||
| 3340 | 2889053093 | |||
| 3341 | 2889276747 | |||
| 3342 | 2889298944 | |||
| 3343 | 2897109770 | |||
| 3344 | 2904168154 | |||
| 3345 | 2904496949 | |||
| 3346 | 2904530167 | |||
| 3347 | 2904564592 | |||
| 3348 | 2904600780 | |||
| 3349 | 2904755673 | |||
| 3350 | 2907208199 | |||
| 3351 | 2908669317 | |||
| 3352 | 2915610001 | |||
| 3353 | 2919097075 | |||
| 3354 | 2919149636 | |||
| 3355 | 2919166248 | |||
| 3356 | 2919419355 | |||
| 3357 | 2919432412 | |||
| 3358 | 2919523191 | |||
| 3359 | 2919726412 | |||
| 3360 | 2919730768 | |||
| 3361 | 2925332838 | |||
| 3362 | 2928099915 | |||
| 3363 | 2929009902 | |||
| 3364 | 2929211882 | |||
| 3365 | 2929233263 | |||
| 3366 | 2929298371 | |||
| 3367 | 2931385115 | |||
| 3368 | 2936343059 | |||
| 3369 | 2936363694 | |||
| 3370 | 2938653387 | |||
| 3371 | 2938917433 | |||
| 3372 | 2939685123 | |||
| 3373 | 2939707603 | |||
| 3374 | 2945996262 | |||
| 3375 | 2946058952 | |||
| 3376 | 2947426731 | |||
| 3377 | 2954776078 | |||
| 3378 | 2956900798 | |||
| 3379 | 2960324283 | |||
| 3380 | 2960378894 | |||
| 3381 | 2962290793 | |||
| 3382 | 2965761265 | |||
| 3383 | 2968562363 | |||
| 3384 | 2969137000 | |||
| 3385 | 2969141169 | |||
| 3386 | 2969766251 | |||
| 3387 | 2969774919 | |||
| 3388 | 2971406755 | |||
| 3389 | 2971410928 | |||
| 3390 | 2971513789 | |||
| 3391 | 2971893530 | |||
| 3392 | 2977254693 | |||
| 3393 | 2979083741 | |||
| 3394 | 2980128575 | |||
| 3395 | 2980179442 | |||
| 3396 | 2980186830 | |||
| 3397 | 2980492744 | |||
| 3398 | 2981289522 | |||
| 3399 | 2981294459 | |||
| 3400 | 2981985115 | |||
| 3401 | 2981990046 | |||
| 3402 | 2984531161 | |||
| 3403 | 2984537270 | |||
| 3404 | 2988229870 | |||
| 3405 | 2990275696 | |||
| 3406 | 2996636942 | |||
| 3407 | 2996707485 | |||
| 3408 | 3001271875 | |||
| 3409 | 3001275961 | |||
| 3410 | 3001898794 | |||
| 3411 | 3006858519 | |||
| 3412 | 3006883631 | |||
| 3413 | 3006980026 | |||
| 3414 | 648172187 | |||
| 3415 | 8002318133 | |||
| 3416 | 8022621217 | |||
| 3417 | 8022631638 | |||
| 3418 | 8022655880 | |||
| 3419 | 8022799056 | |||
| 3420 | 8022893435 | |||
| 3421 | 8022917915 | |||
| 3422 | 8023439812 | |||
| 3423 | 8023447391 | |||
| 3424 | 8046991300 | |||
| 3425 | 8051956513 | |||
| 3426 | 8052174989 | |||
| 3427 | 8054282865 | |||
| 3428 | 8054471310 | |||
| 3429 | 8054801995 | |||
| 3430 | 8055634017 | |||
| 3431 | 8056535609 | |||
| 3432 | 8057473381 | |||
| 3433 | 8057582798 | |||
| 3434 | 8057632288 | |||
| 3435 | 8057735139 | |||
| 3436 | 8057979872 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4v48-assembly1.cif.gz_BS | real space refined coordinates of the 30s and 50s subunits fitted into the low resolution cryo-em map of the initiation-like state of e. coli 70s ribosome | 0.9631 | 12 | 76 |
| 4v48-assembly1.cif.gz_BS | real space refined coordinates of the 30s and 50s subunits fitted into the low resolution cryo-em map of the initiation-like state of e. coli 70s ribosome | 0.949 | 12 | 76 |
| 5mmm-assembly1.cif.gz_s | structure of the 70s chloroplast ribosome | 0.9323 | 6 | 83 |
| 5mmm-assembly1.cif.gz_s | structure of the 70s chloroplast ribosome | 0.921 | 6 | 83 |
| 8a98-assembly1.cif.gz_SW | cryo-em structure of leishmania major 80s ribosome : snorna mutant | 0.9208 | 12 | 78 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4kj2S00 | Alpha Beta;2-Layer Sandwich;30s Ribosomal Protein S19; Chain A;Ribosomal protein S19/S15 | 0.9064 | 3 | 81 | 3.30.860.10 |
| 2y0uS00 | Alpha Beta;2-Layer Sandwich;30s Ribosomal Protein S19; Chain A;Ribosomal protein S19/S15 | 0.9023 | 4 | 81 | 3.30.860.10 |
| 2qbbS00 | Alpha Beta;2-Layer Sandwich;30s Ribosomal Protein S19; Chain A;Ribosomal protein S19/S15 | 0.8962 | 3 | 81 | 3.30.860.10 |
| af_P54018_6_152_3.30.860.10 | Alpha Beta;2-Layer Sandwich;30s Ribosomal Protein S19; Chain A;Ribosomal protein S19/S15 | 0.8959 | 13 | 85 | 3.30.860.10 |
| 4kj2S00 | Alpha Beta;2-Layer Sandwich;30s Ribosomal Protein S19; Chain A;Ribosomal protein S19/S15 | 0.8958 | 3 | 81 | 3.30.860.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-H6T3U6-F1-model_v4 | Small ribosomal subunit protein uS19c (30S ribosomal protein S19, chloroplastic) | 0.9225 | 5 | 84 |
GO:0000028
GO:0003735 GO:0005763 GO:0006412 GO:0009536 GO:0019843 |
| AF-A0A410P9S4-F1-model_v4 | Small ribosomal subunit protein uS19c | 0.9161 | 1 | 81 |
GO:0000028
GO:0003735 GO:0005763 GO:0006412 GO:0009507 GO:0019843 |
| AF-X1L935-F1-model_v4 | Large ribosomal subunit protein uL2 C-terminal domain-containing protein | 0.911 | 1 | 84 |
GO:0002181
GO:0003723 GO:0003735 GO:0005737 GO:0015935 |
| AF-A0A5D0IVM7-F1-model_v4 | Small ribosomal subunit protein uS19 (30S ribosomal protein S19) | 0.9091 | 6 | 86 |
GO:0000028
GO:0003735 GO:0005737 GO:0006412 GO:0015935 GO:0019843 |
| AF-Q36807-F1-model_v4 | Small ribosomal subunit protein uS19c | 0.909 | 1 | 80 |
GO:0003735
GO:0006412 GO:0009507 GO:0015935 GO:0019843 |