F495463

General Info

Members Datasets Scaffolds Average Seq Length
1719 594 3439 373

Family's Representative Sequence

Representative Sequence 3300005334|Ga0068869_100114106|Ga0068869_1001141062
Length 429
Sequence MNKENFEEKTSPLPKESLGQPLSDGEGTNLLEIPNIEEKSLNLNPPSRDSGLRVLFIDRDGTIIKEAPPTYQLDAFTKLEFYPHMFEFLTKIVKELDYELVMVTNQDGLGSQSFPEDSFWPIQHFILRALENEGIVFSEIFIDRTFAHENKLTRKPGTGMLTEYLGTDRYDLKNSFVIGDRITDVKLAENLGCRALWLNNHDELGAGELSVSAKELSSVIAVETQKWEDIYEFLKRPPRKIIHSRNTNETKIEINLNLDGGGISQIETGLGFFDHMLEQLSKHSGMNLGIICKGDLHIDEHHTIEDVALALGEAMLTALGDKRGIERYGFLLPMDDCLAQVGIDFGGRSWLVWNAEFKREKIGEVPTEMFYHFFKSFSDAAKCNLSIKAEGDNEHHKIESIFKAFAKSIKMAIKRDPMNNSLPTTKGLL

Samples

Sample ID Description Type Environment
1 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
9 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
10 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
11 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
12 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
13 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
14 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
15 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
16 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
17 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
18 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
19 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
20 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
21 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
22 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
23 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
24 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
25 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
26 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
27 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
28 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
29 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
30 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
31 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
32 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
33 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
34 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
35 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
36 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
37 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
38 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
39 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
40 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
41 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
42 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
43 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
44 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
45 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
46 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
47 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
48 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
49 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
50 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
51 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
52 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
53 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
54 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
55 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
56 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
57 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
58 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
59 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
60 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
61 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
62 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
63 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
64 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
65 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
66 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
67 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
68 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
69 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
70 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
71 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
72 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
73 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
74 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
75 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
76 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
77 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
78 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
79 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
80 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
81 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
82 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
83 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
84 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
85 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
86 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
87 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
88 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
89 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
90 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
91 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
92 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
93 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
94 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
95 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
96 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
97 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
98 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
99 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
100 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
101 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
102 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
103 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
104 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
105 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
106 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
107 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
108 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
109 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
110 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
111 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
112 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
113 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
114 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
115 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
116 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
117 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
118 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
119 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
120 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
121 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
122 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
123 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
124 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
125 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
126 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
127 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
128 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
129 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
130 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
131 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
132 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
133 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
134 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
135 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
136 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
137 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
138 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
139 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
140 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
141 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
142 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
143 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
144 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
145 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
146 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
148 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
149 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
151 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
152 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
153 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
155 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
156 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
157 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
159 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
160 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
161 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
162 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
163 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
164 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
165 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
166 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
167 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
168 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
169 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
227 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
228 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
229 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
230 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
231 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
232 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
236 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
237 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
238 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
239 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
240 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
241 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
242 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
243 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
244 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
245 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
246 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
247 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
248 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
249 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
250 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
251 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
252 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
253 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
254 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
255 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
256 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
257 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
258 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
259 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
260 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
261 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
262 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
263 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
264 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
265 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
266 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
267 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
268 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
269 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
270 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
271 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
272 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
273 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
274 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
275 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
276 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
277 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
278 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
279 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
280 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
281 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
282 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
283 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
284 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
285 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
286 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
287 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
288 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
289 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
290 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
291 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
292 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
293 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
294 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
295 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
296 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
297 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
298 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
299 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
300 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
301 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
302 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
303 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
304 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
305 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
306 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
307 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
308 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
309 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
310 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
311 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
312 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
313 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
314 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
315 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
316 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
317 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
318 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
319 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
320 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
321 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
322 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
323 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
324 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
325 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
326 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
327 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
328 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
329 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
330 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
331 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
332 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
333 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
334 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
335 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
336 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
337 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
338 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
339 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
340 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
341 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
342 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
343 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
344 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
345 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
346 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
347 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
348 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
349 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
350 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
351 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
352 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
353 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
354 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
355 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
356 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
357 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
358 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
359 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
360 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
361 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
362 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
363 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
364 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
365 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
366 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
367 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
368 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
369 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
370 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
371 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
372 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
373 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
374 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
375 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
376 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
377 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
378 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
379 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
380 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
381 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
382 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
383 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
384 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
385 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
386 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
387 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
388 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
389 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
390 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
391 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
392 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
393 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
394 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
395 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
396 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
397 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
398 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
399 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
400 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
401 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
402 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
403 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
404 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
405 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
406 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
407 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
408 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
409 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
410 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
411 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
412 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
413 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
414 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
415 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
416 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
417 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
418 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
419 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
420 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
421 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
422 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
423 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
424 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
425 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
426 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
427 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
428 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
429 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
430 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
431 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
432 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
433 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
434 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
435 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
436 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
437 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
438 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
439 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
440 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
441 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
442 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
443 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
444 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
445 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
446 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
447 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
448 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
449 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
450 2511231000 Chryseobacterium populi CF314 Isolate Rhizosphere
451 2513020052 Flavobacterium sp. CF136 Isolate Rhizosphere
452 2519899754 Flavobacterium sp. F52 Isolate Rhizosphere
453 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
454 2523533629 Kaistella palustris DSM 21579 Isolate Rhizosphere
455 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
456 2582581278 Chryseobacterium sp. CF365 Isolate Rhizosphere
457 2582581281 Chryseobacterium sp. CF284 Isolate Rhizosphere
458 2582581282 Chryseobacterium sp. CF299 Isolate Rhizosphere
459 2582581873 Chryseobacterium sp. OV259 Isolate Rhizosphere
460 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
461 2585428045 Chryseobacterium sp. OV705 Isolate Rhizosphere
462 2585428060 Chryseobacterium sp. OV715 Isolate Rhizosphere
463 2585428095 Chryseobacterium sp. YR005 Isolate Rhizosphere
464 2585428115 Chryseobacterium sp. YR561 Isolate Rhizosphere
465 2585428182 Chryseobacterium sp. YR477 Isolate Rhizosphere
466 2585428183 Chryseobacterium sp. YR485 Isolate Rhizosphere
467 2585428184 Chryseobacterium sp. YR480 Isolate Rhizosphere
468 2585428185 Chryseobacterium sp. YR459 Isolate Rhizosphere
469 2585428187 Chryseobacterium sp. YR460 Isolate Rhizosphere
470 2588253712 Chryseobacterium sp. OV279 Isolate Rhizosphere
471 2588254255 Chryseobacterium sp. YR221 Isolate Rhizosphere
472 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
473 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
474 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
475 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
476 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
477 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
478 2643221716 Flavobacterium sp. Root901 Isolate Unclassified
479 2643221725 Flavobacterium sp. Root935 Isolate Unclassified
480 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
481 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
482 2728369107 Chryseobacterium kwangjuense KJ1R5 Isolate Unclassified
483 2734482264 Dyella sp. AD052 Isolate Unclassified
484 2738541273 Elizabethkingia sp. YR214 Isolate Unclassified
485 2738541278 Niastella sp. CF465 Isolate Unclassified
486 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
487 2738541283 Pedobacter sp. OK701 Isolate Unclassified
488 2738541284 Pedobacter sp. YR016 Isolate Unclassified
489 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
490 2738541302 Pedobacter sp. CF074 Isolate Unclassified
491 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
492 2738543009 Luteibacter sp. OK325 Isolate Unclassified
493 2738543014 Elizabethkingia sp. YR191 Isolate Unclassified
494 2738543023 Pedobacter sp. OK628 Isolate Unclassified
495 2739367651 Pedobacter sp. OK291 Isolate Unclassified
496 2739367656 Pedobacter sp. CF523 Isolate Unclassified
497 2739367663 Pedobacter sp. YR510 Isolate Unclassified
498 2739367700 Dyella sp. YR388 Isolate Unclassified
499 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
500 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
501 2739367866 Hymenobacter sp. YR204 Isolate Unclassified
502 2739367874 Chryseobacterium sp. T16E-39 Isolate Unclassified
503 2751185877 Chryseobacterium artocarpi UTM-3 Isolate Rhizosphere
504 2765235839 Chryseobacterium indologenes AA5 Isolate Unclassified
505 2772190705 Chryseobacterium contaminans C-26 Isolate Rhizosphere
506 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
507 2802428842 Flavobacterium sp. S87F.05.LMB.W.Kidney.N Isolate Unclassified
508 2816332188 Chryseobacterium aquifrigidense 110 (version 2) Isolate Unclassified
509 2816332280 Flavobacterium johnsoniae GSE09 Isolate Unclassified
510 2818991437 Pedobacter terrae 518 Isolate Unclassified
511 2818991440 Luteibacter yeojuensis 583 Isolate Unclassified
512 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
513 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
514 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
515 2833640130 Mariniflexile sp. TRM1-10 Isolate Rhizosphere
516 2839989709 Pontibacter arcticus 2b14 Isolate Unclassified
517 2842083920 Chryseobacterium lathyri KCTC 22544 Isolate Rhizosphere
518 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
519 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
520 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
521 2842914999 Luteibacter sp. R-72151 Isolate Unclassified
522 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
523 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
524 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
525 2857613821 Flavobacterium sp. R-72247 Isolate Unclassified
526 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
527 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
528 2871720351 Chryseobacterium sp. KLBC 52 Isolate Nodule
529 2881359912 Flavobacterium ustbae T13 Isolate Rhizosphere
530 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
531 2884411467 Dyella sp. AD56 Isolate Rhizosphere
532 2884634485 Algoriphagus kandeliae XY-J91 Isolate Unclassified
533 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
534 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
535 2889290771 Chryseobacterium sp. PvR013 Isolate Rhizosphere
536 2890737413 Parapedobacter sp. SGR-10 Isolate Rhizosphere
537 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
538 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
539 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
540 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
541 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
542 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
543 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
544 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
545 2903895155 Flavobacterium sp. HBTb2-11-1 Isolate Rhizosphere
546 2904419702 Flavobacterium sp. 1355 Isolate Rhizosphere
547 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
548 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
549 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
550 2904555929 Flavobacterium sp. 1750 Isolate Rhizosphere
551 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
552 2905999023 Chryseobacterium elymi KCTC 22547 Isolate Rhizosphere
553 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
554 2911138879 Spirosoma sp. KUDC1026 Isolate Rhizosphere
555 2914759650 Rhizosphaericola mali Isolate Rhizosphere
556 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
557 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
558 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
559 2919399522 Chryseobacterium sp. 2987 Isolate Unclassified
560 2919404418 Luteibacter sp. 3190 Isolate Unclassified
561 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
562 2919683626 Flavobacterium piscis 4129 Isolate Unclassified
563 2919692658 Algoriphagus sp. 4150 Isolate Rhizosphere
564 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
565 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
566 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
567 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
568 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
569 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
570 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
571 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
572 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere
573 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
574 2945924605 Chryseobacterium ginsenosidimutans W1I9 Isolate Rhizosphere
575 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
576 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
577 2946019816 Chryseobacterium sp. W4I1 Isolate Rhizosphere
578 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
579 2958458903 Flavobacterium anhuiense RCM74 Isolate Rhizosphere
580 2958512119 Flavobacterium sp. Sd200 Isolate Rhizosphere
581 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
582 2977243572 Chryseobacterium sp. SORGH_AS 447 Isolate Unclassified
583 2977268062 Flavobacterium sp. SORGH_AS 622 Isolate Unclassified
584 2984572630 Chryseobacterium sp. SORGH_AS909 Isolate Aerial Root
585 2984606641 Chryseobacterium sp. SORGH_AS1175 Isolate Aerial Root
586 2993372514 Chryseobacterium sp. SLBN-27 Isolate Rhizosphere
587 2993480792 Chryseobacterium nepalense SLBN-92 Isolate Rhizosphere
588 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified
589 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified
590 8054307821 Flavobacterium soyae SCIV07 Isolate Rhizosphere
591 8055419101 Flavobacterium tyrosinilyticum KCTC 42726 Isolate Rhizosphere
592 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere
593 8055592153 Flavobacterium panacis DCY106 Isolate Rhizosphere
594 8056440228 Flavobacterium hibisci THG-HG1.4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.33
Metatranscriptomes 0.23
Isolates 8.44

Biome Distribution

Category Percentage (%)
Aerial Root 0.12
Bulb 0
Endosphere 8.14
Nodule 0.12
Rhizoplane 0.52
Rhizosphere 81.5
Stem 0
Stem Tuber 0
Unclassified 1.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068869_100114106 3300005334 Bacteria 2059
2 SwRhRL2b_contig_2106057 2162886007 Bacteria 1249
3 SwRhRL2b_contig_787417 2162886007 Bacteria 8367
4 SwRhRL2b_contig_995218 2162886007 Bacteria 2934
5 JGI24740J21852_10011978 3300001979 Bacteria 3283
6 JGI24739J22299_10005607 3300001989 Bacteria 4759
7 JGI24739J22299_10018320 3300001989 Bacteria 2517
8 JGI24737J22298_10007120 3300001990 Bacteria 3790
9 JGI24737J22298_10007166 3300001990 Bacteria 3774
10 JGI24735J21928_10000004 3300002067 Bacteria 381713
11 JGI24735J21928_10000733 3300002067 Bacteria 11666
12 JGI24738J21930_10007886 3300002075 Bacteria 2436
13 JGI25156J39149_1010714 3300002705 Bacteria 2134
14 JGI25156J39149_1011938 3300002705 Bacteria 1941
15 JGI25162J39368_1000011 3300002737 Bacteria 379156
16 JGI25162J39368_1000395 3300002737 Bacteria 36803
17 JGI25162J39368_1000614 3300002737 Bacteria 25616
18 JGI25154J39366_1000040 3300002738 Bacteria 147410
19 JGI25157J39369_1004284 3300002741 Bacteria 2638
20 JGI25164J39214_1000338 3300002772 Bacteria 29675
21 JGI25164J39214_1000416 3300002772 Bacteria 24162
22 JGI25150J39212_1000001 3300002774 Bacteria 1318726
23 JGI25159J45721_1013514 3300002987 Bacteria 1884
24 JGI25151J46595_10000001 3300003187 Bacteria 887211
25 JGI25151J46595_10012241 3300003187 Bacteria 3909
26 JGI25165J46597_1000513 3300003214 Bacteria 36803
27 JGI25165J46597_1000985 3300003214 Bacteria 19074
28 JGI25153J46596_10000001 3300003215 Bacteria 748985
29 JGI25153J46596_10003346 3300003215 Bacteria 9003
30 rootH1_10005810 3300003316 Bacteria 3544
31 rootH1_10024829 3300003316 Bacteria 25564
32 rootH1_10091502 3300003316 Bacteria 1806
33 rootH2_10001891 3300003320 Bacteria 464318
34 rootH2_10006905 3300003320 Bacteria 21755
35 rootH2_10013742 3300003320 Bacteria 11980
36 rootH2_10026728 3300003320 Bacteria 23571
37 rootH2_10070248 3300003320 Bacteria 1869
38 rootH2_10090920 3300003320 Bacteria 6366
39 rootL2_10009890 3300003322 Bacteria 1938
40 rootL2_10030202 3300003322 Bacteria 2816
41 rootL2_10058669 3300003322 Bacteria 5201
42 rootL2_10102542 3300003322 Bacteria 3154
43 rootL2_10115167 3300003322 Bacteria 2189
44 rootL2_10124282 3300003322 Bacteria 2909
45 rootH1_10000019 3300003316 Bacteria 18606
46 rootH1_10000019 3300003323 Bacteria 34919
47 rootH1_10008801 3300003323 Bacteria 13652
48 rootH1_10014558 3300003323 Bacteria 13059
49 rootH1_10035284 3300003323 Bacteria 47456
50 rootH1_10162681 3300003323 Bacteria 3348
51 rootH1_10178453 3300003323 Bacteria 2808
52 rootH1_10196299 3300003323 Bacteria 1821
53 rootH1_10230245 3300003323 Bacteria 1263
54 JGI25160J50197_1000719 3300003354 Bacteria 18158
55 JGI25160J50197_1005718 3300003354 Bacteria 5138
56 JGI25160J50197_1006644 3300003354 Bacteria 4654
57 JGI25160J50197_1012160 3300003354 Bacteria 3008
58 Ga0006562J51391_1077937 3300003578 Bacteria 7790
59 Ga0055533_1000705 3300003756 Bacteria 10941
60 Ga0055535_1004072 3300003761 Bacteria 3753
61 Ga0055542_1002114 3300003762 Bacteria 7298
62 Ga0055526_1020598 3300003771 Bacteria 2336
63 Ga0055526_1021512 3300003771 Bacteria 2240
64 Ga0055524_1008450 3300003775 Bacteria 4278
65 Ga0055536_1000001 3300003781 Bacteria 630663
66 Ga0055536_1002653 3300003781 Bacteria 9935
67 Ga0055536_1005846 3300003781 Bacteria 5909
68 Ga0055534_1003989 3300003784 Bacteria 4435
69 Ga0055528_1001650 3300003790 Bacteria 13115
70 Ga0055530_10000387 3300003791 Bacteria 39558
71 Ga0055530_10002797 3300003791 Bacteria 10738
72 Ga0055530_10004772 3300003791 Bacteria 6816
73 Ga0055531_10000087 3300003794 Bacteria 101553
74 Ga0055531_10000131 3300003794 Bacteria 85257
75 Ga0055531_10003712 3300003794 Bacteria 9601
76 Ga0055531_10017858 3300003794 Bacteria 2966
77 Ga0055531_10022988 3300003794 Bacteria 2356
78 Ga0065165_1000102 3300005262 Bacteria 140917
79 Ga0065165_1000396 3300005262 Bacteria 70676
80 Ga0065165_1002869 3300005262 Bacteria 13297
81 Ga0065165_1011677 3300005262 Bacteria 3633
82 Ga0065714_10003545 3300005288 Bacteria 7328
83 Ga0065714_10004089 3300005288 Bacteria 9774
84 Ga0065714_10010706 3300005288 Bacteria 2645
85 Ga0065714_10027838 3300005288 Bacteria 1420
86 Ga0065714_10064750 3300005288 Bacteria 20200
87 Ga0065714_10064863 3300005288 Bacteria 16719
88 Ga0065714_10067358 3300005288 Bacteria 5607
89 Ga0065714_10084036 3300005288 Bacteria 2219
90 Ga0065714_10091768 3300005288 Bacteria 1886
91 Ga0065714_10095177 3300005288 Bacteria 1757
92 Ga0065704_10000210 3300005289 Bacteria 93612
93 Ga0065704_10002415 3300005289 Bacteria 5278
94 Ga0065704_10005410 3300005289 Bacteria 3301
95 Ga0065704_10070975 3300005289 Bacteria 14132
96 Ga0065704_10077961 3300005289 Bacteria 4569
97 Ga0065704_10090743 3300005289 Bacteria 2766
98 Ga0065704_10113887 3300005289 Bacteria 1902
99 Ga0065712_10088970 3300005290 Bacteria 2491
100 Ga0065715_10133536 3300005293 Bacteria 1971
101 Ga0070658_10000049 3300005327 Bacteria 119985
102 Ga0070658_10013707 3300005327 Bacteria 6505
103 Ga0070658_10025309 3300005327 Bacteria 4759
104 Ga0070658_10054233 3300005327 Bacteria 3255
105 Ga0070676_10000336 3300005328 Bacteria 21357
106 Ga0070676_10026339 3300005328 Bacteria 3292
107 Ga0070676_10030128 3300005328 Bacteria 3092
108 Ga0070683_100249876 3300005329 Bacteria 1687
109 Ga0070690_100039757 3300005330 Bacteria 2972
110 Ga0070690_100101551 3300005330 Bacteria 1908
111 Ga0070690_100121968 3300005330 Bacteria 1750
112 Ga0070670_100022394 3300005331 Bacteria 5439
113 Ga0070670_100033933 3300005331 Bacteria 4393
114 Ga0070670_100045698 3300005331 Bacteria 3765
115 Ga0070670_100095525 3300005331 Bacteria 2557
116 Ga0070670_100096661 3300005331 Bacteria 2541
117 Ga0070670_100169959 3300005331 Bacteria 1891
118 Ga0070677_10030505 3300005333 Bacteria 2053
119 Ga0070677_10032555 3300005333 Bacteria 2001
120 Ga0068869_100003156 3300005334 Bacteria 10060
121 Ga0068869_100025054 3300005334 Bacteria 4139
122 Ga0068869_100039400 3300005334 Bacteria 3373
123 Ga0068869_100071316 3300005334 Bacteria 2572
124 Ga0068869_100092872 3300005334 Bacteria 2272
125 Ga0068869_100126876 3300005334 Bacteria 1957
126 Ga0068869_100129295 3300005334 Bacteria 1940
127 Ga0068869_100145294 3300005334 Bacteria 1835
128 Ga0068869_100149394 3300005334 Bacteria 1811
129 Ga0068869_100200348 3300005334 Bacteria 1574
130 Ga0070666_10000003 3300005335 Bacteria 463666
131 Ga0070666_10000051 3300005335 Bacteria 99740
132 Ga0070666_10035424 3300005335 Bacteria 3310
133 Ga0070666_10038936 3300005335 Bacteria 3165
134 Ga0070666_10055085 3300005335 Bacteria 2684
135 Ga0070680_100014158 3300005336 Bacteria 6230
136 Ga0070680_100014310 3300005336 Bacteria 6197
137 Ga0070680_100045802 3300005336 Unclassified 3557
138 Ga0070682_100000153 3300005337 Bacteria 53159
139 Ga0070682_100001275 3300005337 Bacteria 14290
140 Ga0070682_100023945 3300005337 Bacteria 3629
141 Ga0068868_100008530 3300005338 Bacteria 7338
142 Ga0068868_100015143 3300005338 Bacteria 5698
143 Ga0068868_100016530 3300005338 Bacteria 5482
144 Ga0068868_100020344 3300005338 Bacteria 4985
145 Ga0068868_100026273 3300005338 Bacteria 4435
146 Ga0068868_100181732 3300005338 Bacteria 1745
147 Ga0070660_100021175 3300005339 Bacteria 4791
148 Ga0070660_100027944 3300005339 Bacteria 4216
149 Ga0070660_100045939 3300005339 Bacteria 3346
150 Ga0070660_100202184 3300005339 Bacteria 1611
151 Ga0070689_100012964 3300005340 Bacteria 6020
152 Ga0070689_100020120 3300005340 Bacteria 4948
153 Ga0070689_100027105 3300005340 Bacteria 4318
154 Ga0070689_100064306 3300005340 Bacteria 2855
155 Ga0070691_10004326 3300005341 Bacteria 6456
156 Ga0070691_10007180 3300005341 Bacteria 5101
157 Ga0070687_100026921 3300005343 Bacteria 2773
158 Ga0070661_100003020 3300005344 Bacteria 11579
159 Ga0070661_100017264 3300005344 Bacteria 5118
160 Ga0070661_100023944 3300005344 Bacteria 4380
161 Ga0070661_100034512 3300005344 Bacteria 3668
162 Ga0070661_100047201 3300005344 Bacteria 3151
163 Ga0070692_10044215 3300005345 Bacteria 2293
164 Ga0070668_100077511 3300005347 Bacteria 2598
165 Ga0070668_100159218 3300005347 Bacteria 1831
166 Ga0070668_100265475 3300005347 Bacteria 1429
167 Ga0070669_100004024 3300005353 Bacteria 10630
168 Ga0070669_100237792 3300005353 Bacteria 1446
169 Ga0070675_100015326 3300005354 Bacteria 6059
170 Ga0070675_100016332 3300005354 Bacteria 5890
171 Ga0070675_100027340 3300005354 Bacteria 4582
172 Ga0070675_100096546 3300005354 Unclassified 2483
173 Ga0070671_100005548 3300005355 Bacteria 10050
174 Ga0070671_100038509 3300005355 Bacteria 3969
175 Ga0070671_100103058 3300005355 Bacteria 2394
176 Ga0070671_100311131 3300005355 Bacteria 1342
177 Ga0070674_100002364 3300005356 Bacteria 10411
178 Ga0070674_100111721 3300005356 Bacteria 2007
179 Ga0070673_100001990 3300005364 Bacteria 12324
180 Ga0070673_100026479 3300005364 Bacteria 4283
181 Ga0070673_100047585 3300005364 Bacteria 3338
182 Ga0070673_100078015 3300005364 Bacteria 2678
183 Ga0070673_100079941 3300005364 Bacteria 2648
184 Ga0070673_100212742 3300005364 Bacteria 1670
185 Ga0070673_100386908 3300005364 Bacteria 1248
186 Ga0070688_100001700 3300005365 Bacteria 10987
187 Ga0070659_100004255 3300005366 Bacteria 10213
188 Ga0070659_100005797 3300005366 Bacteria 8894
189 Ga0070659_100006368 3300005366 Bacteria 8525
190 Ga0070659_100006699 3300005366 Bacteria 8329
191 Ga0070659_100011612 3300005366 Bacteria 6519
192 Ga0070659_100052714 3300005366 Bacteria 3200
193 Ga0070659_100086606 3300005366 Bacteria 2507
194 Ga0070667_100000492 3300005367 Bacteria 40164
195 Ga0070667_100001349 3300005367 Bacteria 22023
196 Ga0070667_100044097 3300005367 Bacteria 3744
197 Ga0070667_100069793 3300005367 Bacteria 2991
198 Ga0070667_100121925 3300005367 Bacteria 2268
199 Ga0070714_100116833 3300005435 Bacteria 2368
200 Ga0070713_100006097 3300005436 Bacteria 8314
201 Ga0070710_10058995 3300005437 Bacteria 2178
202 Ga0070663_100001195 3300005455 Bacteria 14271
203 Ga0070663_100195511 3300005455 Bacteria 1576
204 Ga0070678_100001813 3300005456 Bacteria 11512
205 Ga0070678_100024345 3300005456 Bacteria 4052
206 Ga0070678_100189828 3300005456 Bacteria 1689
207 Ga0070662_100000045 3300005457 Bacteria 67900
208 Ga0070662_100004086 3300005457 Bacteria 9167
209 Ga0070662_100049317 3300005457 Bacteria 3036
210 Ga0070662_100121832 3300005457 Bacteria 2000
211 Ga0070681_10003864 3300005458 Bacteria 14101
212 Ga0070681_10022395 3300005458 Bacteria 6345
213 Ga0070681_10053268 3300005458 Bacteria 4032
214 Ga0070681_10222079 3300005458 Bacteria 1804
215 Ga0068867_100004573 3300005459 Bacteria 9730
216 Ga0068867_100062000 3300005459 Bacteria 2778
217 Ga0068867_100075744 3300005459 Bacteria 2525
218 Ga0068867_100188557 3300005459 Bacteria 1644
219 Ga0070685_10002206 3300005466 Bacteria 10050
220 Ga0070698_100043739 3300005471 Bacteria 4591
221 Ga0070679_100000634 3300005530 Bacteria 29900
222 Ga0070679_100004536 3300005530 Bacteria 12825
223 Ga0070679_100006277 3300005530 Bacteria 11066
224 Ga0070679_100007656 3300005530 Bacteria 10111
225 Ga0070679_100019902 3300005530 Bacteria 6535
226 Ga0070679_100200590 3300005530 Bacteria 1961
227 Ga0070679_100251163 3300005530 Bacteria 1725
228 Ga0070679_100304594 3300005530 Bacteria 1544
229 Ga0070684_100000495 3300005535 Bacteria 27122
230 Ga0070684_100005089 3300005535 Bacteria 10043
231 Ga0070684_100035368 3300005535 Bacteria 4275
232 Ga0070684_100261462 3300005535 Bacteria 1583
233 Ga0068853_100000221 3300005539 Bacteria 40294
234 Ga0068853_100008065 3300005539 Bacteria 8446
235 Ga0068853_100009733 3300005539 Bacteria 7754
236 Ga0068853_100013393 3300005539 Bacteria 6695
237 Ga0068853_100016539 3300005539 Bacteria 6074
238 Ga0068853_100046538 3300005539 Bacteria 3720
239 Ga0068853_100057348 3300005539 Bacteria 3361
240 Ga0068853_100070430 3300005539 Bacteria 3044
241 Ga0068853_100098422 3300005539 Unclassified 2583
242 Ga0068853_100134731 3300005539 Bacteria 2213
243 Ga0068853_100252364 3300005539 Bacteria 1619
244 Ga0068853_100265163 3300005539 Bacteria 1580
245 Ga0070672_100001489 3300005543 Bacteria 14544
246 Ga0070672_100065616 3300005543 Bacteria 2872
247 Ga0070672_100068525 3300005543 Bacteria 2814
248 Ga0070686_100022221 3300005544 Bacteria 3775
249 Ga0070686_100149017 3300005544 Bacteria 1637
250 Ga0070696_100005210 3300005546 Bacteria 8690
251 Ga0070693_100003483 3300005547 Bacteria 7347
252 Ga0070693_100065349 3300005547 Bacteria 2126
253 Ga0070665_100000020 3300005548 Bacteria 389687
254 Ga0070665_100016967 3300005548 Bacteria 7300
255 Ga0070665_100043231 3300005548 Bacteria 4528
256 Ga0070665_100079883 3300005548 Bacteria 3276
257 Ga0070665_100113957 3300005548 Bacteria 2706
258 Ga0068855_100000089 3300005563 Bacteria 110845
259 Ga0068855_100000240 3300005563 Bacteria 69408
260 Ga0068855_100000346 3300005563 Bacteria 57719
261 Ga0068855_100005837 3300005563 Bacteria 15028
262 Ga0068855_100008169 3300005563 Bacteria 12653
263 Ga0068855_100020597 3300005563 Bacteria 7909
264 Ga0068855_100024825 3300005563 Bacteria 7170
265 Ga0068855_100026080 3300005563 Bacteria 6991
266 Ga0068855_100030585 3300005563 Bacteria 6437
267 Ga0068855_100047040 3300005563 Bacteria 5098
268 Ga0068855_100053363 3300005563 Bacteria 4756
269 Ga0068855_100062842 3300005563 Bacteria 4334
270 Ga0068855_100107211 3300005563 Bacteria 3210
271 Ga0068855_100136803 3300005563 Bacteria 2794
272 Ga0068855_100139053 3300005563 Bacteria 2770
273 Ga0068855_100234343 3300005563 Bacteria 2053
274 Ga0068855_100257335 3300005563 Bacteria 1945
275 Ga0068855_100264801 3300005563 Bacteria 1913
276 Ga0070664_100007478 3300005564 Bacteria 8823
277 Ga0070664_100014454 3300005564 Bacteria 6435
278 Ga0070664_100015583 3300005564 Bacteria 6220
279 Ga0070664_100039376 3300005564 Bacteria 3983
280 Ga0070664_100044954 3300005564 Bacteria 3729
281 Ga0070664_100161976 3300005564 Bacteria 1980
282 Ga0070664_100255598 3300005564 Bacteria 1576
283 Ga0068857_100007822 3300005577 Bacteria 9217
284 Ga0068857_100008143 3300005577 Bacteria 9051
285 Ga0068857_100008503 3300005577 Bacteria 8872
286 Ga0068857_100019055 3300005577 Bacteria 6022
287 Ga0068857_100036860 3300005577 Bacteria 4332
288 Ga0068857_100039954 3300005577 Unclassified 4159
289 Ga0068857_100042446 3300005577 Bacteria 4035
290 Ga0068857_100139189 3300005577 Bacteria 2193
291 Ga0068857_100237126 3300005577 Bacteria 1669
292 Ga0068857_100251550 3300005577 Bacteria 1620
293 Ga0068854_100014860 3300005578 Bacteria 5141
294 Ga0068854_100036209 3300005578 Bacteria 3459
295 Ga0068854_100044551 3300005578 Bacteria 3150
296 Ga0068854_100051761 3300005578 Bacteria 2943
297 Ga0068854_100315201 3300005578 Bacteria 1269
298 Ga0068856_100000835 3300005614 Bacteria 33215
299 Ga0068856_100006910 3300005614 Bacteria 11099
300 Ga0068856_100007967 3300005614 Bacteria 10348
301 Ga0068856_100010959 3300005614 Bacteria 8800
302 Ga0068856_100017673 3300005614 Bacteria 6914
303 Ga0068856_100021537 3300005614 Bacteria 6265
304 Ga0068856_100022699 3300005614 Bacteria 6101
305 Ga0068856_100074762 3300005614 Bacteria 3355
306 Ga0068856_100093470 3300005614 Bacteria 2993
307 Ga0068856_100132644 3300005614 Bacteria 2496
308 Ga0068856_100464115 3300005614 Bacteria 1287
309 Ga0068852_100001345 3300005616 Bacteria 16491
310 Ga0068852_100002446 3300005616 Bacteria 12784
311 Ga0068852_100002479 3300005616 Bacteria 12715
312 Ga0068852_100003445 3300005616 Bacteria 11058
313 Ga0068852_100021932 3300005616 Bacteria 5111
314 Ga0068852_100049232 3300005616 Bacteria 3604
315 Ga0068852_100187804 3300005616 Bacteria 1947
316 Ga0068859_100000037 3300005617 Bacteria 165480
317 Ga0068859_100002554 3300005617 Bacteria 18479
318 Ga0068859_100009853 3300005617 Bacteria 9646
319 Ga0068859_100014329 3300005617 Bacteria 7953
320 Ga0068859_100014701 3300005617 Bacteria 7865
321 Ga0068859_100019039 3300005617 Bacteria 6894
322 Ga0068859_100081931 3300005617 Bacteria 3269
323 Ga0068859_100112184 3300005617 Bacteria 2789
324 Ga0068859_100156882 3300005617 Bacteria 2354
325 Ga0068859_100211719 3300005617 Bacteria 2025
326 Ga0068859_100222053 3300005617 Bacteria 1977
327 Ga0068859_100259099 3300005617 Bacteria 1830
328 Ga0068859_100343093 3300005617 Bacteria 1588
329 Ga0068859_100466366 3300005617 Bacteria 1359
330 Ga0068864_100005800 3300005618 Bacteria 10131
331 Ga0068864_100046544 3300005618 Bacteria 3722
332 Ga0068864_100047161 3300005618 Bacteria 3700
333 Ga0068864_100071407 3300005618 Bacteria 3023
334 Ga0068864_100081890 3300005618 Bacteria 2831
335 Ga0068864_100291107 3300005618 Bacteria 1527
336 Ga0068861_100072756 3300005719 Bacteria 2668
337 Ga0068861_100076439 3300005719 Bacteria 2609
338 Ga0068861_100109468 3300005719 Bacteria 2211
339 Ga0068851_10011215 3300005834 Bacteria 4198
340 Ga0068851_10017429 3300005834 Bacteria 3449
341 Ga0068870_10028107 3300005840 Bacteria 2820
342 Ga0068863_100000412 3300005841 Bacteria 43521
343 Ga0068863_100001812 3300005841 Bacteria 21216
344 Ga0068863_100015360 3300005841 Bacteria 7359
345 Ga0068863_100026107 3300005841 Bacteria 5573
346 Ga0068863_100038028 3300005841 Bacteria 4579
347 Ga0068863_100041343 3300005841 Bacteria 4383
348 Ga0068863_100102832 3300005841 Bacteria 2717
349 Ga0068858_100019340 3300005842 Bacteria 6368
350 Ga0068858_100038430 3300005842 Bacteria 4439
351 Ga0068858_100068957 3300005842 Bacteria 3277
352 Ga0068858_100074780 3300005842 Bacteria 3146
353 Ga0068858_100113886 3300005842 Bacteria 2526
354 Ga0068858_100405101 3300005842 Bacteria 1311
355 Ga0068860_100000916 3300005843 Bacteria 32698
356 Ga0068860_100001316 3300005843 Bacteria 26971
357 Ga0068860_100003283 3300005843 Bacteria 16648
358 Ga0068860_100011274 3300005843 Bacteria 8808
359 Ga0068860_100011999 3300005843 Bacteria 8534
360 Ga0068860_100022244 3300005843 Bacteria 6137
361 Ga0068860_100079593 3300005843 Bacteria 3116
362 Ga0068860_100081707 3300005843 Bacteria 3073
363 Ga0068860_100173481 3300005843 Bacteria 2083
364 Ga0068860_100191982 3300005843 Bacteria 1977
365 Ga0068862_100010385 3300005844 Bacteria 7684
366 Ga0068862_100025020 3300005844 Bacteria 5011
367 Ga0068862_100041877 3300005844 Bacteria 3898
368 Ga0068862_100045273 3300005844 Bacteria 3754
369 Ga0068862_100079303 3300005844 Bacteria 2846
370 Ga0068862_100100522 3300005844 Bacteria 2529
371 Ga0068862_100169907 3300005844 Bacteria 1952
372 Ga0068862_100297749 3300005844 Bacteria 1483
373 Ga0081539_10000531 3300005985 Bacteria 79191
374 Ga0081539_10049494 3300005985 Bacteria 2384
375 Ga0070712_100072125 3300006175 Bacteria 2473
376 Ga0075366_10005218 3300006195 Bacteria 7031
377 Ga0075366_10020069 3300006195 Bacteria 3875
378 Ga0075366_10061158 3300006195 Bacteria 2238
379 Ga0097621_100000818 3300006237 Bacteria 21982
380 Ga0097621_100002086 3300006237 Bacteria 13691
381 Ga0097621_100018421 3300006237 Bacteria 5333
382 Ga0097621_100021360 3300006237 Bacteria 5006
383 Ga0097621_100022179 3300006237 Bacteria 4926
384 Ga0097621_100037338 3300006237 Bacteria 3892
385 Ga0097621_100093623 3300006237 Bacteria 2518
386 Ga0068871_100000027 3300006358 Bacteria 78588
387 Ga0068871_100000100 3300006358 Bacteria 51253
388 Ga0068871_100000354 3300006358 Bacteria 31915
389 Ga0068871_100010400 3300006358 Bacteria 6788
390 Ga0068871_100032169 3300006358 Unclassified 4141
391 Ga0068871_100056018 3300006358 Bacteria 3203
392 Ga0075428_100017721 3300006844 Bacteria 7870
393 Ga0075428_100050469 3300006844 Bacteria 4562
394 Ga0075428_100219642 3300006844 Bacteria 2052
395 Ga0075428_100285890 3300006844 Bacteria 1774
396 Ga0075430_100009529 3300006846 Bacteria 8210
397 Ga0075431_100065731 3300006847 Bacteria 3745
398 Ga0075429_100018092 3300006880 Bacteria 6097
399 Ga0075429_100032161 3300006880 Bacteria 4560
400 Ga0075429_100122899 3300006880 Bacteria 2269
401 Ga0068865_100000174 3300006881 Bacteria 35630
402 Ga0068865_100023102 3300006881 Bacteria 4068
403 Ga0068865_100028117 3300006881 Bacteria 3721
404 Ga0068865_100260016 3300006881 Bacteria 1374
405 Ga0097620_100000037 3300006931 Bacteria 165480
406 Ga0097620_100002554 3300006931 Bacteria 18479
407 Ga0097620_100009853 3300006931 Bacteria 9646
408 Ga0097620_100014329 3300006931 Bacteria 7953
409 Ga0097620_100014701 3300006931 Bacteria 7865
410 Ga0097620_100019038 3300006931 Bacteria 6894
411 Ga0097620_100081931 3300006931 Bacteria 3269
412 Ga0097620_100112184 3300006931 Bacteria 2789
413 Ga0097620_100156891 3300006931 Bacteria 2354
414 Ga0097620_100211717 3300006931 Bacteria 2025
415 Ga0097620_100222053 3300006931 Bacteria 1977
416 Ga0097620_100259079 3300006931 Bacteria 1830
417 Ga0097620_100343100 3300006931 Bacteria 1588
418 Ga0097620_100466346 3300006931 Bacteria 1359
419 Ga0105244_10000063 3300009036 Bacteria 122746
420 Ga0105244_10000261 3300009036 Bacteria 53251
421 Ga0105240_10000074 3300009093 Bacteria 199611
422 Ga0105240_10000176 3300009093 Bacteria 130109
423 Ga0105240_10000237 3300009093 Bacteria 109895
424 Ga0105240_10000598 3300009093 Bacteria 67006
425 Ga0105240_10000626 3300009093 Bacteria 65179
426 Ga0105240_10001351 3300009093 Bacteria 42091
427 Ga0105240_10001595 3300009093 Bacteria 38516
428 Ga0105240_10002663 3300009093 Bacteria 28411
429 Ga0105240_10007062 3300009093 Bacteria 16373
430 Ga0105240_10008151 3300009093 Bacteria 15026
431 Ga0105240_10020015 3300009093 Bacteria 8934
432 Ga0105240_10022028 3300009093 Bacteria 8460
433 Ga0105240_10066229 3300009093 Bacteria 4482
434 Ga0105240_10070852 3300009093 Unclassified 4312
435 Ga0105240_10085848 3300009093 Bacteria 3856
436 Ga0105240_10108377 3300009093 Bacteria 3365
437 Ga0105240_10287009 3300009093 Bacteria 1888
438 Ga0105240_10305713 3300009093 Bacteria 1818
439 Ga0105240_10326021 3300009093 Bacteria 1749
440 Ga0105240_10351421 3300009093 Bacteria 1672
441 Ga0105240_10404120 3300009093 Bacteria 1538
442 Ga0111539_10005620 3300009094 Bacteria 16217
443 Ga0111539_10008695 3300009094 Bacteria 12887
444 Ga0111539_10067948 3300009094 Bacteria 4207
445 Ga0105245_10178928 3300009098 Bacteria 2025
446 Ga0105247_10005412 3300009101 Bacteria 8044
447 Ga0105247_10010386 3300009101 Bacteria 5633
448 Ga0105247_10012510 3300009101 Bacteria 5098
449 Ga0105247_10018230 3300009101 Bacteria 4211
450 Ga0114129_10033962 3300009147 Bacteria 7205
451 Ga0114129_10095953 3300009147 Bacteria 4106
452 Ga0105243_10000043 3300009148 Bacteria 158809
453 Ga0105243_10002194 3300009148 Bacteria 16455
454 Ga0105243_10062549 3300009148 Bacteria 2980
455 Ga0105241_10000086 3300009174 Bacteria 69935
456 Ga0105241_10000659 3300009174 Bacteria 25872
457 Ga0105241_10000881 3300009174 Bacteria 22671
458 Ga0105241_10003116 3300009174 Bacteria 12343
459 Ga0105241_10021858 3300009174 Unclassified 4735
460 Ga0105241_10057228 3300009174 Bacteria 2990
461 Ga0105241_10098806 3300009174 Bacteria 2317
462 Ga0105241_10119203 3300009174 Bacteria 2123
463 Ga0105241_10432439 3300009174 Bacteria 1161
464 Ga0105242_10009407 3300009176 Bacteria 7494
465 Ga0105242_10013463 3300009176 Bacteria 6324
466 Ga0105242_10015906 3300009176 Bacteria 5846
467 Ga0105242_10034951 3300009176 Bacteria 4030
468 Ga0105242_10124504 3300009176 Bacteria 2217
469 Ga0105242_10211747 3300009176 Bacteria 1728
470 Ga0105248_10391891 3300009177 Bacteria 1564
471 Ga0105237_10000224 3300009545 Bacteria 79854
472 Ga0105237_10000595 3300009545 Bacteria 50470
473 Ga0105237_10001565 3300009545 Bacteria 29826
474 Ga0105237_10003647 3300009545 Bacteria 18154
475 Ga0105237_10003651 3300009545 Bacteria 18149
476 Ga0105237_10004072 3300009545 Bacteria 17045
477 Ga0105237_10009395 3300009545 Bacteria 10472
478 Ga0105237_10013977 3300009545 Bacteria 8401
479 Ga0105237_10028286 3300009545 Bacteria 5712
480 Ga0105237_10036976 3300009545 Bacteria 4937
481 Ga0105237_10049654 3300009545 Bacteria 4216
482 Ga0105237_10064255 3300009545 Bacteria 3666
483 Ga0105237_10067260 3300009545 Bacteria 3577
484 Ga0105237_10078883 3300009545 Bacteria 3282
485 Ga0105237_10135454 3300009545 Bacteria 2457
486 Ga0105237_10148072 3300009545 Unclassified 2343
487 Ga0105237_10213852 3300009545 Bacteria 1928
488 Ga0105237_10279271 3300009545 Bacteria 1673
489 Ga0105238_10001132 3300009551 Bacteria 26885
490 Ga0105238_10005720 3300009551 Bacteria 12290
491 Ga0105238_10006640 3300009551 Bacteria 11534
492 Ga0105238_10077802 3300009551 Bacteria 3308
493 Ga0105238_10097865 3300009551 Bacteria 2919
494 Ga0105238_10106237 3300009551 Bacteria 2789
495 Ga0105238_10192735 3300009551 Bacteria 2014
496 Ga0105238_10268543 3300009551 Bacteria 1686
497 Ga0105238_10380094 3300009551 Bacteria 1404
498 Ga0105249_10002281 3300009553 Bacteria 16658
499 Ga0105249_10005103 3300009553 Bacteria 11318
500 Ga0105249_10005252 3300009553 Bacteria 11181
501 Ga0105249_10008737 3300009553 Bacteria 8837
502 Ga0105249_10012834 3300009553 Bacteria 7392
503 Ga0105249_10035965 3300009553 Bacteria 4493
504 Ga0105249_10046215 3300009553 Bacteria 3962
505 Ga0105249_10107176 3300009553 Bacteria 2637
506 Ga0105249_10107814 3300009553 Unclassified 2629
507 Ga0105249_10335863 3300009553 Bacteria 1526
508 Ga0105239_10000048 3300010375 Bacteria 177855
509 Ga0105239_10000616 3300010375 Bacteria 50645
510 Ga0105239_10000758 3300010375 Bacteria 45640
511 Ga0105239_10001789 3300010375 Bacteria 28284
512 Ga0105239_10001948 3300010375 Bacteria 26930
513 Ga0105239_10002090 3300010375 Bacteria 25893
514 Ga0105239_10002752 3300010375 Bacteria 22079
515 Ga0105239_10005094 3300010375 Bacteria 15518
516 Ga0105239_10006841 3300010375 Bacteria 13158
517 Ga0105239_10008918 3300010375 Bacteria 11347
518 Ga0105239_10024710 3300010375 Bacteria 6618
519 Ga0105239_10038370 3300010375 Bacteria 5249
520 Ga0105239_10042529 3300010375 Bacteria 4979
521 Ga0105239_10078397 3300010375 Bacteria 3635
522 Ga0105239_10130417 3300010375 Bacteria 2796
523 Ga0105239_10131149 3300010375 Bacteria 2788
524 Ga0105239_10137595 3300010375 Bacteria 2719
525 Ga0105246_10013371 3300011119 Bacteria 5144
526 Ga0105246_10053815 3300011119 Bacteria 2771
527 Ga0157373_10000002 3300013100 Bacteria 750094
528 Ga0157373_10000036 3300013100 Bacteria 122723
529 Ga0157373_10000821 3300013100 Bacteria 24074
530 Ga0157373_10004709 3300013100 Bacteria 10259
531 Ga0157373_10004786 3300013100 Bacteria 10190
532 Ga0157373_10007995 3300013100 Bacteria 7864
533 Ga0157373_10013034 3300013100 Bacteria 6101
534 Ga0157373_10019401 3300013100 Bacteria 4948
535 Ga0157373_10026029 3300013100 Bacteria 4228
536 Ga0157373_10027400 3300013100 Bacteria 4110
537 Ga0157373_10118640 3300013100 Bacteria 1859
538 Ga0157373_10221355 3300013100 Bacteria 1335
539 Ga0157371_10000016 3300013102 Bacteria 330495
540 Ga0157371_10000036 3300013102 Bacteria 215191
541 Ga0157371_10000135 3300013102 Bacteria 107607
542 Ga0157371_10000563 3300013102 Bacteria 43940
543 Ga0157371_10001161 3300013102 Bacteria 28350
544 Ga0157371_10001915 3300013102 Bacteria 20795
545 Ga0157371_10003112 3300013102 Bacteria 15343
546 Ga0157371_10003683 3300013102 Bacteria 13759
547 Ga0157371_10005312 3300013102 Bacteria 10902
548 Ga0157371_10024187 3300013102 Bacteria 4437
549 Ga0157371_10024298 3300013102 Bacteria 4427
550 Ga0157371_10028632 3300013102 Bacteria 4032
551 Ga0157371_10034813 3300013102 Bacteria 3611
552 Ga0157371_10035822 3300013102 Bacteria 3555
553 Ga0157371_10042442 3300013102 Bacteria 3242
554 Ga0157371_10068485 3300013102 Bacteria 2512
555 Ga0157371_10070988 3300013102 Bacteria 2465
556 Ga0157371_10077958 3300013102 Bacteria 2347
557 Ga0157371_10078589 3300013102 Bacteria 2337
558 Ga0157371_10103195 3300013102 Bacteria 2023
559 Ga0157371_10130738 3300013102 Bacteria 1786
560 Ga0157371_10155734 3300013102 Bacteria 1630
561 Ga0157370_10000500 3300013104 Bacteria 48866
562 Ga0157370_10001022 3300013104 Bacteria 35238
563 Ga0157370_10001166 3300013104 Bacteria 32718
564 Ga0157370_10002014 3300013104 Bacteria 24962
565 Ga0157370_10004754 3300013104 Bacteria 15460
566 Ga0157370_10009476 3300013104 Bacteria 10395
567 Ga0157370_10010727 3300013104 Bacteria 9634
568 Ga0157370_10014206 3300013104 Bacteria 8159
569 Ga0157370_10014665 3300013104 Bacteria 8007
570 Ga0157370_10017596 3300013104 Bacteria 7210
571 Ga0157370_10031451 3300013104 Bacteria 5191
572 Ga0157370_10031722 3300013104 Bacteria 5166
573 Ga0157370_10036146 3300013104 Bacteria 4795
574 Ga0157370_10036413 3300013104 Bacteria 4774
575 Ga0157370_10039822 3300013104 Bacteria 4539
576 Ga0157370_10060009 3300013104 Bacteria 3612
577 Ga0157370_10142304 3300013104 Bacteria 2235
578 Ga0157370_10147217 3300013104 Unclassified 2192
579 Ga0157370_10180805 3300013104 Bacteria 1960
580 Ga0157369_10000129 3300013105 Bacteria 108473
581 Ga0157369_10000475 3300013105 Bacteria 53219
582 Ga0157369_10001138 3300013105 Bacteria 33208
583 Ga0157369_10001311 3300013105 Bacteria 30914
584 Ga0157369_10046098 3300013105 Bacteria 4739
585 Ga0157369_10051032 3300013105 Bacteria 4478
586 Ga0157369_10078779 3300013105 Bacteria 3530
587 Ga0157369_10103039 3300013105 Unclassified 3040
588 Ga0157369_10104015 3300013105 Bacteria 3025
589 Ga0157369_10123106 3300013105 Bacteria 2751
590 Ga0157369_10145737 3300013105 Bacteria 2504
591 Ga0157374_10000001 3300013296 Bacteria 1077351
592 Ga0157374_10000128 3300013296 Bacteria 69753
593 Ga0157374_10000202 3300013296 Bacteria 54739
594 Ga0157374_10058779 3300013296 Bacteria 3594
595 Ga0157374_10094451 3300013296 Bacteria 2858
596 Ga0157374_10095724 3300013296 Bacteria 2839
597 Ga0157374_10142797 3300013296 Bacteria 2324
598 Ga0157374_10185874 3300013296 Bacteria 2031
599 Ga0157374_10249613 3300013296 Bacteria 1746
600 Ga0157374_10420002 3300013296 Bacteria 1336
601 Ga0157378_10005717 3300013297 Bacteria 10884
602 Ga0157378_10005849 3300013297 Bacteria 10778
603 Ga0157378_10010586 3300013297 Bacteria 8059
604 Ga0157378_10031758 3300013297 Bacteria 4664
605 Ga0157378_10038652 3300013297 Bacteria 4230
606 Ga0157378_10049204 3300013297 Bacteria 3750
607 Ga0157378_10060809 3300013297 Bacteria 3370
608 Ga0157378_10100527 3300013297 Bacteria 2640
609 Ga0157378_10301761 3300013297 Bacteria 1550
610 Ga0157378_10362527 3300013297 Bacteria 1419
611 Ga0157378_10426561 3300013297 Bacteria 1312
612 Ga0163162_10000032 3300013306 Bacteria 156609
613 Ga0163162_10000152 3300013306 Bacteria 64273
614 Ga0163162_10000236 3300013306 Bacteria 50620
615 Ga0163162_10000331 3300013306 Bacteria 43319
616 Ga0163162_10000967 3300013306 Bacteria 26666
617 Ga0163162_10009046 3300013306 Bacteria 9683
618 Ga0163162_10010809 3300013306 Bacteria 8878
619 Ga0163162_10011763 3300013306 Bacteria 8536
620 Ga0163162_10013133 3300013306 Bacteria 8087
621 Ga0163162_10016026 3300013306 Bacteria 7325
622 Ga0163162_10026171 3300013306 Bacteria 5766
623 Ga0163162_10029333 3300013306 Bacteria 5444
624 Ga0163162_10031876 3300013306 Bacteria 5230
625 Ga0163162_10052634 3300013306 Bacteria 4089
626 Ga0163162_10052936 3300013306 Bacteria 4079
627 Ga0163162_10055013 3300013306 Bacteria 4005
628 Ga0163162_10067516 3300013306 Bacteria 3626
629 Ga0163162_10086163 3300013306 Bacteria 3219
630 Ga0163162_10114892 3300013306 Bacteria 2791
631 Ga0163162_10117466 3300013306 Bacteria 2761
632 Ga0163162_10128129 3300013306 Bacteria 2646
633 Ga0163162_10381208 3300013306 Bacteria 1543
634 Ga0163162_10393182 3300013306 Bacteria 1519
635 Ga0163162_10403773 3300013306 Bacteria 1499
636 Ga0163162_10432294 3300013306 Bacteria 1448
637 Ga0157372_10000017 3300013307 Bacteria 219543
638 Ga0157372_10000061 3300013307 Bacteria 119814
639 Ga0157372_10000921 3300013307 Bacteria 32008
640 Ga0157372_10018588 3300013307 Bacteria 7477
641 Ga0157372_10034779 3300013307 Bacteria 5543
642 Ga0157372_10042883 3300013307 Bacteria 5007
643 Ga0157372_10052962 3300013307 Bacteria 4521
644 Ga0157372_10092410 3300013307 Bacteria 3442
645 Ga0157372_10093593 3300013307 Bacteria 3420
646 Ga0157372_10098360 3300013307 Bacteria 3338
647 Ga0157372_10115846 3300013307 Bacteria 3073
648 Ga0157372_10120930 3300013307 Bacteria 3007
649 Ga0157372_10130498 3300013307 Bacteria 2891
650 Ga0157372_10146950 3300013307 Bacteria 2718
651 Ga0157372_10151239 3300013307 Bacteria 2679
652 Ga0157372_10155057 3300013307 Bacteria 2645
653 Ga0157372_10234220 3300013307 Bacteria 2129
654 Ga0157372_10259321 3300013307 Bacteria 2019
655 Ga0157372_10426779 3300013307 Bacteria 1545
656 Ga0157372_10434537 3300013307 Bacteria 1530
657 Ga0157372_10453975 3300013307 Bacteria 1493
658 Ga0157372_10467762 3300013307 Bacteria 1470
659 Ga0157372_10500769 3300013307 Bacteria 1417
660 Ga0157375_10000229 3300013308 Bacteria 52257
661 Ga0157375_10000910 3300013308 Bacteria 25705
662 Ga0157375_10003117 3300013308 Bacteria 14392
663 Ga0157375_10011803 3300013308 Bacteria 7723
664 Ga0157375_10033928 3300013308 Bacteria 4856
665 Ga0157375_10040512 3300013308 Bacteria 4490
666 Ga0157375_10046217 3300013308 Bacteria 4243
667 Ga0157375_10052220 3300013308 Bacteria 4018
668 Ga0157375_10144618 3300013308 Bacteria 2508
669 Ga0157375_10365735 3300013308 Bacteria 1608
670 Ga0163163_10000477 3300014325 Bacteria 36351
671 Ga0163163_10000653 3300014325 Bacteria 29691
672 Ga0163163_10048819 3300014325 Bacteria 4163
673 Ga0163163_10052489 3300014325 Bacteria 4022
674 Ga0163163_10098082 3300014325 Bacteria 2952
675 Ga0163163_10260990 3300014325 Bacteria 1783
676 Ga0163163_10313114 3300014325 Bacteria 1623
677 Ga0163163_10341979 3300014325 Bacteria 1552
678 Ga0157380_10010112 3300014326 Bacteria 6777
679 Ga0157380_10019234 3300014326 Bacteria 5088
680 Ga0157380_10022125 3300014326 Bacteria 4779
681 Ga0157380_10076848 3300014326 Bacteria 2719
682 Ga0157380_10095552 3300014326 Bacteria 2462
683 Ga0157380_10269005 3300014326 Bacteria 1552
684 Ga0182008_10000006 3300014497 Bacteria 378521
685 Ga0182008_10000011 3300014497 Bacteria 297770
686 Ga0182008_10000818 3300014497 Bacteria 21712
687 Ga0182008_10001192 3300014497 Bacteria 17914
688 Ga0182008_10052173 3300014497 Bacteria 2028
689 Ga0182008_10060873 3300014497 Bacteria 1861
690 Ga0182008_10085277 3300014497 Bacteria 1556
691 Ga0182008_10088475 3300014497 Bacteria 1526
692 Ga0182008_10090629 3300014497 Bacteria 1507
693 Ga0157377_10004205 3300014745 Bacteria 6587
694 Ga0157377_10007108 3300014745 Bacteria 5384
695 Ga0157377_10055979 3300014745 Bacteria 2238
696 Ga0157379_10001640 3300014968 Bacteria 18479
697 Ga0157379_10002723 3300014968 Bacteria 14918
698 Ga0157379_10032061 3300014968 Bacteria 4682
699 Ga0157379_10043311 3300014968 Bacteria 4019
700 Ga0157379_10112740 3300014968 Bacteria 2444
701 Ga0157379_10262260 3300014968 Bacteria 1570
702 Ga0157376_10000721 3300014969 Bacteria 21396
703 Ga0157376_10001279 3300014969 Bacteria 16546
704 Ga0157376_10002407 3300014969 Bacteria 12640
705 Ga0157376_10004414 3300014969 Bacteria 9794
706 Ga0157376_10008360 3300014969 Bacteria 7464
707 Ga0157376_10062287 3300014969 Bacteria 3138
708 Ga0157376_10153139 3300014969 Bacteria 2081
709 Ga0157376_10173014 3300014969 Bacteria 1968
710 Ga0157376_10211479 3300014969 Bacteria 1791
711 Ga0182006_1000011 3300015261 Bacteria 408647
712 Ga0182006_1000068 3300015261 Bacteria 144823
713 Ga0182006_1000869 3300015261 Bacteria 20275
714 Ga0182006_1001629 3300015261 Bacteria 13261
715 Ga0182006_1002952 3300015261 Bacteria 8994
716 Ga0182006_1003367 3300015261 Bacteria 8215
717 Ga0182006_1029738 3300015261 Bacteria 2212
718 Ga0182006_1030063 3300015261 Bacteria 2198
719 Ga0182007_10000003 3300015262 Bacteria 548244
720 Ga0182007_10013574 3300015262 Bacteria 3101
721 Ga0182007_10017113 3300015262 Bacteria 2656
722 Ga0183373_1001 3300015682 Bacteria 1410374
723 Ga0163161_10000012 3300017792 Bacteria 264639
724 Ga0163161_10000074 3300017792 Bacteria 101784
725 Ga0163161_10002988 3300017792 Bacteria 11965
726 Ga0163161_10004613 3300017792 Bacteria 9590
727 Ga0163161_10005307 3300017792 Bacteria 8969
728 Ga0163161_10006285 3300017792 Bacteria 8224
729 Ga0163161_10015370 3300017792 Bacteria 5336
730 Ga0163161_10016813 3300017792 Bacteria 5115
731 Ga0163161_10024699 3300017792 Bacteria 4248
732 Ga0163161_10030157 3300017792 Bacteria 3857
733 Ga0163161_10033399 3300017792 Bacteria 3677
734 Ga0163161_10033761 3300017792 Bacteria 3656
735 Ga0163161_10044131 3300017792 Bacteria 3211
736 Ga0163161_10148063 3300017792 Bacteria 1782
737 Ga0197907_11483478 3300020069 Bacteria 1402
738 Ga0206353_11137735 3300020082 Bacteria 5000
739 Ga0206353_12030687 3300020082 Bacteria 1326
740 Ga0213872_10009314 3300021361 Bacteria 4715
741 Ga0213876_10001528 3300021384 Bacteria 14327
742 Ga0209674_100378 3300025226 Bacteria 23853
743 Ga0207427_100103 3300025231 Bacteria 119618
744 Ga0207427_100115 3300025231 Bacteria 104282
745 Ga0207427_100130 3300025231 Bacteria 94510
746 Ga0209437_100017 3300025233 Bacteria 694471
747 Ga0209437_100020 3300025233 Bacteria 656374
748 Ga0209437_100079 3300025233 Bacteria 275948
749 Ga0209437_100101 3300025233 Bacteria 226668
750 Ga0209258_100151 3300025242 Bacteria 160444
751 Ga0207425_1000002 3300025245 Bacteria 1362590
752 Ga0209646_1000002 3300025246 Bacteria 1425781
753 Ga0209646_1000745 3300025246 Bacteria 11381
754 Ga0209646_1001409 3300025246 Bacteria 6528
755 Ga0209026_1000105 3300025250 Bacteria 150738
756 Ga0209026_1000162 3300025250 Bacteria 102867
757 Ga0209026_1000434 3300025250 Bacteria 34861
758 Ga0209026_1007075 3300025250 Bacteria 2608
759 Ga0209148_1000154 3300025254 Bacteria 145214
760 Ga0209759_1004885 3300025256 Bacteria 4852
761 Ga0209759_1004887 3300025256 Bacteria 4852
762 Ga0209759_1009298 3300025256 Bacteria 2979
763 Ga0209129_1000002 3300025258 Bacteria 1359086
764 Ga0209129_1002458 3300025258 Bacteria 9072
765 Ga0209233_1000020 3300025261 Bacteria 798224
766 Ga0209233_1000121 3300025261 Bacteria 233309
767 Ga0209233_1000124 3300025261 Bacteria 226743
768 Ga0209455_1000560 3300025272 Bacteria 25084
769 Ga0209673_1000208 3300025273 Bacteria 117755
770 Ga0209673_1042251 3300025273 Bacteria 1284
771 Ga0209130_1005416 3300025284 Bacteria 4431
772 Ga0209675_1000033 3300025291 Bacteria 271576
773 Ga0209675_1003459 3300025291 Bacteria 7489
774 Ga0209676_1000008 3300025292 Bacteria 991778
775 Ga0209676_1000390 3300025292 Bacteria 80030
776 Ga0209676_1001110 3300025292 Bacteria 29893
777 Ga0209676_1002036 3300025292 Bacteria 15843
778 Ga0209676_1004629 3300025292 Bacteria 7572
779 Ga0209676_1007535 3300025292 Bacteria 5078
780 Ga0209025_1000004 3300025294 Bacteria 1361782
781 Ga0209025_1009272 3300025294 Bacteria 6891
782 Ga0209564_1006739 3300025295 Bacteria 6100
783 Ga0209564_1014033 3300025295 Bacteria 3359
784 Ga0209564_1014047 3300025295 Bacteria 3357
785 Ga0209758_1000006 3300025297 Bacteria 1359562
786 Ga0209758_1003065 3300025297 Bacteria 15894
787 Ga0209758_1020284 3300025297 Bacteria 3153
788 Ga0209050_1000045 3300025298 Bacteria 388022
789 Ga0209050_1000134 3300025298 Bacteria 184417
790 Ga0209256_1003208 3300025299 Bacteria 11815
791 Ga0209256_1028734 3300025299 Bacteria 1563
792 Ga0207426_1000002 3300025302 Bacteria 1249660
793 Ga0207426_1000051 3300025302 Bacteria 391700
794 Ga0207426_1000497 3300025302 Bacteria 58506
795 Ga0207426_1001981 3300025302 Bacteria 14539
796 Ga0207426_1006084 3300025302 Bacteria 5323
797 Ga0209257_1000001 3300025304 Bacteria 2274655
798 Ga0209257_1000006 3300025304 Bacteria 1570111
799 Ga0209257_1001605 3300025304 Bacteria 25882
800 Ga0209257_1003878 3300025304 Bacteria 12208
801 Ga0209257_1008310 3300025304 Bacteria 5948
802 Ga0207656_10007257 3300025321 Bacteria 4026
803 Ga0207656_10107870 3300025321 Bacteria 1284
804 Ga0207655_1000008 3300025728 Bacteria 734289
805 Ga0207655_1005122 3300025728 Bacteria 9034
806 Ga0207682_10010357 3300025893 Bacteria 3654
807 Ga0207682_10033618 3300025893 Bacteria 2065
808 Ga0207692_10028338 3300025898 Bacteria 2648
809 Ga0207642_10142856 3300025899 Bacteria 1264
810 Ga0207710_10002439 3300025900 Bacteria 8644
811 Ga0207710_10002748 3300025900 Bacteria 8047
812 Ga0207710_10008558 3300025900 Bacteria 4313
813 Ga0207688_10130719 3300025901 Bacteria 1472
814 Ga0207680_10000006 3300025903 Bacteria 635950
815 Ga0207680_10000162 3300025903 Bacteria 32782
816 Ga0207680_10023544 3300025903 Bacteria 3365
817 Ga0207680_10028103 3300025903 Bacteria 3142
818 Ga0207680_10039495 3300025903 Bacteria 2739
819 Ga0207680_10052159 3300025903 Bacteria 2449
820 Ga0207680_10208101 3300025903 Bacteria 1336
821 Ga0207647_10000105 3300025904 Bacteria 65502
822 Ga0207647_10000511 3300025904 Bacteria 30935
823 Ga0207647_10011313 3300025904 Bacteria 6265
824 Ga0207647_10018195 3300025904 Bacteria 4761
825 Ga0207647_10025074 3300025904 Bacteria 3925
826 Ga0207647_10027673 3300025904 Bacteria 3693
827 Ga0207647_10041070 3300025904 Bacteria 2910
828 Ga0207647_10080460 3300025904 Bacteria 1954
829 Ga0207645_10000622 3300025907 Bacteria 29378
830 Ga0207645_10001210 3300025907 Bacteria 21312
831 Ga0207645_10003591 3300025907 Bacteria 11736
832 Ga0207645_10004714 3300025907 Bacteria 10031
833 Ga0207643_10023368 3300025908 Bacteria 3408
834 Ga0207643_10104056 3300025908 Bacteria 1667
835 Ga0207643_10130808 3300025908 Bacteria 1493
836 Ga0207705_10000079 3300025909 Bacteria 119999
837 Ga0207705_10061750 3300025909 Bacteria 2707
838 Ga0207705_10090827 3300025909 Bacteria 2236
839 Ga0207705_10093493 3300025909 Bacteria 2204
840 Ga0207705_10125830 3300025909 Bacteria 1905
841 Ga0207654_10003772 3300025911 Bacteria 7635
842 Ga0207654_10005580 3300025911 Bacteria 6363
843 Ga0207654_10016294 3300025911 Bacteria 3868
844 Ga0207707_10000051 3300025912 Bacteria 117204
845 Ga0207707_10003389 3300025912 Bacteria 14147
846 Ga0207707_10038834 3300025912 Bacteria 4161
847 Ga0207707_10170685 3300025912 Bacteria 1901
848 Ga0207707_10283405 3300025912 Bacteria 1435
849 Ga0207695_10000013 3300025913 Bacteria 821265
850 Ga0207695_10000071 3300025913 Bacteria 315568
851 Ga0207695_10000084 3300025913 Bacteria 282392
852 Ga0207695_10000102 3300025913 Bacteria 257838
853 Ga0207695_10000323 3300025913 Bacteria 114265
854 Ga0207695_10001232 3300025913 Bacteria 43800
855 Ga0207695_10004447 3300025913 Bacteria 19105
856 Ga0207695_10004602 3300025913 Bacteria 18731
857 Ga0207695_10009118 3300025913 Bacteria 12316
858 Ga0207695_10015643 3300025913 Bacteria 8923
859 Ga0207695_10023061 3300025913 Bacteria 7045
860 Ga0207695_10026849 3300025913 Bacteria 6420
861 Ga0207695_10040999 3300025913 Bacteria 4957
862 Ga0207695_10047480 3300025913 Bacteria 4544
863 Ga0207695_10084921 3300025913 Bacteria 3195
864 Ga0207695_10094245 3300025913 Bacteria 3002
865 Ga0207695_10276714 3300025913 Unclassified 1573
866 Ga0207671_10000036 3300025914 Bacteria 236133
867 Ga0207671_10000272 3300025914 Bacteria 77080
868 Ga0207671_10000726 3300025914 Bacteria 41902
869 Ga0207671_10001497 3300025914 Bacteria 26937
870 Ga0207671_10002907 3300025914 Bacteria 17690
871 Ga0207671_10005889 3300025914 Bacteria 11125
872 Ga0207671_10008744 3300025914 Bacteria 8532
873 Ga0207671_10014622 3300025914 Bacteria 6192
874 Ga0207671_10021459 3300025914 Bacteria 4901
875 Ga0207671_10042678 3300025914 Bacteria 3356
876 Ga0207671_10119462 3300025914 Bacteria 2013
877 Ga0207671_10119489 3300025914 Bacteria 2013
878 Ga0207660_10044410 3300025917 Bacteria 3126
879 Ga0207660_10055888 3300025917 Bacteria 2823
880 Ga0207660_10249322 3300025917 Bacteria 1401
881 Ga0207662_10004762 3300025918 Bacteria 7171
882 Ga0207662_10016297 3300025918 Bacteria 4192
883 Ga0207657_10021748 3300025919 Bacteria 6027
884 Ga0207657_10031993 3300025919 Bacteria 4758
885 Ga0207657_10049273 3300025919 Bacteria 3672
886 Ga0207657_10049826 3300025919 Bacteria 3647
887 Ga0207657_10110330 3300025919 Bacteria 2272
888 Ga0207649_10023770 3300025920 Bacteria 3553
889 Ga0207649_10150443 3300025920 Bacteria 1603
890 Ga0207652_10000384 3300025921 Bacteria 46082
891 Ga0207652_10001696 3300025921 Bacteria 19285
892 Ga0207652_10061632 3300025921 Bacteria 3239
893 Ga0207681_10037670 3300025923 Bacteria 3198
894 Ga0207694_10003086 3300025924 Bacteria 13334
895 Ga0207694_10006130 3300025924 Bacteria 9187
896 Ga0207694_10007231 3300025924 Bacteria 8426
897 Ga0207694_10092271 3300025924 Bacteria 2390
898 Ga0207694_10097905 3300025924 Bacteria 2321
899 Ga0207650_10019073 3300025925 Bacteria 4820
900 Ga0207650_10042343 3300025925 Bacteria 3341
901 Ga0207650_10062339 3300025925 Bacteria 2786
902 Ga0207650_10066978 3300025925 Bacteria 2694
903 Ga0207650_10084184 3300025925 Bacteria 2417
904 Ga0207650_10173709 3300025925 Bacteria 1714
905 Ga0207659_10008155 3300025926 Bacteria 6484
906 Ga0207659_10053334 3300025926 Bacteria 2884
907 Ga0207687_10196626 3300025927 Bacteria 1573
908 Ga0207700_10003865 3300025928 Bacteria 8752
909 Ga0207664_10022981 3300025929 Bacteria 4666
910 Ga0207644_10002938 3300025931 Bacteria 10975
911 Ga0207644_10041897 3300025931 Bacteria 3241
912 Ga0207644_10075688 3300025931 Bacteria 2474
913 Ga0207690_10000314 3300025932 Bacteria 32801
914 Ga0207690_10000318 3300025932 Bacteria 32496
915 Ga0207690_10000797 3300025932 Bacteria 20327
916 Ga0207690_10008204 3300025932 Bacteria 6196
917 Ga0207690_10023288 3300025932 Bacteria 3864
918 Ga0207690_10052218 3300025932 Bacteria 2737
919 Ga0207690_10058473 3300025932 Bacteria 2608
920 Ga0207690_10076849 3300025932 Bacteria 2320
921 Ga0207690_10103318 3300025932 Bacteria 2039
922 Ga0207706_10000120 3300025933 Bacteria 84222
923 Ga0207706_10027522 3300025933 Bacteria 5083
924 Ga0207706_10029817 3300025933 Bacteria 4869
925 Ga0207706_10064116 3300025933 Bacteria 3235
926 Ga0207706_10083306 3300025933 Bacteria 2811
927 Ga0207706_10153267 3300025933 Bacteria 2027
928 Ga0207686_10000546 3300025934 Bacteria 24296
929 Ga0207686_10024502 3300025934 Bacteria 3498
930 Ga0207686_10093300 3300025934 Bacteria 1993
931 Ga0207686_10103114 3300025934 Unclassified 1908
932 Ga0207709_10000021 3300025935 Bacteria 386722
933 Ga0207709_10001686 3300025935 Bacteria 14848
934 Ga0207670_10080132 3300025936 Bacteria 2281
935 Ga0207704_10000099 3300025938 Bacteria 48088
936 Ga0207691_10002527 3300025940 Bacteria 17886
937 Ga0207691_10004310 3300025940 Bacteria 13818
938 Ga0207691_10027226 3300025940 Bacteria 5363
939 Ga0207691_10172503 3300025940 Bacteria 1893
940 Ga0207691_10230027 3300025940 Bacteria 1606
941 Ga0207689_10008841 3300025942 Bacteria 8746
942 Ga0207689_10009849 3300025942 Bacteria 8237
943 Ga0207689_10017703 3300025942 Bacteria 6022
944 Ga0207689_10022258 3300025942 Bacteria 5329
945 Ga0207689_10025477 3300025942 Bacteria 4956
946 Ga0207689_10066990 3300025942 Bacteria 2951
947 Ga0207689_10085796 3300025942 Bacteria 2588
948 Ga0207689_10100672 3300025942 Bacteria 2374
949 Ga0207689_10169592 3300025942 Bacteria 1799
950 Ga0207661_10027722 3300025944 Bacteria 4330
951 Ga0207679_10007258 3300025945 Bacteria 7021
952 Ga0207679_10011633 3300025945 Bacteria 5711
953 Ga0207679_10025004 3300025945 Bacteria 4102
954 Ga0207679_10036528 3300025945 Bacteria 3485
955 Ga0207679_10070427 3300025945 Bacteria 2635
956 Ga0207667_10000037 3300025949 Bacteria 297252
957 Ga0207667_10000177 3300025949 Bacteria 92852
958 Ga0207667_10007957 3300025949 Bacteria 12648
959 Ga0207667_10011669 3300025949 Bacteria 10195
960 Ga0207667_10015290 3300025949 Bacteria 8725
961 Ga0207667_10017914 3300025949 Bacteria 7961
962 Ga0207667_10028059 3300025949 Bacteria 6116
963 Ga0207667_10028127 3300025949 Bacteria 6107
964 Ga0207667_10038231 3300025949 Bacteria 5127
965 Ga0207667_10048612 3300025949 Bacteria 4485
966 Ga0207667_10064211 3300025949 Bacteria 3834
967 Ga0207667_10066061 3300025949 Bacteria 3771
968 Ga0207667_10144396 3300025949 Bacteria 2450
969 Ga0207667_10195765 3300025949 Bacteria 2074
970 Ga0207667_10223392 3300025949 Bacteria 1930
971 Ga0207667_10224780 3300025949 Bacteria 1923
972 Ga0207651_10001099 3300025960 Bacteria 12009
973 Ga0207651_10005116 3300025960 Bacteria 6696
974 Ga0207651_10021365 3300025960 Bacteria 3933
975 Ga0207651_10037220 3300025960 Bacteria 3186
976 Ga0207712_10002040 3300025961 Bacteria 13248
977 Ga0207712_10002656 3300025961 Bacteria 11439
978 Ga0207712_10004495 3300025961 Bacteria 8810
979 Ga0207712_10005109 3300025961 Bacteria 8305
980 Ga0207712_10007103 3300025961 Bacteria 7062
981 Ga0207712_10016647 3300025961 Bacteria 4766
982 Ga0207712_10037202 3300025961 Bacteria 3319
983 Ga0207668_10135219 3300025972 Bacteria 1888
984 Ga0207668_10165388 3300025972 Bacteria 1729
985 Ga0207640_10014412 3300025981 Bacteria 4553
986 Ga0207640_10043616 3300025981 Bacteria 2868
987 Ga0207640_10088672 3300025981 Bacteria 2136
988 Ga0207640_10300155 3300025981 Bacteria 1270
989 Ga0207658_10007260 3300025986 Bacteria 7555
990 Ga0207658_10024494 3300025986 Bacteria 4224
991 Ga0207658_10079172 3300025986 Bacteria 2513
992 Ga0207658_10105398 3300025986 Bacteria 2217
993 Ga0207658_10156711 3300025986 Bacteria 1862
994 Ga0207658_10249189 3300025986 Bacteria 1508
995 Ga0207658_10327430 3300025986 Bacteria 1328
996 Ga0207677_10014691 3300026023 Bacteria 4581
997 Ga0207677_10085142 3300026023 Bacteria 2281
998 Ga0207677_10159092 3300026023 Bacteria 1753
999 Ga0207703_10004370 3300026035 Bacteria 11617
1000 Ga0207703_10102381 3300026035 Bacteria 2430
1001 Ga0207703_10158557 3300026035 Bacteria 1980
1002 Ga0207639_10001126 3300026041 Bacteria 18166
1003 Ga0207639_10015924 3300026041 Bacteria 5309
1004 Ga0207639_10022108 3300026041 Bacteria 4578
1005 Ga0207639_10047659 3300026041 Bacteria 3240
1006 Ga0207639_10065475 3300026041 Bacteria 2821
1007 Ga0207639_10151182 3300026041 Bacteria 1944
1008 Ga0207639_10242079 3300026041 Bacteria 1569
1009 Ga0207639_10292829 3300026041 Bacteria 1436
1010 Ga0207678_10009382 3300026067 Bacteria 8612
1011 Ga0207678_10038074 3300026067 Bacteria 4181
1012 Ga0207678_10124809 3300026067 Bacteria 2196
1013 Ga0207702_10000196 3300026078 Bacteria 71703
1014 Ga0207702_10005976 3300026078 Bacteria 10568
1015 Ga0207702_10009327 3300026078 Bacteria 8244
1016 Ga0207702_10032297 3300026078 Bacteria 4368
1017 Ga0207702_10042660 3300026078 Bacteria 3806
1018 Ga0207702_10057179 3300026078 Bacteria 3315
1019 Ga0207702_10105221 3300026078 Bacteria 2499
1020 Ga0207702_10107011 3300026078 Bacteria 2479
1021 Ga0207702_10206373 3300026078 Bacteria 1824
1022 Ga0207702_10251550 3300026078 Bacteria 1660
1023 Ga0207641_10000226 3300026088 Bacteria 72539
1024 Ga0207641_10000253 3300026088 Bacteria 67848
1025 Ga0207641_10043904 3300026088 Bacteria 3757
1026 Ga0207641_10196855 3300026088 Bacteria 1855
1027 Ga0207648_10002506 3300026089 Bacteria 19710
1028 Ga0207648_10003327 3300026089 Bacteria 16884
1029 Ga0207648_10004019 3300026089 Bacteria 15269
1030 Ga0207648_10018210 3300026089 Bacteria 6362
1031 Ga0207648_10021796 3300026089 Bacteria 5756
1032 Ga0207648_10034323 3300026089 Bacteria 4472
1033 Ga0207648_10060760 3300026089 Bacteria 3295
1034 Ga0207648_10104599 3300026089 Bacteria 2483
1035 Ga0207676_10009837 3300026095 Bacteria 6802
1036 Ga0207676_10045351 3300026095 Bacteria 3396
1037 Ga0207676_10063266 3300026095 Bacteria 2938
1038 Ga0207676_10120226 3300026095 Bacteria 2214
1039 Ga0207676_10159764 3300026095 Bacteria 1951
1040 Ga0207676_10224103 3300026095 Unclassified 1676
1041 Ga0207674_10000672 3300026116 Bacteria 44419
1042 Ga0207674_10006740 3300026116 Bacteria 13484
1043 Ga0207674_10017537 3300026116 Bacteria 7811
1044 Ga0207674_10021327 3300026116 Bacteria 6980
1045 Ga0207674_10047238 3300026116 Bacteria 4415
1046 Ga0207674_10048707 3300026116 Bacteria 4336
1047 Ga0207674_10054469 3300026116 Bacteria 4072
1048 Ga0207674_10054880 3300026116 Bacteria 4054
1049 Ga0207674_10084731 3300026116 Bacteria 3166
1050 Ga0207674_10103679 3300026116 Bacteria 2823
1051 Ga0207674_10106119 3300026116 Bacteria 2787
1052 Ga0207674_10110348 3300026116 Bacteria 2726
1053 Ga0207674_10136063 3300026116 Unclassified 2419
1054 Ga0207674_10264485 3300026116 Bacteria 1668
1055 Ga0207675_100000304 3300026118 Bacteria 47181
1056 Ga0207675_100014435 3300026118 Bacteria 7364
1057 Ga0207675_100048449 3300026118 Bacteria 3966
1058 Ga0207675_100080172 3300026118 Bacteria 3060
1059 Ga0207675_100083807 3300026118 Bacteria 2990
1060 Ga0207683_10003712 3300026121 Bacteria 13255
1061 Ga0207683_10005010 3300026121 Bacteria 11378
1062 Ga0207683_10250288 3300026121 Bacteria 1617
1063 Ga0207698_10001082 3300026142 Bacteria 15843
1064 Ga0207698_10002060 3300026142 Bacteria 11858
1065 Ga0207698_10004520 3300026142 Bacteria 8484
1066 Ga0207698_10056964 3300026142 Bacteria 3020
1067 Ga0207698_10174689 3300026142 Bacteria 1896
1068 Ga0209281_1000094 3300027111 Bacteria 238155
1069 Ga0209995_1001337 3300027471 Bacteria 3795
1070 Ga0209968_1002355 3300027526 Bacteria 2857
1071 Ga0210002_1001420 3300027617 Bacteria 3370
1072 Ga0209974_10017789 3300027876 Bacteria 2356
1073 Ga0207428_10179661 3300027907 Bacteria 1599
1074 Ga0268266_10000018 3300028379 Bacteria 569141
1075 Ga0268266_10000021 3300028379 Bacteria 522453
1076 Ga0268266_10000049 3300028379 Bacteria 307763
1077 Ga0268266_10071433 3300028379 Bacteria 3008
1078 Ga0268265_10014622 3300028380 Bacteria 5351
1079 Ga0268265_10019901 3300028380 Bacteria 4675
1080 Ga0268265_10138654 3300028380 Bacteria 2033
1081 Ga0268265_10235540 3300028380 Bacteria 1612
1082 Ga0268264_10000041 3300028381 Bacteria 372501
1083 Ga0268264_10001720 3300028381 Bacteria 20153
1084 Ga0268264_10003107 3300028381 Bacteria 14381
1085 Ga0268264_10003860 3300028381 Bacteria 12861
1086 Ga0268264_10009362 3300028381 Bacteria 8107
1087 Ga0268264_10011235 3300028381 Bacteria 7398
1088 Ga0268264_10014882 3300028381 Bacteria 6389
1089 Ga0268264_10022519 3300028381 Bacteria 5143
1090 Ga0268264_10054823 3300028381 Bacteria 3330
1091 Ga0268264_10066048 3300028381 Bacteria 3050
1092 Ga0268264_10166098 3300028381 Bacteria 1992
1093 Ga0268264_10274850 3300028381 Bacteria 1575
1094 Ga0265334_10005205 3300028573 Bacteria 5701
1095 Ga0265323_10000381 3300028653 Bacteria 25539
1096 Ga0307517_10002048 3300028786 Bacteria 32795
1097 Ga0307517_10004683 3300028786 Bacteria 20955
1098 Ga0307515_10000001 3300028794 Bacteria 4259510
1099 Ga0307515_10001752 3300028794 Bacteria 48338
1100 Ga0307515_10002910 3300028794 Bacteria 36374
1101 Ga0307515_10014453 3300028794 Bacteria 14631
1102 Ga0307515_10086237 3300028794 Bacteria 4005
1103 Ga0265338_10000471 3300028800 Bacteria 71881
1104 Ga0265338_10138998 3300028800 Bacteria 1905
1105 Ga0307511_10000042 3300030521 Bacteria 102114
1106 Ga0316177_1198244 3300030731 Bacteria 7343
1107 Ga0316176_1050137 3300030732 Bacteria 14004
1108 Ga0314311_1025340 3300030733 Bacteria 9144
1109 Ga0316183_1065995 3300030742 Bacteria 27909
1110 Ga0316181_1148726 3300030744 Bacteria 7875
1111 Ga0265327_10000010 3300031251 Bacteria 566817
1112 Ga0265327_10000192 3300031251 Bacteria 129439
1113 Ga0265327_10000653 3300031251 Bacteria 55957
1114 Ga0265327_10000972 3300031251 Bacteria 40973
1115 Ga0265316_10000618 3300031344 Bacteria 39590
1116 Ga0265316_10028488 3300031344 Bacteria 4608
1117 Ga0307509_10026381 3300031507 Bacteria 6479
1118 Ga0307509_10105279 3300031507 Bacteria 2843
1119 Ga0307408_100000121 3300031548 Bacteria 85849
1120 Ga0307408_100000611 3300031548 Bacteria 30550
1121 Ga0307408_100000660 3300031548 Bacteria 28737
1122 Ga0307408_100001373 3300031548 Bacteria 18154
1123 Ga0307408_100002250 3300031548 Bacteria 13771
1124 Ga0307408_100129664 3300031548 Unclassified 1966
1125 Ga0307408_100160155 3300031548 Bacteria 1787
1126 Ga0307508_10002100 3300031616 Bacteria 21430
1127 Ga0316575_10070219 3300031665 Bacteria 1407
1128 Ga0265342_10123102 3300031712 Bacteria 1459
1129 Ga0316576_10008094 3300031727 Bacteria 6672
1130 Ga0316576_10075969 3300031727 Bacteria 2485
1131 Ga0316578_10044042 3300031728 Unclassified 2594
1132 Ga0316578_10162598 3300031728 Bacteria 1346
1133 Ga0307516_10003117 3300031730 Bacteria 21573
1134 Ga0307405_10000003 3300031731 Bacteria 569064
1135 Ga0307405_10156175 3300031731 Bacteria 1610
1136 Ga0316577_10004430 3300031733 Bacteria 7246
1137 Ga0316577_10026440 3300031733 Bacteria 3233
1138 Ga0307413_10001112 3300031824 Bacteria 9834
1139 Ga0307413_10185404 3300031824 Bacteria 1488
1140 Ga0307410_10000067 3300031852 Bacteria 37092
1141 Ga0307410_10001320 3300031852 Bacteria 11079
1142 Ga0307410_10003139 3300031852 Bacteria 8213
1143 Ga0307406_10000035 3300031901 Bacteria 82953
1144 Ga0307406_10008639 3300031901 Bacteria 5692
1145 Ga0307406_10083253 3300031901 Bacteria 2133
1146 Ga0307406_10147620 3300031901 Bacteria 1673
1147 Ga0307407_10000008 3300031903 Bacteria 191228
1148 Ga0307407_10004708 3300031903 Bacteria 5831
1149 Ga0307407_10048190 3300031903 Bacteria 2423
1150 Ga0307412_10000012 3300031911 Bacteria 404180
1151 Ga0307412_10000427 3300031911 Bacteria 25500
1152 Ga0307412_10001456 3300031911 Bacteria 13169
1153 Ga0307412_10031631 3300031911 Bacteria 3344
1154 Ga0307409_100006323 3300031995 Bacteria 6943
1155 Ga0307409_100008566 3300031995 Bacteria 6218
1156 Ga0307409_100063317 3300031995 Bacteria 2900
1157 Ga0307416_100000009 3300032002 Bacteria 374271
1158 Ga0307416_100000010 3300032002 Bacteria 320243
1159 Ga0307416_100000639 3300032002 Bacteria 18075
1160 Ga0307416_100063210 3300032002 Bacteria 3030
1161 Ga0307414_10000009 3300032004 Bacteria 359782
1162 Ga0307414_10000038 3300032004 Bacteria 150774
1163 Ga0307414_10000063 3300032004 Bacteria 107710
1164 Ga0307414_10002879 3300032004 Bacteria 9086
1165 Ga0307414_10004631 3300032004 Bacteria 7486
1166 Ga0307414_10008231 3300032004 Bacteria 5899
1167 Ga0307414_10010064 3300032004 Bacteria 5464
1168 Ga0307414_10014324 3300032004 Bacteria 4751
1169 Ga0307414_10033966 3300032004 Bacteria 3376
1170 Ga0307414_10086212 3300032004 Bacteria 2316
1171 Ga0307414_10131628 3300032004 Bacteria 1943
1172 Ga0307414_10207829 3300032004 Bacteria 1597
1173 Ga0307411_10000001 3300032005 Bacteria 931810
1174 Ga0307411_10003236 3300032005 Bacteria 7504
1175 Ga0307411_10108067 3300032005 Bacteria 1984
1176 Ga0307415_100012792 3300032126 Bacteria 4868
1177 Ga0307415_100050534 3300032126 Unclassified 2818
1178 Ga0316580_10014554 3300032139 Bacteria 2402
1179 Ga0307507_10000064 3300033179 Bacteria 161226
1180 Ga0307507_10110315 3300033179 Bacteria 2252
1181 Ga0307510_10002860 3300033180 Bacteria 19841
1182 Ga0307510_10006943 3300033180 Bacteria 13500
1183 Ga0307510_10041880 3300033180 Bacteria 4999
1184 Ga0373941_0013117 3300035115 Bacteria 2184
1185 Ga0316574_0101490 3300035398 Bacteria 1842
1186 Ga0373927_0005849 3300035695 Bacteria 8433
1187 Ga0373947_0056584 3300035725 Bacteria 2371
1188 Ga0373937_0078419 3300036401 Bacteria 3053
1189 Ga0373937_0287874 3300036401 Bacteria 1552
1190 Ga0316582_0015711 3300036647 Bacteria 4340
1191 Ga0316582_0120513 3300036647 Unclassified 1755
1192 Ga0316584_0004574 3300036712 Bacteria 9170
1193 Ga0316584_0004745 3300036712 Bacteria 9012
1194 Ga0316584_0294557 3300036712 Unclassified 1176
1195 Ga0395899_0000025 3300037312 Bacteria 350927
1196 Ga0395899_0000033 3300037312 Bacteria 306589
1197 Ga0395899_0000493 3300037312 Bacteria 44066
1198 Ga0395899_0000629 3300037312 Bacteria 36706
1199 Ga0395899_0001884 3300037312 Bacteria 17312
1200 Ga0395899_0029186 3300037312 Bacteria 4149
1201 Ga0395899_0041383 3300037312 Bacteria 3443
1202 Ga0395899_0066951 3300037312 Bacteria 2636
1203 Ga0395899_0126590 3300037312 Bacteria 1826
1204 Ga0395900_0000480 3300037418 Bacteria 56578
1205 Ga0395900_0000506 3300037418 Bacteria 54890
1206 Ga0395900_0006601 3300037418 Bacteria 12073
1207 Ga0395900_0009920 3300037418 Bacteria 9750
1208 Ga0395900_0012177 3300037418 Bacteria 8793
1209 Ga0395900_0108003 3300037418 Bacteria 2859
1210 Ga0395900_0194491 3300037418 Bacteria 2055
1211 Ga0395898_0001651 3300037466 Bacteria 30118
1212 Ga0395898_0006652 3300037466 Bacteria 12328
1213 Ga0395898_0021259 3300037466 Bacteria 6581
1214 Ga0395898_0031717 3300037466 Bacteria 5277
1215 Ga0395898_0032624 3300037466 Bacteria 5199
1216 Ga0395898_0056108 3300037466 Bacteria 3841
1217 Ga0395898_0058562 3300037466 Bacteria 3750
1218 Ga0395898_0095872 3300037466 Bacteria 2850
1219 Ga0395898_0097172 3300037466 Bacteria 2829
1220 Ga0395905_0000254 3300037471 Bacteria 79953
1221 Ga0395905_0000738 3300037471 Bacteria 43061
1222 Ga0395905_0001166 3300037471 Bacteria 32800
1223 Ga0395905_0006569 3300037471 Bacteria 11683
1224 Ga0395905_0064234 3300037471 Bacteria 3435
1225 Ga0395901_0000853 3300038443 Bacteria 33521
1226 Ga0395901_0004350 3300038443 Bacteria 14289
1227 Ga0395901_0010578 3300038443 Bacteria 9348
1228 Ga0395901_0013263 3300038443 Bacteria 8369
1229 Ga0395901_0041573 3300038443 Bacteria 4765
1230 Ga0395901_0059253 3300038443 Bacteria 3983
1231 Ga0395901_0119295 3300038443 Bacteria 2772
1232 Ga0395901_0293579 3300038443 Bacteria 1686
1233 Ga0400491_13685 3300038727 Bacteria 1556
1234 Ga0400488_26420 3300038741 Bacteria 1348
1235 Ga0400483_075612 3300039062 Bacteria 31325
1236 Ga0400483_151915 3300039062 Bacteria 21081
1237 Ga0436365_0688175 3300039437 Bacteria 1274
1238 Ga0436365_1079918 3300039437 Bacteria 37760
1239 Ga0436361_0021149 3300039447 Bacteria 8615
1240 Ga0439436_0033356 3300041404 Bacteria 1491
1241 Ga0439439_0011270 3300041406 Bacteria 2150
1242 Ga0439466_0001850 3300041411 Bacteria 8310
1243 Ga0439431_0010163 3300041997 Bacteria 2133
1244 Ga0439442_001916 3300042002 Bacteria 4086
1245 Ga0439445_0005056 3300042004 Bacteria 2995
1246 Ga0439449_0047197 3300042007 Bacteria 1595
1247 Ga0439457_003825 3300042014 Bacteria 4037
1248 Ga0439462_0005205 3300042015 Bacteria 3198
1249 Ga0450898_003860 3300042134 Bacteria 2180
1250 Ga0439459_0002997 3300042438 Bacteria 2649
1251 Ga0451577_0001046 3300042876 Bacteria 40002
1252 Ga0451577_0002168 3300042876 Bacteria 23990
1253 Ga0451577_0005746 3300042876 Bacteria 12578
1254 Ga0451577_0044094 3300042876 Bacteria 3993
1255 Ga0451577_0092006 3300042876 Bacteria 2708
1256 Ga0451577_0119738 3300042876 Bacteria 2358
1257 Ga0451577_0173668 3300042876 Bacteria 1942
1258 Ga0466969_0000912 3300044656 Bacteria 15928
1259 Ga0466972_0000002 3300044658 Bacteria 408005
1260 Ga0466972_0000013 3300044658 Bacteria 229345
1261 Ga0466972_0036255 3300044658 Bacteria 2413
1262 Ga0466982_0000020 3300044672 Bacteria 99164
1263 Ga0453683_0000594 3300044673 Bacteria 40002
1264 Ga0453683_0001699 3300044673 Bacteria 18345
1265 Ga0453683_0048234 3300044673 Bacteria 2671
1266 Ga0466965_0031585 3300044683 Bacteria 2583
1267 Ga0466966_0000045 3300044684 Bacteria 92504
1268 Ga0466966_0008999 3300044684 Bacteria 6617
1269 Ga0466966_0053935 3300044684 Bacteria 2549
1270 Ga0466961_0033719 3300044693 Bacteria 3289
1271 Ga0466964_0060823 3300044706 Bacteria 1571
1272 Ga0453684_0000165 3300044712 Bacteria 294572
1273 Ga0453684_0000432 3300044712 Bacteria 170746
1274 Ga0453684_0000889 3300044712 Bacteria 99678
1275 Ga0453684_0001834 3300044712 Bacteria 55525
1276 Ga0453684_0002066 3300044712 Bacteria 51033
1277 Ga0453684_0002932 3300044712 Bacteria 40002
1278 Ga0453684_0003998 3300044712 Bacteria 32179
1279 Ga0453684_0004204 3300044712 Bacteria 30947
1280 Ga0453684_0006105 3300044712 Bacteria 23232
1281 Ga0453684_0007145 3300044712 Bacteria 20778
1282 Ga0453684_0009766 3300044712 Bacteria 16663
1283 Ga0453684_0017983 3300044712 Bacteria 10888
1284 Ga0453684_0027844 3300044712 Bacteria 8087
1285 Ga0453684_0027912 3300044712 Bacteria 8075
1286 Ga0453684_0032909 3300044712 Bacteria 7239
1287 Ga0453684_0048440 3300044712 Bacteria 5620
1288 Ga0453684_0071008 3300044712 Bacteria 4405
1289 Ga0453684_0097891 3300044712 Bacteria 3599
1290 Ga0453684_0110447 3300044712 Bacteria 3342
1291 Ga0453684_0114624 3300044712 Bacteria 3267
1292 Ga0453684_0354844 3300044712 Bacteria 1652
1293 Ga0453684_0508637 3300044712 Bacteria 1332
1294 Ga0466971_0011181 3300044719 Bacteria 3932
1295 Ga0466968_0012998 3300044735 Bacteria 3267
1296 Ga0466968_0016306 3300044735 Bacteria 2956
1297 Ga0466968_0038964 3300044735 Bacteria 1999
1298 Ga0466970_0000765 3300044765 Bacteria 15584
1299 Ga0466970_0024226 3300044765 Bacteria 3173
1300 Ga0466970_0045474 3300044765 Bacteria 2338
1301 Ga0466970_0057555 3300044765 Bacteria 2079
1302 Ga0466957_0000070 3300044842 Bacteria 39824
1303 Ga0466957_0003333 3300044842 Bacteria 8805
1304 Ga0466959_0000023 3300045049 Bacteria 124545
1305 Ga0466959_0004264 3300045049 Bacteria 9538
1306 Ga0466959_0099272 3300045049 Bacteria 2085
1307 Ga0466959_0216616 3300045049 Bacteria 1329
1308 Ga0451576_0000003 3300045051 Bacteria 1550573
1309 Ga0451576_0000113 3300045051 Bacteria 208644
1310 Ga0451576_0001464 3300045051 Bacteria 40002
1311 Ga0451576_0007020 3300045051 Bacteria 13616
1312 Ga0451576_0007064 3300045051 Bacteria 13567
1313 Ga0451576_0010902 3300045051 Bacteria 10390
1314 Ga0451576_0023244 3300045051 Bacteria 6714
1315 Ga0451576_0085698 3300045051 Bacteria 3277
1316 Ga0451576_0100688 3300045051 Bacteria 3005
1317 Ga0451576_0182787 3300045051 Bacteria 2189
1318 Ga0451576_0384349 3300045051 Bacteria 1471
1319 Ga0466958_0016632 3300045836 Bacteria 4239
1320 Ga0495627_000003 3300046453 Bacteria 704557
1321 Ga0495590_0003121 3300046457 Bacteria 6775
1322 Ga0495638_0020976 3300046460 Bacteria 4313
1323 Ga0495653_0134127 3300046463 Bacteria 1749
1324 Ga0495650_0000087 3300046471 Bacteria 234870
1325 Ga0495650_0001052 3300046471 Bacteria 30673
1326 Ga0495650_0012544 3300046471 Bacteria 4552
1327 Ga0495580_0176230 3300046472 Bacteria 1477
1328 Ga0495585_0000286 3300046492 Bacteria 50524
1329 Ga0495585_0001651 3300046492 Bacteria 17060
1330 Ga0495596_0000878 3300046500 Bacteria 18129
1331 Ga0495607_0040258 3300046501 Bacteria 2784
1332 Ga0495606_0000052 3300046507 Bacteria 201529
1333 Ga0495606_0002637 3300046507 Bacteria 20464
1334 Ga0495606_0014847 3300046507 Bacteria 6048
1335 Ga0495606_0053437 3300046507 Bacteria 2621
1336 Ga0495606_0131942 3300046507 Bacteria 1484
1337 Ga0495608_0247946 3300046511 Bacteria 1111
1338 Ga0495610_0000001 3300046512 Bacteria 1620061
1339 Ga0495610_0000903 3300046512 Bacteria 27607
1340 Ga0495610_0006770 3300046512 Bacteria 7778
1341 Ga0495610_0010020 3300046512 Bacteria 5922
1342 Ga0495616_0005196 3300046513 Bacteria 8053
1343 Ga0495616_0045190 3300046513 Bacteria 2231
1344 Ga0495628_0046274 3300046516 Bacteria 3456
1345 Ga0495630_0023979 3300046517 Bacteria 4512
1346 Ga0495631_0061416 3300046518 Bacteria 1630
1347 Ga0495632_0000032 3300046519 Bacteria 164561
1348 Ga0495643_0049195 3300046522 Bacteria 2275
1349 Ga0495648_0003874 3300046524 Bacteria 12979
1350 Ga0495648_0009989 3300046524 Bacteria 7280
1351 Ga0495652_0150381 3300046529 Bacteria 1820
1352 Ga0495652_0183721 3300046529 Bacteria 1602
1353 Ga0495654_0000001 3300046530 Bacteria 1513197
1354 Ga0495587_0011934 3300046536 Bacteria 5492
1355 Ga0495609_0000134 3300046538 Bacteria 79757
1356 Ga0495609_0012533 3300046538 Bacteria 4022
1357 Ga0495621_0020509 3300046539 Bacteria 2170
1358 Ga0495633_0000008 3300046558 Bacteria 301830
1359 Ga0495633_0000080 3300046558 Bacteria 127703
1360 Ga0495633_0000081 3300046558 Bacteria 125903
1361 Ga0495633_0004351 3300046558 Bacteria 9044
1362 Ga0495656_0039957 3300046615 Bacteria 1952
1363 Ga0495668_0000012 3300046616 Bacteria 458817
1364 Ga0495668_0000292 3300046616 Bacteria 68757
1365 Ga0495668_0000592 3300046616 Bacteria 44008
1366 Ga0495668_0000751 3300046616 Bacteria 38311
1367 Ga0495611_0001116 3300046648 Bacteria 14130
1368 Ga0495625_0000036 3300046660 Bacteria 221680
1369 Ga0495625_0000781 3300046660 Bacteria 44239
1370 Ga0495625_0002289 3300046660 Bacteria 20991
1371 Ga0495625_0010136 3300046660 Bacteria 7829
1372 Ga0495625_0014574 3300046660 Bacteria 6267
1373 Ga0495625_0115965 3300046660 Bacteria 1827
1374 Ga0495661_0003611 3300046665 Bacteria 11391
1375 Ga0495661_0015900 3300046665 Bacteria 5009
1376 Ga0495661_0054910 3300046665 Bacteria 2390
1377 Ga0495657_0093194 3300046675 Bacteria 1929
1378 Ga0495658_0027377 3300046683 Bacteria 3067
1379 Ga0495658_0068601 3300046683 Bacteria 2054
1380 Ga0495670_0033633 3300046691 Bacteria 2551
1381 Ga0495670_0091140 3300046691 Bacteria 1560
1382 Ga0495649_0000017 3300046694 Bacteria 221685
1383 Ga0495649_0014914 3300046694 Bacteria 4441
1384 Ga0495649_0135922 3300046694 Bacteria 1296
1385 Ga0495660_0013731 3300046810 Bacteria 4694
1386 Ga0495636_0014693 3300047318 Bacteria 3115
1387 Ga0495674_0225205 3300047319 Bacteria 1549
1388 Ga0495672_0002824 3300047320 Bacteria 15467
1389 Ga0495672_0012654 3300047320 Bacteria 5872
1390 Ga0495672_0030914 3300047320 Bacteria 3350
1391 Ga0495687_000001 3300047443 Bacteria 1215582
1392 Ga0495687_001156 3300047443 Bacteria 25557
1393 Ga0495687_004759 3300047443 Bacteria 8973
1394 Ga0495673_0000010 3300047469 Bacteria 709599
1395 Ga0495684_0059523 3300047471 Bacteria 2909
1396 Ga0495686_0000004 3300047472 Bacteria 869019
1397 Ga0495686_0000118 3300047472 Bacteria 165897
1398 Ga0495686_0000582 3300047472 Bacteria 51799
1399 Ga0495686_0000884 3300047472 Bacteria 38050
1400 Ga0495686_0020028 3300047472 Bacteria 4464
1401 Ga0495686_0028549 3300047472 Bacteria 3633
1402 Ga0495686_0079786 3300047472 Bacteria 2001
1403 Ga0495614_0015805 3300048089 Bacteria 3287
1404 Ga0496100_0035115 3300048903 Bacteria 3152
1405 Ga0496102_0049516 3300048905 Bacteria 3823
1406 Ga0496104_0317799 3300048907 Bacteria 1470
1407 Ga0496108_0142405 3300048911 Bacteria 2066
1408 Ga0496109_0165330 3300048912 Bacteria 2074
1409 Ga0496114_0000594 3300048917 Bacteria 26726
1410 Ga0496114_0091226 3300048917 Bacteria 2588
1411 Ga0496115_0045415 3300048918 Bacteria 3507
1412 Ga0496116_0000053 3300048919 Bacteria 291837
1413 Ga0496116_0001728 3300048919 Bacteria 23852
1414 Ga0496117_0000050 3300048920 Bacteria 292727
1415 Ga0496117_0003269 3300048920 Bacteria 19047
1416 Ga0496118_0000044 3300048921 Bacteria 283524
1417 Ga0496118_0065557 3300048921 Bacteria 2657
1418 Ga0496119_0000002 3300048922 Bacteria 738385
1419 Ga0496121_0000030 3300048924 Bacteria 412079
1420 Ga0496121_0021002 3300048924 Bacteria 6424
1421 Ga0496121_0150208 3300048924 Bacteria 1715
1422 Ga0496122_0000188 3300048925 Bacteria 143808
1423 Ga0496122_0000191 3300048925 Bacteria 140173
1424 Ga0496122_0000538 3300048925 Bacteria 78492
1425 Ga0496122_0000769 3300048925 Bacteria 61918
1426 Ga0496122_0001208 3300048925 Bacteria 43998
1427 Ga0496122_0006115 3300048925 Bacteria 14014
1428 Ga0496123_0000636 3300048926 Bacteria 58636
1429 Ga0496123_0003634 3300048926 Bacteria 17066
1430 Ga0496123_0003787 3300048926 Bacteria 16562
1431 Ga0496123_0005816 3300048926 Bacteria 12234
1432 Ga0496123_0008537 3300048926 Bacteria 9392
1433 Ga0496124_0001056 3300048927 Bacteria 43505
1434 Ga0496124_0096704 3300048927 Bacteria 2398
1435 Ga0496124_0099531 3300048927 Bacteria 2358
1436 Ga0496124_0112931 3300048927 Bacteria 2184
1437 Ga0496125_0000059 3300048928 Bacteria 264149
1438 Ga0496125_0000310 3300048928 Bacteria 95700
1439 Ga0496125_0000623 3300048928 Bacteria 59478
1440 Ga0496125_0007782 3300048928 Bacteria 11336
1441 Ga0496125_0008192 3300048928 Bacteria 10999
1442 Ga0496125_0036412 3300048928 Bacteria 4298
1443 Ga0496125_0043748 3300048928 Bacteria 3796
1444 Ga0496126_0000660 3300048929 Bacteria 63892
1445 Ga0496126_0008790 3300048929 Bacteria 10843
1446 Ga0496126_0022457 3300048929 Bacteria 6139
1447 Ga0501031_0003605 3300049568 Bacteria 9955
1448 Ga0501032_0030825 3300049569 Bacteria 3679
1449 Ga0501033_0001868 3300049570 Bacteria 18315
1450 Ga0501033_0010675 3300049570 Bacteria 7038
1451 Ga0501034_0000083 3300049571 Bacteria 169656
1452 Ga0501034_0004012 3300049571 Bacteria 16517
1453 Ga0501034_0016530 3300049571 Bacteria 7567
1454 Ga0501034_0018957 3300049571 Bacteria 7050
1455 Ga0501034_0027052 3300049571 Bacteria 5835
1456 Ga0501034_0054770 3300049571 Bacteria 4015
1457 Ga0501034_0110395 3300049571 Bacteria 2741
1458 Ga0501034_0151692 3300049571 Bacteria 2293
1459 Ga0501034_0167744 3300049571 Bacteria 2163
1460 Ga0501034_0225484 3300049571 Bacteria 1825
1461 Ga0501036_0029789 3300049572 Bacteria 4612
1462 Ga0501036_0111278 3300049572 Bacteria 2314
1463 Ga0501036_0205073 3300049572 Bacteria 1658
1464 Ga0501037_0046526 3300049573 Bacteria 3182
1465 Ga0501037_0046561 3300049573 Bacteria 3180
1466 Ga0501038_0012291 3300049574 Bacteria 7820
1467 Ga0501038_0060482 3300049574 Bacteria 3242
1468 Ga0501038_0162179 3300049574 Bacteria 1816
1469 Ga0501039_0212900 3300049575 Bacteria 1519
1470 Ga0501043_0016678 3300049579 Bacteria 5755
1471 Ga0501043_0024314 3300049579 Bacteria 4754
1472 Ga0501046_0045170 3300049580 Bacteria 3501
1473 Ga0501047_0021075 3300049581 Bacteria 6258
1474 Ga0501047_0027231 3300049581 Bacteria 5506
1475 Ga0501047_0072959 3300049581 Bacteria 3304
1476 Ga0501047_0180380 3300049581 Bacteria 1978
1477 Ga0501048_0043141 3300049582 Bacteria 3229
1478 Ga0501073_0019693 3300049589 Bacteria 4870
1479 Ga0501074_0036497 3300049590 Bacteria 3560
1480 Ga0501199_008572 3300049650 Bacteria 1073
1481 Ga0501207_007577 3300049654 Bacteria 1549
1482 Ga0501223_002893 3300049663 Bacteria 3764
1483 Ga0501233_003872 3300049668 Bacteria 2711
1484 Ga0501233_018303 3300049668 Bacteria 1472
1485 Ga0501235_003383 3300049669 Bacteria 3450
1486 Ga0501238_002082 3300049671 Bacteria 2358
1487 Ga0501238_006011 3300049671 Bacteria 1555
1488 Ga0501249_000037 3300049679 Bacteria 63492
1489 Ga0501249_009400 3300049679 Bacteria 2034
1490 Ga0501252_001366 3300049682 Bacteria 2233
1491 Ga0501257_004852 3300049686 Bacteria 2945
1492 Ga0501259_001042 3300049688 Bacteria 4623
1493 Ga0501221_000044 3300049704 Bacteria 12905
1494 Ga0501225_0010824 3300049705 Bacteria 2576
1495 Ga0501225_0026170 3300049705 Bacteria 1605
1496 Ga0501234_012219 3300049707 Bacteria 1344
1497 Ga0501080_0083979 3300049742 Bacteria 2959
1498 Ga0501083_0056426 3300049744 Bacteria 2631
1499 Ga0501241_000031 3300049758 Bacteria 52001
1500 Ga0501241_013916 3300049758 Bacteria 1461
1501 Ga0501264_003224 3300049761 Bacteria 1488
1502 Ga0501266_000011 3300049763 Bacteria 197280
1503 Ga0501266_001616 3300049763 Bacteria 2875
1504 Ga0501270_000445 3300049767 Bacteria 3533
1505 Ga0501275_000447 3300049772 Bacteria 4640
1506 Ga0501280_005944 3300049776 Bacteria 1733
1507 Ga0501280_006796 3300049776 Bacteria 1608
1508 Ga0501035_0015438 3300049822 Bacteria 7045
1509 Ga0501035_0017043 3300049822 Bacteria 6694
1510 Ga0501035_0023420 3300049822 Bacteria 5664
1511 Ga0501035_0048319 3300049822 Bacteria 3816
1512 Ga0501035_0082433 3300049822 Bacteria 2838
1513 Ga0501044_0017840 3300049823 Bacteria 7614
1514 Ga0501044_0021863 3300049823 Bacteria 6820
1515 Ga0501044_0037569 3300049823 Bacteria 5061
1516 Ga0501044_0042471 3300049823 Bacteria 4728
1517 Ga0501044_0054836 3300049823 Bacteria 4095
1518 Ga0501044_0058135 3300049823 Bacteria 3967
1519 Ga0501284_00029 3300050005 Bacteria 74818
1520 nmdc:mga0k408_124405_c1 3300050493 Bacteria 1529
1521 nmdc:mga0k408_127396_c1 3300050493 Bacteria 1510
1522 nmdc:mga0k408_3518_c1 3300050493 Bacteria 8279
1523 nmdc:mga0k408_749_c1 3300050493 Bacteria 17824
1524 nmdc:mga0k408_821_c1 3300050493 Bacteria 17147
1525 nmdc:mga05p37_60273_c1 3300050507 Bacteria 4673
1526 nmdc:mga09592_983_c1 3300050508 Bacteria 22557
1527 nmdc:mga0qj67_97741_c1 3300050509 Bacteria 2365
1528 nmdc:mga06r32_98089_c1 3300050510 Bacteria 2872
1529 nmdc:mga08y16_10414_c1 3300050511 Bacteria 9752
1530 nmdc:mga08y16_107284_c1 3300050511 Bacteria 2907
1531 nmdc:mga08y16_244111_c1 3300050511 Bacteria 1856
1532 Ga0500578_0004418 3300053086 Bacteria 9905
1533 Ga0500578_0137455 3300053086 Bacteria 1529
1534 Ga0500644_0000283 3300053088 Bacteria 28078
1535 Ga0500646_0001428 3300053090 Bacteria 6341
1536 Ga0500646_0004317 3300053090 Bacteria 3602
1537 Ga0500583_0000108 3300053092 Bacteria 41760
1538 Ga0500583_0004742 3300053092 Bacteria 4474
1539 Ga0500651_0000084 3300053093 Bacteria 60127
1540 Ga0500641_0000017 3300053096 Bacteria 132678
1541 Ga0500641_0002621 3300053096 Bacteria 6345
1542 Ga0500556_0003239 3300053104 Bacteria 4841
1543 Ga0500562_000050 3300053108 Bacteria 60058
1544 Ga0500572_020975 3300053111 Bacteria 1726
1545 Ga0500592_009044 3300053116 Bacteria 1582
1546 Ga0500607_043640 3300053121 Bacteria 2415
1547 Ga0500608_004098 3300053122 Bacteria 5585
1548 Ga0500608_016279 3300053122 Bacteria 3356
1549 Ga0500614_006386 3300053123 Bacteria 2478
1550 Ga0500618_000002 3300053125 Bacteria 370822
1551 Ga0500652_072800 3300053131 Bacteria 1426
1552 Ga0500658_0000003 3300053134 Bacteria 512506
1553 Ga0500658_0006060 3300053134 Bacteria 4494
1554 Ga0500564_024121 3300053138 Bacteria 2791
1555 Ga0500568_0001545 3300053139 Bacteria 14626
1556 Ga0500577_0002086 3300053142 Bacteria 5107
1557 Ga0500589_003337 3300053147 Bacteria 5739
1558 Ga0500604_0021565 3300053151 Bacteria 1822
1559 Ga0500616_0000082 3300053153 Bacteria 198665
1560 Ga0500616_0000849 3300053153 Bacteria 34031
1561 Ga0500616_0009033 3300053153 Bacteria 6104
1562 Ga0500616_0059069 3300053153 Bacteria 1993
1563 Ga0500622_0000003 3300053156 Bacteria 613483
1564 Ga0500622_0000008 3300053156 Bacteria 423636
1565 Ga0500622_0000777 3300053156 Bacteria 27709
1566 Ga0500622_0004378 3300053156 Bacteria 8905
1567 Ga0500622_0004557 3300053156 Bacteria 8641
1568 Ga0500622_0005633 3300053156 Bacteria 7461
1569 Ga0500627_0051765 3300053158 Bacteria 1792
1570 Ga0500633_0020452 3300053160 Bacteria 1997
1571 Ga0500637_0167162 3300053178 Bacteria 1266
1572 Ga0500611_000022 3300053727 Bacteria 102349
1573 Ga0500645_019667 3300053730 Bacteria 2099
1574 Ga0501082_0050376 3300060353 Bacteria 3591
1575 Ga0466962_0005611 3300061719 Bacteria 6028
1576 2511234749 2511231000 Bacteria 4488346
1577 2513235061 2513020052 Bacteria 5120511
1578 2520879409 2519899754 Bacteria 5336938
1579 2522548015 2522125168 Bacteria 7376607
1580 2524004499 2523533629 Bacteria 2982326
1581 2538832432 2537561836 Bacteria 3910579
1582 2585143470 2582581278 Bacteria 5296881
1583 2585158507 2582581281 Bacteria 4487904
1584 2585162855 2582581282 Bacteria 4495830
1585 2585424754 2582581873 Bacteria 3032664
1586 2586210051 2585427687 Bacteria 5544917
1587 2587680655 2585428045 Bacteria 5203023
1588 2587747861 2585428060 Bacteria 5304711
1589 2587866777 2585428095 Bacteria 3789702
1590 2587942916 2585428115 Bacteria 4420269
1591 2588208243 2585428182 Bacteria 5007281
1592 2588213191 2585428183 Bacteria 5166119
1593 2588219807 2585428184 Bacteria 4978681
1594 2588223920 2585428185 Bacteria 4969476
1595 2588233479 2585428187 Bacteria 4629388
1596 2588446447 2588253712 Bacteria 5403181
1597 2590600845 2588254255 Bacteria 5014294
1598 2590611894 2588254257 Bacteria 5436094
1599 2595451676 2593339239 Bacteria 4124669
1600 2599478339 2599185184 Bacteria 6430550
1601 2643830454 2643221562 Bacteria 4048635
1602 2644013060 2643221600 Bacteria 5530138
1603 2644372378 2643221667 Bacteria 5627472
1604 2644642606 2643221716 Bacteria 4986332
1605 2644684850 2643221725 Bacteria 5087956
1606 2721028239 2718218334 Bacteria 4765486
1607 2722726342 2721755487 Bacteria 6357185
1608 2729198586 2728369107 Bacteria 5082720
1609 2735836266 2734482264 Unclassified 5014763
1610 2738700679 2738541273 Bacteria 4048577
1611 2738726372 2738541278 Bacteria 9755573
1612 2738732464 2738541279 Bacteria 6149495
1613 2738757064 2738541283 Bacteria 7222293
1614 2738760401 2738541284 Bacteria 5199923
1615 2738765029 2738541285 Bacteria 6150075
1616 2738851782 2738541302 Bacteria 5944758
1617 2739214044 2738543007 Bacteria 6149845
1618 2739227679 2738543009 Bacteria 4944499
1619 2739254428 2738543014 Bacteria 4048139
1620 2739302548 2738543023 Bacteria 6767879
1621 2739590672 2739367651 Bacteria 6359826
1622 2739617092 2739367656 Bacteria 5152243
1623 2739647397 2739367663 Bacteria 5040914
1624 2739730759 2739367700 Bacteria 4747630
1625 2740001324 2739367857 Bacteria 5433684
1626 2740006140 2739367858 Bacteria 5432813
1627 2740032875 2739367866 Bacteria 4215900
1628 2740057599 2739367874 Bacteria 4872888
1629 2753672695 2751185877 Bacteria 4921427
1630 2765572573 2765235839 Bacteria 5314748
1631 2772605418 2772190705 Bacteria 4666226
1632 2776612452 2775506987 Bacteria 5373360
1633 2802653772 2802428842 Bacteria 4926114
1634 2816872924 2816332188 Bacteria 5133218
1635 2817416277 2816332280 Bacteria 5109718
1636 2819546346 2818991437 Bacteria 5805520
1637 2819563491 2818991440 Bacteria 4774720
1638 2819573626 2818991442 Bacteria 8318214
1639 2819680874 2818991460 Bacteria 7595395
1640 2821136960 2821136567 Bacteria 8080116
1641 2833643624 2833640130 Bacteria 4858325
1642 2839991350 2839989709 Bacteria 3773432
1643 2842084181 2842083920 Bacteria 4857652
1644 2842725023 2842722452 Bacteria 6263924
1645 2842908875 2842903701 Bacteria 6986368
1646 2842914187 2842909656 Bacteria 6185908
1647 2842915361 2842914999 Bacteria 4419378
1648 2849286581 2849281842 Bacteria 6065644
1649 2852623163 2852623160 Bacteria 4376875
1650 2852630367 2852627209 Bacteria 5896285
1651 2857614955 2857613821 Bacteria 4917088
1652 2857618659 2857618242 Bacteria 5635925
1653 2857630291 2857627736 Bacteria 5625397
1654 2871723726 2871720351 Bacteria 4862476
1655 2881363108 2881359912 Bacteria 4935907
1656 2883072582 2883068021 Bacteria 6192739
1657 2884414414 2884411467 Bacteria 5246714
1658 2884635382 2884634485 Bacteria 3928637
1659 2884795631 2884791551 Bacteria 8511252
1660 2884937972 2884933994 Bacteria 4535041
1661 2889291699 2889290771 Bacteria 5530962
1662 2890739568 2890737413 Bacteria 4269751
1663 2895398771 2895395659 Bacteria 3983269
1664 2895503564 2895498888 Bacteria 5283788
1665 2896087749 2896085136 Bacteria 6129793
1666 2896112545 2896109856 Bacteria 7140722
1667 2896319310 2896317667 Bacteria 4606601
1668 2896346134 2896344016 Bacteria 3811746
1669 2898716259 2898713307 Bacteria 4110805
1670 2902051527 2902048731 Bacteria 4976191
1671 2903896889 2903895155 Bacteria 5258610
1672 2904422794 2904419702 Bacteria 5166287
1673 2904448667 2904445276 Bacteria 5310396
1674 2904464199 2904463128 Bacteria 4775606
1675 2904468298 2904467357 Bacteria 8057758
1676 2904557072 2904555929 Bacteria 5218588
1677 2904783772 2904780799 Bacteria 5840761
1678 2906000812 2905999023 Bacteria 4591259
1679 2910247658 2910245624 Bacteria 6935613
1680 2911143607 2911138879 Bacteria 5811561
1681 2914760592 2914759650 Bacteria 4701441
1682 2919181978 2919177583 Bacteria 5641607
1683 2919189654 2919186247 Bacteria 6244071
1684 2919195304 2919191525 Bacteria 5765973
1685 2919402895 2919399522 Bacteria 5164947
1686 2919404752 2919404418 Bacteria 4232372
1687 2919440791 2919437846 Bacteria 6199444
1688 2919685974 2919683626 Bacteria 5534354
1689 2919695678 2919692658 Bacteria 5943958
1690 2928080611 2928078545 Bacteria 6534839
1691 2928150836 2928147474 Bacteria 6512076
1692 2929153565 2929150217 Bacteria 5462483
1693 2929157423 2929154850 Bacteria 6753285
1694 2929178798 2929177148 Bacteria 7883697
1695 2929241239 2929239360 Bacteria 7745570
1696 2929923237 2929921140 Bacteria 8649150
1697 2932083004 2932082852 Bacteria 6563563
1698 2939612355 2939611941 Bacteria 3892017
1699 2939667880 2939664404 Bacteria 6364494
1700 2945927284 2945924605 Bacteria 4296724
1701 2946001965 2945997725 Bacteria 6404843
1702 2946019398 2946013367 Bacteria 7766675
1703 2946021401 2946019816 Bacteria 4621265
1704 2954018849 2954016120 Bacteria 6446024
1705 2958461119 2958458903 Bacteria 5301041
1706 2958513294 2958512119 Bacteria 4528530
1707 2977232529 2977232053 Bacteria 5485925
1708 2977246214 2977243572 Bacteria 4374394
1709 2977270229 2977268062 Bacteria 5243061
1710 2984575975 2984572630 Bacteria 4186940
1711 2984609430 2984606641 Bacteria 4186971
1712 2993373501 2993372514 Bacteria 4214139
1713 2993484184 2993480792 Bacteria 4022225
1714 3003237224 3003233435 Bacteria 4458031
1715 8003153680 8003151029 Bacteria 8187759
1716 8054310081 8054307821 Bacteria 5212224
1717 8055421936 8055419101 Bacteria 5289643
1718 8055589910 8055588893 Bacteria 3619545
1719 8055593424 8055592153 Bacteria 5961247
1720 8056443838 8056440228 Bacteria 4946504
1721 Ga0068869_100114106
1722 SwRhRL2b_contig_2106057
1723 SwRhRL2b_contig_787417
1724 SwRhRL2b_contig_995218
1725 JGI24740J21852_10011978
1726 JGI24739J22299_10005607
1727 JGI24739J22299_10018320
1728 JGI24737J22298_10007120
1729 JGI24737J22298_10007166
1730 JGI24735J21928_10000004
1731 JGI24735J21928_10000733
1732 JGI24738J21930_10007886
1733 JGI25156J39149_1010714
1734 JGI25156J39149_1011938
1735 JGI25162J39368_1000011
1736 JGI25162J39368_1000395
1737 JGI25162J39368_1000614
1738 JGI25154J39366_1000040
1739 JGI25157J39369_1004284
1740 JGI25164J39214_1000338
1741 JGI25164J39214_1000416
1742 JGI25150J39212_1000001
1743 JGI25159J45721_1013514
1744 JGI25151J46595_10000001
1745 JGI25151J46595_10012241
1746 JGI25165J46597_1000513
1747 JGI25165J46597_1000985
1748 JGI25153J46596_10000001
1749 JGI25153J46596_10003346
1750 rootH1_10005810
1751 rootH1_10024829
1752 rootH1_10091502
1753 rootH2_10001891
1754 rootH2_10006905
1755 rootH2_10013742
1756 rootH2_10026728
1757 rootH2_10070248
1758 rootH2_10090920
1759 rootL2_10009890
1760 rootL2_10030202
1761 rootL2_10058669
1762 rootL2_10102542
1763 rootL2_10115167
1764 rootL2_10124282
1765 rootH1_10000019
1766 rootH1_10008801
1767 rootH1_10014558
1768 rootH1_10035284
1769 rootH1_10162681
1770 rootH1_10178453
1771 rootH1_10196299
1772 rootH1_10230245
1773 JGI25160J50197_1000719
1774 JGI25160J50197_1005718
1775 JGI25160J50197_1006644
1776 JGI25160J50197_1012160
1777 Ga0006562J51391_1077937
1778 Ga0055533_1000705
1779 Ga0055535_1004072
1780 Ga0055542_1002114
1781 Ga0055526_1020598
1782 Ga0055526_1021512
1783 Ga0055524_1008450
1784 Ga0055536_1000001
1785 Ga0055536_1002653
1786 Ga0055536_1005846
1787 Ga0055534_1003989
1788 Ga0055528_1001650
1789 Ga0055530_10000387
1790 Ga0055530_10002797
1791 Ga0055530_10004772
1792 Ga0055531_10000087
1793 Ga0055531_10000131
1794 Ga0055531_10003712
1795 Ga0055531_10017858
1796 Ga0055531_10022988
1797 Ga0065165_1000102
1798 Ga0065165_1000396
1799 Ga0065165_1002869
1800 Ga0065165_1011677
1801 Ga0065714_10003545
1802 Ga0065714_10004089
1803 Ga0065714_10010706
1804 Ga0065714_10027838
1805 Ga0065714_10064750
1806 Ga0065714_10064863
1807 Ga0065714_10067358
1808 Ga0065714_10084036
1809 Ga0065714_10091768
1810 Ga0065714_10095177
1811 Ga0065704_10000210
1812 Ga0065704_10002415
1813 Ga0065704_10005410
1814 Ga0065704_10070975
1815 Ga0065704_10077961
1816 Ga0065704_10090743
1817 Ga0065704_10113887
1818 Ga0065712_10088970
1819 Ga0065715_10133536
1820 Ga0070658_10000049
1821 Ga0070658_10013707
1822 Ga0070658_10025309
1823 Ga0070658_10054233
1824 Ga0070676_10000336
1825 Ga0070676_10026339
1826 Ga0070676_10030128
1827 Ga0070683_100249876
1828 Ga0070690_100039757
1829 Ga0070690_100101551
1830 Ga0070690_100121968
1831 Ga0070670_100022394
1832 Ga0070670_100033933
1833 Ga0070670_100045698
1834 Ga0070670_100095525
1835 Ga0070670_100096661
1836 Ga0070670_100169959
1837 Ga0070677_10030505
1838 Ga0070677_10032555
1839 Ga0068869_100003156
1840 Ga0068869_100025054
1841 Ga0068869_100039400
1842 Ga0068869_100071316
1843 Ga0068869_100092872
1844 Ga0068869_100126876
1845 Ga0068869_100129295
1846 Ga0068869_100145294
1847 Ga0068869_100149394
1848 Ga0068869_100200348
1849 Ga0070666_10000003
1850 Ga0070666_10000051
1851 Ga0070666_10035424
1852 Ga0070666_10038936
1853 Ga0070666_10055085
1854 Ga0070680_100014158
1855 Ga0070680_100014310
1856 Ga0070680_100045802
1857 Ga0070682_100000153
1858 Ga0070682_100001275
1859 Ga0070682_100023945
1860 Ga0068868_100008530
1861 Ga0068868_100015143
1862 Ga0068868_100016530
1863 Ga0068868_100020344
1864 Ga0068868_100026273
1865 Ga0068868_100181732
1866 Ga0070660_100021175
1867 Ga0070660_100027944
1868 Ga0070660_100045939
1869 Ga0070660_100202184
1870 Ga0070689_100012964
1871 Ga0070689_100020120
1872 Ga0070689_100027105
1873 Ga0070689_100064306
1874 Ga0070691_10004326
1875 Ga0070691_10007180
1876 Ga0070687_100026921
1877 Ga0070661_100003020
1878 Ga0070661_100017264
1879 Ga0070661_100023944
1880 Ga0070661_100034512
1881 Ga0070661_100047201
1882 Ga0070692_10044215
1883 Ga0070668_100077511
1884 Ga0070668_100159218
1885 Ga0070668_100265475
1886 Ga0070669_100004024
1887 Ga0070669_100237792
1888 Ga0070675_100015326
1889 Ga0070675_100016332
1890 Ga0070675_100027340
1891 Ga0070675_100096546
1892 Ga0070671_100005548
1893 Ga0070671_100038509
1894 Ga0070671_100103058
1895 Ga0070671_100311131
1896 Ga0070674_100002364
1897 Ga0070674_100111721
1898 Ga0070673_100001990
1899 Ga0070673_100026479
1900 Ga0070673_100047585
1901 Ga0070673_100078015
1902 Ga0070673_100079941
1903 Ga0070673_100212742
1904 Ga0070673_100386908
1905 Ga0070688_100001700
1906 Ga0070659_100004255
1907 Ga0070659_100005797
1908 Ga0070659_100006368
1909 Ga0070659_100006699
1910 Ga0070659_100011612
1911 Ga0070659_100052714
1912 Ga0070659_100086606
1913 Ga0070667_100000492
1914 Ga0070667_100001349
1915 Ga0070667_100044097
1916 Ga0070667_100069793
1917 Ga0070667_100121925
1918 Ga0070714_100116833
1919 Ga0070713_100006097
1920 Ga0070710_10058995
1921 Ga0070663_100001195
1922 Ga0070663_100195511
1923 Ga0070678_100001813
1924 Ga0070678_100024345
1925 Ga0070678_100189828
1926 Ga0070662_100000045
1927 Ga0070662_100004086
1928 Ga0070662_100049317
1929 Ga0070662_100121832
1930 Ga0070681_10003864
1931 Ga0070681_10022395
1932 Ga0070681_10053268
1933 Ga0070681_10222079
1934 Ga0068867_100004573
1935 Ga0068867_100062000
1936 Ga0068867_100075744
1937 Ga0068867_100188557
1938 Ga0070685_10002206
1939 Ga0070698_100043739
1940 Ga0070679_100000634
1941 Ga0070679_100004536
1942 Ga0070679_100006277
1943 Ga0070679_100007656
1944 Ga0070679_100019902
1945 Ga0070679_100200590
1946 Ga0070679_100251163
1947 Ga0070679_100304594
1948 Ga0070684_100000495
1949 Ga0070684_100005089
1950 Ga0070684_100035368
1951 Ga0070684_100261462
1952 Ga0068853_100000221
1953 Ga0068853_100008065
1954 Ga0068853_100009733
1955 Ga0068853_100013393
1956 Ga0068853_100016539
1957 Ga0068853_100046538
1958 Ga0068853_100057348
1959 Ga0068853_100070430
1960 Ga0068853_100098422
1961 Ga0068853_100134731
1962 Ga0068853_100252364
1963 Ga0068853_100265163
1964 Ga0070672_100001489
1965 Ga0070672_100065616
1966 Ga0070672_100068525
1967 Ga0070686_100022221
1968 Ga0070686_100149017
1969 Ga0070696_100005210
1970 Ga0070693_100003483
1971 Ga0070693_100065349
1972 Ga0070665_100000020
1973 Ga0070665_100016967
1974 Ga0070665_100043231
1975 Ga0070665_100079883
1976 Ga0070665_100113957
1977 Ga0068855_100000089
1978 Ga0068855_100000240
1979 Ga0068855_100000346
1980 Ga0068855_100005837
1981 Ga0068855_100008169
1982 Ga0068855_100020597
1983 Ga0068855_100024825
1984 Ga0068855_100026080
1985 Ga0068855_100030585
1986 Ga0068855_100047040
1987 Ga0068855_100053363
1988 Ga0068855_100062842
1989 Ga0068855_100107211
1990 Ga0068855_100136803
1991 Ga0068855_100139053
1992 Ga0068855_100234343
1993 Ga0068855_100257335
1994 Ga0068855_100264801
1995 Ga0070664_100007478
1996 Ga0070664_100014454
1997 Ga0070664_100015583
1998 Ga0070664_100039376
1999 Ga0070664_100044954
2000 Ga0070664_100161976
2001 Ga0070664_100255598
2002 Ga0068857_100007822
2003 Ga0068857_100008143
2004 Ga0068857_100008503
2005 Ga0068857_100019055
2006 Ga0068857_100036860
2007 Ga0068857_100039954
2008 Ga0068857_100042446
2009 Ga0068857_100139189
2010 Ga0068857_100237126
2011 Ga0068857_100251550
2012 Ga0068854_100014860
2013 Ga0068854_100036209
2014 Ga0068854_100044551
2015 Ga0068854_100051761
2016 Ga0068854_100315201
2017 Ga0068856_100000835
2018 Ga0068856_100006910
2019 Ga0068856_100007967
2020 Ga0068856_100010959
2021 Ga0068856_100017673
2022 Ga0068856_100021537
2023 Ga0068856_100022699
2024 Ga0068856_100074762
2025 Ga0068856_100093470
2026 Ga0068856_100132644
2027 Ga0068856_100464115
2028 Ga0068852_100001345
2029 Ga0068852_100002446
2030 Ga0068852_100002479
2031 Ga0068852_100003445
2032 Ga0068852_100021932
2033 Ga0068852_100049232
2034 Ga0068852_100187804
2035 Ga0068859_100000037
2036 Ga0068859_100002554
2037 Ga0068859_100009853
2038 Ga0068859_100014329
2039 Ga0068859_100014701
2040 Ga0068859_100019039
2041 Ga0068859_100081931
2042 Ga0068859_100112184
2043 Ga0068859_100156882
2044 Ga0068859_100211719
2045 Ga0068859_100222053
2046 Ga0068859_100259099
2047 Ga0068859_100343093
2048 Ga0068859_100466366
2049 Ga0068864_100005800
2050 Ga0068864_100046544
2051 Ga0068864_100047161
2052 Ga0068864_100071407
2053 Ga0068864_100081890
2054 Ga0068864_100291107
2055 Ga0068861_100072756
2056 Ga0068861_100076439
2057 Ga0068861_100109468
2058 Ga0068851_10011215
2059 Ga0068851_10017429
2060 Ga0068870_10028107
2061 Ga0068863_100000412
2062 Ga0068863_100001812
2063 Ga0068863_100015360
2064 Ga0068863_100026107
2065 Ga0068863_100038028
2066 Ga0068863_100041343
2067 Ga0068863_100102832
2068 Ga0068858_100019340
2069 Ga0068858_100038430
2070 Ga0068858_100068957
2071 Ga0068858_100074780
2072 Ga0068858_100113886
2073 Ga0068858_100405101
2074 Ga0068860_100000916
2075 Ga0068860_100001316
2076 Ga0068860_100003283
2077 Ga0068860_100011274
2078 Ga0068860_100011999
2079 Ga0068860_100022244
2080 Ga0068860_100079593
2081 Ga0068860_100081707
2082 Ga0068860_100173481
2083 Ga0068860_100191982
2084 Ga0068862_100010385
2085 Ga0068862_100025020
2086 Ga0068862_100041877
2087 Ga0068862_100045273
2088 Ga0068862_100079303
2089 Ga0068862_100100522
2090 Ga0068862_100169907
2091 Ga0068862_100297749
2092 Ga0081539_10000531
2093 Ga0081539_10049494
2094 Ga0070712_100072125
2095 Ga0075366_10005218
2096 Ga0075366_10020069
2097 Ga0075366_10061158
2098 Ga0097621_100000818
2099 Ga0097621_100002086
2100 Ga0097621_100018421
2101 Ga0097621_100021360
2102 Ga0097621_100022179
2103 Ga0097621_100037338
2104 Ga0097621_100093623
2105 Ga0068871_100000027
2106 Ga0068871_100000100
2107 Ga0068871_100000354
2108 Ga0068871_100010400
2109 Ga0068871_100032169
2110 Ga0068871_100056018
2111 Ga0075428_100017721
2112 Ga0075428_100050469
2113 Ga0075428_100219642
2114 Ga0075428_100285890
2115 Ga0075430_100009529
2116 Ga0075431_100065731
2117 Ga0075429_100018092
2118 Ga0075429_100032161
2119 Ga0075429_100122899
2120 Ga0068865_100000174
2121 Ga0068865_100023102
2122 Ga0068865_100028117
2123 Ga0068865_100260016
2124 Ga0097620_100000037
2125 Ga0097620_100002554
2126 Ga0097620_100009853
2127 Ga0097620_100014329
2128 Ga0097620_100014701
2129 Ga0097620_100019038
2130 Ga0097620_100081931
2131 Ga0097620_100112184
2132 Ga0097620_100156891
2133 Ga0097620_100211717
2134 Ga0097620_100222053
2135 Ga0097620_100259079
2136 Ga0097620_100343100
2137 Ga0097620_100466346
2138 Ga0105244_10000063
2139 Ga0105244_10000261
2140 Ga0105240_10000074
2141 Ga0105240_10000176
2142 Ga0105240_10000237
2143 Ga0105240_10000598
2144 Ga0105240_10000626
2145 Ga0105240_10001351
2146 Ga0105240_10001595
2147 Ga0105240_10002663
2148 Ga0105240_10007062
2149 Ga0105240_10008151
2150 Ga0105240_10020015
2151 Ga0105240_10022028
2152 Ga0105240_10066229
2153 Ga0105240_10070852
2154 Ga0105240_10085848
2155 Ga0105240_10108377
2156 Ga0105240_10287009
2157 Ga0105240_10305713
2158 Ga0105240_10326021
2159 Ga0105240_10351421
2160 Ga0105240_10404120
2161 Ga0111539_10005620
2162 Ga0111539_10008695
2163 Ga0111539_10067948
2164 Ga0105245_10178928
2165 Ga0105247_10005412
2166 Ga0105247_10010386
2167 Ga0105247_10012510
2168 Ga0105247_10018230
2169 Ga0114129_10033962
2170 Ga0114129_10095953
2171 Ga0105243_10000043
2172 Ga0105243_10002194
2173 Ga0105243_10062549
2174 Ga0105241_10000086
2175 Ga0105241_10000659
2176 Ga0105241_10000881
2177 Ga0105241_10003116
2178 Ga0105241_10021858
2179 Ga0105241_10057228
2180 Ga0105241_10098806
2181 Ga0105241_10119203
2182 Ga0105241_10432439
2183 Ga0105242_10009407
2184 Ga0105242_10013463
2185 Ga0105242_10015906
2186 Ga0105242_10034951
2187 Ga0105242_10124504
2188 Ga0105242_10211747
2189 Ga0105248_10391891
2190 Ga0105237_10000224
2191 Ga0105237_10000595
2192 Ga0105237_10001565
2193 Ga0105237_10003647
2194 Ga0105237_10003651
2195 Ga0105237_10004072
2196 Ga0105237_10009395
2197 Ga0105237_10013977
2198 Ga0105237_10028286
2199 Ga0105237_10036976
2200 Ga0105237_10049654
2201 Ga0105237_10064255
2202 Ga0105237_10067260
2203 Ga0105237_10078883
2204 Ga0105237_10135454
2205 Ga0105237_10148072
2206 Ga0105237_10213852
2207 Ga0105237_10279271
2208 Ga0105238_10001132
2209 Ga0105238_10005720
2210 Ga0105238_10006640
2211 Ga0105238_10077802
2212 Ga0105238_10097865
2213 Ga0105238_10106237
2214 Ga0105238_10192735
2215 Ga0105238_10268543
2216 Ga0105238_10380094
2217 Ga0105249_10002281
2218 Ga0105249_10005103
2219 Ga0105249_10005252
2220 Ga0105249_10008737
2221 Ga0105249_10012834
2222 Ga0105249_10035965
2223 Ga0105249_10046215
2224 Ga0105249_10107176
2225 Ga0105249_10107814
2226 Ga0105249_10335863
2227 Ga0105239_10000048
2228 Ga0105239_10000616
2229 Ga0105239_10000758
2230 Ga0105239_10001789
2231 Ga0105239_10001948
2232 Ga0105239_10002090
2233 Ga0105239_10002752
2234 Ga0105239_10005094
2235 Ga0105239_10006841
2236 Ga0105239_10008918
2237 Ga0105239_10024710
2238 Ga0105239_10038370
2239 Ga0105239_10042529
2240 Ga0105239_10078397
2241 Ga0105239_10130417
2242 Ga0105239_10131149
2243 Ga0105239_10137595
2244 Ga0105246_10013371
2245 Ga0105246_10053815
2246 Ga0157373_10000002
2247 Ga0157373_10000036
2248 Ga0157373_10000821
2249 Ga0157373_10004709
2250 Ga0157373_10004786
2251 Ga0157373_10007995
2252 Ga0157373_10013034
2253 Ga0157373_10019401
2254 Ga0157373_10026029
2255 Ga0157373_10027400
2256 Ga0157373_10118640
2257 Ga0157373_10221355
2258 Ga0157371_10000016
2259 Ga0157371_10000036
2260 Ga0157371_10000135
2261 Ga0157371_10000563
2262 Ga0157371_10001161
2263 Ga0157371_10001915
2264 Ga0157371_10003112
2265 Ga0157371_10003683
2266 Ga0157371_10005312
2267 Ga0157371_10024187
2268 Ga0157371_10024298
2269 Ga0157371_10028632
2270 Ga0157371_10034813
2271 Ga0157371_10035822
2272 Ga0157371_10042442
2273 Ga0157371_10068485
2274 Ga0157371_10070988
2275 Ga0157371_10077958
2276 Ga0157371_10078589
2277 Ga0157371_10103195
2278 Ga0157371_10130738
2279 Ga0157371_10155734
2280 Ga0157370_10000500
2281 Ga0157370_10001022
2282 Ga0157370_10001166
2283 Ga0157370_10002014
2284 Ga0157370_10004754
2285 Ga0157370_10009476
2286 Ga0157370_10010727
2287 Ga0157370_10014206
2288 Ga0157370_10014665
2289 Ga0157370_10017596
2290 Ga0157370_10031451
2291 Ga0157370_10031722
2292 Ga0157370_10036146
2293 Ga0157370_10036413
2294 Ga0157370_10039822
2295 Ga0157370_10060009
2296 Ga0157370_10142304
2297 Ga0157370_10147217
2298 Ga0157370_10180805
2299 Ga0157369_10000129
2300 Ga0157369_10000475
2301 Ga0157369_10001138
2302 Ga0157369_10001311
2303 Ga0157369_10046098
2304 Ga0157369_10051032
2305 Ga0157369_10078779
2306 Ga0157369_10103039
2307 Ga0157369_10104015
2308 Ga0157369_10123106
2309 Ga0157369_10145737
2310 Ga0157374_10000001
2311 Ga0157374_10000128
2312 Ga0157374_10000202
2313 Ga0157374_10058779
2314 Ga0157374_10094451
2315 Ga0157374_10095724
2316 Ga0157374_10142797
2317 Ga0157374_10185874
2318 Ga0157374_10249613
2319 Ga0157374_10420002
2320 Ga0157378_10005717
2321 Ga0157378_10005849
2322 Ga0157378_10010586
2323 Ga0157378_10031758
2324 Ga0157378_10038652
2325 Ga0157378_10049204
2326 Ga0157378_10060809
2327 Ga0157378_10100527
2328 Ga0157378_10301761
2329 Ga0157378_10362527
2330 Ga0157378_10426561
2331 Ga0163162_10000032
2332 Ga0163162_10000152
2333 Ga0163162_10000236
2334 Ga0163162_10000331
2335 Ga0163162_10000967
2336 Ga0163162_10009046
2337 Ga0163162_10010809
2338 Ga0163162_10011763
2339 Ga0163162_10013133
2340 Ga0163162_10016026
2341 Ga0163162_10026171
2342 Ga0163162_10029333
2343 Ga0163162_10031876
2344 Ga0163162_10052634
2345 Ga0163162_10052936
2346 Ga0163162_10055013
2347 Ga0163162_10067516
2348 Ga0163162_10086163
2349 Ga0163162_10114892
2350 Ga0163162_10117466
2351 Ga0163162_10128129
2352 Ga0163162_10381208
2353 Ga0163162_10393182
2354 Ga0163162_10403773
2355 Ga0163162_10432294
2356 Ga0157372_10000017
2357 Ga0157372_10000061
2358 Ga0157372_10000921
2359 Ga0157372_10018588
2360 Ga0157372_10034779
2361 Ga0157372_10042883
2362 Ga0157372_10052962
2363 Ga0157372_10092410
2364 Ga0157372_10093593
2365 Ga0157372_10098360
2366 Ga0157372_10115846
2367 Ga0157372_10120930
2368 Ga0157372_10130498
2369 Ga0157372_10146950
2370 Ga0157372_10151239
2371 Ga0157372_10155057
2372 Ga0157372_10234220
2373 Ga0157372_10259321
2374 Ga0157372_10426779
2375 Ga0157372_10434537
2376 Ga0157372_10453975
2377 Ga0157372_10467762
2378 Ga0157372_10500769
2379 Ga0157375_10000229
2380 Ga0157375_10000910
2381 Ga0157375_10003117
2382 Ga0157375_10011803
2383 Ga0157375_10033928
2384 Ga0157375_10040512
2385 Ga0157375_10046217
2386 Ga0157375_10052220
2387 Ga0157375_10144618
2388 Ga0157375_10365735
2389 Ga0163163_10000477
2390 Ga0163163_10000653
2391 Ga0163163_10048819
2392 Ga0163163_10052489
2393 Ga0163163_10098082
2394 Ga0163163_10260990
2395 Ga0163163_10313114
2396 Ga0163163_10341979
2397 Ga0157380_10010112
2398 Ga0157380_10019234
2399 Ga0157380_10022125
2400 Ga0157380_10076848
2401 Ga0157380_10095552
2402 Ga0157380_10269005
2403 Ga0182008_10000006
2404 Ga0182008_10000011
2405 Ga0182008_10000818
2406 Ga0182008_10001192
2407 Ga0182008_10052173
2408 Ga0182008_10060873
2409 Ga0182008_10085277
2410 Ga0182008_10088475
2411 Ga0182008_10090629
2412 Ga0157377_10004205
2413 Ga0157377_10007108
2414 Ga0157377_10055979
2415 Ga0157379_10001640
2416 Ga0157379_10002723
2417 Ga0157379_10032061
2418 Ga0157379_10043311
2419 Ga0157379_10112740
2420 Ga0157379_10262260
2421 Ga0157376_10000721
2422 Ga0157376_10001279
2423 Ga0157376_10002407
2424 Ga0157376_10004414
2425 Ga0157376_10008360
2426 Ga0157376_10062287
2427 Ga0157376_10153139
2428 Ga0157376_10173014
2429 Ga0157376_10211479
2430 Ga0182006_1000011
2431 Ga0182006_1000068
2432 Ga0182006_1000869
2433 Ga0182006_1001629
2434 Ga0182006_1002952
2435 Ga0182006_1003367
2436 Ga0182006_1029738
2437 Ga0182006_1030063
2438 Ga0182007_10000003
2439 Ga0182007_10013574
2440 Ga0182007_10017113
2441 Ga0183373_1001
2442 Ga0163161_10000012
2443 Ga0163161_10000074
2444 Ga0163161_10002988
2445 Ga0163161_10004613
2446 Ga0163161_10005307
2447 Ga0163161_10006285
2448 Ga0163161_10015370
2449 Ga0163161_10016813
2450 Ga0163161_10024699
2451 Ga0163161_10030157
2452 Ga0163161_10033399
2453 Ga0163161_10033761
2454 Ga0163161_10044131
2455 Ga0163161_10148063
2456 Ga0197907_11483478
2457 Ga0206353_11137735
2458 Ga0206353_12030687
2459 Ga0213872_10009314
2460 Ga0213876_10001528
2461 Ga0209674_100378
2462 Ga0207427_100103
2463 Ga0207427_100115
2464 Ga0207427_100130
2465 Ga0209437_100017
2466 Ga0209437_100020
2467 Ga0209437_100079
2468 Ga0209437_100101
2469 Ga0209258_100151
2470 Ga0207425_1000002
2471 Ga0209646_1000002
2472 Ga0209646_1000745
2473 Ga0209646_1001409
2474 Ga0209026_1000105
2475 Ga0209026_1000162
2476 Ga0209026_1000434
2477 Ga0209026_1007075
2478 Ga0209148_1000154
2479 Ga0209759_1004885
2480 Ga0209759_1004887
2481 Ga0209759_1009298
2482 Ga0209129_1000002
2483 Ga0209129_1002458
2484 Ga0209233_1000020
2485 Ga0209233_1000121
2486 Ga0209233_1000124
2487 Ga0209455_1000560
2488 Ga0209673_1000208
2489 Ga0209673_1042251
2490 Ga0209130_1005416
2491 Ga0209675_1000033
2492 Ga0209675_1003459
2493 Ga0209676_1000008
2494 Ga0209676_1000390
2495 Ga0209676_1001110
2496 Ga0209676_1002036
2497 Ga0209676_1004629
2498 Ga0209676_1007535
2499 Ga0209025_1000004
2500 Ga0209025_1009272
2501 Ga0209564_1006739
2502 Ga0209564_1014033
2503 Ga0209564_1014047
2504 Ga0209758_1000006
2505 Ga0209758_1003065
2506 Ga0209758_1020284
2507 Ga0209050_1000045
2508 Ga0209050_1000134
2509 Ga0209256_1003208
2510 Ga0209256_1028734
2511 Ga0207426_1000002
2512 Ga0207426_1000051
2513 Ga0207426_1000497
2514 Ga0207426_1001981
2515 Ga0207426_1006084
2516 Ga0209257_1000001
2517 Ga0209257_1000006
2518 Ga0209257_1001605
2519 Ga0209257_1003878
2520 Ga0209257_1008310
2521 Ga0207656_10007257
2522 Ga0207656_10107870
2523 Ga0207655_1000008
2524 Ga0207655_1005122
2525 Ga0207682_10010357
2526 Ga0207682_10033618
2527 Ga0207692_10028338
2528 Ga0207642_10142856
2529 Ga0207710_10002439
2530 Ga0207710_10002748
2531 Ga0207710_10008558
2532 Ga0207688_10130719
2533 Ga0207680_10000006
2534 Ga0207680_10000162
2535 Ga0207680_10023544
2536 Ga0207680_10028103
2537 Ga0207680_10039495
2538 Ga0207680_10052159
2539 Ga0207680_10208101
2540 Ga0207647_10000105
2541 Ga0207647_10000511
2542 Ga0207647_10011313
2543 Ga0207647_10018195
2544 Ga0207647_10025074
2545 Ga0207647_10027673
2546 Ga0207647_10041070
2547 Ga0207647_10080460
2548 Ga0207645_10000622
2549 Ga0207645_10001210
2550 Ga0207645_10003591
2551 Ga0207645_10004714
2552 Ga0207643_10023368
2553 Ga0207643_10104056
2554 Ga0207643_10130808
2555 Ga0207705_10000079
2556 Ga0207705_10061750
2557 Ga0207705_10090827
2558 Ga0207705_10093493
2559 Ga0207705_10125830
2560 Ga0207654_10003772
2561 Ga0207654_10005580
2562 Ga0207654_10016294
2563 Ga0207707_10000051
2564 Ga0207707_10003389
2565 Ga0207707_10038834
2566 Ga0207707_10170685
2567 Ga0207707_10283405
2568 Ga0207695_10000013
2569 Ga0207695_10000071
2570 Ga0207695_10000084
2571 Ga0207695_10000102
2572 Ga0207695_10000323
2573 Ga0207695_10001232
2574 Ga0207695_10004447
2575 Ga0207695_10004602
2576 Ga0207695_10009118
2577 Ga0207695_10015643
2578 Ga0207695_10023061
2579 Ga0207695_10026849
2580 Ga0207695_10040999
2581 Ga0207695_10047480
2582 Ga0207695_10084921
2583 Ga0207695_10094245
2584 Ga0207695_10276714
2585 Ga0207671_10000036
2586 Ga0207671_10000272
2587 Ga0207671_10000726
2588 Ga0207671_10001497
2589 Ga0207671_10002907
2590 Ga0207671_10005889
2591 Ga0207671_10008744
2592 Ga0207671_10014622
2593 Ga0207671_10021459
2594 Ga0207671_10042678
2595 Ga0207671_10119462
2596 Ga0207671_10119489
2597 Ga0207660_10044410
2598 Ga0207660_10055888
2599 Ga0207660_10249322
2600 Ga0207662_10004762
2601 Ga0207662_10016297
2602 Ga0207657_10021748
2603 Ga0207657_10031993
2604 Ga0207657_10049273
2605 Ga0207657_10049826
2606 Ga0207657_10110330
2607 Ga0207649_10023770
2608 Ga0207649_10150443
2609 Ga0207652_10000384
2610 Ga0207652_10001696
2611 Ga0207652_10061632
2612 Ga0207681_10037670
2613 Ga0207694_10003086
2614 Ga0207694_10006130
2615 Ga0207694_10007231
2616 Ga0207694_10092271
2617 Ga0207694_10097905
2618 Ga0207650_10019073
2619 Ga0207650_10042343
2620 Ga0207650_10062339
2621 Ga0207650_10066978
2622 Ga0207650_10084184
2623 Ga0207650_10173709
2624 Ga0207659_10008155
2625 Ga0207659_10053334
2626 Ga0207687_10196626
2627 Ga0207700_10003865
2628 Ga0207664_10022981
2629 Ga0207644_10002938
2630 Ga0207644_10041897
2631 Ga0207644_10075688
2632 Ga0207690_10000314
2633 Ga0207690_10000318
2634 Ga0207690_10000797
2635 Ga0207690_10008204
2636 Ga0207690_10023288
2637 Ga0207690_10052218
2638 Ga0207690_10058473
2639 Ga0207690_10076849
2640 Ga0207690_10103318
2641 Ga0207706_10000120
2642 Ga0207706_10027522
2643 Ga0207706_10029817
2644 Ga0207706_10064116
2645 Ga0207706_10083306
2646 Ga0207706_10153267
2647 Ga0207686_10000546
2648 Ga0207686_10024502
2649 Ga0207686_10093300
2650 Ga0207686_10103114
2651 Ga0207709_10000021
2652 Ga0207709_10001686
2653 Ga0207670_10080132
2654 Ga0207704_10000099
2655 Ga0207691_10002527
2656 Ga0207691_10004310
2657 Ga0207691_10027226
2658 Ga0207691_10172503
2659 Ga0207691_10230027
2660 Ga0207689_10008841
2661 Ga0207689_10009849
2662 Ga0207689_10017703
2663 Ga0207689_10022258
2664 Ga0207689_10025477
2665 Ga0207689_10066990
2666 Ga0207689_10085796
2667 Ga0207689_10100672
2668 Ga0207689_10169592
2669 Ga0207661_10027722
2670 Ga0207679_10007258
2671 Ga0207679_10011633
2672 Ga0207679_10025004
2673 Ga0207679_10036528
2674 Ga0207679_10070427
2675 Ga0207667_10000037
2676 Ga0207667_10000177
2677 Ga0207667_10007957
2678 Ga0207667_10011669
2679 Ga0207667_10015290
2680 Ga0207667_10017914
2681 Ga0207667_10028059
2682 Ga0207667_10028127
2683 Ga0207667_10038231
2684 Ga0207667_10048612
2685 Ga0207667_10064211
2686 Ga0207667_10066061
2687 Ga0207667_10144396
2688 Ga0207667_10195765
2689 Ga0207667_10223392
2690 Ga0207667_10224780
2691 Ga0207651_10001099
2692 Ga0207651_10005116
2693 Ga0207651_10021365
2694 Ga0207651_10037220
2695 Ga0207712_10002040
2696 Ga0207712_10002656
2697 Ga0207712_10004495
2698 Ga0207712_10005109
2699 Ga0207712_10007103
2700 Ga0207712_10016647
2701 Ga0207712_10037202
2702 Ga0207668_10135219
2703 Ga0207668_10165388
2704 Ga0207640_10014412
2705 Ga0207640_10043616
2706 Ga0207640_10088672
2707 Ga0207640_10300155
2708 Ga0207658_10007260
2709 Ga0207658_10024494
2710 Ga0207658_10079172
2711 Ga0207658_10105398
2712 Ga0207658_10156711
2713 Ga0207658_10249189
2714 Ga0207658_10327430
2715 Ga0207677_10014691
2716 Ga0207677_10085142
2717 Ga0207677_10159092
2718 Ga0207703_10004370
2719 Ga0207703_10102381
2720 Ga0207703_10158557
2721 Ga0207639_10001126
2722 Ga0207639_10015924
2723 Ga0207639_10022108
2724 Ga0207639_10047659
2725 Ga0207639_10065475
2726 Ga0207639_10151182
2727 Ga0207639_10242079
2728 Ga0207639_10292829
2729 Ga0207678_10009382
2730 Ga0207678_10038074
2731 Ga0207678_10124809
2732 Ga0207702_10000196
2733 Ga0207702_10005976
2734 Ga0207702_10009327
2735 Ga0207702_10032297
2736 Ga0207702_10042660
2737 Ga0207702_10057179
2738 Ga0207702_10105221
2739 Ga0207702_10107011
2740 Ga0207702_10206373
2741 Ga0207702_10251550
2742 Ga0207641_10000226
2743 Ga0207641_10000253
2744 Ga0207641_10043904
2745 Ga0207641_10196855
2746 Ga0207648_10002506
2747 Ga0207648_10003327
2748 Ga0207648_10004019
2749 Ga0207648_10018210
2750 Ga0207648_10021796
2751 Ga0207648_10034323
2752 Ga0207648_10060760
2753 Ga0207648_10104599
2754 Ga0207676_10009837
2755 Ga0207676_10045351
2756 Ga0207676_10063266
2757 Ga0207676_10120226
2758 Ga0207676_10159764
2759 Ga0207676_10224103
2760 Ga0207674_10000672
2761 Ga0207674_10006740
2762 Ga0207674_10017537
2763 Ga0207674_10021327
2764 Ga0207674_10047238
2765 Ga0207674_10048707
2766 Ga0207674_10054469
2767 Ga0207674_10054880
2768 Ga0207674_10084731
2769 Ga0207674_10103679
2770 Ga0207674_10106119
2771 Ga0207674_10110348
2772 Ga0207674_10136063
2773 Ga0207674_10264485
2774 Ga0207675_100000304
2775 Ga0207675_100014435
2776 Ga0207675_100048449
2777 Ga0207675_100080172
2778 Ga0207675_100083807
2779 Ga0207683_10003712
2780 Ga0207683_10005010
2781 Ga0207683_10250288
2782 Ga0207698_10001082
2783 Ga0207698_10002060
2784 Ga0207698_10004520
2785 Ga0207698_10056964
2786 Ga0207698_10174689
2787 Ga0209281_1000094
2788 Ga0209995_1001337
2789 Ga0209968_1002355
2790 Ga0210002_1001420
2791 Ga0209974_10017789
2792 Ga0207428_10179661
2793 Ga0268266_10000018
2794 Ga0268266_10000021
2795 Ga0268266_10000049
2796 Ga0268266_10071433
2797 Ga0268265_10014622
2798 Ga0268265_10019901
2799 Ga0268265_10138654
2800 Ga0268265_10235540
2801 Ga0268264_10000041
2802 Ga0268264_10001720
2803 Ga0268264_10003107
2804 Ga0268264_10003860
2805 Ga0268264_10009362
2806 Ga0268264_10011235
2807 Ga0268264_10014882
2808 Ga0268264_10022519
2809 Ga0268264_10054823
2810 Ga0268264_10066048
2811 Ga0268264_10166098
2812 Ga0268264_10274850
2813 Ga0265334_10005205
2814 Ga0265323_10000381
2815 Ga0307517_10002048
2816 Ga0307517_10004683
2817 Ga0307515_10000001
2818 Ga0307515_10001752
2819 Ga0307515_10002910
2820 Ga0307515_10014453
2821 Ga0307515_10086237
2822 Ga0265338_10000471
2823 Ga0265338_10138998
2824 Ga0307511_10000042
2825 Ga0316177_1198244
2826 Ga0316176_1050137
2827 Ga0314311_1025340
2828 Ga0316183_1065995
2829 Ga0316181_1148726
2830 Ga0265327_10000010
2831 Ga0265327_10000192
2832 Ga0265327_10000653
2833 Ga0265327_10000972
2834 Ga0265316_10000618
2835 Ga0265316_10028488
2836 Ga0307509_10026381
2837 Ga0307509_10105279
2838 Ga0307408_100000121
2839 Ga0307408_100000611
2840 Ga0307408_100000660
2841 Ga0307408_100001373
2842 Ga0307408_100002250
2843 Ga0307408_100129664
2844 Ga0307408_100160155
2845 Ga0307508_10002100
2846 Ga0316575_10070219
2847 Ga0265342_10123102
2848 Ga0316576_10008094
2849 Ga0316576_10075969
2850 Ga0316578_10044042
2851 Ga0316578_10162598
2852 Ga0307516_10003117
2853 Ga0307405_10000003
2854 Ga0307405_10156175
2855 Ga0316577_10004430
2856 Ga0316577_10026440
2857 Ga0307413_10001112
2858 Ga0307413_10185404
2859 Ga0307410_10000067
2860 Ga0307410_10001320
2861 Ga0307410_10003139
2862 Ga0307406_10000035
2863 Ga0307406_10008639
2864 Ga0307406_10083253
2865 Ga0307406_10147620
2866 Ga0307407_10000008
2867 Ga0307407_10004708
2868 Ga0307407_10048190
2869 Ga0307412_10000012
2870 Ga0307412_10000427
2871 Ga0307412_10001456
2872 Ga0307412_10031631
2873 Ga0307409_100006323
2874 Ga0307409_100008566
2875 Ga0307409_100063317
2876 Ga0307416_100000009
2877 Ga0307416_100000010
2878 Ga0307416_100000639
2879 Ga0307416_100063210
2880 Ga0307414_10000009
2881 Ga0307414_10000038
2882 Ga0307414_10000063
2883 Ga0307414_10002879
2884 Ga0307414_10004631
2885 Ga0307414_10008231
2886 Ga0307414_10010064
2887 Ga0307414_10014324
2888 Ga0307414_10033966
2889 Ga0307414_10086212
2890 Ga0307414_10131628
2891 Ga0307414_10207829
2892 Ga0307411_10000001
2893 Ga0307411_10003236
2894 Ga0307411_10108067
2895 Ga0307415_100012792
2896 Ga0307415_100050534
2897 Ga0316580_10014554
2898 Ga0307507_10000064
2899 Ga0307507_10110315
2900 Ga0307510_10002860
2901 Ga0307510_10006943
2902 Ga0307510_10041880
2903 Ga0373941_0013117
2904 Ga0316574_0101490
2905 Ga0373927_0005849
2906 Ga0373947_0056584
2907 Ga0373937_0078419
2908 Ga0373937_0287874
2909 Ga0316582_0015711
2910 Ga0316582_0120513
2911 Ga0316584_0004574
2912 Ga0316584_0004745
2913 Ga0316584_0294557
2914 Ga0395899_0000025
2915 Ga0395899_0000033
2916 Ga0395899_0000493
2917 Ga0395899_0000629
2918 Ga0395899_0001884
2919 Ga0395899_0029186
2920 Ga0395899_0041383
2921 Ga0395899_0066951
2922 Ga0395899_0126590
2923 Ga0395900_0000480
2924 Ga0395900_0000506
2925 Ga0395900_0006601
2926 Ga0395900_0009920
2927 Ga0395900_0012177
2928 Ga0395900_0108003
2929 Ga0395900_0194491
2930 Ga0395898_0001651
2931 Ga0395898_0006652
2932 Ga0395898_0021259
2933 Ga0395898_0031717
2934 Ga0395898_0032624
2935 Ga0395898_0056108
2936 Ga0395898_0058562
2937 Ga0395898_0095872
2938 Ga0395898_0097172
2939 Ga0395905_0000254
2940 Ga0395905_0000738
2941 Ga0395905_0001166
2942 Ga0395905_0006569
2943 Ga0395905_0064234
2944 Ga0395901_0000853
2945 Ga0395901_0004350
2946 Ga0395901_0010578
2947 Ga0395901_0013263
2948 Ga0395901_0041573
2949 Ga0395901_0059253
2950 Ga0395901_0119295
2951 Ga0395901_0293579
2952 Ga0400491_13685
2953 Ga0400488_26420
2954 Ga0400483_075612
2955 Ga0400483_151915
2956 Ga0436365_0688175
2957 Ga0436365_1079918
2958 Ga0436361_0021149
2959 Ga0439436_0033356
2960 Ga0439439_0011270
2961 Ga0439466_0001850
2962 Ga0439431_0010163
2963 Ga0439442_001916
2964 Ga0439445_0005056
2965 Ga0439449_0047197
2966 Ga0439457_003825
2967 Ga0439462_0005205
2968 Ga0450898_003860
2969 Ga0439459_0002997
2970 Ga0451577_0001046
2971 Ga0451577_0002168
2972 Ga0451577_0005746
2973 Ga0451577_0044094
2974 Ga0451577_0092006
2975 Ga0451577_0119738
2976 Ga0451577_0173668
2977 Ga0466969_0000912
2978 Ga0466972_0000002
2979 Ga0466972_0000013
2980 Ga0466972_0036255
2981 Ga0466982_0000020
2982 Ga0453683_0000594
2983 Ga0453683_0001699
2984 Ga0453683_0048234
2985 Ga0466965_0031585
2986 Ga0466966_0000045
2987 Ga0466966_0008999
2988 Ga0466966_0053935
2989 Ga0466961_0033719
2990 Ga0466964_0060823
2991 Ga0453684_0000165
2992 Ga0453684_0000432
2993 Ga0453684_0000889
2994 Ga0453684_0001834
2995 Ga0453684_0002066
2996 Ga0453684_0002932
2997 Ga0453684_0003998
2998 Ga0453684_0004204
2999 Ga0453684_0006105
3000 Ga0453684_0007145
3001 Ga0453684_0009766
3002 Ga0453684_0017983
3003 Ga0453684_0027844
3004 Ga0453684_0027912
3005 Ga0453684_0032909
3006 Ga0453684_0048440
3007 Ga0453684_0071008
3008 Ga0453684_0097891
3009 Ga0453684_0110447
3010 Ga0453684_0114624
3011 Ga0453684_0354844
3012 Ga0453684_0508637
3013 Ga0466971_0011181
3014 Ga0466968_0012998
3015 Ga0466968_0016306
3016 Ga0466968_0038964
3017 Ga0466970_0000765
3018 Ga0466970_0024226
3019 Ga0466970_0045474
3020 Ga0466970_0057555
3021 Ga0466957_0000070
3022 Ga0466957_0003333
3023 Ga0466959_0000023
3024 Ga0466959_0004264
3025 Ga0466959_0099272
3026 Ga0466959_0216616
3027 Ga0451576_0000003
3028 Ga0451576_0000113
3029 Ga0451576_0001464
3030 Ga0451576_0007020
3031 Ga0451576_0007064
3032 Ga0451576_0010902
3033 Ga0451576_0023244
3034 Ga0451576_0085698
3035 Ga0451576_0100688
3036 Ga0451576_0182787
3037 Ga0451576_0384349
3038 Ga0466958_0016632
3039 Ga0495627_000003
3040 Ga0495590_0003121
3041 Ga0495638_0020976
3042 Ga0495653_0134127
3043 Ga0495650_0000087
3044 Ga0495650_0001052
3045 Ga0495650_0012544
3046 Ga0495580_0176230
3047 Ga0495585_0000286
3048 Ga0495585_0001651
3049 Ga0495596_0000878
3050 Ga0495607_0040258
3051 Ga0495606_0000052
3052 Ga0495606_0002637
3053 Ga0495606_0014847
3054 Ga0495606_0053437
3055 Ga0495606_0131942
3056 Ga0495608_0247946
3057 Ga0495610_0000001
3058 Ga0495610_0000903
3059 Ga0495610_0006770
3060 Ga0495610_0010020
3061 Ga0495616_0005196
3062 Ga0495616_0045190
3063 Ga0495628_0046274
3064 Ga0495630_0023979
3065 Ga0495631_0061416
3066 Ga0495632_0000032
3067 Ga0495643_0049195
3068 Ga0495648_0003874
3069 Ga0495648_0009989
3070 Ga0495652_0150381
3071 Ga0495652_0183721
3072 Ga0495654_0000001
3073 Ga0495587_0011934
3074 Ga0495609_0000134
3075 Ga0495609_0012533
3076 Ga0495621_0020509
3077 Ga0495633_0000008
3078 Ga0495633_0000080
3079 Ga0495633_0000081
3080 Ga0495633_0004351
3081 Ga0495656_0039957
3082 Ga0495668_0000012
3083 Ga0495668_0000292
3084 Ga0495668_0000592
3085 Ga0495668_0000751
3086 Ga0495611_0001116
3087 Ga0495625_0000036
3088 Ga0495625_0000781
3089 Ga0495625_0002289
3090 Ga0495625_0010136
3091 Ga0495625_0014574
3092 Ga0495625_0115965
3093 Ga0495661_0003611
3094 Ga0495661_0015900
3095 Ga0495661_0054910
3096 Ga0495657_0093194
3097 Ga0495658_0027377
3098 Ga0495658_0068601
3099 Ga0495670_0033633
3100 Ga0495670_0091140
3101 Ga0495649_0000017
3102 Ga0495649_0014914
3103 Ga0495649_0135922
3104 Ga0495660_0013731
3105 Ga0495636_0014693
3106 Ga0495674_0225205
3107 Ga0495672_0002824
3108 Ga0495672_0012654
3109 Ga0495672_0030914
3110 Ga0495687_000001
3111 Ga0495687_001156
3112 Ga0495687_004759
3113 Ga0495673_0000010
3114 Ga0495684_0059523
3115 Ga0495686_0000004
3116 Ga0495686_0000118
3117 Ga0495686_0000582
3118 Ga0495686_0000884
3119 Ga0495686_0020028
3120 Ga0495686_0028549
3121 Ga0495686_0079786
3122 Ga0495614_0015805
3123 Ga0496100_0035115
3124 Ga0496102_0049516
3125 Ga0496104_0317799
3126 Ga0496108_0142405
3127 Ga0496109_0165330
3128 Ga0496114_0000594
3129 Ga0496114_0091226
3130 Ga0496115_0045415
3131 Ga0496116_0000053
3132 Ga0496116_0001728
3133 Ga0496117_0000050
3134 Ga0496117_0003269
3135 Ga0496118_0000044
3136 Ga0496118_0065557
3137 Ga0496119_0000002
3138 Ga0496121_0000030
3139 Ga0496121_0021002
3140 Ga0496121_0150208
3141 Ga0496122_0000188
3142 Ga0496122_0000191
3143 Ga0496122_0000538
3144 Ga0496122_0000769
3145 Ga0496122_0001208
3146 Ga0496122_0006115
3147 Ga0496123_0000636
3148 Ga0496123_0003634
3149 Ga0496123_0003787
3150 Ga0496123_0005816
3151 Ga0496123_0008537
3152 Ga0496124_0001056
3153 Ga0496124_0096704
3154 Ga0496124_0099531
3155 Ga0496124_0112931
3156 Ga0496125_0000059
3157 Ga0496125_0000310
3158 Ga0496125_0000623
3159 Ga0496125_0007782
3160 Ga0496125_0008192
3161 Ga0496125_0036412
3162 Ga0496125_0043748
3163 Ga0496126_0000660
3164 Ga0496126_0008790
3165 Ga0496126_0022457
3166 Ga0501031_0003605
3167 Ga0501032_0030825
3168 Ga0501033_0001868
3169 Ga0501033_0010675
3170 Ga0501034_0000083
3171 Ga0501034_0004012
3172 Ga0501034_0016530
3173 Ga0501034_0018957
3174 Ga0501034_0027052
3175 Ga0501034_0054770
3176 Ga0501034_0110395
3177 Ga0501034_0151692
3178 Ga0501034_0167744
3179 Ga0501034_0225484
3180 Ga0501036_0029789
3181 Ga0501036_0111278
3182 Ga0501036_0205073
3183 Ga0501037_0046526
3184 Ga0501037_0046561
3185 Ga0501038_0012291
3186 Ga0501038_0060482
3187 Ga0501038_0162179
3188 Ga0501039_0212900
3189 Ga0501043_0016678
3190 Ga0501043_0024314
3191 Ga0501046_0045170
3192 Ga0501047_0021075
3193 Ga0501047_0027231
3194 Ga0501047_0072959
3195 Ga0501047_0180380
3196 Ga0501048_0043141
3197 Ga0501073_0019693
3198 Ga0501074_0036497
3199 Ga0501199_008572
3200 Ga0501207_007577
3201 Ga0501223_002893
3202 Ga0501233_003872
3203 Ga0501233_018303
3204 Ga0501235_003383
3205 Ga0501238_002082
3206 Ga0501238_006011
3207 Ga0501249_000037
3208 Ga0501249_009400
3209 Ga0501252_001366
3210 Ga0501257_004852
3211 Ga0501259_001042
3212 Ga0501221_000044
3213 Ga0501225_0010824
3214 Ga0501225_0026170
3215 Ga0501234_012219
3216 Ga0501080_0083979
3217 Ga0501083_0056426
3218 Ga0501241_000031
3219 Ga0501241_013916
3220 Ga0501264_003224
3221 Ga0501266_000011
3222 Ga0501266_001616
3223 Ga0501270_000445
3224 Ga0501275_000447
3225 Ga0501280_005944
3226 Ga0501280_006796
3227 Ga0501035_0015438
3228 Ga0501035_0017043
3229 Ga0501035_0023420
3230 Ga0501035_0048319
3231 Ga0501035_0082433
3232 Ga0501044_0017840
3233 Ga0501044_0021863
3234 Ga0501044_0037569
3235 Ga0501044_0042471
3236 Ga0501044_0054836
3237 Ga0501044_0058135
3238 Ga0501284_00029
3239 nmdc:mga0k408_124405_c1
3240 nmdc:mga0k408_127396_c1
3241 nmdc:mga0k408_3518_c1
3242 nmdc:mga0k408_749_c1
3243 nmdc:mga0k408_821_c1
3244 nmdc:mga05p37_60273_c1
3245 nmdc:mga09592_983_c1
3246 nmdc:mga0qj67_97741_c1
3247 nmdc:mga06r32_98089_c1
3248 nmdc:mga08y16_10414_c1
3249 nmdc:mga08y16_107284_c1
3250 nmdc:mga08y16_244111_c1
3251 Ga0500578_0004418
3252 Ga0500578_0137455
3253 Ga0500644_0000283
3254 Ga0500646_0001428
3255 Ga0500646_0004317
3256 Ga0500583_0000108
3257 Ga0500583_0004742
3258 Ga0500651_0000084
3259 Ga0500641_0000017
3260 Ga0500641_0002621
3261 Ga0500556_0003239
3262 Ga0500562_000050
3263 Ga0500572_020975
3264 Ga0500592_009044
3265 Ga0500607_043640
3266 Ga0500608_004098
3267 Ga0500608_016279
3268 Ga0500614_006386
3269 Ga0500618_000002
3270 Ga0500652_072800
3271 Ga0500658_0000003
3272 Ga0500658_0006060
3273 Ga0500564_024121
3274 Ga0500568_0001545
3275 Ga0500577_0002086
3276 Ga0500589_003337
3277 Ga0500604_0021565
3278 Ga0500616_0000082
3279 Ga0500616_0000849
3280 Ga0500616_0009033
3281 Ga0500616_0059069
3282 Ga0500622_0000003
3283 Ga0500622_0000008
3284 Ga0500622_0000777
3285 Ga0500622_0004378
3286 Ga0500622_0004557
3287 Ga0500622_0005633
3288 Ga0500627_0051765
3289 Ga0500633_0020452
3290 Ga0500637_0167162
3291 Ga0500611_000022
3292 Ga0500645_019667
3293 Ga0501082_0050376
3294 Ga0466962_0005611
3295 2511234749
3296 2513235061
3297 2520879409
3298 2522548015
3299 2524004499
3300 2538832432
3301 2585143470
3302 2585158507
3303 2585162855
3304 2585424754
3305 2586210051
3306 2587680655
3307 2587747861
3308 2587866777
3309 2587942916
3310 2588208243
3311 2588213191
3312 2588219807
3313 2588223920
3314 2588233479
3315 2588446447
3316 2590600845
3317 2590611894
3318 2595451676
3319 2599478339
3320 2643830454
3321 2644013060
3322 2644372378
3323 2644642606
3324 2644684850
3325 2721028239
3326 2722726342
3327 2729198586
3328 2735836266
3329 2738700679
3330 2738726372
3331 2738732464
3332 2738757064
3333 2738760401
3334 2738765029
3335 2738851782
3336 2739214044
3337 2739227679
3338 2739254428
3339 2739302548
3340 2739590672
3341 2739617092
3342 2739647397
3343 2739730759
3344 2740001324
3345 2740006140
3346 2740032875
3347 2740057599
3348 2753672695
3349 2765572573
3350 2772605418
3351 2776612452
3352 2802653772
3353 2816872924
3354 2817416277
3355 2819546346
3356 2819563491
3357 2819573626
3358 2819680874
3359 2821136960
3360 2833643624
3361 2839991350
3362 2842084181
3363 2842725023
3364 2842908875
3365 2842914187
3366 2842915361
3367 2849286581
3368 2852623163
3369 2852630367
3370 2857614955
3371 2857618659
3372 2857630291
3373 2871723726
3374 2881363108
3375 2883072582
3376 2884414414
3377 2884635382
3378 2884795631
3379 2884937972
3380 2889291699
3381 2890739568
3382 2895398771
3383 2895503564
3384 2896087749
3385 2896112545
3386 2896319310
3387 2896346134
3388 2898716259
3389 2902051527
3390 2903896889
3391 2904422794
3392 2904448667
3393 2904464199
3394 2904468298
3395 2904557072
3396 2904783772
3397 2906000812
3398 2910247658
3399 2911143607
3400 2914760592
3401 2919181978
3402 2919189654
3403 2919195304
3404 2919402895
3405 2919404752
3406 2919440791
3407 2919685974
3408 2919695678
3409 2928080611
3410 2928150836
3411 2929153565
3412 2929157423
3413 2929178798
3414 2929241239
3415 2929923237
3416 2932083004
3417 2939612355
3418 2939667880
3419 2945927284
3420 2946001965
3421 2946019398
3422 2946021401
3423 2954018849
3424 2958461119
3425 2958513294
3426 2977232529
3427 2977246214
3428 2977270229
3429 2984575975
3430 2984609430
3431 2993373501
3432 2993484184
3433 3003237224
3434 8003153680
3435 8054310081
3436 8055421936
3437 8055589910
3438 8055593424
3439 8056443838

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00475

IGPD

Imidazoleglycerol-phosphate dehydratase

268

409

0.99

PF13242

Hydrolase_like

HAD-hyrolase-like

152

203

0.94

PF08645

PNK3P

Polynucleotide kinase 3 phosphatase

53

194

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
7oj5-assembly1.cif.gz_A cryo-em structure of medicago truncatula hisn5 protein 0.9668 197 355
4mu3-assembly1.cif.gz_A the form a structure of an e21q catalytic mutant of a. thaliana igpd2 in complex with mn2+ and a mixture of its substrate, 2r3s-igp, and an inhibitor, 2s3s-igp, to 1.12 a resolution 0.9652 197 357
4mu4-assembly1.cif.gz_A the form b structure of an e21q catalytic mutant of a. thaliana igpd2 in complex with mn2+ and its substrate, 2r3s-igp, to 1.41 a resolution 0.9503 197 365
6fwh-assembly1.cif.gz_A acanthamoeba igpd in complex with r-c348 to 1.7a resolution 0.9418 197 367
4lom-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis hisb in complex with its substrate 0.9396 197 355
ID Description Score Start End Superfamily
2f1dA02 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 0.9679 264 355 3.30.230.40
1rhyA02 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 0.9634 264 353 3.30.230.40
1rhyA02 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 0.9431 264 353 3.30.230.40
2f1dA02 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 0.9381 264 355 3.30.230.40
af_Q58109_93_196_3.30.230.40 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 0.9318 264 367 3.30.230.40
ID Description Score Start End GO Terms
AF-A0A354X489-F1-model_v4 Bifunctional histidinol-phosphatase/imidazoleglycerol-phosphate dehydratase (EC 3.1.3.15, EC 4.2.1.19) 0.9975 1 93 GO:0004401
GO:0004424
AF-A0A7X3D3U3-F1-model_v4 D,D-heptose 1,7-bisphosphate phosphatase 0.9941 2 143 GO:0000105
GO:0004401
GO:0004424
GO:0005737
GO:0005975
GO:0046872
AF-A0A838TSW8-F1-model_v4 D,D-heptose 1,7-bisphosphate phosphatase 0.9824 3 130 GO:0000105
GO:0004401
GO:0004424
GO:0005737
GO:0005975
GO:0046872
AF-A0A354X489-F1-model_v4 Bifunctional histidinol-phosphatase/imidazoleglycerol-phosphate dehydratase (EC 3.1.3.15, EC 4.2.1.19) 0.9765 1 93 GO:0004401
GO:0004424
AF-A0A7J4NV12-F1-model_v4 Imidazoleglycerol-phosphate dehydratase HisB 0.9749 197 342 GO:0000105
GO:0004424

Map