metagRoot

F495478

General Info

Members	Datasets	Scaffolds	Average Seq Length
1723	592	3447	152

Family's Representative Sequence

Representative Sequence	3300005458\|Ga0070681_10898991\|Ga0070681_108989912
Length	187
Sequence	MTVRIELKVLDPRLAGWGFPHYGSELAAGLDLHACIDEPLLLRPQAPAVLISSGIAVRIGDPGWCALVLPRSGLGHREGLVLGNAVGLIDADYEGPCLVSAWNRNPASANRTDEGILIRPGDRIAQLVVTSVARPAFTVVAEFSARGGRQAGGFGSTGTAAADANACSDPAAGRHYPEREDPAARKP

Samples

	Sample ID	Description	Type	Environment
1	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
2	3300001979	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6	Metagenome	Rhizosphere
3	3300002704	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB	Metagenome	Unclassified
4	3300002705	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS	Metagenome	Unclassified
5	3300002738	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA	Metagenome	Unclassified
6	3300002741	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL	Metagenome	Unclassified
7	3300002774	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA	Metagenome	Endosphere
8	3300002987	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB	Metagenome	Endosphere
9	3300003187	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB	Metagenome	Endosphere
10	3300003203	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
11	3300003215	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF	Metagenome	Endosphere
12	3300003322	Sugarcane root Sample L2	Metagenome	Unclassified
13	3300003323	Sugarcane root Sample H1	Metagenome	Unclassified
14	3300003354	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS	Metagenome	Endosphere
15	3300003374	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF	Metagenome	Endosphere
16	3300003771	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2	Metagenome	Endosphere
17	3300003773	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2	Metagenome	Endosphere
18	3300003775	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2	Metagenome	Endosphere
19	3300003781	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2	Metagenome	Endosphere
20	3300003784	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2	Metagenome	Endosphere
21	3300003790	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2	Metagenome	Endosphere
22	3300003791	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2	Metagenome	Endosphere
23	3300003792	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2	Metagenome	Endosphere
24	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
25	3300004625	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2	Metagenome	Endosphere
26	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
27	3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3)	Metagenome	Rhizosphere
28	3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2)	Metagenome	Rhizosphere
29	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
30	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
31	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
32	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
33	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
34	3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Metagenome	Rhizosphere
35	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
36	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
37	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
38	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
39	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
40	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
41	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
42	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
43	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
44	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
45	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
46	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
47	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
48	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
49	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
50	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
51	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
52	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
53	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
54	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
55	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
56	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
57	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
58	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
59	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
60	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
61	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
62	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
63	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
64	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
65	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
66	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
67	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
68	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
69	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
70	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
71	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
72	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
73	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
74	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
75	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
76	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
77	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
78	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
79	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
80	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
81	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
82	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
83	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
84	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
85	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
86	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
87	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
88	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
89	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
90	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
91	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
92	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
93	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
94	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
95	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
96	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
97	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
98	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
99	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
100	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
101	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
102	3300006058	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Metagenome	Rhizosphere
103	3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Metagenome	Rhizosphere
104	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
105	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
106	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
107	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
108	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
109	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
110	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
111	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
112	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
113	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
114	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
115	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
116	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
117	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
118	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
119	3300006944	Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW	Metagenome	Nodule
120	3300006946	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG	Metagenome	Nodule
121	3300006948	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15	Metagenome	Nodule
122	3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Metagenome	Rhizosphere
123	3300009036	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG	Metagenome	Rhizosphere
124	3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Metagenome	Rhizosphere
125	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
126	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
127	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
128	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
129	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
130	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
131	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
132	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
133	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
134	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
135	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
136	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
137	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
138	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
139	3300012475	Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610	Metagenome	Rhizosphere
140	3300012497	Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510	Metagenome	Rhizosphere
141	3300012500	Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610	Metagenome	Rhizosphere
142	3300012513	Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510	Metagenome	Rhizosphere
143	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
144	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
145	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
146	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
147	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
148	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
149	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
150	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
151	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
152	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
153	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
154	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
155	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
156	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
157	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
158	3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Metagenome	Rhizosphere
159	3300015265	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG	Metagenome	Rhizosphere
160	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
161	3300020081	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
162	3300021361	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2	Metagenome	Rhizosphere
163	3300021388	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8	Metagenome	Unclassified
164	3300025206	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2)	Metagenome	Unclassified
165	3300025208	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
166	3300025242	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
167	3300025245	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3)	Metagenome	Endosphere
168	3300025246	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2)	Metagenome	Unclassified
169	3300025250	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2)	Metagenome	Unclassified
170	3300025256	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2)	Metagenome	Unclassified
171	3300025258	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3)	Metagenome	Endosphere
172	3300025263	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3)	Metagenome	Endosphere
173	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
174	3300025284	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
175	3300025291	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3)	Metagenome	Endosphere
176	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
177	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
178	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
179	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
180	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
181	3300025299	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3)	Metagenome	Endosphere
182	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
183	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
184	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
185	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
186	3300025728	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
187	3300025735	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
188	3300025885	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
189	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
190	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
191	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
192	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
193	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
194	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
195	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
196	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
197	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
198	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
199	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
200	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
201	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
202	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
203	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
204	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
205	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
206	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
207	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
208	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
209	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
210	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
211	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
212	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
213	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
214	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
215	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
216	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
217	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
218	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
219	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
220	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
221	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
222	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
223	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
224	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
225	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
226	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
227	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
228	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
229	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
230	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
231	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
232	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
233	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
234	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
235	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
236	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
237	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
238	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
239	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
240	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
241	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
242	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
243	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
244	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
245	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
246	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
247	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
248	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
249	3300027111	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2)	Metagenome	Nodule
250	3300027296	Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2)	Metagenome	Nodule
251	3300027876	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
252	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
253	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
254	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
255	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
256	3300028558	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG	Metagenome	Rhizosphere
257	3300028563	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG	Metagenome	Rhizosphere
258	3300028573	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG	Metagenome	Rhizosphere
259	3300028577	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG	Metagenome	Rhizosphere
260	3300028786	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM	Metagenome	Unclassified
261	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
262	3300029957	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG	Metagenome	Rhizosphere
263	3300030500	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3)	Metagenome	Rhizosphere
264	3300030521	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM	Metagenome	Unclassified
265	3300031235	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG	Metagenome	Rhizosphere
266	3300031238	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG	Metagenome	Rhizosphere
267	3300031239	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG	Metagenome	Rhizosphere
268	3300031240	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG	Metagenome	Rhizosphere
269	3300031242	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG	Metagenome	Rhizosphere
270	3300031247	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG	Metagenome	Rhizosphere
271	3300031249	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG	Metagenome	Rhizosphere
272	3300031250	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG	Metagenome	Rhizosphere
273	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
274	3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Metagenome	Rhizosphere
275	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
276	3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Metagenome	Unclassified
277	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
278	3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Metagenome	Unclassified
279	3300031649	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM	Metagenome	Unclassified
280	3300031665	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3	Metagenome	Rhizosphere
281	3300031691	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA	Metagenome	Rhizosphere
282	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
283	3300031712	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG	Metagenome	Rhizosphere
284	3300031727	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5	Metagenome	Rhizosphere
285	3300031728	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC	Metagenome	Rhizosphere
286	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
287	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
288	3300031733	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1	Metagenome	Rhizosphere
289	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
290	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
291	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
292	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
293	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
294	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
295	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
296	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
297	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
298	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
299	3300032139	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB	Metagenome	Rhizosphere
300	3300033179	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM	Metagenome	Unclassified
301	3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Metagenome	Unclassified
302	3300034817	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1	Metagenome	Rhizosphere
303	3300034820	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2	Metagenome	Rhizosphere
304	3300034957	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2	Metagenome	Rhizosphere
305	3300035084	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1	Metagenome	Rhizosphere
306	3300035088	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4	Metagenome	Rhizosphere
307	3300035090	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2	Metagenome	Rhizosphere
308	3300035091	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4	Metagenome	Rhizosphere
309	3300035112	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16	Metagenome	Rhizosphere
310	3300035113	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12	Metagenome	Rhizosphere
311	3300035114	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3	Metagenome	Rhizosphere
312	3300035115	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11	Metagenome	Rhizosphere
313	3300035116	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3	Metagenome	Rhizosphere
314	3300035121	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3	Metagenome	Rhizosphere
315	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
316	3300035171	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4	Metagenome	Rhizosphere
317	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
318	3300035241	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4	Metagenome	Rhizosphere
319	3300035398	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1	Metagenome	Rhizosphere
320	3300035410	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12	Metagenome	Rhizosphere
321	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
322	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
323	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
324	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
325	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
326	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
327	3300036647	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA	Metagenome	Rhizosphere
328	3300036712	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA	Metagenome	Rhizosphere
329	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
330	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
331	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
332	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
333	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
334	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
335	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
336	3300038726	Seagrass microbial communities from Seahorse Key, FL, USA - TH0319	Metagenome	Unclassified
337	3300038741	Seagrass microbial communities from Seahorse Key, FL, USA - SV0818	Metagenome	Unclassified
338	3300039062	Seagrass microbial communities from Seahorse Key, FL, USA - HH0818	Metagenome	Unclassified
339	3300039093	Seagrass microbial communities from Seahorse Key, FL, USA - TH0818	Metagenome	Unclassified
340	3300039145	Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1	Metagenome	Unclassified
341	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
342	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
343	3300039450	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2	Metagenome	Unclassified
344	3300041405	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414	Metagenome	Rhizosphere
345	3300041410	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596	Metagenome	Rhizosphere
346	3300041441	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG	Metagenome	Rhizoplane
347	3300041443	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG	Metagenome	Rhizoplane
348	3300041451	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG	Metagenome	Rhizoplane
349	3300041452	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG	Metagenome	Rhizoplane
350	3300041453	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG	Metagenome	Rhizoplane
351	3300041456	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG	Metagenome	Rhizoplane
352	3300041459	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG	Metagenome	Rhizoplane
353	3300041460	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG	Metagenome	Rhizoplane
354	3300041486	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG	Metagenome	Rhizoplane
355	3300041491	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG	Metagenome	Unclassified
356	3300041494	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG	Metagenome	Unclassified
357	3300041498	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG	Metagenome	Unclassified
358	3300041507	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG	Metagenome	Unclassified
359	3300041509	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG	Metagenome	Unclassified
360	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
361	3300042000	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539	Metagenome	Rhizosphere
362	3300042002	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616	Metagenome	Rhizosphere
363	3300042016	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357	Metagenome	Rhizosphere
364	3300042115	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642	Metagenome	Rhizosphere
365	3300042117	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937	Metagenome	Rhizosphere
366	3300042120	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192	Metagenome	Rhizosphere
367	3300042126	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87	Metagenome	Rhizosphere
368	3300042127	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91	Metagenome	Rhizosphere
369	3300042130	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97	Metagenome	Rhizosphere
370	3300042138	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379	Metagenome	Rhizosphere
371	3300042139	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442	Metagenome	Rhizosphere
372	3300042144	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89	Metagenome	Rhizosphere
373	3300042156	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593	Metagenome	Rhizosphere
374	3300042532	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92	Metagenome	Rhizosphere
375	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
376	3300044656	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R	Metagenome	Rhizosphere
377	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
378	3300044673	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED	Metagenome	Rhizosphere
379	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
380	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
381	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
382	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
383	3300044706	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R	Metagenome	Rhizosphere
384	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
385	3300044719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R	Metagenome	Rhizosphere
386	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
387	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
388	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
389	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
390	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
391	3300046452	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere	Metagenome	Rhizosphere
392	3300046453	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere	Metagenome	Rhizosphere
393	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
394	3300046457	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere	Metagenome	Rhizosphere
395	3300046458	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere	Metagenome	Rhizosphere
396	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
397	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
398	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
399	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
400	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
401	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
402	3300046474	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere	Metagenome	Rhizosphere
403	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
404	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
405	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
406	3300046500	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere	Metagenome	Rhizosphere
407	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
408	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
409	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
410	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
411	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
412	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
413	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
414	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
415	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
416	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
417	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
418	3300046523	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere	Metagenome	Rhizosphere
419	3300046528	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere	Metagenome	Rhizosphere
420	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
421	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
422	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
423	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
424	3300046537	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere	Metagenome	Rhizosphere
425	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
426	3300046539	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere	Metagenome	Rhizosphere
427	3300046542	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere	Metagenome	Rhizosphere
428	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
429	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
430	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
431	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
432	3300046648	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere	Metagenome	Rhizosphere
433	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
434	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
435	3300046664	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere	Metagenome	Rhizosphere
436	3300046665	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere	Metagenome	Rhizosphere
437	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
438	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
439	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
440	3300046681	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere	Metagenome	Rhizosphere
441	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
442	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
443	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
444	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
445	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
446	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
447	3300046794	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere	Metagenome	Rhizosphere
448	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
449	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
450	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
451	3300047318	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere	Metagenome	Rhizosphere
452	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
453	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
454	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
455	3300047443	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere	Metagenome	Rhizosphere
456	3300047445	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere	Metagenome	Rhizosphere
457	3300047446	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere	Metagenome	Rhizosphere
458	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
459	3300047470	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere	Metagenome	Rhizosphere
460	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
461	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
462	3300048089	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere	Metagenome	Rhizosphere
463	3300048091	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere	Metagenome	Rhizosphere
464	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
465	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
466	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
467	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
468	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
469	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
470	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
471	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
472	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
473	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
474	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
475	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
476	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
477	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
478	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
479	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
480	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
481	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
482	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
483	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
484	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
485	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
486	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
487	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
488	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
489	3300049129	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
490	3300049459	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere	Metagenome	Rhizosphere
491	3300049460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere	Metagenome	Rhizosphere
492	3300049522	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control	Metagenome	Rhizosphere
493	3300049530	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
494	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
495	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
496	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
497	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
498	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
499	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
500	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
501	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
502	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
503	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
504	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
505	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
506	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
507	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
508	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
509	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
510	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
511	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
512	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
513	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
514	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
515	3300049650	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought	Metagenome	Rhizosphere
516	3300049652	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought	Metagenome	Rhizosphere
517	3300049658	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought	Metagenome	Rhizosphere
518	3300049662	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control	Metagenome	Rhizosphere
519	3300049679	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought	Metagenome	Rhizosphere
520	3300049683	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control	Metagenome	Rhizosphere
521	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
522	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
523	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
524	3300049761	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control	Metagenome	Rhizosphere
525	3300049763	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control	Metagenome	Rhizosphere
526	3300049764	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control	Metagenome	Rhizosphere
527	3300049769	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought	Metagenome	Rhizosphere
528	3300049774	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought	Metagenome	Rhizosphere
529	3300049775	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought	Metagenome	Rhizosphere
530	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
531	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
532	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
533	3300049853	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought	Metagenome	Rhizosphere
534	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
535	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
536	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
537	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
538	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
539	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
540	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
541	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
542	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
543	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
544	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
545	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
546	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
547	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
548	3300053078	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere	Metagenome	Rhizosphere
549	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
550	3300053086	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere	Metagenome	Endosphere
551	3300053088	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere	Metagenome	Endosphere
552	3300053090	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere	Metagenome	Endosphere
553	3300053091	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere	Metagenome	Endosphere
554	3300053092	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere	Metagenome	Endosphere
555	3300053093	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere	Metagenome	Endosphere
556	3300053098	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere	Metagenome	Endosphere
557	3300053100	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere	Metagenome	Endosphere
558	3300053103	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere	Metagenome	Endosphere
559	3300053108	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere	Metagenome	Endosphere
560	3300053109	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere	Metagenome	Endosphere
561	3300053115	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere	Metagenome	Endosphere
562	3300053117	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere	Metagenome	Endosphere
563	3300053118	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere	Metagenome	Endosphere
564	3300053129	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere	Metagenome	Endosphere
565	3300053130	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere	Metagenome	Endosphere
566	3300053131	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere	Metagenome	Endosphere
567	3300053133	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere	Metagenome	Endosphere
568	3300053134	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere	Metagenome	Endosphere
569	3300053136	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere	Metagenome	Endosphere
570	3300053137	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere	Metagenome	Endosphere
571	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
572	3300053142	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere	Metagenome	Endosphere
573	3300053146	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere	Metagenome	Endosphere
574	3300053151	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere	Metagenome	Endosphere
575	3300053154	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere	Metagenome	Endosphere
576	3300053156	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere	Metagenome	Endosphere
577	3300053730	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere	Metagenome	Endosphere
578	3300053734	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere	Metagenome	Endosphere
579	3300053739	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere	Metagenome	Endosphere
580	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
581	3300059421	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
582	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
583	2599185307	Pseudomonas sp. NFACC02	Isolate	Rhizoplane
584	2643221665	Acinetobacter sp. Root1280	Isolate	Unclassified
585	2765235841	Pseudomonas putida AA7	Isolate	Unclassified
586	2855020534	Paracoccus endophyticus SYSUP0003	Isolate	Stem Tuber
587	2861691609	Methylorubrum thiocyanatum DSM 11490	Isolate	Rhizosphere
588	2919155634	Pseudomonas fulva 1992	Isolate	Unclassified
589	2928515477	Acinetobacter bereziniae 1375	Isolate	Rhizosphere
590	2952252522	Salinicola sp. DM10	Isolate	Unclassified
591	3003665799	Methylobacterium aquaticum BG2	Isolate	Unclassified
592	8056161164	Pseudomonas azadiae SWRI103	Isolate	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	99.25
Metatranscriptomes	0.17
Isolates	0.58

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	15.21
Nodule	0.41
Rhizoplane	3.83
Rhizosphere	74.41
Stem	0
Stem Tuber	0.06
Unclassified	0.23

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	Ga0070681_10898991	3300005458	Bacteria	804
2	JGI24740J21852_10012529	3300001979	Bacteria	3194
3	JGI25155J39150_1000079	3300002704	Bacteria	56287
4	JGI25156J39149_1000125	3300002705	Bacteria	56308
5	JGI25154J39366_1000141	3300002738	Bacteria	56305
6	JGI25157J39369_1000159	3300002741	Bacteria	56308
7	JGI25150J39212_1006333	3300002774	Bacteria	2452
8	JGI25150J39212_1007862	3300002774	Bacteria	2120
9	JGI25159J45721_1000638	3300002987	Bacteria	15559
10	JGI25159J45721_1002502	3300002987	Bacteria	6925
11	JGI25151J46595_10019053	3300003187	Bacteria	2928
12	JGI25406J46586_10000015	3300003203	Bacteria	91406
13	JGI25153J46596_10002603	3300003215	Bacteria	10329
14	JGI25153J46596_10002737	3300003215	Bacteria	10048
15	rootL2_10048698	3300003322	Bacteria	6451
16	rootH1_10008298	3300003316	Bacteria	7116
17	rootH1_10008298	3300003323	Bacteria	13422
18	rootH1_10032418	3300003323	Bacteria	4244
19	rootH1_10219628	3300003323	Bacteria	1059
20	rootH1_10235640	3300003323	Bacteria	3076
21	JGI25160J50197_1000067	3300003354	Bacteria	113436
22	JGI25161J50226_1000035	3300003374	Bacteria	133666
23	Ga0055526_1000542	3300003771	Bacteria	29770
24	Ga0055526_1007532	3300003771	Bacteria	5632
25	Ga0055526_1007544	3300003771	Bacteria	5625
26	Ga0055537_1001739	3300003773	Bacteria	8036
27	Ga0055537_1024062	3300003773	Bacteria	861
28	Ga0055524_1000006	3300003775	Bacteria	324702
29	Ga0055524_1000079	3300003775	Bacteria	120203
30	Ga0055524_1001129	3300003775	Bacteria	16068
31	Ga0055536_1000447	3300003781	Bacteria	29029
32	Ga0055534_1001178	3300003784	Bacteria	10992
33	Ga0055534_1003541	3300003784	Bacteria	4874
34	Ga0055528_1000374	3300003790	Bacteria	36367
35	Ga0055530_10000346	3300003791	Bacteria	41934
36	Ga0055530_10002750	3300003791	Bacteria	10882
37	Ga0055530_10013673	3300003791	Bacteria	2755
38	Ga0055530_10018865	3300003791	Bacteria	2110
39	Ga0055540_1000005	3300003792	Bacteria	378126
40	Ga0055540_1000086	3300003792	Bacteria	102576
41	Ga0055540_1056259	3300003792	Bacteria	797
42	Ga0055531_10000604	3300003794	Bacteria	31172
43	Ga0055531_10000607	3300003794	Bacteria	31111
44	Ga0055531_10002992	3300003794	Bacteria	10972
45	Ga0055531_10003346	3300003794	Bacteria	10256
46	Ga0055531_10005016	3300003794	Bacteria	7847
47	Ga0055531_10009416	3300003794	Bacteria	4992
48	Ga0055543_1001289	3300004625	Bacteria	10317
49	Ga0065165_1010114	3300005262	Bacteria	4130
50	Ga0065165_1014561	3300005262	Bacteria	3047
51	Ga0065165_1018974	3300005262	Bacteria	2470
52	Ga0065165_1021684	3300005262	Bacteria	2223
53	Ga0065712_10188573	3300005290	Bacteria	1148
54	Ga0065707_10242902	3300005295	Bacteria	1150
55	Ga0070658_10165783	3300005327	Bacteria	1855
56	Ga0070658_10178500	3300005327	Bacteria	1787
57	Ga0070658_10376755	3300005327	Bacteria	1217
58	Ga0070676_10002509	3300005328	Bacteria	9418
59	Ga0070676_10025454	3300005328	Bacteria	3345
60	Ga0070676_10075715	3300005328	Bacteria	2030
61	Ga0070676_10224705	3300005328	Bacteria	1242
62	Ga0070683_100037706	3300005329	Bacteria	4425
63	Ga0070683_100121661	3300005329	Bacteria	2466
64	Ga0070690_100010662	3300005330	Bacteria	5354
65	Ga0070690_100239905	3300005330	Bacteria	1278
66	Ga0070670_100024964	3300005331	Bacteria	5142
67	Ga0070670_100046533	3300005331	Bacteria	3731
68	Ga0070670_100949901	3300005331	Bacteria	780
69	Ga0070670_101241508	3300005331	Bacteria	681
70	Ga0070670_101617950	3300005331	Bacteria	595
71	Ga0070677_10006749	3300005333	Bacteria	3821
72	Ga0070677_10012615	3300005333	Bacteria	2937
73	Ga0070677_10017639	3300005333	Bacteria	2559
74	Ga0070677_10092265	3300005333	Bacteria	1319
75	Ga0070677_10334597	3300005333	Bacteria	780
76	Ga0068869_100012500	3300005334	Bacteria	5614
77	Ga0068869_100096147	3300005334	Bacteria	2235
78	Ga0070666_10000910	3300005335	Bacteria	17957
79	Ga0070666_10004166	3300005335	Bacteria	8775
80	Ga0070666_10241796	3300005335	Bacteria	1277
81	Ga0070666_10429708	3300005335	Bacteria	952
82	Ga0070666_10457645	3300005335	Bacteria	922
83	Ga0070680_100056960	3300005336	Bacteria	3194
84	Ga0070680_100157655	3300005336	Bacteria	1907
85	Ga0070680_100573155	3300005336	Bacteria	968
86	Ga0068868_100004895	3300005338	Bacteria	9402
87	Ga0068868_100019803	3300005338	Bacteria	5048
88	Ga0068868_100615315	3300005338	Bacteria	964
89	Ga0068868_101493088	3300005338	Bacteria	632
90	Ga0070660_100019427	3300005339	Bacteria	4980
91	Ga0070689_100103553	3300005340	Bacteria	2256
92	Ga0070689_101208455	3300005340	Bacteria	679
93	Ga0070691_10049116	3300005341	Bacteria	2009
94	Ga0070687_100107854	3300005343	Bacteria	1571
95	Ga0070661_100000925	3300005344	Bacteria	21020
96	Ga0070668_100000411	3300005347	Bacteria	28460
97	Ga0070668_100253166	3300005347	Bacteria	1463
98	Ga0070669_100005882	3300005353	Bacteria	8848
99	Ga0070669_100007708	3300005353	Bacteria	7696
100	Ga0070669_100153600	3300005353	Bacteria	1783
101	Ga0070669_100197215	3300005353	Bacteria	1582
102	Ga0070669_100442007	3300005353	Bacteria	1070
103	Ga0070675_100000199	3300005354	Bacteria	37845
104	Ga0070675_100003618	3300005354	Bacteria	11759
105	Ga0070675_100016158	3300005354	Bacteria	5918
106	Ga0070675_100025060	3300005354	Bacteria	4781
107	Ga0070675_100059825	3300005354	Bacteria	3144
108	Ga0070675_100063020	3300005354	Bacteria	3064
109	Ga0070675_100129478	3300005354	Bacteria	2149
110	Ga0070675_100175593	3300005354	Bacteria	1850
111	Ga0070675_100234314	3300005354	Bacteria	1602
112	Ga0070675_100261486	3300005354	Bacteria	1517
113	Ga0070675_100304386	3300005354	Bacteria	1405
114	Ga0070675_100605865	3300005354	Bacteria	993
115	Ga0070671_100068600	3300005355	Bacteria	2958
116	Ga0070671_100082092	3300005355	Bacteria	2695
117	Ga0070671_100119592	3300005355	Bacteria	2216
118	Ga0070671_100174389	3300005355	Bacteria	1819
119	Ga0070671_100282123	3300005355	Bacteria	1413
120	Ga0070671_100558339	3300005355	Bacteria	988
121	Ga0070671_100577438	3300005355	Bacteria	971
122	Ga0070671_100751456	3300005355	Bacteria	848
123	Ga0070674_100008421	3300005356	Bacteria	6142
124	Ga0070674_100009710	3300005356	Bacteria	5777
125	Ga0070674_100076188	3300005356	Bacteria	2384
126	Ga0070674_100171882	3300005356	Bacteria	1653
127	Ga0070674_100191479	3300005356	Bacteria	1574
128	Ga0070674_100224656	3300005356	Bacteria	1462
129	Ga0070674_100803409	3300005356	Bacteria	812
130	Ga0070674_101195863	3300005356	Bacteria	675
131	Ga0070673_100001468	3300005364	Bacteria	13793
132	Ga0070673_100008853	3300005364	Bacteria	6723
133	Ga0070673_100028271	3300005364	Bacteria	4167
134	Ga0070673_100070117	3300005364	Bacteria	2812
135	Ga0070673_100147698	3300005364	Bacteria	1988
136	Ga0070673_100150088	3300005364	Bacteria	1973
137	Ga0070673_100177443	3300005364	Bacteria	1822
138	Ga0070673_100319302	3300005364	Bacteria	1371
139	Ga0070688_100317323	3300005365	Bacteria	1131
140	Ga0070659_100001694	3300005366	Bacteria	15853
141	Ga0070659_100788685	3300005366	Bacteria	826
142	Ga0070667_100000463	3300005367	Bacteria	41711
143	Ga0070667_100003988	3300005367	Bacteria	12507
144	Ga0070667_100019707	3300005367	Bacteria	5596
145	Ga0070667_100044588	3300005367	Bacteria	3725
146	Ga0070667_100088182	3300005367	Bacteria	2664
147	Ga0070667_100162405	3300005367	Bacteria	1968
148	Ga0070667_100274337	3300005367	Bacteria	1513
149	Ga0070667_100857417	3300005367	Bacteria	844
150	Ga0070714_100085415	3300005435	Bacteria	2756
151	Ga0070714_100940801	3300005435	Bacteria	840
152	Ga0070713_100150212	3300005436	Bacteria	2071
153	Ga0070713_100276595	3300005436	Bacteria	1539
154	Ga0070713_100473741	3300005436	Bacteria	1179
155	Ga0070713_100495254	3300005436	Bacteria	1153
156	Ga0070713_100626243	3300005436	Bacteria	1023
157	Ga0070713_100753871	3300005436	Bacteria	931
158	Ga0070710_10007341	3300005437	Bacteria	5334
159	Ga0070710_10065129	3300005437	Bacteria	2087
160	Ga0070710_10506754	3300005437	Bacteria	827
161	Ga0070710_10549970	3300005437	Bacteria	797
162	Ga0070701_10346409	3300005438	Bacteria	927
163	Ga0070711_100061388	3300005439	Bacteria	2617
164	Ga0070705_100857867	3300005440	Bacteria	727
165	Ga0070705_100978965	3300005440	Bacteria	685
166	Ga0070700_100054257	3300005441	Bacteria	2504
167	Ga0070700_100081321	3300005441	Bacteria	2093
168	Ga0070708_100104465	3300005445	Bacteria	2598
169	Ga0070708_100595274	3300005445	Bacteria	1042
170	Ga0070663_100003243	3300005455	Bacteria	9358
171	Ga0070663_100003886	3300005455	Bacteria	8706
172	Ga0070663_100850583	3300005455	Bacteria	785
173	Ga0070663_101262511	3300005455	Bacteria	651
174	Ga0070678_100001786	3300005456	Bacteria	11591
175	Ga0070678_100025816	3300005456	Bacteria	3960
176	Ga0070678_100028458	3300005456	Bacteria	3812
177	Ga0070678_100087358	3300005456	Bacteria	2381
178	Ga0070678_100289859	3300005456	Bacteria	1387
179	Ga0070678_100338210	3300005456	Bacteria	1290
180	Ga0070678_101232293	3300005456	Bacteria	695
181	Ga0070678_101284639	3300005456	Bacteria	681
182	Ga0070662_100034028	3300005457	Bacteria	3591
183	Ga0070662_100093049	3300005457	Bacteria	2267
184	Ga0070662_100182623	3300005457	Bacteria	1655
185	Ga0070662_100183998	3300005457	Bacteria	1649
186	Ga0070662_100509332	3300005457	Bacteria	1005
187	Ga0070681_10005119	3300005458	Bacteria	12655
188	Ga0070681_10188912	3300005458	Bacteria	1980
189	Ga0070681_10239500	3300005458	Bacteria	1728
190	Ga0070681_10675550	3300005458	Bacteria	948
191	Ga0068867_100000077	3300005459	Bacteria	59836
192	Ga0068867_100000932	3300005459	Bacteria	19916
193	Ga0068867_100012398	3300005459	Bacteria	6029
194	Ga0068867_100038819	3300005459	Bacteria	3468
195	Ga0068867_100054825	3300005459	Bacteria	2945
196	Ga0068867_100136111	3300005459	Bacteria	1915
197	Ga0068867_100213688	3300005459	Bacteria	1550
198	Ga0068867_100411850	3300005459	Bacteria	1143
199	Ga0068867_100569602	3300005459	Bacteria	983
200	Ga0070685_10111492	3300005466	Bacteria	1686
201	Ga0070706_100001777	3300005467	Bacteria	22328
202	Ga0070706_100375056	3300005467	Bacteria	1325
203	Ga0070706_100855603	3300005467	Bacteria	841
204	Ga0070707_100036485	3300005468	Bacteria	4691
205	Ga0070707_100417757	3300005468	Bacteria	1302
206	Ga0070698_100933444	3300005471	Unclassified	814
207	Ga0070699_100232285	3300005518	Bacteria	1645
208	Ga0070679_100077785	3300005530	Bacteria	3307
209	Ga0070679_100120419	3300005530	Bacteria	2609
210	Ga0070679_100128179	3300005530	Bacteria	2519
211	Ga0070679_100337587	3300005530	Bacteria	1455
212	Ga0070684_100039305	3300005535	Bacteria	4068
213	Ga0068853_100006065	3300005539	Bacteria	9563
214	Ga0068853_100034477	3300005539	Bacteria	4296
215	Ga0068853_100071781	3300005539	Bacteria	3015
216	Ga0068853_100078556	3300005539	Bacteria	2884
217	Ga0070672_100000674	3300005543	Bacteria	20065
218	Ga0070672_100001496	3300005543	Bacteria	14501
219	Ga0070672_100027912	3300005543	Bacteria	4216
220	Ga0070672_100029785	3300005543	Bacteria	4096
221	Ga0070672_100112138	3300005543	Bacteria	2224
222	Ga0070672_100130914	3300005543	Bacteria	2061
223	Ga0070672_100689912	3300005543	Bacteria	894
224	Ga0070672_100693904	3300005543	Bacteria	891
225	Ga0070672_101302960	3300005543	Bacteria	649
226	Ga0070686_100089925	3300005544	Bacteria	2052
227	Ga0070686_100533423	3300005544	Bacteria	916
228	Ga0070696_100166665	3300005546	Bacteria	1626
229	Ga0070693_100220427	3300005547	Bacteria	1243
230	Ga0070665_101304575	3300005548	Bacteria	736
231	Ga0070704_101847512	3300005549	Bacteria	559
232	Ga0068855_100022408	3300005563	Bacteria	7571
233	Ga0068855_100039828	3300005563	Bacteria	5578
234	Ga0068855_100077143	3300005563	Bacteria	3866
235	Ga0068855_100092900	3300005563	Bacteria	3479
236	Ga0068855_100256710	3300005563	Bacteria	1948
237	Ga0070664_100000939	3300005564	Bacteria	22774
238	Ga0070664_100025855	3300005564	Bacteria	4867
239	Ga0070664_100063541	3300005564	Bacteria	3148
240	Ga0070664_100091218	3300005564	Bacteria	2637
241	Ga0070664_100532892	3300005564	Bacteria	1085
242	Ga0068857_100117060	3300005577	Bacteria	2398
243	Ga0068857_100131701	3300005577	Bacteria	2255
244	Ga0068857_100655455	3300005577	Bacteria	995
245	Ga0068857_101040811	3300005577	Bacteria	789
246	Ga0068854_100069996	3300005578	Bacteria	2563
247	Ga0068854_100882064	3300005578	Bacteria	785
248	Ga0068856_100012917	3300005614	Bacteria	8084
249	Ga0068856_100289670	3300005614	Bacteria	1654
250	Ga0068856_100447216	3300005614	Bacteria	1313
251	Ga0070702_100474759	3300005615	Bacteria	913
252	Ga0068852_100014816	3300005616	Bacteria	6022
253	Ga0068852_100018603	3300005616	Bacteria	5475
254	Ga0068852_100027821	3300005616	Bacteria	4615
255	Ga0068852_100044259	3300005616	Bacteria	3779
256	Ga0068852_100046620	3300005616	Bacteria	3694
257	Ga0068852_100198851	3300005616	Bacteria	1896
258	Ga0068852_100252895	3300005616	Bacteria	1689
259	Ga0068852_100466299	3300005616	Bacteria	1253
260	Ga0068852_100526853	3300005616	Bacteria	1179
261	Ga0068859_100007180	3300005617	Bacteria	11309
262	Ga0068859_100032232	3300005617	Bacteria	5264
263	Ga0068859_100183101	3300005617	Bacteria	2178
264	Ga0068859_100468786	3300005617	Bacteria	1355
265	Ga0068864_100000354	3300005618	Bacteria	40336
266	Ga0068864_100002399	3300005618	Bacteria	15473
267	Ga0068864_100037250	3300005618	Bacteria	4150
268	Ga0068864_100055665	3300005618	Bacteria	3416
269	Ga0068864_100115684	3300005618	Bacteria	2392
270	Ga0068864_101070786	3300005618	Bacteria	802
271	Ga0068864_102265800	3300005618	Bacteria	550
272	Ga0068866_10002910	3300005718	Bacteria	7059
273	Ga0068866_10456408	3300005718	Bacteria	837
274	Ga0068861_100003227	3300005719	Bacteria	10790
275	Ga0068861_100026530	3300005719	Bacteria	4212
276	Ga0068861_100268015	3300005719	Bacteria	1465
277	Ga0068851_10004231	3300005834	Bacteria	6460
278	Ga0068851_10065962	3300005834	Bacteria	1864
279	Ga0068851_10351275	3300005834	Bacteria	858
280	Ga0068870_10012786	3300005840	Bacteria	3931
281	Ga0068870_10029084	3300005840	Bacteria	2781
282	Ga0068870_10292604	3300005840	Bacteria	1025
283	Ga0068863_100003312	3300005841	Bacteria	15900
284	Ga0068863_100034898	3300005841	Bacteria	4791
285	Ga0068863_100037190	3300005841	Bacteria	4635
286	Ga0068863_100044132	3300005841	Bacteria	4232
287	Ga0068863_100100578	3300005841	Bacteria	2748
288	Ga0068863_100178913	3300005841	Bacteria	2036
289	Ga0068863_100206566	3300005841	Bacteria	1890
290	Ga0068858_100000262	3300005842	Bacteria	56062
291	Ga0068858_100005749	3300005842	Bacteria	12118
292	Ga0068858_100009778	3300005842	Bacteria	9130
293	Ga0068858_100044019	3300005842	Bacteria	4139
294	Ga0068858_101045860	3300005842	Bacteria	801
295	Ga0068860_100006843	3300005843	Bacteria	11430
296	Ga0068860_100085476	3300005843	Bacteria	3002
297	Ga0068860_100089805	3300005843	Bacteria	2926
298	Ga0068862_100019197	3300005844	Bacteria	5701
299	Ga0068862_100023970	3300005844	Bacteria	5115
300	Ga0068862_100028761	3300005844	Bacteria	4681
301	Ga0068862_100058582	3300005844	Bacteria	3304
302	Ga0068862_100059433	3300005844	Bacteria	3283
303	Ga0068862_100094485	3300005844	Bacteria	2608
304	Ga0068862_100126510	3300005844	Bacteria	2257
305	Ga0068862_100784788	3300005844	Bacteria	929
306	Ga0081455_10004966	3300005937	Bacteria	14710
307	Ga0081455_10488458	3300005937	Bacteria	830
308	Ga0081455_10588779	3300005937	Bacteria	727
309	Ga0081540_1012498	3300005983	Bacteria	5582
310	Ga0075365_10070149	3300006038	Bacteria	2357
311	Ga0075365_10110299	3300006038	Bacteria	1890
312	Ga0075368_10029146	3300006042	Bacteria	2133
313	Ga0075368_10109207	3300006042	Bacteria	1139
314	Ga0075368_10192943	3300006042	Bacteria	861
315	Ga0075363_100537181	3300006048	Bacteria	697
316	Ga0075364_10129145	3300006051	Bacteria	1695
317	Ga0075364_10139836	3300006051	Bacteria	1628
318	Ga0075364_10154009	3300006051	Bacteria	1550
319	Ga0075432_10154894	3300006058	Bacteria	883
320	Ga0075432_10596429	3300006058	Bacteria	505
321	Ga0070715_10036873	3300006163	Bacteria	2020
322	Ga0070716_100270348	3300006173	Bacteria	1168
323	Ga0070716_101375385	3300006173	Bacteria	573
324	Ga0070712_100133058	3300006175	Bacteria	1887
325	Ga0075362_10005748	3300006177	Bacteria	4566
326	Ga0075362_10015938	3300006177	Bacteria	3067
327	Ga0075362_10030414	3300006177	Bacteria	2332
328	Ga0075362_10040413	3300006177	Bacteria	2053
329	Ga0075362_10131295	3300006177	Bacteria	1192
330	Ga0075362_10165182	3300006177	Bacteria	1067
331	Ga0075362_10294084	3300006177	Bacteria	805
332	Ga0075362_10315725	3300006177	Bacteria	778
333	Ga0075367_10008021	3300006178	Bacteria	5445
334	Ga0075367_10038031	3300006178	Bacteria	2799
335	Ga0075367_10052397	3300006178	Bacteria	2415
336	Ga0075367_10113141	3300006178	Bacteria	1667
337	Ga0075367_10309550	3300006178	Bacteria	995
338	Ga0075369_10025461	3300006186	Bacteria	2460
339	Ga0075369_10089557	3300006186	Bacteria	1372
340	Ga0075366_10001921	3300006195	Bacteria	10509
341	Ga0075366_10002417	3300006195	Bacteria	9579
342	Ga0075366_10009102	3300006195	Bacteria	5537
343	Ga0075366_10022250	3300006195	Bacteria	3687
344	Ga0075366_10023025	3300006195	Bacteria	3628
345	Ga0075366_10043968	3300006195	Bacteria	2647
346	Ga0075366_10087477	3300006195	Bacteria	1865
347	Ga0075366_10099101	3300006195	Bacteria	1748
348	Ga0075366_10106906	3300006195	Bacteria	1682
349	Ga0075366_10190494	3300006195	Bacteria	1246
350	Ga0075366_10194245	3300006195	Bacteria	1234
351	Ga0075366_10282479	3300006195	Bacteria	1014
352	Ga0075366_10320595	3300006195	Bacteria	949
353	Ga0075366_10641719	3300006195	Bacteria	659
354	Ga0097621_100006883	3300006237	Bacteria	8088
355	Ga0097621_100016215	3300006237	Bacteria	5627
356	Ga0097621_100034883	3300006237	Bacteria	4016
357	Ga0097621_100133582	3300006237	Bacteria	2114
358	Ga0097621_100207916	3300006237	Bacteria	1701
359	Ga0097621_100222507	3300006237	Bacteria	1645
360	Ga0097621_100800847	3300006237	Bacteria	873
361	Ga0075370_10005490	3300006353	Bacteria	6312
362	Ga0075370_10005571	3300006353	Bacteria	6276
363	Ga0075370_10008637	3300006353	Bacteria	5251
364	Ga0075370_10015091	3300006353	Bacteria	4129
365	Ga0075370_10059640	3300006353	Bacteria	2172
366	Ga0075370_10136023	3300006353	Bacteria	1436
367	Ga0075370_10490564	3300006353	Bacteria	741
368	Ga0068871_100008710	3300006358	Bacteria	7297
369	Ga0068871_100065266	3300006358	Bacteria	2981
370	Ga0068871_100075803	3300006358	Bacteria	2777
371	Ga0068871_100400827	3300006358	Bacteria	1222
372	Ga0068871_100703754	3300006358	Bacteria	926
373	Ga0068871_101192775	3300006358	Bacteria	714
374	Ga0075428_100036897	3300006844	Bacteria	5382
375	Ga0075430_100496766	3300006846	Bacteria	1007
376	Ga0075431_100005587	3300006847	Bacteria	12415
377	Ga0075429_100401840	3300006880	Bacteria	1200
378	Ga0075429_100444789	3300006880	Bacteria	1136
379	Ga0068865_100010698	3300006881	Bacteria	5719
380	Ga0068865_100015466	3300006881	Bacteria	4867
381	Ga0068865_100418978	3300006881	Bacteria	1100
382	Ga0097620_100007180	3300006931	Bacteria	11309
383	Ga0097620_100032233	3300006931	Bacteria	5264
384	Ga0097620_100183102	3300006931	Bacteria	2178
385	Ga0097620_100468776	3300006931	Bacteria	1355
386	Ga0099823_1002035	3300006944	Bacteria	17811
387	Ga0079104_1000100	3300006946	Bacteria	126924
388	Ga0079104_1006080	3300006946	Bacteria	4667
389	Ga0099826_10166791	3300006948	Bacteria	1241
390	Ga0105251_10000309	3300009011	Bacteria	48873
391	Ga0105251_10043577	3300009011	Bacteria	2172
392	Ga0105251_10098387	3300009011	Bacteria	1339
393	Ga0105251_10123778	3300009011	Bacteria	1174
394	Ga0105244_10019485	3300009036	Bacteria	3785
395	Ga0105244_10019533	3300009036	Bacteria	3779
396	Ga0105244_10121111	3300009036	Bacteria	1267
397	Ga0105244_10165564	3300009036	Bacteria	1054
398	Ga0105244_10176417	3300009036	Bacteria	1015
399	Ga0105250_10010061	3300009092	Bacteria	3954
400	Ga0105250_10159959	3300009092	Bacteria	940
401	Ga0105240_10007299	3300009093	Bacteria	16087
402	Ga0105240_10031265	3300009093	Bacteria	6906
403	Ga0105240_10034862	3300009093	Bacteria	6488
404	Ga0105240_10041587	3300009093	Bacteria	5865
405	Ga0105240_10079757	3300009093	Bacteria	4028
406	Ga0105240_10377581	3300009093	Bacteria	1601
407	Ga0105240_10432590	3300009093	Bacteria	1476
408	Ga0111539_10322283	3300009094	Bacteria	1798
409	Ga0111539_10558638	3300009094	Bacteria	1333
410	Ga0111539_10627877	3300009094	Bacteria	1251
411	Ga0105245_10307238	3300009098	Bacteria	1558
412	Ga0105245_10856702	3300009098	Bacteria	949
413	Ga0105245_11120787	3300009098	Bacteria	833
414	Ga0105247_10431794	3300009101	Bacteria	945
415	Ga0105247_10977890	3300009101	Bacteria	659
416	Ga0114129_10491018	3300009147	Bacteria	1605
417	Ga0114129_11031304	3300009147	Bacteria	1034
418	Ga0105243_10002591	3300009148	Bacteria	15085
419	Ga0105243_10068864	3300009148	Bacteria	2853
420	Ga0105243_10075438	3300009148	Bacteria	2737
421	Ga0105243_10386578	3300009148	Bacteria	1296
422	Ga0105243_11957074	3300009148	Bacteria	620
423	Ga0105241_10015147	3300009174	Bacteria	5648
424	Ga0105241_10434571	3300009174	Bacteria	1158
425	Ga0105242_10587584	3300009176	Bacteria	1074
426	Ga0105242_11152775	3300009176	Bacteria	792
427	Ga0105248_10007009	3300009177	Bacteria	12342
428	Ga0105248_10056848	3300009177	Bacteria	4390
429	Ga0105248_10064841	3300009177	Bacteria	4100
430	Ga0105248_10088653	3300009177	Bacteria	3482
431	Ga0105248_10130214	3300009177	Bacteria	2838
432	Ga0105248_10191639	3300009177	Bacteria	2304
433	Ga0105248_10245116	3300009177	Bacteria	2017
434	Ga0105248_10387556	3300009177	Bacteria	1573
435	Ga0105248_10454797	3300009177	Bacteria	1443
436	Ga0105248_10958676	3300009177	Bacteria	966
437	Ga0105237_10000998	3300009545	Bacteria	38080
438	Ga0105237_10105952	3300009545	Bacteria	2803
439	Ga0105237_10179800	3300009545	Bacteria	2116
440	Ga0105237_11091736	3300009545	Bacteria	805
441	Ga0105238_10012661	3300009551	Bacteria	8514
442	Ga0105238_10018725	3300009551	Bacteria	7051
443	Ga0105238_10019715	3300009551	Bacteria	6868
444	Ga0105238_10033490	3300009551	Bacteria	5230
445	Ga0105238_10046675	3300009551	Bacteria	4370
446	Ga0105238_10244541	3300009551	Bacteria	1772
447	Ga0105238_10638696	3300009551	Bacteria	1074
448	Ga0105249_10000342	3300009553	Bacteria	47083
449	Ga0105249_10044280	3300009553	Bacteria	4047
450	Ga0105249_10104287	3300009553	Bacteria	2672
451	Ga0105249_10151394	3300009553	Bacteria	2234
452	Ga0105249_10318448	3300009553	Bacteria	1566
453	Ga0105239_10000318	3300010375	Bacteria	71045
454	Ga0105239_10509498	3300010375	Bacteria	1368
455	Ga0105239_11138897	3300010375	Bacteria	898
456	Ga0105246_12327865	3300011119	Bacteria	524
457	Ga0157317_1000493	3300012475	Bacteria	1713
458	Ga0157319_1000035	3300012497	Bacteria	40594
459	Ga0157314_1005544	3300012500	Bacteria	961
460	Ga0157326_1005406	3300012513	Bacteria	1351
461	Ga0157373_10486659	3300013100	Bacteria	890
462	Ga0157371_10005864	3300013102	Bacteria	10264
463	Ga0157371_10650304	3300013102	Bacteria	787
464	Ga0157370_10438793	3300013104	Bacteria	1201
465	Ga0157370_10815178	3300013104	Bacteria	849
466	Ga0157370_11080649	3300013104	Bacteria	725
467	Ga0157369_10031818	3300013105	Bacteria	5805
468	Ga0157369_10037600	3300013105	Bacteria	5299
469	Ga0157369_11072985	3300013105	Bacteria	823
470	Ga0157374_10025164	3300013296	Bacteria	5341
471	Ga0157374_10125887	3300013296	Bacteria	2477
472	Ga0157374_10221280	3300013296	Bacteria	1857
473	Ga0157374_10646021	3300013296	Bacteria	1070
474	Ga0157378_10180665	3300013297	Bacteria	1985
475	Ga0157378_10308886	3300013297	Bacteria	1533
476	Ga0157378_10445647	3300013297	Bacteria	1284
477	Ga0157378_10492593	3300013297	Bacteria	1223
478	Ga0157378_11466363	3300013297	Bacteria	726
479	Ga0163162_10000679	3300013306	Bacteria	31608
480	Ga0163162_10012705	3300013306	Bacteria	8221
481	Ga0163162_10025634	3300013306	Bacteria	5828
482	Ga0163162_10048557	3300013306	Bacteria	4253
483	Ga0163162_10053465	3300013306	Bacteria	4059
484	Ga0163162_10086236	3300013306	Bacteria	3217
485	Ga0163162_10871690	3300013306	Bacteria	1015
486	Ga0157372_10000718	3300013307	Bacteria	36311
487	Ga0157372_10035925	3300013307	Bacteria	5457
488	Ga0157372_10102543	3300013307	Bacteria	3269
489	Ga0157372_10117708	3300013307	Bacteria	3047
490	Ga0157372_10699447	3300013307	Bacteria	1179
491	Ga0157372_10743795	3300013307	Bacteria	1140
492	Ga0157375_10004728	3300013308	Bacteria	11830
493	Ga0157375_10018087	3300013308	Bacteria	6385
494	Ga0157375_10019246	3300013308	Bacteria	6206
495	Ga0157375_10034066	3300013308	Bacteria	4847
496	Ga0157375_10056743	3300013308	Bacteria	3868
497	Ga0157375_10207553	3300013308	Bacteria	2116
498	Ga0157375_10261577	3300013308	Bacteria	1892
499	Ga0157375_10275214	3300013308	Bacteria	1846
500	Ga0157375_10308210	3300013308	Bacteria	1747
501	Ga0157375_10592298	3300013308	Bacteria	1268
502	Ga0157375_10746747	3300013308	Bacteria	1130
503	Ga0157375_11075442	3300013308	Bacteria	941
504	Ga0163163_10004764	3300014325	Bacteria	11640
505	Ga0163163_10098591	3300014325	Bacteria	2944
506	Ga0163163_10107334	3300014325	Bacteria	2819
507	Ga0163163_10246292	3300014325	Bacteria	1837
508	Ga0163163_10526712	3300014325	Bacteria	1244
509	Ga0163163_10560854	3300014325	Bacteria	1205
510	Ga0163163_11979705	3300014325	Bacteria	642
511	Ga0157380_10022857	3300014326	Bacteria	4715
512	Ga0157380_10023566	3300014326	Bacteria	4645
513	Ga0157380_10048088	3300014326	Bacteria	3358
514	Ga0157380_10062916	3300014326	Bacteria	2974
515	Ga0157380_10069002	3300014326	Bacteria	2851
516	Ga0157380_10148857	3300014326	Bacteria	2021
517	Ga0157380_10202571	3300014326	Bacteria	1762
518	Ga0157380_10205600	3300014326	Bacteria	1750
519	Ga0157380_11222749	3300014326	Bacteria	796
520	Ga0157380_11258212	3300014326	Bacteria	786
521	Ga0157380_11438656	3300014326	Bacteria	741
522	Ga0157380_12702528	3300014326	Bacteria	563
523	Ga0182008_10003595	3300014497	Bacteria	9279
524	Ga0182008_10366545	3300014497	Bacteria	767
525	Ga0157377_10000094	3300014745	Bacteria	64283
526	Ga0157377_10521026	3300014745	Bacteria	834
527	Ga0157379_10004559	3300014968	Bacteria	11882
528	Ga0157379_10091048	3300014968	Bacteria	2736
529	Ga0157379_10157624	3300014968	Bacteria	2048
530	Ga0157376_10002171	3300014969	Bacteria	13216
531	Ga0157376_10016007	3300014969	Bacteria	5683
532	Ga0157376_10098229	3300014969	Bacteria	2552
533	Ga0157376_10151948	3300014969	Bacteria	2089
534	Ga0157376_10285856	3300014969	Bacteria	1555
535	Ga0157376_10374167	3300014969	Bacteria	1370
536	Ga0157376_10420659	3300014969	Bacteria	1297
537	Ga0157376_10451251	3300014969	Bacteria	1254
538	Ga0157376_10556812	3300014969	Bacteria	1135
539	Ga0157376_10803234	3300014969	Bacteria	953
540	Ga0182007_10035004	3300015262	Bacteria	1693
541	Ga0182005_1095988	3300015265	Bacteria	828
542	Ga0163161_10041756	3300017792	Bacteria	3296
543	Ga0163161_10073964	3300017792	Bacteria	2498
544	Ga0163161_10118524	3300017792	Bacteria	1987
545	Ga0163161_10153661	3300017792	Bacteria	1750
546	Ga0206354_11363812	3300020081	Bacteria	611
547	Ga0213872_10004955	3300021361	Bacteria	6924
548	Ga0213872_10026335	3300021361	Bacteria	2671
549	Ga0213875_10000114	3300021388	Bacteria	91363
550	Ga0213875_10008122	3300021388	Bacteria	5388
551	Ga0213875_10255900	3300021388	Bacteria	826
552	Ga0209435_100001	3300025206	Bacteria	1424171
553	Ga0209436_113645	3300025208	Bacteria	1320
554	Ga0209258_110482	3300025242	Bacteria	1201
555	Ga0207425_1002625	3300025245	Bacteria	6213
556	Ga0207425_1008135	3300025245	Bacteria	2710
557	Ga0207425_1008784	3300025245	Bacteria	2557
558	Ga0209646_1000001	3300025246	Bacteria	3092932
559	Ga0209026_1000003	3300025250	Bacteria	1060571
560	Ga0209759_1000001	3300025256	Bacteria	2799452
561	Ga0209129_1000041	3300025258	Bacteria	307590
562	Ga0209129_1003651	3300025258	Bacteria	6553
563	Ga0209129_1018536	3300025258	Bacteria	1334
564	Ga0209565_1000124	3300025263	Bacteria	110789
565	Ga0209565_1000498	3300025263	Bacteria	28727
566	Ga0209565_1009374	3300025263	Bacteria	2490
567	Ga0209565_1024593	3300025263	Bacteria	1224
568	Ga0209673_1000043	3300025273	Bacteria	291503
569	Ga0209673_1001809	3300025273	Bacteria	17590
570	Ga0209673_1007730	3300025273	Bacteria	4896
571	Ga0209673_1010237	3300025273	Bacteria	3970
572	Ga0209673_1010311	3300025273	Bacteria	3944
573	Ga0209673_1044280	3300025273	Bacteria	1233
574	Ga0209673_1049602	3300025273	Bacteria	1121
575	Ga0209130_1000442	3300025284	Bacteria	43829
576	Ga0209130_1000620	3300025284	Bacteria	33992
577	Ga0209130_1001702	3300025284	Bacteria	13299
578	Ga0209130_1055162	3300025284	Bacteria	708
579	Ga0209675_1000309	3300025291	Bacteria	44113
580	Ga0209675_1008560	3300025291	Bacteria	3738
581	Ga0209675_1031186	3300025291	Bacteria	1263
582	Ga0209675_1064089	3300025291	Bacteria	717
583	Ga0209676_1000007	3300025292	Bacteria	1029371
584	Ga0209676_1005708	3300025292	Bacteria	6399
585	Ga0209025_1002427	3300025294	Bacteria	19781
586	Ga0209025_1004916	3300025294	Bacteria	11238
587	Ga0209025_1024249	3300025294	Bacteria	3138
588	Ga0209025_1025283	3300025294	Bacteria	3028
589	Ga0209025_1095108	3300025294	Bacteria	960
590	Ga0209564_1000003	3300025295	Bacteria	1585848
591	Ga0209564_1000029	3300025295	Bacteria	505995
592	Ga0209564_1000268	3300025295	Bacteria	109101
593	Ga0209564_1000476	3300025295	Bacteria	67062
594	Ga0209564_1003314	3300025295	Bacteria	11188
595	Ga0209758_1000043	3300025297	Bacteria	402310
596	Ga0209758_1000167	3300025297	Bacteria	151074
597	Ga0209758_1043883	3300025297	Bacteria	1641
598	Ga0209758_1045258	3300025297	Bacteria	1599
599	Ga0209758_1061488	3300025297	Bacteria	1236
600	Ga0209050_1000003	3300025298	Bacteria	1609245
601	Ga0209050_1000467	3300025298	Bacteria	71711
602	Ga0209050_1000808	3300025298	Bacteria	44058
603	Ga0209050_1001494	3300025298	Bacteria	24797
604	Ga0209050_1003886	3300025298	Bacteria	10607
605	Ga0209050_1004391	3300025298	Bacteria	9566
606	Ga0209050_1016100	3300025298	Bacteria	3084
607	Ga0209050_1021541	3300025298	Bacteria	2346
608	Ga0209050_1096249	3300025298	Bacteria	595
609	Ga0209256_1000001	3300025299	Bacteria	2166974
610	Ga0209256_1000011	3300025299	Bacteria	865309
611	Ga0209256_1000398	3300025299	Bacteria	68796
612	Ga0209256_1002559	3300025299	Bacteria	14528
613	Ga0209256_1017854	3300025299	Bacteria	2335
614	Ga0209256_1021626	3300025299	Bacteria	1969
615	Ga0209256_1043431	3300025299	Bacteria	1129
616	Ga0207426_1000247	3300025302	Bacteria	119659
617	Ga0207426_1009688	3300025302	Bacteria	3790
618	Ga0207426_1046867	3300025302	Bacteria	1307
619	Ga0207426_1067929	3300025302	Bacteria	1003
620	Ga0209051_1000003	3300025303	Bacteria	1609245
621	Ga0209051_1000210	3300025303	Bacteria	102629
622	Ga0209051_1000320	3300025303	Bacteria	72764
623	Ga0209051_1001335	3300025303	Bacteria	21466
624	Ga0209051_1007045	3300025303	Bacteria	6221
625	Ga0209051_1012479	3300025303	Bacteria	4107
626	Ga0209051_1017118	3300025303	Bacteria	3250
627	Ga0209257_1000017	3300025304	Bacteria	866287
628	Ga0209257_1000020	3300025304	Bacteria	773356
629	Ga0209257_1000161	3300025304	Bacteria	176089
630	Ga0209257_1000314	3300025304	Bacteria	102629
631	Ga0209257_1000799	3300025304	Bacteria	45956
632	Ga0209257_1005062	3300025304	Bacteria	9572
633	Ga0209257_1005554	3300025304	Bacteria	8781
634	Ga0209257_1016941	3300025304	Bacteria	2905
635	Ga0207656_10005941	3300025321	Bacteria	4356
636	Ga0207655_1005008	3300025728	Bacteria	9169
637	Ga0207655_1005064	3300025728	Bacteria	9110
638	Ga0207655_1083830	3300025728	Bacteria	1141
639	Ga0207655_1105079	3300025728	Bacteria	965
640	Ga0207655_1107523	3300025728	Bacteria	948
641	Ga0207713_1069190	3300025735	Bacteria	1309
642	Ga0207713_1116723	3300025735	Bacteria	900
643	Ga0207713_1124951	3300025735	Bacteria	858
644	Ga0207653_10200309	3300025885	Bacteria	752
645	Ga0207682_10001767	3300025893	Bacteria	9913
646	Ga0207682_10001984	3300025893	Bacteria	9267
647	Ga0207682_10009729	3300025893	Bacteria	3787
648	Ga0207682_10013197	3300025893	Bacteria	3221
649	Ga0207692_10105491	3300025898	Bacteria	1554
650	Ga0207642_10006842	3300025899	Bacteria	3816
651	Ga0207642_10080122	3300025899	Bacteria	1583
652	Ga0207642_10115095	3300025899	Bacteria	1377
653	Ga0207642_10218813	3300025899	Bacteria	1063
654	Ga0207680_10003848	3300025903	Bacteria	7066
655	Ga0207680_10024370	3300025903	Bacteria	3320
656	Ga0207680_10025961	3300025903	Bacteria	3239
657	Ga0207699_10030917	3300025906	Bacteria	3001
658	Ga0207645_10012039	3300025907	Bacteria	5882
659	Ga0207645_10032364	3300025907	Bacteria	3361
660	Ga0207645_10727408	3300025907	Bacteria	675
661	Ga0207643_10003782	3300025908	Bacteria	8136
662	Ga0207643_10028009	3300025908	Bacteria	3127
663	Ga0207643_10058785	3300025908	Bacteria	2192
664	Ga0207643_10303128	3300025908	Bacteria	995
665	Ga0207705_10106972	3300025909	Bacteria	2063
666	Ga0207705_10339781	3300025909	Bacteria	1156
667	Ga0207705_10551886	3300025909	Bacteria	896
668	Ga0207684_10000743	3300025910	Bacteria	38135
669	Ga0207684_10726554	3300025910	Bacteria	843
670	Ga0207654_10044947	3300025911	Bacteria	2511
671	Ga0207707_10002563	3300025912	Bacteria	16290
672	Ga0207707_10078608	3300025912	Bacteria	2881
673	Ga0207707_10176459	3300025912	Bacteria	1866
674	Ga0207707_10529490	3300025912	Bacteria	1003
675	Ga0207707_10772269	3300025912	Unclassified	802
676	Ga0207695_10025991	3300025913	Bacteria	6542
677	Ga0207695_10043173	3300025913	Bacteria	4807
678	Ga0207695_10065868	3300025913	Bacteria	3723
679	Ga0207695_10354968	3300025913	Bacteria	1353
680	Ga0207671_10006034	3300025914	Bacteria	10939
681	Ga0207671_10040022	3300025914	Bacteria	3470
682	Ga0207671_10118785	3300025914	Bacteria	2019
683	Ga0207671_10788372	3300025914	Bacteria	754
684	Ga0207693_10061984	3300025915	Bacteria	2929
685	Ga0207693_10448950	3300025915	Unclassified	1008
686	Ga0207693_10461586	3300025915	Bacteria	992
687	Ga0207663_10421691	3300025916	Bacteria	1024
688	Ga0207660_10033235	3300025917	Bacteria	3566
689	Ga0207660_10095087	3300025917	Bacteria	2216
690	Ga0207660_10331851	3300025917	Bacteria	1216
691	Ga0207662_10142406	3300025918	Bacteria	1519
692	Ga0207662_10647713	3300025918	Bacteria	738
693	Ga0207657_10034309	3300025919	Bacteria	4566
694	Ga0207657_10062069	3300025919	Bacteria	3201
695	Ga0207657_10094700	3300025919	Bacteria	2486
696	Ga0207657_10358752	3300025919	Bacteria	1149
697	Ga0207649_10001323	3300025920	Bacteria	14731
698	Ga0207649_10122954	3300025920	Bacteria	1752
699	Ga0207649_10186377	3300025920	Bacteria	1456
700	Ga0207649_10789743	3300025920	Bacteria	740
701	Ga0207652_10156540	3300025921	Bacteria	2041
702	Ga0207652_10334427	3300025921	Bacteria	1367
703	Ga0207646_10022087	3300025922	Bacteria	5869
704	Ga0207646_10731365	3300025922	Bacteria	884
705	Ga0207681_10000819	3300025923	Bacteria	20485
706	Ga0207681_10014662	3300025923	Bacteria	4878
707	Ga0207681_10032915	3300025923	Bacteria	3397
708	Ga0207681_10224280	3300025923	Bacteria	1455
709	Ga0207681_10753890	3300025923	Bacteria	812
710	Ga0207681_10795349	3300025923	Bacteria	790
711	Ga0207681_11504552	3300025923	Bacteria	564
712	Ga0207694_10028662	3300025924	Bacteria	4245
713	Ga0207694_10059195	3300025924	Bacteria	2979
714	Ga0207694_10090675	3300025924	Bacteria	2412
715	Ga0207694_10183514	3300025924	Bacteria	1697
716	Ga0207694_10997260	3300025924	Bacteria	709
717	Ga0207650_10001268	3300025925	Bacteria	18324
718	Ga0207650_10005261	3300025925	Bacteria	8826
719	Ga0207650_10040024	3300025925	Bacteria	3428
720	Ga0207650_10064135	3300025925	Bacteria	2749
721	Ga0207650_10182010	3300025925	Bacteria	1675
722	Ga0207650_10500826	3300025925	Bacteria	1015
723	Ga0207650_11165107	3300025925	Bacteria	656
724	Ga0207659_10001423	3300025926	Bacteria	14256
725	Ga0207659_10003128	3300025926	Bacteria	9889
726	Ga0207659_10038727	3300025926	Bacteria	3319
727	Ga0207659_10082489	3300025926	Bacteria	2380
728	Ga0207659_10507491	3300025926	Bacteria	1021
729	Ga0207659_10827396	3300025926	Bacteria	796
730	Ga0207659_11065387	3300025926	Bacteria	696
731	Ga0207687_10111231	3300025927	Bacteria	2033
732	Ga0207687_10524916	3300025927	Bacteria	991
733	Ga0207700_10001011	3300025928	Bacteria	16240
734	Ga0207700_10147485	3300025928	Bacteria	1941
735	Ga0207700_10387519	3300025928	Bacteria	1223
736	Ga0207664_10489841	3300025929	Bacteria	1100
737	Ga0207664_11067131	3300025929	Bacteria	723
738	Ga0207644_10004489	3300025931	Bacteria	9062
739	Ga0207644_10004958	3300025931	Bacteria	8685
740	Ga0207644_10022737	3300025931	Bacteria	4286
741	Ga0207644_10052099	3300025931	Bacteria	2940
742	Ga0207644_10075325	3300025931	Bacteria	2480
743	Ga0207644_10077977	3300025931	Bacteria	2441
744	Ga0207644_10096958	3300025931	Bacteria	2208
745	Ga0207644_10435136	3300025931	Bacteria	1076
746	Ga0207644_11029242	3300025931	Bacteria	691
747	Ga0207690_10004800	3300025932	Bacteria	7976
748	Ga0207690_10187909	3300025932	Bacteria	1560
749	Ga0207690_10464084	3300025932	Bacteria	1019
750	Ga0207706_10002276	3300025933	Bacteria	18747
751	Ga0207706_10026649	3300025933	Bacteria	5174
752	Ga0207706_10027008	3300025933	Bacteria	5135
753	Ga0207706_10032086	3300025933	Bacteria	4678
754	Ga0207706_10039929	3300025933	Bacteria	4160
755	Ga0207706_10164864	3300025933	Bacteria	1948
756	Ga0207706_10822153	3300025933	Bacteria	788
757	Ga0207706_10871904	3300025933	Bacteria	761
758	Ga0207686_10173253	3300025934	Bacteria	1524
759	Ga0207686_10246698	3300025934	Bacteria	1302
760	Ga0207686_10302986	3300025934	Bacteria	1187
761	Ga0207686_10390103	3300025934	Bacteria	1058
762	Ga0207709_10001678	3300025935	Bacteria	14925
763	Ga0207709_10010988	3300025935	Bacteria	4990
764	Ga0207709_10079035	3300025935	Bacteria	2113
765	Ga0207709_10874614	3300025935	Bacteria	729
766	Ga0207670_10099553	3300025936	Bacteria	2074
767	Ga0207670_10307801	3300025936	Bacteria	1243
768	Ga0207669_10003846	3300025937	Bacteria	6543
769	Ga0207669_10010270	3300025937	Bacteria	4501
770	Ga0207669_10012607	3300025937	Bacteria	4163
771	Ga0207669_10085268	3300025937	Bacteria	2038
772	Ga0207669_10235698	3300025937	Bacteria	1353
773	Ga0207669_10239937	3300025937	Bacteria	1343
774	Ga0207669_10615124	3300025937	Bacteria	884
775	Ga0207704_10006026	3300025938	Bacteria	5620
776	Ga0207704_10014210	3300025938	Bacteria	4013
777	Ga0207704_10017503	3300025938	Bacteria	3718
778	Ga0207704_10681021	3300025938	Bacteria	850
779	Ga0207704_11373056	3300025938	Bacteria	605
780	Ga0207691_10001131	3300025940	Bacteria	26484
781	Ga0207691_10001663	3300025940	Bacteria	21997
782	Ga0207691_10012709	3300025940	Bacteria	8063
783	Ga0207691_10022785	3300025940	Bacteria	5905
784	Ga0207691_10023069	3300025940	Bacteria	5861
785	Ga0207691_10033026	3300025940	Bacteria	4820
786	Ga0207691_10035543	3300025940	Bacteria	4623
787	Ga0207691_10059029	3300025940	Bacteria	3489
788	Ga0207691_10222012	3300025940	Bacteria	1638
789	Ga0207691_10419274	3300025940	Bacteria	1141
790	Ga0207691_10513620	3300025940	Bacteria	1017
791	Ga0207691_10632706	3300025940	Bacteria	905
792	Ga0207691_10717664	3300025940	Bacteria	843
793	Ga0207711_10003690	3300025941	Bacteria	13225
794	Ga0207711_10036823	3300025941	Bacteria	4153
795	Ga0207711_10049870	3300025941	Bacteria	3584
796	Ga0207711_10131852	3300025941	Bacteria	2242
797	Ga0207711_10154234	3300025941	Bacteria	2074
798	Ga0207689_10006291	3300025942	Bacteria	10520
799	Ga0207689_10026446	3300025942	Bacteria	4858
800	Ga0207689_10164403	3300025942	Bacteria	1829
801	Ga0207689_10479955	3300025942	Bacteria	1041
802	Ga0207689_10481973	3300025942	Bacteria	1038
803	Ga0207689_10935714	3300025942	Bacteria	731
804	Ga0207661_10034192	3300025944	Bacteria	3951
805	Ga0207661_11098916	3300025944	Bacteria	732
806	Ga0207679_10000201	3300025945	Bacteria	48099
807	Ga0207679_10156225	3300025945	Bacteria	1863
808	Ga0207679_10205136	3300025945	Bacteria	1649
809	Ga0207679_11014935	3300025945	Bacteria	761
810	Ga0207679_11330367	3300025945	Bacteria	659
811	Ga0207667_10002059	3300025949	Bacteria	25205
812	Ga0207667_10751256	3300025949	Bacteria	975
813	Ga0207667_11647900	3300025949	Bacteria	609
814	Ga0207651_10000562	3300025960	Bacteria	15636
815	Ga0207651_10007162	3300025960	Bacteria	5927
816	Ga0207651_10066265	3300025960	Bacteria	2536
817	Ga0207651_10239047	3300025960	Bacteria	1479
818	Ga0207651_10271290	3300025960	Bacteria	1397
819	Ga0207651_10613907	3300025960	Bacteria	952
820	Ga0207651_10897019	3300025960	Bacteria	789
821	Ga0207712_10014803	3300025961	Bacteria	5021
822	Ga0207712_10142390	3300025961	Bacteria	1842
823	Ga0207712_10188629	3300025961	Bacteria	1626
824	Ga0207712_10284826	3300025961	Bacteria	1350
825	Ga0207712_10793933	3300025961	Bacteria	832
826	Ga0207668_10001789	3300025972	Bacteria	12552
827	Ga0207668_10002933	3300025972	Bacteria	10010
828	Ga0207668_10158500	3300025972	Bacteria	1761
829	Ga0207640_10055882	3300025981	Bacteria	2588
830	Ga0207640_10518385	3300025981	Bacteria	996
831	Ga0207640_11196877	3300025981	Bacteria	675
832	Ga0207640_11383352	3300025981	Bacteria	630
833	Ga0207658_10000336	3300025986	Bacteria	47108
834	Ga0207658_10002766	3300025986	Bacteria	12635
835	Ga0207658_10009362	3300025986	Bacteria	6645
836	Ga0207658_10051764	3300025986	Bacteria	3027
837	Ga0207658_10174954	3300025986	Bacteria	1772
838	Ga0207658_10252584	3300025986	Bacteria	1499
839	Ga0207658_10492893	3300025986	Bacteria	1090
840	Ga0207658_10670323	3300025986	Bacteria	936
841	Ga0207677_10376693	3300026023	Bacteria	1197
842	Ga0207677_10654372	3300026023	Bacteria	928
843	Ga0207677_10948795	3300026023	Bacteria	778
844	Ga0207677_11042000	3300026023	Bacteria	743
845	Ga0207703_10000277	3300026035	Bacteria	56761
846	Ga0207703_10000866	3300026035	Bacteria	29661
847	Ga0207703_10031615	3300026035	Bacteria	4186
848	Ga0207703_10042191	3300026035	Bacteria	3659
849	Ga0207703_10983484	3300026035	Bacteria	809
850	Ga0207639_10013995	3300026041	Bacteria	5629
851	Ga0207639_10046007	3300026041	Bacteria	3290
852	Ga0207639_10051308	3300026041	Bacteria	3137
853	Ga0207639_10213011	3300026041	Bacteria	1664
854	Ga0207639_10623822	3300026041	Bacteria	996
855	Ga0207678_10007848	3300026067	Bacteria	9417
856	Ga0207678_10009214	3300026067	Bacteria	8685
857	Ga0207678_10253384	3300026067	Bacteria	1508
858	Ga0207678_10492475	3300026067	Bacteria	1068
859	Ga0207678_10516914	3300026067	Bacteria	1042
860	Ga0207678_10563073	3300026067	Bacteria	997
861	Ga0207678_11487702	3300026067	Bacteria	598
862	Ga0207708_10104075	3300026075	Bacteria	2199
863	Ga0207708_10990513	3300026075	Bacteria	730
864	Ga0207702_10117957	3300026078	Bacteria	2371
865	Ga0207702_10230662	3300026078	Bacteria	1730
866	Ga0207702_10871672	3300026078	Bacteria	892
867	Ga0207641_10001090	3300026088	Bacteria	27309
868	Ga0207641_10002663	3300026088	Bacteria	16308
869	Ga0207641_10007781	3300026088	Bacteria	8905
870	Ga0207641_10049730	3300026088	Bacteria	3544
871	Ga0207641_10269052	3300026088	Bacteria	1598
872	Ga0207641_10576301	3300026088	Bacteria	1100
873	Ga0207648_10000193	3300026089	Bacteria	64119
874	Ga0207648_10000512	3300026089	Bacteria	43350
875	Ga0207648_10015267	3300026089	Bacteria	7065
876	Ga0207648_10026488	3300026089	Bacteria	5151
877	Ga0207648_10080813	3300026089	Bacteria	2836
878	Ga0207648_10083200	3300026089	Bacteria	2791
879	Ga0207648_10147787	3300026089	Bacteria	2073
880	Ga0207648_10193541	3300026089	Bacteria	1803
881	Ga0207648_10234269	3300026089	Bacteria	1634
882	Ga0207648_10238932	3300026089	Bacteria	1617
883	Ga0207648_10428686	3300026089	Bacteria	1202
884	Ga0207648_10857208	3300026089	Bacteria	847
885	Ga0207676_10001342	3300026095	Bacteria	18294
886	Ga0207676_10017194	3300026095	Bacteria	5240
887	Ga0207676_10028849	3300026095	Bacteria	4150
888	Ga0207676_10040743	3300026095	Bacteria	3561
889	Ga0207676_10089162	3300026095	Bacteria	2527
890	Ga0207676_10165480	3300026095	Bacteria	1921
891	Ga0207676_10203090	3300026095	Bacteria	1753
892	Ga0207676_10318130	3300026095	Bacteria	1427
893	Ga0207676_10557604	3300026095	Bacteria	1095
894	Ga0207674_10038832	3300026116	Bacteria	4939
895	Ga0207674_10047553	3300026116	Bacteria	4396
896	Ga0207674_10117981	3300026116	Bacteria	2624
897	Ga0207674_10411923	3300026116	Bacteria	1306
898	Ga0207675_100004491	3300026118	Bacteria	13479
899	Ga0207675_100007449	3300026118	Bacteria	10340
900	Ga0207675_100024043	3300026118	Bacteria	5664
901	Ga0207675_100109797	3300026118	Bacteria	2603
902	Ga0207675_100789046	3300026118	Bacteria	963
903	Ga0207683_10003565	3300026121	Bacteria	13573
904	Ga0207683_10011473	3300026121	Bacteria	7562
905	Ga0207683_10026198	3300026121	Bacteria	5033
906	Ga0207683_10054273	3300026121	Bacteria	3514
907	Ga0207683_10058630	3300026121	Bacteria	3381
908	Ga0207683_10063497	3300026121	Bacteria	3253
909	Ga0207683_10069534	3300026121	Bacteria	3109
910	Ga0207683_10102073	3300026121	Bacteria	2561
911	Ga0207683_10177091	3300026121	Bacteria	1933
912	Ga0207683_10241812	3300026121	Bacteria	1647
913	Ga0207683_10328446	3300026121	Bacteria	1402
914	Ga0207683_10465256	3300026121	Bacteria	1166
915	Ga0207698_10014969	3300026142	Bacteria	5178
916	Ga0207698_10026945	3300026142	Bacteria	4073
917	Ga0207698_10031774	3300026142	Bacteria	3815
918	Ga0207698_10057062	3300026142	Bacteria	3018
919	Ga0207698_10218218	3300026142	Bacteria	1721
920	Ga0207698_10356318	3300026142	Bacteria	1384
921	Ga0207698_10426945	3300026142	Bacteria	1273
922	Ga0207698_11044887	3300026142	Bacteria	828
923	Ga0209281_1000084	3300027111	Bacteria	254215
924	Ga0209281_1026166	3300027111	Bacteria	1081
925	Ga0209389_1038266	3300027296	Bacteria	3781
926	Ga0209974_10005575	3300027876	Bacteria	4423
927	Ga0209974_10082990	3300027876	Bacteria	1105
928	Ga0209974_10129742	3300027876	Bacteria	898
929	Ga0209974_10347476	3300027876	Bacteria	575
930	Ga0207428_10112389	3300027907	Bacteria	2095
931	Ga0207428_10598606	3300027907	Bacteria	794
932	Ga0268266_10003010	3300028379	Bacteria	17318
933	Ga0268266_10319051	3300028379	Bacteria	1454
934	Ga0268266_10422883	3300028379	Bacteria	1263
935	Ga0268266_11609399	3300028379	Bacteria	625
936	Ga0268265_10054074	3300028380	Bacteria	3044
937	Ga0268265_10096117	3300028380	Bacteria	2380
938	Ga0268265_10232084	3300028380	Bacteria	1622
939	Ga0268265_10970838	3300028380	Bacteria	838
940	Ga0268265_11083685	3300028380	Bacteria	795
941	Ga0268265_11084055	3300028380	Bacteria	794
942	Ga0268265_12360000	3300028380	Bacteria	538
943	Ga0268264_10003687	3300028381	Bacteria	13142
944	Ga0268264_10064917	3300028381	Bacteria	3073
945	Ga0268264_10371228	3300028381	Bacteria	1367
946	Ga0268264_10610115	3300028381	Bacteria	1076
947	Ga0265326_10027167	3300028558	Bacteria	1632
948	Ga0265319_1169895	3300028563	Bacteria	672
949	Ga0265334_10025101	3300028573	Bacteria	2415
950	Ga0265318_10000347	3300028577	Bacteria	36774
951	Ga0307517_10137926	3300028786	Bacteria	1726
952	Ga0307517_10149902	3300028786	Bacteria	1604
953	Ga0307515_10000093	3300028794	Bacteria	212053
954	Ga0307515_10001261	3300028794	Bacteria	57708
955	Ga0307515_10001283	3300028794	Bacteria	57022
956	Ga0307515_10002007	3300028794	Bacteria	45041
957	Ga0307515_10004636	3300028794	Bacteria	28226
958	Ga0307515_10009359	3300028794	Bacteria	18952
959	Ga0307515_10020687	3300028794	Bacteria	11721
960	Ga0307515_10026101	3300028794	Bacteria	10069
961	Ga0307515_10033140	3300028794	Bacteria	8518
962	Ga0307515_10097581	3300028794	Bacteria	3590
963	Ga0307515_10601201	3300028794	Bacteria	710
964	Ga0265324_10056156	3300029957	Bacteria	1349
965	Ga0268256_1046721	3300030500	Bacteria	936
966	Ga0307511_10023720	3300030521	Bacteria	5711
967	Ga0265330_10001084	3300031235	Bacteria	16403
968	Ga0265332_10000920	3300031238	Bacteria	17618
969	Ga0265332_10032003	3300031238	Bacteria	2293
970	Ga0265332_10037720	3300031238	Bacteria	2095
971	Ga0265328_10000034	3300031239	Bacteria	99505
972	Ga0265328_10007066	3300031239	Bacteria	4703
973	Ga0265328_10047051	3300031239	Bacteria	1585
974	Ga0265320_10000726	3300031240	Bacteria	25199
975	Ga0265329_10002112	3300031242	Bacteria	9220
976	Ga0265329_10009738	3300031242	Bacteria	3564
977	Ga0265340_10053639	3300031247	Bacteria	1947
978	Ga0265339_10140775	3300031249	Bacteria	1227
979	Ga0265331_10000024	3300031250	Bacteria	235118
980	Ga0265331_10001289	3300031250	Bacteria	18660
981	Ga0265331_10170948	3300031250	Bacteria	983
982	Ga0265327_10000079	3300031251	Bacteria	206892
983	Ga0265327_10001928	3300031251	Bacteria	23964
984	Ga0265327_10003163	3300031251	Bacteria	16124
985	Ga0265316_10000181	3300031344	Bacteria	71764
986	Ga0265316_10003160	3300031344	Bacteria	16764
987	Ga0265316_10276769	3300031344	Bacteria	1227
988	Ga0307513_10000054	3300031456	Bacteria	148887
989	Ga0307513_10006568	3300031456	Bacteria	15190
990	Ga0307513_10018646	3300031456	Bacteria	8286
991	Ga0307513_10042813	3300031456	Bacteria	4980
992	Ga0307513_10044622	3300031456	Bacteria	4854
993	Ga0307513_10044801	3300031456	Bacteria	4842
994	Ga0307513_10402559	3300031456	Bacteria	1103
995	Ga0307513_10539573	3300031456	Bacteria	880
996	Ga0307513_10693937	3300031456	Bacteria	724
997	Ga0307509_10095877	3300031507	Bacteria	3021
998	Ga0307509_10459073	3300031507	Bacteria	966
999	Ga0307408_100000086	3300031548	Bacteria	101944
1000	Ga0307408_100022993	3300031548	Bacteria	4242
1001	Ga0307408_100046888	3300031548	Bacteria	3092
1002	Ga0307408_100067163	3300031548	Bacteria	2636
1003	Ga0307408_100160787	3300031548	Bacteria	1784
1004	Ga0307408_100187706	3300031548	Bacteria	1663
1005	Ga0307408_100378949	3300031548	Bacteria	1209
1006	Ga0307408_100803196	3300031548	Bacteria	854
1007	Ga0307508_10003350	3300031616	Bacteria	16262
1008	Ga0307508_10192655	3300031616	Bacteria	1640
1009	Ga0307514_10000795	3300031649	Bacteria	52015
1010	Ga0307514_10001506	3300031649	Bacteria	27927
1011	Ga0307514_10019015	3300031649	Bacteria	5624
1012	Ga0316575_10011595	3300031665	Bacteria	3264
1013	Ga0316575_10021874	3300031665	Bacteria	2465
1014	Ga0316575_10229925	3300031665	Bacteria	775
1015	Ga0316579_10101236	3300031691	Bacteria	1380
1016	Ga0265314_10002818	3300031711	Bacteria	17343
1017	Ga0265314_10030007	3300031711	Bacteria	4031
1018	Ga0265314_10038203	3300031711	Bacteria	3471
1019	Ga0265342_10013145	3300031712	Bacteria	5568
1020	Ga0265342_10161854	3300031712	Bacteria	1236
1021	Ga0265342_10179830	3300031712	Bacteria	1159
1022	Ga0316576_10056045	3300031727	Bacteria	2878
1023	Ga0316576_10056950	3300031727	Bacteria	2856
1024	Ga0316576_10062960	3300031727	Bacteria	2722
1025	Ga0316576_10133008	3300031727	Bacteria	1871
1026	Ga0316576_10349662	3300031727	Bacteria	1100
1027	Ga0316576_10369636	3300031727	Bacteria	1066
1028	Ga0316576_10737003	3300031727	Bacteria	712
1029	Ga0316578_10035518	3300031728	Bacteria	2866
1030	Ga0316578_10043091	3300031728	Bacteria	2619
1031	Ga0316578_10309484	3300031728	Bacteria	944
1032	Ga0307516_10000383	3300031730	Bacteria	57684
1033	Ga0307516_10004457	3300031730	Bacteria	17254
1034	Ga0307516_10011720	3300031730	Bacteria	9515
1035	Ga0307516_10017724	3300031730	Bacteria	7419
1036	Ga0307405_10005414	3300031731	Bacteria	6156
1037	Ga0307405_10461688	3300031731	Bacteria	1009
1038	Ga0316577_10028286	3300031733	Bacteria	3126
1039	Ga0316577_10092948	3300031733	Bacteria	1689
1040	Ga0307413_10020005	3300031824	Bacteria	3550
1041	Ga0307413_10445499	3300031824	Bacteria	1026
1042	Ga0307413_10735437	3300031824	Bacteria	823
1043	Ga0307410_10023516	3300031852	Bacteria	3832
1044	Ga0307410_10270386	3300031852	Bacteria	1329
1045	Ga0307410_10656781	3300031852	Bacteria	880
1046	Ga0307406_10025180	3300031901	Bacteria	3560
1047	Ga0307406_10086465	3300031901	Bacteria	2099
1048	Ga0307406_10244742	3300031901	Bacteria	1347
1049	Ga0307407_10034140	3300031903	Bacteria	2782
1050	Ga0307407_11071374	3300031903	Bacteria	625
1051	Ga0307412_10113378	3300031911	Bacteria	1940
1052	Ga0307409_100009342	3300031995	Bacteria	6018
1053	Ga0307409_100399816	3300031995	Bacteria	1312
1054	Ga0307409_100539592	3300031995	Bacteria	1143
1055	Ga0307409_100950063	3300031995	Bacteria	875
1056	Ga0307409_101072765	3300031995	Bacteria	826
1057	Ga0307416_100003992	3300032002	Bacteria	8796
1058	Ga0307416_100909977	3300032002	Bacteria	980
1059	Ga0307414_10148718	3300032004	Bacteria	1844
1060	Ga0307414_10812751	3300032004	Bacteria	853
1061	Ga0307414_11196898	3300032004	Bacteria	703
1062	Ga0307414_11417309	3300032004	Bacteria	646
1063	Ga0307414_11708164	3300032004	Bacteria	587
1064	Ga0307411_10001320	3300032005	Bacteria	9982
1065	Ga0307411_10005005	3300032005	Bacteria	6447
1066	Ga0307411_10228908	3300032005	Bacteria	1447
1067	Ga0307411_11399808	3300032005	Bacteria	640
1068	Ga0307415_100006691	3300032126	Bacteria	6240
1069	Ga0307415_100339325	3300032126	Bacteria	1260
1070	Ga0307415_101042866	3300032126	Bacteria	762
1071	Ga0316580_10012176	3300032139	Bacteria	2618
1072	Ga0307507_10157523	3300033179	Bacteria	1688
1073	Ga0307510_10113907	3300033180	Bacteria	2435
1074	Ga0373948_0002019	3300034817	Bacteria	2929
1075	Ga0373959_0051324	3300034820	Bacteria	891
1076	Ga0373938_0101796	3300034957	Bacteria	722
1077	Ga0373928_0096224	3300035084	Bacteria	766
1078	Ga0373940_0019893	3300035088	Bacteria	1700
1079	Ga0373940_0298720	3300035088	Bacteria	554
1080	Ga0373949_0112347	3300035090	Bacteria	757
1081	Ga0373951_0047822	3300035091	Bacteria	1046
1082	Ga0373932_0187236	3300035112	Bacteria	729
1083	Ga0373932_0226077	3300035112	Bacteria	674
1084	Ga0373936_0108705	3300035113	Bacteria	1176
1085	Ga0373939_0000017	3300035114	Bacteria	61924
1086	Ga0373941_0085831	3300035115	Bacteria	1071
1087	Ga0373945_0451096	3300035116	Bacteria	569
1088	Ga0373960_0000109	3300035121	Bacteria	13152
1089	Ga0373943_0130231	3300035170	Bacteria	1346
1090	Ga0373943_0287586	3300035170	Bacteria	931
1091	Ga0373943_0414377	3300035170	Bacteria	779
1092	Ga0373946_0073518	3300035171	Bacteria	1482
1093	Ga0373946_0227840	3300035171	Bacteria	902
1094	Ga0373946_0283561	3300035171	Bacteria	815
1095	Ga0373955_0006739	3300035172	Bacteria	5244
1096	Ga0373955_0311201	3300035172	Bacteria	951
1097	Ga0373955_0360841	3300035172	Bacteria	881
1098	Ga0373955_0727802	3300035172	Bacteria	609
1099	Ga0373961_0195318	3300035241	Bacteria	711
1100	Ga0316574_0002109	3300035398	Bacteria	9863
1101	Ga0316574_0004706	3300035398	Bacteria	7195
1102	Ga0316574_0006307	3300035398	Bacteria	6398
1103	Ga0316574_0106501	3300035398	Bacteria	1796
1104	Ga0316574_0167217	3300035398	Bacteria	1416
1105	Ga0316574_0280514	3300035398	Bacteria	1061
1106	Ga0316574_0783821	3300035398	Bacteria	581
1107	Ga0373924_0166644	3300035410	Bacteria	967
1108	Ga0373924_0194584	3300035410	Bacteria	894
1109	Ga0373924_0245055	3300035410	Bacteria	793
1110	Ga0373931_0000641	3300035691	Bacteria	14534
1111	Ga0373931_0014924	3300035691	Bacteria	3806
1112	Ga0373935_0302056	3300035692	Bacteria	1132
1113	Ga0373927_0286813	3300035695	Bacteria	1083
1114	Ga0373933_0018395	3300035724	Bacteria	3929
1115	Ga0373947_0215560	3300035725	Bacteria	1260
1116	Ga0373937_0005971	3300036401	Bacteria	10483
1117	Ga0373937_0052497	3300036401	Bacteria	3738
1118	Ga0373937_0075221	3300036401	Bacteria	3117
1119	Ga0373937_0150570	3300036401	Bacteria	2179
1120	Ga0373937_0224658	3300036401	Bacteria	1767
1121	Ga0373937_0293183	3300036401	Bacteria	1537
1122	Ga0373937_0901458	3300036401	Bacteria	833
1123	Ga0316582_0001870	3300036647	Bacteria	9560
1124	Ga0316582_0034461	3300036647	Bacteria	3118
1125	Ga0316582_0134775	3300036647	Bacteria	1661
1126	Ga0316584_0027762	3300036712	Bacteria	4167
1127	Ga0316584_0050235	3300036712	Bacteria	3117
1128	Ga0316584_0127724	3300036712	Bacteria	1899
1129	Ga0316584_0194067	3300036712	Bacteria	1500
1130	Ga0373925_0100843	3300037068	Bacteria	2219
1131	Ga0373925_0231330	3300037068	Bacteria	1478
1132	Ga0373925_0521850	3300037068	Bacteria	976
1133	Ga0373925_0801770	3300037068	Bacteria	776
1134	Ga0373925_0954722	3300037068	Bacteria	706
1135	Ga0373925_1242065	3300037068	Bacteria	612
1136	Ga0395899_0000010	3300037312	Bacteria	523837
1137	Ga0395899_0018492	3300037312	Bacteria	5297
1138	Ga0395899_0235742	3300037312	Bacteria	1261
1139	Ga0395900_0000005	3300037418	Bacteria	523836
1140	Ga0395900_0008244	3300037418	Bacteria	10728
1141	Ga0395900_0010948	3300037418	Bacteria	9276
1142	Ga0395900_0105001	3300037418	Bacteria	2902
1143	Ga0395900_0128127	3300037418	Bacteria	2602
1144	Ga0395900_0139094	3300037418	Bacteria	2487
1145	Ga0395900_0181050	3300037418	Bacteria	2142
1146	Ga0395900_0229277	3300037418	Bacteria	1869
1147	Ga0395900_0404011	3300037418	Bacteria	1329
1148	Ga0395900_1492503	3300037418	Bacteria	588
1149	Ga0395898_0013534	3300037466	Bacteria	8399
1150	Ga0395898_0018082	3300037466	Bacteria	7192
1151	Ga0395898_0109116	3300037466	Bacteria	2653
1152	Ga0395898_0418814	3300037466	Bacteria	1277
1153	Ga0395905_0000653	3300037471	Bacteria	46132
1154	Ga0395905_0000733	3300037471	Bacteria	43190
1155	Ga0395905_0000895	3300037471	Bacteria	38905
1156	Ga0395905_0003480	3300037471	Bacteria	16823
1157	Ga0395905_0018268	3300037471	Bacteria	6657
1158	Ga0395905_0073034	3300037471	Bacteria	3215
1159	Ga0395905_0102588	3300037471	Bacteria	2685
1160	Ga0395905_0123164	3300037471	Bacteria	2438
1161	Ga0395905_0203231	3300037471	Bacteria	1857
1162	Ga0395905_0303223	3300037471	Bacteria	1485
1163	Ga0395905_0355915	3300037471	Bacteria	1356
1164	Ga0436364_0528735	3300037853	Bacteria	840
1165	Ga0436364_0667041	3300037853	Bacteria	2536
1166	Ga0436364_1043221	3300037853	Bacteria	42769
1167	Ga0395901_0051281	3300038443	Bacteria	4289
1168	Ga0395901_0052453	3300038443	Bacteria	4239
1169	Ga0395901_0065113	3300038443	Bacteria	3794
1170	Ga0395901_0081508	3300038443	Bacteria	3380
1171	Ga0395901_0136710	3300038443	Bacteria	2575
1172	Ga0395901_0175988	3300038443	Bacteria	2244
1173	Ga0395901_0277755	3300038443	Bacteria	1741
1174	Ga0395901_0529523	3300038443	Bacteria	1196
1175	Ga0400490_35404	3300038726	Bacteria	4845
1176	Ga0400488_10414	3300038741	Bacteria	1515
1177	Ga0400483_115564	3300039062	Bacteria	1608
1178	Ga0400483_167120	3300039062	Bacteria	1856
1179	Ga0400489_77120	3300039093	Bacteria	1269
1180	Ga0237816_00148	3300039145	Bacteria	5547
1181	Ga0436365_0308506	3300039437	Bacteria	1267
1182	Ga0436365_0805618	3300039437	Bacteria	2672
1183	Ga0436365_0960828	3300039437	Bacteria	636
1184	Ga0436365_1149228	3300039437	Bacteria	1437
1185	Ga0436365_1378466	3300039437	Bacteria	1244
1186	Ga0436361_0932343	3300039447	Bacteria	25287
1187	Ga0436363_0998404	3300039450	Bacteria	907
1188	Ga0439438_000268	3300041405	Bacteria	23335
1189	Ga0439461_0020382	3300041410	Bacteria	1312
1190	Ga0451787_664484	3300041441	Bacteria	1570
1191	Ga0451789_0205740	3300041443	Bacteria	1201
1192	Ga0451789_0668546	3300041443	Bacteria	777
1193	Ga0451791_0533597	3300041451	Bacteria	2737
1194	Ga0451793_0259988	3300041452	Bacteria	764
1195	Ga0451793_0300321	3300041452	Bacteria	1572
1196	Ga0451793_0779431	3300041452	Bacteria	589
1197	Ga0451793_1098328	3300041452	Bacteria	1729
1198	Ga0451797_0814064	3300041453	Bacteria	979
1199	Ga0451797_0960381	3300041453	Bacteria	834
1200	Ga0451797_1287132	3300041453	Bacteria	622
1201	Ga0451795_0037673	3300041456	Bacteria	1169
1202	Ga0451795_0302360	3300041456	Bacteria	632
1203	Ga0451795_1093367	3300041456	Bacteria	773
1204	Ga0451800_0531416	3300041459	Bacteria	707
1205	Ga0451800_1143563	3300041459	Bacteria	861
1206	Ga0451800_1336356	3300041459	Bacteria	716
1207	Ga0451800_1347080	3300041459	Bacteria	1140
1208	Ga0451800_1453629	3300041459	Bacteria	867
1209	Ga0451802_0737550	3300041460	Bacteria	2476
1210	Ga0451802_1791109	3300041460	Bacteria	1088
1211	Ga0451807_0109086	3300041486	Bacteria	1433
1212	Ga0451807_1015374	3300041486	Bacteria	4853
1213	Ga0451807_2127931	3300041486	Unclassified	986
1214	Ga0451833_0875683	3300041491	Bacteria	4595
1215	Ga0451833_1495386	3300041491	Bacteria	2204
1216	Ga0451837_0954212	3300041494	Bacteria	2847
1217	Ga0451841_0278424	3300041498	Bacteria	942
1218	Ga0451841_0659571	3300041498	Bacteria	861
1219	Ga0451851_1274973	3300041507	Bacteria	1302
1220	Ga0451843_0108815	3300041509	Bacteria	655
1221	Ga0451853_1190134	3300041512	Bacteria	2455
1222	Ga0451853_3865866	3300041512	Bacteria	1056
1223	Ga0451853_4036164	3300041512	Bacteria	1608
1224	Ga0439437_002898	3300042000	Bacteria	1848
1225	Ga0439442_050139	3300042002	Bacteria	880
1226	Ga0439463_000609	3300042016	Bacteria	9928
1227	Ga0450911_020803	3300042115	Bacteria	856
1228	Ga0450913_017850	3300042117	Bacteria	630
1229	Ga0450917_002467	3300042120	Bacteria	1320
1230	Ga0450888_000480	3300042126	Bacteria	3773
1231	Ga0450890_000295	3300042127	Bacteria	7255
1232	Ga0450890_039658	3300042127	Bacteria	693
1233	Ga0450892_001087	3300042130	Bacteria	2844
1234	Ga0450903_027492	3300042138	Bacteria	865
1235	Ga0450904_014358	3300042139	Bacteria	790
1236	Ga0450889_009573	3300042144	Bacteria	993
1237	Ga0439446_0004039	3300042156	Bacteria	3691
1238	Ga0450893_0021574	3300042532	Bacteria	1112
1239	Ga0451577_0000013	3300042876	Bacteria	550689
1240	Ga0451577_0003554	3300042876	Bacteria	17210
1241	Ga0451577_0003789	3300042876	Bacteria	16461
1242	Ga0451577_0005413	3300042876	Bacteria	13094
1243	Ga0451577_0036543	3300042876	Bacteria	4421
1244	Ga0451577_0143508	3300042876	Bacteria	2146
1245	Ga0451577_0537562	3300042876	Bacteria	1061
1246	Ga0451577_1964921	3300042876	Bacteria	512
1247	Ga0466969_0000036	3300044656	Bacteria	75718
1248	Ga0466969_0006230	3300044656	Bacteria	6352
1249	Ga0466969_0025156	3300044656	Bacteria	3063
1250	Ga0466969_0032912	3300044656	Bacteria	2634
1251	Ga0466969_0039565	3300044656	Bacteria	2367
1252	Ga0466972_0000282	3300044658	Bacteria	31733
1253	Ga0466972_0267270	3300044658	Bacteria	799
1254	Ga0453683_0000059	3300044673	Bacteria	187158
1255	Ga0453683_0004047	3300044673	Bacteria	10564
1256	Ga0453683_1236468	3300044673	Bacteria	501
1257	Ga0466965_0049757	3300044683	Bacteria	2077
1258	Ga0466965_0091575	3300044683	Bacteria	1547
1259	Ga0466965_0195039	3300044683	Bacteria	1072
1260	Ga0466965_0223023	3300044683	Bacteria	1005
1261	Ga0466965_0231324	3300044683	Bacteria	987
1262	Ga0466966_0026011	3300044684	Bacteria	3821
1263	Ga0466966_0224184	3300044684	Bacteria	1134
1264	Ga0466961_0000406	3300044693	Bacteria	27671
1265	Ga0466961_0003921	3300044693	Bacteria	9308
1266	Ga0466961_0015938	3300044693	Bacteria	4823
1267	Ga0466961_0027523	3300044693	Bacteria	3657
1268	Ga0466961_0231567	3300044693	Bacteria	1137
1269	Ga0466963_0008785	3300044694	Bacteria	6068
1270	Ga0466963_0355516	3300044694	Bacteria	1032
1271	Ga0466963_1240527	3300044694	Bacteria	524
1272	Ga0466964_0261218	3300044706	Bacteria	858
1273	Ga0453684_0000040	3300044712	Bacteria	690210
1274	Ga0453684_0000085	3300044712	Bacteria	397817
1275	Ga0453684_0070718	3300044712	Bacteria	4417
1276	Ga0453684_1221549	3300044712	Bacteria	788
1277	Ga0453684_1418603	3300044712	Bacteria	719
1278	Ga0453684_1703371	3300044712	Bacteria	644
1279	Ga0466971_0034131	3300044719	Bacteria	2280
1280	Ga0466970_0023540	3300044765	Bacteria	3218
1281	Ga0466970_0025771	3300044765	Bacteria	3080
1282	Ga0466970_0046693	3300044765	Bacteria	2307
1283	Ga0466970_0401824	3300044765	Bacteria	782
1284	Ga0466957_0238191	3300044842	Bacteria	1207
1285	Ga0466959_0032407	3300045049	Bacteria	3868
1286	Ga0466959_0038662	3300045049	Bacteria	3526
1287	Ga0466959_0042728	3300045049	Bacteria	3343
1288	Ga0466959_0306609	3300045049	Bacteria	1087
1289	Ga0466959_0767138	3300045049	Bacteria	645
1290	Ga0451576_0000018	3300045051	Bacteria	550689
1291	Ga0451576_0006036	3300045051	Bacteria	14958
1292	Ga0451576_0046314	3300045051	Bacteria	4580
1293	Ga0451576_0062742	3300045051	Bacteria	3873
1294	Ga0451576_0147519	3300045051	Bacteria	2453
1295	Ga0451576_0625897	3300045051	Bacteria	1131
1296	Ga0451576_1084978	3300045051	Bacteria	838
1297	Ga0451576_1689404	3300045051	Bacteria	656
1298	Ga0466967_1225235	3300045976	Bacteria	748
1299	Ga0495617_171111	3300046452	Bacteria	686
1300	Ga0495627_008265	3300046453	Bacteria	3915
1301	Ga0495592_0059971	3300046454	Bacteria	2800
1302	Ga0495590_0169163	3300046457	Bacteria	796
1303	Ga0495591_002740	3300046458	Bacteria	9543
1304	Ga0495629_0016220	3300046459	Bacteria	5348
1305	Ga0495629_0107860	3300046459	Bacteria	1942
1306	Ga0495629_0252120	3300046459	Bacteria	1214
1307	Ga0495629_0480371	3300046459	Bacteria	839
1308	Ga0495638_0060421	3300046460	Bacteria	2344
1309	Ga0495638_0088234	3300046460	Bacteria	1872
1310	Ga0495638_0115806	3300046460	Bacteria	1588
1311	Ga0495638_0550317	3300046460	Bacteria	574
1312	Ga0495653_0019297	3300046463	Bacteria	5528
1313	Ga0495650_0008829	3300046471	Bacteria	5823
1314	Ga0495650_0059084	3300046471	Bacteria	1545
1315	Ga0495580_0100343	3300046472	Bacteria	2014
1316	Ga0495580_0206695	3300046472	Bacteria	1352
1317	Ga0495580_0210191	3300046472	Bacteria	1339
1318	Ga0495580_0234349	3300046472	Bacteria	1260
1319	Ga0495580_0365861	3300046472	Bacteria	975
1320	Ga0495580_0383443	3300046472	Bacteria	949
1321	Ga0495580_0468007	3300046472	Bacteria	844
1322	Ga0495582_0014361	3300046473	Bacteria	4354
1323	Ga0495582_0117472	3300046473	Bacteria	1497
1324	Ga0495582_0355075	3300046473	Bacteria	844
1325	Ga0495605_0000079	3300046474	Bacteria	126756
1326	Ga0495605_0010273	3300046474	Bacteria	5242
1327	Ga0495664_0023776	3300046477	Bacteria	3557
1328	Ga0495664_0098878	3300046477	Bacteria	1757
1329	Ga0495584_0053064	3300046491	Bacteria	2040
1330	Ga0495594_0002116	3300046499	Bacteria	10340
1331	Ga0495596_0116045	3300046500	Bacteria	1040
1332	Ga0495607_0005948	3300046501	Bacteria	8652
1333	Ga0495607_0024242	3300046501	Bacteria	3785
1334	Ga0495607_0027845	3300046501	Bacteria	3490
1335	Ga0495607_0187075	3300046501	Bacteria	1034
1336	Ga0495607_0191961	3300046501	Bacteria	1017
1337	Ga0495583_0006278	3300046506	Bacteria	7812
1338	Ga0495583_0138597	3300046506	Bacteria	1014
1339	Ga0495606_0000018	3300046507	Bacteria	281058
1340	Ga0495606_0001693	3300046507	Bacteria	28471
1341	Ga0495606_0004808	3300046507	Bacteria	13263
1342	Ga0495606_0012829	3300046507	Bacteria	6677
1343	Ga0495606_0086766	3300046507	Bacteria	1933
1344	Ga0495608_0532451	3300046511	Bacteria	709
1345	Ga0495610_0039322	3300046512	Bacteria	2393
1346	Ga0495610_0063754	3300046512	Bacteria	1744
1347	Ga0495610_0112226	3300046512	Bacteria	1206
1348	Ga0495610_0151459	3300046512	Bacteria	989
1349	Ga0495610_0237895	3300046512	Bacteria	727
1350	Ga0495618_0690362	3300046514	Bacteria	601
1351	Ga0495620_0013339	3300046515	Bacteria	4210
1352	Ga0495620_0048024	3300046515	Bacteria	1834
1353	Ga0495620_0092085	3300046515	Bacteria	1215
1354	Ga0495620_0300239	3300046515	Bacteria	610
1355	Ga0495628_0245793	3300046516	Bacteria	1337
1356	Ga0495631_0048144	3300046518	Bacteria	1870
1357	Ga0495632_0004573	3300046519	Bacteria	9377
1358	Ga0495632_0005877	3300046519	Bacteria	8013
1359	Ga0495632_0019284	3300046519	Bacteria	3720
1360	Ga0495632_0055251	3300046519	Bacteria	1944
1361	Ga0495632_0067376	3300046519	Bacteria	1726
1362	Ga0495632_0146319	3300046519	Bacteria	1094
1363	Ga0495643_0004561	3300046522	Bacteria	9647
1364	Ga0495643_0277504	3300046522	Bacteria	772
1365	Ga0495644_0040888	3300046523	Bacteria	1747
1366	Ga0495644_0187454	3300046523	Bacteria	796
1367	Ga0495642_0010968	3300046528	Bacteria	3474
1368	Ga0495642_0126278	3300046528	Bacteria	1100
1369	Ga0495652_0474867	3300046529	Bacteria	871
1370	Ga0495654_0091204	3300046530	Bacteria	1414
1371	Ga0495640_0152833	3300046533	Bacteria	1482
1372	Ga0495586_0199579	3300046535	Bacteria	1134
1373	Ga0495598_0126453	3300046537	Bacteria	872
1374	Ga0495598_0273086	3300046537	Bacteria	632
1375	Ga0495598_0363899	3300046537	Bacteria	559
1376	Ga0495609_0124522	3300046538	Bacteria	1107
1377	Ga0495621_0064902	3300046539	Bacteria	1333
1378	Ga0495597_0092634	3300046542	Bacteria	1281
1379	Ga0495597_0278207	3300046542	Bacteria	652
1380	Ga0495645_0074164	3300046543	Bacteria	2451
1381	Ga0495645_0245104	3300046543	Bacteria	1193
1382	Ga0495622_0027086	3300046557	Bacteria	2675
1383	Ga0495656_0124763	3300046615	Bacteria	1219
1384	Ga0495668_0026531	3300046616	Bacteria	3287
1385	Ga0495668_0273037	3300046616	Bacteria	926
1386	Ga0495668_0291160	3300046616	Bacteria	895
1387	Ga0495668_0603867	3300046616	Bacteria	606
1388	Ga0495611_0001249	3300046648	Bacteria	13066
1389	Ga0495611_0063900	3300046648	Bacteria	1676
1390	Ga0495611_0088526	3300046648	Bacteria	1429
1391	Ga0495611_0270890	3300046648	Bacteria	785
1392	Ga0495625_0010777	3300046660	Bacteria	7524
1393	Ga0495625_0128312	3300046660	Bacteria	1719
1394	Ga0495625_0180493	3300046660	Bacteria	1404
1395	Ga0495625_0609068	3300046660	Bacteria	655
1396	Ga0495635_0074733	3300046663	Bacteria	2322
1397	Ga0495635_0115894	3300046663	Bacteria	1829
1398	Ga0495659_0338654	3300046664	Bacteria	641
1399	Ga0495661_0025068	3300046665	Bacteria	3858
1400	Ga0495661_0226445	3300046665	Bacteria	966
1401	Ga0495657_0082973	3300046675	Bacteria	2070
1402	Ga0495599_0161085	3300046678	Bacteria	1387
1403	Ga0495646_0073389	3300046680	Bacteria	2010
1404	Ga0495647_0021435	3300046681	Bacteria	2326
1405	Ga0495647_0021548	3300046681	Bacteria	2321
1406	Ga0495658_0018582	3300046683	Bacteria	3616
1407	Ga0495658_0032930	3300046683	Bacteria	2834
1408	Ga0495658_0254946	3300046683	Bacteria	1104
1409	Ga0495658_0263091	3300046683	Bacteria	1086
1410	Ga0495669_0015535	3300046684	Bacteria	3261
1411	Ga0495613_0339900	3300046689	Bacteria	1033
1412	Ga0495613_0420755	3300046689	Bacteria	909
1413	Ga0495670_0007900	3300046691	Bacteria	5230
1414	Ga0495671_0020895	3300046692	Bacteria	3445
1415	Ga0495671_0053956	3300046692	Bacteria	1994
1416	Ga0495671_0397257	3300046692	Bacteria	660
1417	Ga0495649_0003794	3300046694	Bacteria	10019
1418	Ga0495649_0222559	3300046694	Bacteria	976
1419	Ga0495589_0017714	3300046794	Bacteria	3655
1420	Ga0495589_0272469	3300046794	Bacteria	788
1421	Ga0495600_0286469	3300046809	Bacteria	1042
1422	Ga0495660_0025217	3300046810	Bacteria	3378
1423	Ga0495660_0394460	3300046810	Bacteria	607
1424	Ga0495604_0192249	3300047317	Bacteria	1421
1425	Ga0495636_0060240	3300047318	Bacteria	1603
1426	Ga0495674_0111820	3300047319	Bacteria	2315
1427	Ga0495672_0009983	3300047320	Bacteria	6811
1428	Ga0495680_0255245	3300047322	Bacteria	1241
1429	Ga0495687_000912	3300047443	Bacteria	30787
1430	Ga0495687_011633	3300047443	Bacteria	4715
1431	Ga0495677_0019763	3300047445	Bacteria	2441
1432	Ga0495679_066707	3300047446	Bacteria	1044
1433	Ga0495673_0010730	3300047469	Bacteria	4964
1434	Ga0495673_0021951	3300047469	Bacteria	3138
1435	Ga0495681_0145242	3300047470	Bacteria	999
1436	Ga0495684_0163503	3300047471	Bacteria	1659
1437	Ga0495686_0337769	3300047472	Bacteria	822
1438	Ga0495686_0549571	3300047472	Bacteria	603
1439	Ga0495614_0242387	3300048089	Bacteria	823
1440	Ga0495626_0111959	3300048091	Bacteria	1181
1441	Ga0495626_0124367	3300048091	Bacteria	1106
1442	Ga0496100_0832195	3300048903	Bacteria	724
1443	Ga0496101_0024961	3300048904	Bacteria	4143
1444	Ga0496101_0297444	3300048904	Bacteria	1264
1445	Ga0496101_0364831	3300048904	Bacteria	1136
1446	Ga0496102_0021149	3300048905	Bacteria	5753
1447	Ga0496102_0039318	3300048905	Bacteria	4274
1448	Ga0496102_0079561	3300048905	Bacteria	3019
1449	Ga0496102_0136772	3300048905	Bacteria	2296
1450	Ga0496102_0439587	3300048905	Bacteria	1224
1451	Ga0496102_1093602	3300048905	Bacteria	717
1452	Ga0496104_0013206	3300048907	Bacteria	7445
1453	Ga0496104_0085647	3300048907	Bacteria	3008
1454	Ga0496104_0124767	3300048907	Bacteria	2472
1455	Ga0496105_0745533	3300048908	Bacteria	748
1456	Ga0496106_0057379	3300048909	Bacteria	2944
1457	Ga0496106_0084887	3300048909	Bacteria	2437
1458	Ga0496106_0185495	3300048909	Bacteria	1653
1459	Ga0496106_0299452	3300048909	Bacteria	1289
1460	Ga0496107_0088189	3300048910	Bacteria	2265
1461	Ga0496108_0543160	3300048911	Bacteria	1014
1462	Ga0496108_1625881	3300048911	Bacteria	534
1463	Ga0496108_1737401	3300048911	Bacteria	512
1464	Ga0496109_0125768	3300048912	Bacteria	2390
1465	Ga0496109_0520052	3300048912	Bacteria	1123
1466	Ga0496109_0592397	3300048912	Bacteria	1045
1467	Ga0496109_0940342	3300048912	Bacteria	802
1468	Ga0496110_0069135	3300048913	Bacteria	3127
1469	Ga0496110_0132413	3300048913	Bacteria	2252
1470	Ga0496110_0218016	3300048913	Bacteria	1735
1471	Ga0496110_0262072	3300048913	Bacteria	1573
1472	Ga0496110_0546433	3300048913	Bacteria	1053
1473	Ga0496110_1333805	3300048913	Bacteria	627
1474	Ga0496112_0005059	3300048915	Bacteria	11325
1475	Ga0496113_0007024	3300048916	Bacteria	7202
1476	Ga0496114_0001047	3300048917	Bacteria	20785
1477	Ga0496114_0008159	3300048917	Bacteria	8300
1478	Ga0496114_0028612	3300048917	Bacteria	4575
1479	Ga0496114_0061024	3300048917	Bacteria	3153
1480	Ga0496114_0352539	3300048917	Bacteria	1302
1481	Ga0496115_0204471	3300048918	Bacteria	1631
1482	Ga0496115_0375720	3300048918	Bacteria	1156
1483	Ga0496116_0020148	3300048919	Bacteria	5075
1484	Ga0496117_0056774	3300048920	Bacteria	2724
1485	Ga0496118_0142551	3300048921	Bacteria	1516
1486	Ga0496119_0000834	3300048922	Bacteria	41096
1487	Ga0496120_0000718	3300048923	Bacteria	48575
1488	Ga0496121_0026934	3300048924	Bacteria	5396
1489	Ga0496122_0000592	3300048925	Bacteria	74496
1490	Ga0496122_0016985	3300048925	Bacteria	6837
1491	Ga0496123_0000656	3300048926	Bacteria	57313
1492	Ga0496123_0030819	3300048926	Bacteria	3917
1493	Ga0496124_0003362	3300048927	Bacteria	19661
1494	Ga0496124_0010223	3300048927	Bacteria	9532
1495	Ga0496124_0022120	3300048927	Bacteria	5837
1496	Ga0496124_0078596	3300048927	Bacteria	2718
1497	Ga0496124_0079168	3300048927	Bacteria	2707
1498	Ga0496124_0091501	3300048927	Bacteria	2479
1499	Ga0496124_0437474	3300048927	Bacteria	896
1500	Ga0496125_0022697	3300048928	Bacteria	5819
1501	Ga0496125_0062565	3300048928	Bacteria	2975
1502	Ga0496125_0137894	3300048928	Bacteria	1702
1503	Ga0496126_0011307	3300048929	Bacteria	9260
1504	Ga0496126_0047047	3300048929	Bacteria	3951
1505	Ga0496126_0293202	3300048929	Bacteria	1345
1506	Ga0501309_010432	3300049129	Bacteria	1198
1507	Ga0495678_023711	3300049459	Bacteria	2662
1508	Ga0495678_036235	3300049459	Bacteria	2014
1509	Ga0495678_119543	3300049459	Bacteria	887
1510	Ga0495682_0002074	3300049460	Bacteria	9792
1511	Ga0495682_0340000	3300049460	Bacteria	529
1512	Ga0501299_012430	3300049522	Bacteria	1453
1513	Ga0501299_040320	3300049522	Bacteria	935
1514	Ga0501314_003354	3300049530	Bacteria	1289
1515	Ga0501031_0001649	3300049568	Bacteria	14009
1516	Ga0501031_1003052	3300049568	Bacteria	534
1517	Ga0501032_0125464	3300049569	Bacteria	1696
1518	Ga0501032_0142264	3300049569	Bacteria	1580
1519	Ga0501032_0750232	3300049569	Bacteria	617
1520	Ga0501033_0082237	3300049570	Bacteria	2362
1521	Ga0501034_0130008	3300049571	Bacteria	2502
1522	Ga0501034_0172250	3300049571	Bacteria	2131
1523	Ga0501034_0199961	3300049571	Bacteria	1957
1524	Ga0501034_0364902	3300049571	Bacteria	1371
1525	Ga0501036_0245252	3300049572	Bacteria	1502
1526	Ga0501036_0640592	3300049572	Bacteria	880
1527	Ga0501036_0820355	3300049572	Bacteria	765
1528	Ga0501037_0013659	3300049573	Bacteria	5983
1529	Ga0501038_0120063	3300049574	Bacteria	2169
1530	Ga0501038_0348001	3300049574	Bacteria	1155
1531	Ga0501038_0891020	3300049574	Bacteria	657
1532	Ga0501039_0032761	3300049575	Bacteria	4008
1533	Ga0501039_0052269	3300049575	Bacteria	3162
1534	Ga0501039_0188149	3300049575	Bacteria	1624
1535	Ga0501040_0103737	3300049576	Bacteria	1985
1536	Ga0501040_0165251	3300049576	Bacteria	1566
1537	Ga0501040_0675638	3300049576	Bacteria	747
1538	Ga0501040_0735400	3300049576	Bacteria	714
1539	Ga0501042_1075571	3300049578	Bacteria	586
1540	Ga0501043_0000004	3300049579	Bacteria	291085
1541	Ga0501043_0088959	3300049579	Bacteria	2427
1542	Ga0501046_0000016	3300049580	Bacteria	234374
1543	Ga0501046_0201970	3300049580	Bacteria	1479
1544	Ga0501046_0218551	3300049580	Bacteria	1412
1545	Ga0501047_0000012	3300049581	Bacteria	368824
1546	Ga0501047_0002537	3300049581	Bacteria	17406
1547	Ga0501047_0122948	3300049581	Bacteria	2476
1548	Ga0501047_0287570	3300049581	Bacteria	1488
1549	Ga0501047_0293404	3300049581	Bacteria	1470
1550	Ga0501047_0335198	3300049581	Bacteria	1351
1551	Ga0501047_0335504	3300049581	Bacteria	1350
1552	Ga0501047_0625024	3300049581	Bacteria	898
1553	Ga0501047_1051994	3300049581	Bacteria	627
1554	Ga0501048_0010438	3300049582	Bacteria	6935
1555	Ga0501068_0275027	3300049584	Bacteria	1075
1556	Ga0501069_0011816	3300049585	Bacteria	4630
1557	Ga0501070_0013166	3300049586	Bacteria	6971
1558	Ga0501070_0050947	3300049586	Bacteria	3436
1559	Ga0501070_0734822	3300049586	Bacteria	779
1560	Ga0501071_0008835	3300049587	Bacteria	6679
1561	Ga0501071_0410886	3300049587	Bacteria	1034
1562	Ga0501073_0025636	3300049589	Bacteria	4225
1563	Ga0501074_0002091	3300049590	Bacteria	13779
1564	Ga0501076_0373427	3300049592	Bacteria	1172
1565	Ga0501199_005273	3300049650	Bacteria	1297
1566	Ga0501202_013977	3300049652	Bacteria	1533
1567	Ga0501211_000722	3300049658	Bacteria	3372
1568	Ga0501222_001247	3300049662	Bacteria	3582
1569	Ga0501249_087284	3300049679	Bacteria	737
1570	Ga0501253_028874	3300049683	Bacteria	1042
1571	Ga0501080_0033654	3300049742	Bacteria	4783
1572	Ga0501080_0047008	3300049742	Bacteria	4018
1573	Ga0501080_0175561	3300049742	Bacteria	1974
1574	Ga0501080_0527557	3300049742	Bacteria	1053
1575	Ga0501080_1094767	3300049742	Bacteria	688
1576	Ga0501081_0217634	3300049743	Bacteria	1388
1577	Ga0501083_0014526	3300049744	Bacteria	5506
1578	Ga0501264_006472	3300049761	Bacteria	1079
1579	Ga0501266_008842	3300049763	Bacteria	1270
1580	Ga0501267_006197	3300049764	Bacteria	1145
1581	Ga0501272_005513	3300049769	Bacteria	1334
1582	Ga0501278_010212	3300049774	Bacteria	746
1583	Ga0501279_003394	3300049775	Bacteria	2079
1584	Ga0501035_0016682	3300049822	Bacteria	6771
1585	Ga0501035_0068118	3300049822	Bacteria	3156
1586	Ga0501035_0103549	3300049822	Bacteria	2497
1587	Ga0501044_0007417	3300049823	Bacteria	12064
1588	Ga0501044_0064676	3300049823	Bacteria	3733
1589	Ga0501044_0139113	3300049823	Bacteria	2417
1590	Ga0501044_0191635	3300049823	Bacteria	2007
1591	Ga0501044_0247169	3300049823	Bacteria	1726
1592	Ga0501045_0009097	3300049824	Bacteria	6937
1593	Ga0501045_0434923	3300049824	Bacteria	976
1594	Ga0501226_004955	3300049853	Bacteria	1528
1595	Ga0501226_006472	3300049853	Bacteria	1327
1596	nmdc:mga03683_102014_c1	3300050489	Bacteria	1262
1597	nmdc:mga03683_115789_c1	3300050489	Bacteria	1189
1598	nmdc:mga03683_307019_c1	3300050489	Bacteria	745
1599	nmdc:mga03683_313614_c1	3300050489	Bacteria	737
1600	nmdc:mga03683_54553_c1	3300050489	Bacteria	1676
1601	nmdc:mga03n38_41237_c1	3300050490	Bacteria	2011
1602	nmdc:mga03n38_827733_c1	3300050490	Bacteria	540
1603	nmdc:mga00v17_127984_c1	3300050491	Bacteria	1621
1604	nmdc:mga00v17_143688_c1	3300050491	Bacteria	1531
1605	nmdc:mga00v17_186953_c1	3300050491	Bacteria	1337
1606	nmdc:mga00v17_828904_c1	3300050491	Bacteria	588
1607	nmdc:mga0yw44_30213_c1	3300050492	Bacteria	3136
1608	nmdc:mga0yw44_459892_c1	3300050492	Bacteria	862
1609	nmdc:mga0k408_109179_c1	3300050493	Bacteria	1635
1610	nmdc:mga0k408_11211_c1	3300050493	Bacteria	4875
1611	nmdc:mga0k408_114833_c1	3300050493	Bacteria	1593
1612	nmdc:mga0k408_136285_c1	3300050493	Bacteria	1459
1613	nmdc:mga0k408_14639_c1	3300050493	Bacteria	4325
1614	nmdc:mga0k408_152829_c1	3300050493	Bacteria	1375
1615	nmdc:mga0k408_15620_c1	3300050493	Bacteria	4201
1616	nmdc:mga0k408_263616_c1	3300050493	Bacteria	1029
1617	nmdc:mga0k408_2673_c1	3300050493	Bacteria	9451
1618	nmdc:mga0k408_47503_c1	3300050493	Bacteria	2481
1619	nmdc:mga0k408_60046_c1	3300050493	Bacteria	2209
1620	nmdc:mga0k408_607146_c1	3300050493	Bacteria	645
1621	nmdc:mga0k408_63531_c1	3300050493	Bacteria	958
1622	nmdc:mga0k408_92973_c1	3300050493	Bacteria	1773
1623	nmdc:mga0k408_96201_c1	3300050493	Bacteria	1743
1624	nmdc:mga06z11_23782_c1	3300050494	Bacteria	2883
1625	nmdc:mga06z11_27127_c1	3300050494	Bacteria	2735
1626	nmdc:mga06z11_51754_c1	3300050494	Bacteria	2104
1627	nmdc:mga06z11_551408_c1	3300050494	Bacteria	700
1628	nmdc:mga06z11_65667_c1	3300050494	Bacteria	1905
1629	nmdc:mga07m45_1019_c1	3300050496	Bacteria	7575
1630	nmdc:mga07m45_103975_c1	3300050496	Bacteria	1633
1631	nmdc:mga07m45_1241_c1	3300050496	Bacteria	11565
1632	nmdc:mga07m45_144604_c1	3300050496	Bacteria	1378
1633	nmdc:mga07m45_215893_c1	3300050496	Bacteria	1116
1634	nmdc:mga07m45_22037_c1	3300050496	Bacteria	3476
1635	nmdc:mga07m45_4444_c1	3300050496	Bacteria	6863
1636	nmdc:mga07m45_46325_c1	3300050496	Bacteria	2443
1637	nmdc:mga07m45_650_c1	3300050496	Bacteria	14760
1638	nmdc:mga07m45_687772_c1	3300050496	Bacteria	589
1639	nmdc:mga05p37_1697299_c1	3300050507	Bacteria	616
1640	nmdc:mga05p37_566117_c1	3300050507	Bacteria	1290
1641	nmdc:mga09592_349395_c1	3300050508	Bacteria	1280
1642	nmdc:mga09592_522300_c1	3300050508	Bacteria	1021
1643	nmdc:mga0qj67_453007_c1	3300050509	Bacteria	1033
1644	nmdc:mga0qj67_639730_c1	3300050509	Bacteria	849
1645	nmdc:mga06r32_352_c1	3300050510	Bacteria	38408
1646	nmdc:mga06r32_77840_c1	3300050510	Bacteria	3222
1647	nmdc:mga08y16_304961_c1	3300050511	Bacteria	1641
1648	nmdc:mga08y16_465913_c1	3300050511	Bacteria	1287
1649	nmdc:mga08y16_674920_c1	3300050511	Bacteria	1035
1650	nmdc:mga0sz30_45120_c1	3300050516	Bacteria	1859
1651	Ga0495601_0057819	3300053077	Bacteria	2457
1652	Ga0495601_0448656	3300053077	Bacteria	834
1653	Ga0495612_0038847	3300053078	Bacteria	1935
1654	Ga0495612_0040355	3300053078	Bacteria	1901
1655	Ga0495619_0119836	3300053085	Bacteria	1804
1656	Ga0495619_0734208	3300053085	Bacteria	670
1657	Ga0500578_0000049	3300053086	Bacteria	124281
1658	Ga0500644_0032189	3300053088	Bacteria	1674
1659	Ga0500644_0099111	3300053088	Bacteria	1104
1660	Ga0500646_0003195	3300053090	Bacteria	4205
1661	Ga0500647_0132189	3300053091	Bacteria	1176
1662	Ga0500583_0389368	3300053092	Bacteria	670
1663	Ga0500583_0532016	3300053092	Bacteria	548
1664	Ga0500651_0097062	3300053093	Bacteria	1810
1665	Ga0500651_0114859	3300053093	Bacteria	1640
1666	Ga0500651_0406196	3300053093	Bacteria	764
1667	Ga0500650_0057076	3300053098	Bacteria	1820
1668	Ga0500650_0183909	3300053098	Bacteria	957
1669	Ga0500660_124303	3300053100	Bacteria	1066
1670	Ga0500555_089260	3300053103	Bacteria	793
1671	Ga0500562_007913	3300053108	Bacteria	2684
1672	Ga0500569_105324	3300053109	Bacteria	928
1673	Ga0500591_075673	3300053115	Bacteria	1512
1674	Ga0500593_000729	3300053117	Bacteria	12456
1675	Ga0500593_030750	3300053117	Bacteria	2399
1676	Ga0500594_0054739	3300053118	Bacteria	1134
1677	Ga0500594_0058307	3300053118	Bacteria	1106
1678	Ga0500628_000439	3300053129	Bacteria	7917
1679	Ga0500642_0006244	3300053130	Bacteria	3906
1680	Ga0500652_000044	3300053131	Bacteria	64309
1681	Ga0500652_023494	3300053131	Bacteria	2345
1682	Ga0500655_029979	3300053133	Bacteria	1045
1683	Ga0500658_0002543	3300053134	Bacteria	7066
1684	Ga0500658_0015441	3300053134	Bacteria	2836
1685	Ga0500658_0074183	3300053134	Bacteria	1442
1686	Ga0500658_0128090	3300053134	Bacteria	1130
1687	Ga0500559_0006184	3300053136	Bacteria	5418
1688	Ga0500559_0327048	3300053136	Bacteria	718
1689	Ga0500561_0058022	3300053137	Bacteria	1076
1690	Ga0500568_0001263	3300053139	Bacteria	16721
1691	Ga0500568_0016548	3300053139	Bacteria	3275
1692	Ga0500568_0027522	3300053139	Bacteria	2376
1693	Ga0500568_0038336	3300053139	Bacteria	1940
1694	Ga0500577_0003546	3300053142	Bacteria	4058
1695	Ga0500577_0347215	3300053142	Bacteria	649
1696	Ga0500588_0033202	3300053146	Bacteria	1504
1697	Ga0500604_0012951	3300053151	Bacteria	2257
1698	Ga0500604_0112477	3300053151	Bacteria	905
1699	Ga0500619_000120	3300053154	Bacteria	20611
1700	Ga0500622_0000002	3300053156	Bacteria	646442
1701	Ga0500622_0000128	3300053156	Bacteria	79659
1702	Ga0500622_0001173	3300053156	Bacteria	21675
1703	Ga0500622_0001549	3300053156	Bacteria	18205
1704	Ga0500622_0007550	3300053156	Bacteria	6162
1705	Ga0500622_0071964	3300053156	Bacteria	1746
1706	Ga0500622_0170851	3300053156	Bacteria	1012
1707	Ga0500645_000413	3300053730	Bacteria	29917
1708	Ga0500645_014269	3300053730	Bacteria	2534
1709	Ga0500565_014417	3300053734	Bacteria	872
1710	Ga0500587_005732	3300053739	Bacteria	1663
1711	Ga0500587_011776	3300053739	Bacteria	1104
1712	Ga0501084_0054143	3300054114	Bacteria	3356
1713	Ga0590071_001980	3300059421	Bacteria	5239
1714	Ga0501082_0821023	3300060353	Bacteria	813
1715	2599971989	2599185307	Bacteria	6194719
1716	2644363260	2643221665	Bacteria	4699229
1717	2765586689	2765235841	Bacteria	6137024
1718	2855021425	2855020534	Bacteria	3204685
1719	2861695613	2861691609	Bacteria	5628931
1720	2919156000	2919155634	Bacteria	4860545
1721	2928516354	2928515477	Bacteria	4448421
1722	2952254092	2952252522	Bacteria	4171745
1723	3003670766	3003665799	Bacteria	7279786
1724	8056163744	8056161164	Bacteria	6106669
1725	Ga0070681_10898991
1726	JGI24740J21852_10012529
1727	JGI25155J39150_1000079
1728	JGI25156J39149_1000125
1729	JGI25154J39366_1000141
1730	JGI25157J39369_1000159
1731	JGI25150J39212_1006333
1732	JGI25150J39212_1007862
1733	JGI25159J45721_1000638
1734	JGI25159J45721_1002502
1735	JGI25151J46595_10019053
1736	JGI25406J46586_10000015
1737	JGI25153J46596_10002603
1738	JGI25153J46596_10002737
1739	rootL2_10048698
1740	rootH1_10008298
1741	rootH1_10032418
1742	rootH1_10219628
1743	rootH1_10235640
1744	JGI25160J50197_1000067
1745	JGI25161J50226_1000035
1746	Ga0055526_1000542
1747	Ga0055526_1007532
1748	Ga0055526_1007544
1749	Ga0055537_1001739
1750	Ga0055537_1024062
1751	Ga0055524_1000006
1752	Ga0055524_1000079
1753	Ga0055524_1001129
1754	Ga0055536_1000447
1755	Ga0055534_1001178
1756	Ga0055534_1003541
1757	Ga0055528_1000374
1758	Ga0055530_10000346
1759	Ga0055530_10002750
1760	Ga0055530_10013673
1761	Ga0055530_10018865
1762	Ga0055540_1000005
1763	Ga0055540_1000086
1764	Ga0055540_1056259
1765	Ga0055531_10000604
1766	Ga0055531_10000607
1767	Ga0055531_10002992
1768	Ga0055531_10003346
1769	Ga0055531_10005016
1770	Ga0055531_10009416
1771	Ga0055543_1001289
1772	Ga0065165_1010114
1773	Ga0065165_1014561
1774	Ga0065165_1018974
1775	Ga0065165_1021684
1776	Ga0065712_10188573
1777	Ga0065707_10242902
1778	Ga0070658_10165783
1779	Ga0070658_10178500
1780	Ga0070658_10376755
1781	Ga0070676_10002509
1782	Ga0070676_10025454
1783	Ga0070676_10075715
1784	Ga0070676_10224705
1785	Ga0070683_100037706
1786	Ga0070683_100121661
1787	Ga0070690_100010662
1788	Ga0070690_100239905
1789	Ga0070670_100024964
1790	Ga0070670_100046533
1791	Ga0070670_100949901
1792	Ga0070670_101241508
1793	Ga0070670_101617950
1794	Ga0070677_10006749
1795	Ga0070677_10012615
1796	Ga0070677_10017639
1797	Ga0070677_10092265
1798	Ga0070677_10334597
1799	Ga0068869_100012500
1800	Ga0068869_100096147
1801	Ga0070666_10000910
1802	Ga0070666_10004166
1803	Ga0070666_10241796
1804	Ga0070666_10429708
1805	Ga0070666_10457645
1806	Ga0070680_100056960
1807	Ga0070680_100157655
1808	Ga0070680_100573155
1809	Ga0068868_100004895
1810	Ga0068868_100019803
1811	Ga0068868_100615315
1812	Ga0068868_101493088
1813	Ga0070660_100019427
1814	Ga0070689_100103553
1815	Ga0070689_101208455
1816	Ga0070691_10049116
1817	Ga0070687_100107854
1818	Ga0070661_100000925
1819	Ga0070668_100000411
1820	Ga0070668_100253166
1821	Ga0070669_100005882
1822	Ga0070669_100007708
1823	Ga0070669_100153600
1824	Ga0070669_100197215
1825	Ga0070669_100442007
1826	Ga0070675_100000199
1827	Ga0070675_100003618
1828	Ga0070675_100016158
1829	Ga0070675_100025060
1830	Ga0070675_100059825
1831	Ga0070675_100063020
1832	Ga0070675_100129478
1833	Ga0070675_100175593
1834	Ga0070675_100234314
1835	Ga0070675_100261486
1836	Ga0070675_100304386
1837	Ga0070675_100605865
1838	Ga0070671_100068600
1839	Ga0070671_100082092
1840	Ga0070671_100119592
1841	Ga0070671_100174389
1842	Ga0070671_100282123
1843	Ga0070671_100558339
1844	Ga0070671_100577438
1845	Ga0070671_100751456
1846	Ga0070674_100008421
1847	Ga0070674_100009710
1848	Ga0070674_100076188
1849	Ga0070674_100171882
1850	Ga0070674_100191479
1851	Ga0070674_100224656
1852	Ga0070674_100803409
1853	Ga0070674_101195863
1854	Ga0070673_100001468
1855	Ga0070673_100008853
1856	Ga0070673_100028271
1857	Ga0070673_100070117
1858	Ga0070673_100147698
1859	Ga0070673_100150088
1860	Ga0070673_100177443
1861	Ga0070673_100319302
1862	Ga0070688_100317323
1863	Ga0070659_100001694
1864	Ga0070659_100788685
1865	Ga0070667_100000463
1866	Ga0070667_100003988
1867	Ga0070667_100019707
1868	Ga0070667_100044588
1869	Ga0070667_100088182
1870	Ga0070667_100162405
1871	Ga0070667_100274337
1872	Ga0070667_100857417
1873	Ga0070714_100085415
1874	Ga0070714_100940801
1875	Ga0070713_100150212
1876	Ga0070713_100276595
1877	Ga0070713_100473741
1878	Ga0070713_100495254
1879	Ga0070713_100626243
1880	Ga0070713_100753871
1881	Ga0070710_10007341
1882	Ga0070710_10065129
1883	Ga0070710_10506754
1884	Ga0070710_10549970
1885	Ga0070701_10346409
1886	Ga0070711_100061388
1887	Ga0070705_100857867
1888	Ga0070705_100978965
1889	Ga0070700_100054257
1890	Ga0070700_100081321
1891	Ga0070708_100104465
1892	Ga0070708_100595274
1893	Ga0070663_100003243
1894	Ga0070663_100003886
1895	Ga0070663_100850583
1896	Ga0070663_101262511
1897	Ga0070678_100001786
1898	Ga0070678_100025816
1899	Ga0070678_100028458
1900	Ga0070678_100087358
1901	Ga0070678_100289859
1902	Ga0070678_100338210
1903	Ga0070678_101232293
1904	Ga0070678_101284639
1905	Ga0070662_100034028
1906	Ga0070662_100093049
1907	Ga0070662_100182623
1908	Ga0070662_100183998
1909	Ga0070662_100509332
1910	Ga0070681_10005119
1911	Ga0070681_10188912
1912	Ga0070681_10239500
1913	Ga0070681_10675550
1914	Ga0068867_100000077
1915	Ga0068867_100000932
1916	Ga0068867_100012398
1917	Ga0068867_100038819
1918	Ga0068867_100054825
1919	Ga0068867_100136111
1920	Ga0068867_100213688
1921	Ga0068867_100411850
1922	Ga0068867_100569602
1923	Ga0070685_10111492
1924	Ga0070706_100001777
1925	Ga0070706_100375056
1926	Ga0070706_100855603
1927	Ga0070707_100036485
1928	Ga0070707_100417757
1929	Ga0070698_100933444
1930	Ga0070699_100232285
1931	Ga0070679_100077785
1932	Ga0070679_100120419
1933	Ga0070679_100128179
1934	Ga0070679_100337587
1935	Ga0070684_100039305
1936	Ga0068853_100006065
1937	Ga0068853_100034477
1938	Ga0068853_100071781
1939	Ga0068853_100078556
1940	Ga0070672_100000674
1941	Ga0070672_100001496
1942	Ga0070672_100027912
1943	Ga0070672_100029785
1944	Ga0070672_100112138
1945	Ga0070672_100130914
1946	Ga0070672_100689912
1947	Ga0070672_100693904
1948	Ga0070672_101302960
1949	Ga0070686_100089925
1950	Ga0070686_100533423
1951	Ga0070696_100166665
1952	Ga0070693_100220427
1953	Ga0070665_101304575
1954	Ga0070704_101847512
1955	Ga0068855_100022408
1956	Ga0068855_100039828
1957	Ga0068855_100077143
1958	Ga0068855_100092900
1959	Ga0068855_100256710
1960	Ga0070664_100000939
1961	Ga0070664_100025855
1962	Ga0070664_100063541
1963	Ga0070664_100091218
1964	Ga0070664_100532892
1965	Ga0068857_100117060
1966	Ga0068857_100131701
1967	Ga0068857_100655455
1968	Ga0068857_101040811
1969	Ga0068854_100069996
1970	Ga0068854_100882064
1971	Ga0068856_100012917
1972	Ga0068856_100289670
1973	Ga0068856_100447216
1974	Ga0070702_100474759
1975	Ga0068852_100014816
1976	Ga0068852_100018603
1977	Ga0068852_100027821
1978	Ga0068852_100044259
1979	Ga0068852_100046620
1980	Ga0068852_100198851
1981	Ga0068852_100252895
1982	Ga0068852_100466299
1983	Ga0068852_100526853
1984	Ga0068859_100007180
1985	Ga0068859_100032232
1986	Ga0068859_100183101
1987	Ga0068859_100468786
1988	Ga0068864_100000354
1989	Ga0068864_100002399
1990	Ga0068864_100037250
1991	Ga0068864_100055665
1992	Ga0068864_100115684
1993	Ga0068864_101070786
1994	Ga0068864_102265800
1995	Ga0068866_10002910
1996	Ga0068866_10456408
1997	Ga0068861_100003227
1998	Ga0068861_100026530
1999	Ga0068861_100268015
2000	Ga0068851_10004231
2001	Ga0068851_10065962
2002	Ga0068851_10351275
2003	Ga0068870_10012786
2004	Ga0068870_10029084
2005	Ga0068870_10292604
2006	Ga0068863_100003312
2007	Ga0068863_100034898
2008	Ga0068863_100037190
2009	Ga0068863_100044132
2010	Ga0068863_100100578
2011	Ga0068863_100178913
2012	Ga0068863_100206566
2013	Ga0068858_100000262
2014	Ga0068858_100005749
2015	Ga0068858_100009778
2016	Ga0068858_100044019
2017	Ga0068858_101045860
2018	Ga0068860_100006843
2019	Ga0068860_100085476
2020	Ga0068860_100089805
2021	Ga0068862_100019197
2022	Ga0068862_100023970
2023	Ga0068862_100028761
2024	Ga0068862_100058582
2025	Ga0068862_100059433
2026	Ga0068862_100094485
2027	Ga0068862_100126510
2028	Ga0068862_100784788
2029	Ga0081455_10004966
2030	Ga0081455_10488458
2031	Ga0081455_10588779
2032	Ga0081540_1012498
2033	Ga0075365_10070149
2034	Ga0075365_10110299
2035	Ga0075368_10029146
2036	Ga0075368_10109207
2037	Ga0075368_10192943
2038	Ga0075363_100537181
2039	Ga0075364_10129145
2040	Ga0075364_10139836
2041	Ga0075364_10154009
2042	Ga0075432_10154894
2043	Ga0075432_10596429
2044	Ga0070715_10036873
2045	Ga0070716_100270348
2046	Ga0070716_101375385
2047	Ga0070712_100133058
2048	Ga0075362_10005748
2049	Ga0075362_10015938
2050	Ga0075362_10030414
2051	Ga0075362_10040413
2052	Ga0075362_10131295
2053	Ga0075362_10165182
2054	Ga0075362_10294084
2055	Ga0075362_10315725
2056	Ga0075367_10008021
2057	Ga0075367_10038031
2058	Ga0075367_10052397
2059	Ga0075367_10113141
2060	Ga0075367_10309550
2061	Ga0075369_10025461
2062	Ga0075369_10089557
2063	Ga0075366_10001921
2064	Ga0075366_10002417
2065	Ga0075366_10009102
2066	Ga0075366_10022250
2067	Ga0075366_10023025
2068	Ga0075366_10043968
2069	Ga0075366_10087477
2070	Ga0075366_10099101
2071	Ga0075366_10106906
2072	Ga0075366_10190494
2073	Ga0075366_10194245
2074	Ga0075366_10282479
2075	Ga0075366_10320595
2076	Ga0075366_10641719
2077	Ga0097621_100006883
2078	Ga0097621_100016215
2079	Ga0097621_100034883
2080	Ga0097621_100133582
2081	Ga0097621_100207916
2082	Ga0097621_100222507
2083	Ga0097621_100800847
2084	Ga0075370_10005490
2085	Ga0075370_10005571
2086	Ga0075370_10008637
2087	Ga0075370_10015091
2088	Ga0075370_10059640
2089	Ga0075370_10136023
2090	Ga0075370_10490564
2091	Ga0068871_100008710
2092	Ga0068871_100065266
2093	Ga0068871_100075803
2094	Ga0068871_100400827
2095	Ga0068871_100703754
2096	Ga0068871_101192775
2097	Ga0075428_100036897
2098	Ga0075430_100496766
2099	Ga0075431_100005587
2100	Ga0075429_100401840
2101	Ga0075429_100444789
2102	Ga0068865_100010698
2103	Ga0068865_100015466
2104	Ga0068865_100418978
2105	Ga0097620_100007180
2106	Ga0097620_100032233
2107	Ga0097620_100183102
2108	Ga0097620_100468776
2109	Ga0099823_1002035
2110	Ga0079104_1000100
2111	Ga0079104_1006080
2112	Ga0099826_10166791
2113	Ga0105251_10000309
2114	Ga0105251_10043577
2115	Ga0105251_10098387
2116	Ga0105251_10123778
2117	Ga0105244_10019485
2118	Ga0105244_10019533
2119	Ga0105244_10121111
2120	Ga0105244_10165564
2121	Ga0105244_10176417
2122	Ga0105250_10010061
2123	Ga0105250_10159959
2124	Ga0105240_10007299
2125	Ga0105240_10031265
2126	Ga0105240_10034862
2127	Ga0105240_10041587
2128	Ga0105240_10079757
2129	Ga0105240_10377581
2130	Ga0105240_10432590
2131	Ga0111539_10322283
2132	Ga0111539_10558638
2133	Ga0111539_10627877
2134	Ga0105245_10307238
2135	Ga0105245_10856702
2136	Ga0105245_11120787
2137	Ga0105247_10431794
2138	Ga0105247_10977890
2139	Ga0114129_10491018
2140	Ga0114129_11031304
2141	Ga0105243_10002591
2142	Ga0105243_10068864
2143	Ga0105243_10075438
2144	Ga0105243_10386578
2145	Ga0105243_11957074
2146	Ga0105241_10015147
2147	Ga0105241_10434571
2148	Ga0105242_10587584
2149	Ga0105242_11152775
2150	Ga0105248_10007009
2151	Ga0105248_10056848
2152	Ga0105248_10064841
2153	Ga0105248_10088653
2154	Ga0105248_10130214
2155	Ga0105248_10191639
2156	Ga0105248_10245116
2157	Ga0105248_10387556
2158	Ga0105248_10454797
2159	Ga0105248_10958676
2160	Ga0105237_10000998
2161	Ga0105237_10105952
2162	Ga0105237_10179800
2163	Ga0105237_11091736
2164	Ga0105238_10012661
2165	Ga0105238_10018725
2166	Ga0105238_10019715
2167	Ga0105238_10033490
2168	Ga0105238_10046675
2169	Ga0105238_10244541
2170	Ga0105238_10638696
2171	Ga0105249_10000342
2172	Ga0105249_10044280
2173	Ga0105249_10104287
2174	Ga0105249_10151394
2175	Ga0105249_10318448
2176	Ga0105239_10000318
2177	Ga0105239_10509498
2178	Ga0105239_11138897
2179	Ga0105246_12327865
2180	Ga0157317_1000493
2181	Ga0157319_1000035
2182	Ga0157314_1005544
2183	Ga0157326_1005406
2184	Ga0157373_10486659
2185	Ga0157371_10005864
2186	Ga0157371_10650304
2187	Ga0157370_10438793
2188	Ga0157370_10815178
2189	Ga0157370_11080649
2190	Ga0157369_10031818
2191	Ga0157369_10037600
2192	Ga0157369_11072985
2193	Ga0157374_10025164
2194	Ga0157374_10125887
2195	Ga0157374_10221280
2196	Ga0157374_10646021
2197	Ga0157378_10180665
2198	Ga0157378_10308886
2199	Ga0157378_10445647
2200	Ga0157378_10492593
2201	Ga0157378_11466363
2202	Ga0163162_10000679
2203	Ga0163162_10012705
2204	Ga0163162_10025634
2205	Ga0163162_10048557
2206	Ga0163162_10053465
2207	Ga0163162_10086236
2208	Ga0163162_10871690
2209	Ga0157372_10000718
2210	Ga0157372_10035925
2211	Ga0157372_10102543
2212	Ga0157372_10117708
2213	Ga0157372_10699447
2214	Ga0157372_10743795
2215	Ga0157375_10004728
2216	Ga0157375_10018087
2217	Ga0157375_10019246
2218	Ga0157375_10034066
2219	Ga0157375_10056743
2220	Ga0157375_10207553
2221	Ga0157375_10261577
2222	Ga0157375_10275214
2223	Ga0157375_10308210
2224	Ga0157375_10592298
2225	Ga0157375_10746747
2226	Ga0157375_11075442
2227	Ga0163163_10004764
2228	Ga0163163_10098591
2229	Ga0163163_10107334
2230	Ga0163163_10246292
2231	Ga0163163_10526712
2232	Ga0163163_10560854
2233	Ga0163163_11979705
2234	Ga0157380_10022857
2235	Ga0157380_10023566
2236	Ga0157380_10048088
2237	Ga0157380_10062916
2238	Ga0157380_10069002
2239	Ga0157380_10148857
2240	Ga0157380_10202571
2241	Ga0157380_10205600
2242	Ga0157380_11222749
2243	Ga0157380_11258212
2244	Ga0157380_11438656
2245	Ga0157380_12702528
2246	Ga0182008_10003595
2247	Ga0182008_10366545
2248	Ga0157377_10000094
2249	Ga0157377_10521026
2250	Ga0157379_10004559
2251	Ga0157379_10091048
2252	Ga0157379_10157624
2253	Ga0157376_10002171
2254	Ga0157376_10016007
2255	Ga0157376_10098229
2256	Ga0157376_10151948
2257	Ga0157376_10285856
2258	Ga0157376_10374167
2259	Ga0157376_10420659
2260	Ga0157376_10451251
2261	Ga0157376_10556812
2262	Ga0157376_10803234
2263	Ga0182007_10035004
2264	Ga0182005_1095988
2265	Ga0163161_10041756
2266	Ga0163161_10073964
2267	Ga0163161_10118524
2268	Ga0163161_10153661
2269	Ga0206354_11363812
2270	Ga0213872_10004955
2271	Ga0213872_10026335
2272	Ga0213875_10000114
2273	Ga0213875_10008122
2274	Ga0213875_10255900
2275	Ga0209435_100001
2276	Ga0209436_113645
2277	Ga0209258_110482
2278	Ga0207425_1002625
2279	Ga0207425_1008135
2280	Ga0207425_1008784
2281	Ga0209646_1000001
2282	Ga0209026_1000003
2283	Ga0209759_1000001
2284	Ga0209129_1000041
2285	Ga0209129_1003651
2286	Ga0209129_1018536
2287	Ga0209565_1000124
2288	Ga0209565_1000498
2289	Ga0209565_1009374
2290	Ga0209565_1024593
2291	Ga0209673_1000043
2292	Ga0209673_1001809
2293	Ga0209673_1007730
2294	Ga0209673_1010237
2295	Ga0209673_1010311
2296	Ga0209673_1044280
2297	Ga0209673_1049602
2298	Ga0209130_1000442
2299	Ga0209130_1000620
2300	Ga0209130_1001702
2301	Ga0209130_1055162
2302	Ga0209675_1000309
2303	Ga0209675_1008560
2304	Ga0209675_1031186
2305	Ga0209675_1064089
2306	Ga0209676_1000007
2307	Ga0209676_1005708
2308	Ga0209025_1002427
2309	Ga0209025_1004916
2310	Ga0209025_1024249
2311	Ga0209025_1025283
2312	Ga0209025_1095108
2313	Ga0209564_1000003
2314	Ga0209564_1000029
2315	Ga0209564_1000268
2316	Ga0209564_1000476
2317	Ga0209564_1003314
2318	Ga0209758_1000043
2319	Ga0209758_1000167
2320	Ga0209758_1043883
2321	Ga0209758_1045258
2322	Ga0209758_1061488
2323	Ga0209050_1000003
2324	Ga0209050_1000467
2325	Ga0209050_1000808
2326	Ga0209050_1001494
2327	Ga0209050_1003886
2328	Ga0209050_1004391
2329	Ga0209050_1016100
2330	Ga0209050_1021541
2331	Ga0209050_1096249
2332	Ga0209256_1000001
2333	Ga0209256_1000011
2334	Ga0209256_1000398
2335	Ga0209256_1002559
2336	Ga0209256_1017854
2337	Ga0209256_1021626
2338	Ga0209256_1043431
2339	Ga0207426_1000247
2340	Ga0207426_1009688
2341	Ga0207426_1046867
2342	Ga0207426_1067929
2343	Ga0209051_1000003
2344	Ga0209051_1000210
2345	Ga0209051_1000320
2346	Ga0209051_1001335
2347	Ga0209051_1007045
2348	Ga0209051_1012479
2349	Ga0209051_1017118
2350	Ga0209257_1000017
2351	Ga0209257_1000020
2352	Ga0209257_1000161
2353	Ga0209257_1000314
2354	Ga0209257_1000799
2355	Ga0209257_1005062
2356	Ga0209257_1005554
2357	Ga0209257_1016941
2358	Ga0207656_10005941
2359	Ga0207655_1005008
2360	Ga0207655_1005064
2361	Ga0207655_1083830
2362	Ga0207655_1105079
2363	Ga0207655_1107523
2364	Ga0207713_1069190
2365	Ga0207713_1116723
2366	Ga0207713_1124951
2367	Ga0207653_10200309
2368	Ga0207682_10001767
2369	Ga0207682_10001984
2370	Ga0207682_10009729
2371	Ga0207682_10013197
2372	Ga0207692_10105491
2373	Ga0207642_10006842
2374	Ga0207642_10080122
2375	Ga0207642_10115095
2376	Ga0207642_10218813
2377	Ga0207680_10003848
2378	Ga0207680_10024370
2379	Ga0207680_10025961
2380	Ga0207699_10030917
2381	Ga0207645_10012039
2382	Ga0207645_10032364
2383	Ga0207645_10727408
2384	Ga0207643_10003782
2385	Ga0207643_10028009
2386	Ga0207643_10058785
2387	Ga0207643_10303128
2388	Ga0207705_10106972
2389	Ga0207705_10339781
2390	Ga0207705_10551886
2391	Ga0207684_10000743
2392	Ga0207684_10726554
2393	Ga0207654_10044947
2394	Ga0207707_10002563
2395	Ga0207707_10078608
2396	Ga0207707_10176459
2397	Ga0207707_10529490
2398	Ga0207707_10772269
2399	Ga0207695_10025991
2400	Ga0207695_10043173
2401	Ga0207695_10065868
2402	Ga0207695_10354968
2403	Ga0207671_10006034
2404	Ga0207671_10040022
2405	Ga0207671_10118785
2406	Ga0207671_10788372
2407	Ga0207693_10061984
2408	Ga0207693_10448950
2409	Ga0207693_10461586
2410	Ga0207663_10421691
2411	Ga0207660_10033235
2412	Ga0207660_10095087
2413	Ga0207660_10331851
2414	Ga0207662_10142406
2415	Ga0207662_10647713
2416	Ga0207657_10034309
2417	Ga0207657_10062069
2418	Ga0207657_10094700
2419	Ga0207657_10358752
2420	Ga0207649_10001323
2421	Ga0207649_10122954
2422	Ga0207649_10186377
2423	Ga0207649_10789743
2424	Ga0207652_10156540
2425	Ga0207652_10334427
2426	Ga0207646_10022087
2427	Ga0207646_10731365
2428	Ga0207681_10000819
2429	Ga0207681_10014662
2430	Ga0207681_10032915
2431	Ga0207681_10224280
2432	Ga0207681_10753890
2433	Ga0207681_10795349
2434	Ga0207681_11504552
2435	Ga0207694_10028662
2436	Ga0207694_10059195
2437	Ga0207694_10090675
2438	Ga0207694_10183514
2439	Ga0207694_10997260
2440	Ga0207650_10001268
2441	Ga0207650_10005261
2442	Ga0207650_10040024
2443	Ga0207650_10064135
2444	Ga0207650_10182010
2445	Ga0207650_10500826
2446	Ga0207650_11165107
2447	Ga0207659_10001423
2448	Ga0207659_10003128
2449	Ga0207659_10038727
2450	Ga0207659_10082489
2451	Ga0207659_10507491
2452	Ga0207659_10827396
2453	Ga0207659_11065387
2454	Ga0207687_10111231
2455	Ga0207687_10524916
2456	Ga0207700_10001011
2457	Ga0207700_10147485
2458	Ga0207700_10387519
2459	Ga0207664_10489841
2460	Ga0207664_11067131
2461	Ga0207644_10004489
2462	Ga0207644_10004958
2463	Ga0207644_10022737
2464	Ga0207644_10052099
2465	Ga0207644_10075325
2466	Ga0207644_10077977
2467	Ga0207644_10096958
2468	Ga0207644_10435136
2469	Ga0207644_11029242
2470	Ga0207690_10004800
2471	Ga0207690_10187909
2472	Ga0207690_10464084
2473	Ga0207706_10002276
2474	Ga0207706_10026649
2475	Ga0207706_10027008
2476	Ga0207706_10032086
2477	Ga0207706_10039929
2478	Ga0207706_10164864
2479	Ga0207706_10822153
2480	Ga0207706_10871904
2481	Ga0207686_10173253
2482	Ga0207686_10246698
2483	Ga0207686_10302986
2484	Ga0207686_10390103
2485	Ga0207709_10001678
2486	Ga0207709_10010988
2487	Ga0207709_10079035
2488	Ga0207709_10874614
2489	Ga0207670_10099553
2490	Ga0207670_10307801
2491	Ga0207669_10003846
2492	Ga0207669_10010270
2493	Ga0207669_10012607
2494	Ga0207669_10085268
2495	Ga0207669_10235698
2496	Ga0207669_10239937
2497	Ga0207669_10615124
2498	Ga0207704_10006026
2499	Ga0207704_10014210
2500	Ga0207704_10017503
2501	Ga0207704_10681021
2502	Ga0207704_11373056
2503	Ga0207691_10001131
2504	Ga0207691_10001663
2505	Ga0207691_10012709
2506	Ga0207691_10022785
2507	Ga0207691_10023069
2508	Ga0207691_10033026
2509	Ga0207691_10035543
2510	Ga0207691_10059029
2511	Ga0207691_10222012
2512	Ga0207691_10419274
2513	Ga0207691_10513620
2514	Ga0207691_10632706
2515	Ga0207691_10717664
2516	Ga0207711_10003690
2517	Ga0207711_10036823
2518	Ga0207711_10049870
2519	Ga0207711_10131852
2520	Ga0207711_10154234
2521	Ga0207689_10006291
2522	Ga0207689_10026446
2523	Ga0207689_10164403
2524	Ga0207689_10479955
2525	Ga0207689_10481973
2526	Ga0207689_10935714
2527	Ga0207661_10034192
2528	Ga0207661_11098916
2529	Ga0207679_10000201
2530	Ga0207679_10156225
2531	Ga0207679_10205136
2532	Ga0207679_11014935
2533	Ga0207679_11330367
2534	Ga0207667_10002059
2535	Ga0207667_10751256
2536	Ga0207667_11647900
2537	Ga0207651_10000562
2538	Ga0207651_10007162
2539	Ga0207651_10066265
2540	Ga0207651_10239047
2541	Ga0207651_10271290
2542	Ga0207651_10613907
2543	Ga0207651_10897019
2544	Ga0207712_10014803
2545	Ga0207712_10142390
2546	Ga0207712_10188629
2547	Ga0207712_10284826
2548	Ga0207712_10793933
2549	Ga0207668_10001789
2550	Ga0207668_10002933
2551	Ga0207668_10158500
2552	Ga0207640_10055882
2553	Ga0207640_10518385
2554	Ga0207640_11196877
2555	Ga0207640_11383352
2556	Ga0207658_10000336
2557	Ga0207658_10002766
2558	Ga0207658_10009362
2559	Ga0207658_10051764
2560	Ga0207658_10174954
2561	Ga0207658_10252584
2562	Ga0207658_10492893
2563	Ga0207658_10670323
2564	Ga0207677_10376693
2565	Ga0207677_10654372
2566	Ga0207677_10948795
2567	Ga0207677_11042000
2568	Ga0207703_10000277
2569	Ga0207703_10000866
2570	Ga0207703_10031615
2571	Ga0207703_10042191
2572	Ga0207703_10983484
2573	Ga0207639_10013995
2574	Ga0207639_10046007
2575	Ga0207639_10051308
2576	Ga0207639_10213011
2577	Ga0207639_10623822
2578	Ga0207678_10007848
2579	Ga0207678_10009214
2580	Ga0207678_10253384
2581	Ga0207678_10492475
2582	Ga0207678_10516914
2583	Ga0207678_10563073
2584	Ga0207678_11487702
2585	Ga0207708_10104075
2586	Ga0207708_10990513
2587	Ga0207702_10117957
2588	Ga0207702_10230662
2589	Ga0207702_10871672
2590	Ga0207641_10001090
2591	Ga0207641_10002663
2592	Ga0207641_10007781
2593	Ga0207641_10049730
2594	Ga0207641_10269052
2595	Ga0207641_10576301
2596	Ga0207648_10000193
2597	Ga0207648_10000512
2598	Ga0207648_10015267
2599	Ga0207648_10026488
2600	Ga0207648_10080813
2601	Ga0207648_10083200
2602	Ga0207648_10147787
2603	Ga0207648_10193541
2604	Ga0207648_10234269
2605	Ga0207648_10238932
2606	Ga0207648_10428686
2607	Ga0207648_10857208
2608	Ga0207676_10001342
2609	Ga0207676_10017194
2610	Ga0207676_10028849
2611	Ga0207676_10040743
2612	Ga0207676_10089162
2613	Ga0207676_10165480
2614	Ga0207676_10203090
2615	Ga0207676_10318130
2616	Ga0207676_10557604
2617	Ga0207674_10038832
2618	Ga0207674_10047553
2619	Ga0207674_10117981
2620	Ga0207674_10411923
2621	Ga0207675_100004491
2622	Ga0207675_100007449
2623	Ga0207675_100024043
2624	Ga0207675_100109797
2625	Ga0207675_100789046
2626	Ga0207683_10003565
2627	Ga0207683_10011473
2628	Ga0207683_10026198
2629	Ga0207683_10054273
2630	Ga0207683_10058630
2631	Ga0207683_10063497
2632	Ga0207683_10069534
2633	Ga0207683_10102073
2634	Ga0207683_10177091
2635	Ga0207683_10241812
2636	Ga0207683_10328446
2637	Ga0207683_10465256
2638	Ga0207698_10014969
2639	Ga0207698_10026945
2640	Ga0207698_10031774
2641	Ga0207698_10057062
2642	Ga0207698_10218218
2643	Ga0207698_10356318
2644	Ga0207698_10426945
2645	Ga0207698_11044887
2646	Ga0209281_1000084
2647	Ga0209281_1026166
2648	Ga0209389_1038266
2649	Ga0209974_10005575
2650	Ga0209974_10082990
2651	Ga0209974_10129742
2652	Ga0209974_10347476
2653	Ga0207428_10112389
2654	Ga0207428_10598606
2655	Ga0268266_10003010
2656	Ga0268266_10319051
2657	Ga0268266_10422883
2658	Ga0268266_11609399
2659	Ga0268265_10054074
2660	Ga0268265_10096117
2661	Ga0268265_10232084
2662	Ga0268265_10970838
2663	Ga0268265_11083685
2664	Ga0268265_11084055
2665	Ga0268265_12360000
2666	Ga0268264_10003687
2667	Ga0268264_10064917
2668	Ga0268264_10371228
2669	Ga0268264_10610115
2670	Ga0265326_10027167
2671	Ga0265319_1169895
2672	Ga0265334_10025101
2673	Ga0265318_10000347
2674	Ga0307517_10137926
2675	Ga0307517_10149902
2676	Ga0307515_10000093
2677	Ga0307515_10001261
2678	Ga0307515_10001283
2679	Ga0307515_10002007
2680	Ga0307515_10004636
2681	Ga0307515_10009359
2682	Ga0307515_10020687
2683	Ga0307515_10026101
2684	Ga0307515_10033140
2685	Ga0307515_10097581
2686	Ga0307515_10601201
2687	Ga0265324_10056156
2688	Ga0268256_1046721
2689	Ga0307511_10023720
2690	Ga0265330_10001084
2691	Ga0265332_10000920
2692	Ga0265332_10032003
2693	Ga0265332_10037720
2694	Ga0265328_10000034
2695	Ga0265328_10007066
2696	Ga0265328_10047051
2697	Ga0265320_10000726
2698	Ga0265329_10002112
2699	Ga0265329_10009738
2700	Ga0265340_10053639
2701	Ga0265339_10140775
2702	Ga0265331_10000024
2703	Ga0265331_10001289
2704	Ga0265331_10170948
2705	Ga0265327_10000079
2706	Ga0265327_10001928
2707	Ga0265327_10003163
2708	Ga0265316_10000181
2709	Ga0265316_10003160
2710	Ga0265316_10276769
2711	Ga0307513_10000054
2712	Ga0307513_10006568
2713	Ga0307513_10018646
2714	Ga0307513_10042813
2715	Ga0307513_10044622
2716	Ga0307513_10044801
2717	Ga0307513_10402559
2718	Ga0307513_10539573
2719	Ga0307513_10693937
2720	Ga0307509_10095877
2721	Ga0307509_10459073
2722	Ga0307408_100000086
2723	Ga0307408_100022993
2724	Ga0307408_100046888
2725	Ga0307408_100067163
2726	Ga0307408_100160787
2727	Ga0307408_100187706
2728	Ga0307408_100378949
2729	Ga0307408_100803196
2730	Ga0307508_10003350
2731	Ga0307508_10192655
2732	Ga0307514_10000795
2733	Ga0307514_10001506
2734	Ga0307514_10019015
2735	Ga0316575_10011595
2736	Ga0316575_10021874
2737	Ga0316575_10229925
2738	Ga0316579_10101236
2739	Ga0265314_10002818
2740	Ga0265314_10030007
2741	Ga0265314_10038203
2742	Ga0265342_10013145
2743	Ga0265342_10161854
2744	Ga0265342_10179830
2745	Ga0316576_10056045
2746	Ga0316576_10056950
2747	Ga0316576_10062960
2748	Ga0316576_10133008
2749	Ga0316576_10349662
2750	Ga0316576_10369636
2751	Ga0316576_10737003
2752	Ga0316578_10035518
2753	Ga0316578_10043091
2754	Ga0316578_10309484
2755	Ga0307516_10000383
2756	Ga0307516_10004457
2757	Ga0307516_10011720
2758	Ga0307516_10017724
2759	Ga0307405_10005414
2760	Ga0307405_10461688
2761	Ga0316577_10028286
2762	Ga0316577_10092948
2763	Ga0307413_10020005
2764	Ga0307413_10445499
2765	Ga0307413_10735437
2766	Ga0307410_10023516
2767	Ga0307410_10270386
2768	Ga0307410_10656781
2769	Ga0307406_10025180
2770	Ga0307406_10086465
2771	Ga0307406_10244742
2772	Ga0307407_10034140
2773	Ga0307407_11071374
2774	Ga0307412_10113378
2775	Ga0307409_100009342
2776	Ga0307409_100399816
2777	Ga0307409_100539592
2778	Ga0307409_100950063
2779	Ga0307409_101072765
2780	Ga0307416_100003992
2781	Ga0307416_100909977
2782	Ga0307414_10148718
2783	Ga0307414_10812751
2784	Ga0307414_11196898
2785	Ga0307414_11417309
2786	Ga0307414_11708164
2787	Ga0307411_10001320
2788	Ga0307411_10005005
2789	Ga0307411_10228908
2790	Ga0307411_11399808
2791	Ga0307415_100006691
2792	Ga0307415_100339325
2793	Ga0307415_101042866
2794	Ga0316580_10012176
2795	Ga0307507_10157523
2796	Ga0307510_10113907
2797	Ga0373948_0002019
2798	Ga0373959_0051324
2799	Ga0373938_0101796
2800	Ga0373928_0096224
2801	Ga0373940_0019893
2802	Ga0373940_0298720
2803	Ga0373949_0112347
2804	Ga0373951_0047822
2805	Ga0373932_0187236
2806	Ga0373932_0226077
2807	Ga0373936_0108705
2808	Ga0373939_0000017
2809	Ga0373941_0085831
2810	Ga0373945_0451096
2811	Ga0373960_0000109
2812	Ga0373943_0130231
2813	Ga0373943_0287586
2814	Ga0373943_0414377
2815	Ga0373946_0073518
2816	Ga0373946_0227840
2817	Ga0373946_0283561
2818	Ga0373955_0006739
2819	Ga0373955_0311201
2820	Ga0373955_0360841
2821	Ga0373955_0727802
2822	Ga0373961_0195318
2823	Ga0316574_0002109
2824	Ga0316574_0004706
2825	Ga0316574_0006307
2826	Ga0316574_0106501
2827	Ga0316574_0167217
2828	Ga0316574_0280514
2829	Ga0316574_0783821
2830	Ga0373924_0166644
2831	Ga0373924_0194584
2832	Ga0373924_0245055
2833	Ga0373931_0000641
2834	Ga0373931_0014924
2835	Ga0373935_0302056
2836	Ga0373927_0286813
2837	Ga0373933_0018395
2838	Ga0373947_0215560
2839	Ga0373937_0005971
2840	Ga0373937_0052497
2841	Ga0373937_0075221
2842	Ga0373937_0150570
2843	Ga0373937_0224658
2844	Ga0373937_0293183
2845	Ga0373937_0901458
2846	Ga0316582_0001870
2847	Ga0316582_0034461
2848	Ga0316582_0134775
2849	Ga0316584_0027762
2850	Ga0316584_0050235
2851	Ga0316584_0127724
2852	Ga0316584_0194067
2853	Ga0373925_0100843
2854	Ga0373925_0231330
2855	Ga0373925_0521850
2856	Ga0373925_0801770
2857	Ga0373925_0954722
2858	Ga0373925_1242065
2859	Ga0395899_0000010
2860	Ga0395899_0018492
2861	Ga0395899_0235742
2862	Ga0395900_0000005
2863	Ga0395900_0008244
2864	Ga0395900_0010948
2865	Ga0395900_0105001
2866	Ga0395900_0128127
2867	Ga0395900_0139094
2868	Ga0395900_0181050
2869	Ga0395900_0229277
2870	Ga0395900_0404011
2871	Ga0395900_1492503
2872	Ga0395898_0013534
2873	Ga0395898_0018082
2874	Ga0395898_0109116
2875	Ga0395898_0418814
2876	Ga0395905_0000653
2877	Ga0395905_0000733
2878	Ga0395905_0000895
2879	Ga0395905_0003480
2880	Ga0395905_0018268
2881	Ga0395905_0073034
2882	Ga0395905_0102588
2883	Ga0395905_0123164
2884	Ga0395905_0203231
2885	Ga0395905_0303223
2886	Ga0395905_0355915
2887	Ga0436364_0528735
2888	Ga0436364_0667041
2889	Ga0436364_1043221
2890	Ga0395901_0051281
2891	Ga0395901_0052453
2892	Ga0395901_0065113
2893	Ga0395901_0081508
2894	Ga0395901_0136710
2895	Ga0395901_0175988
2896	Ga0395901_0277755
2897	Ga0395901_0529523
2898	Ga0400490_35404
2899	Ga0400488_10414
2900	Ga0400483_115564
2901	Ga0400483_167120
2902	Ga0400489_77120
2903	Ga0237816_00148
2904	Ga0436365_0308506
2905	Ga0436365_0805618
2906	Ga0436365_0960828
2907	Ga0436365_1149228
2908	Ga0436365_1378466
2909	Ga0436361_0932343
2910	Ga0436363_0998404
2911	Ga0439438_000268
2912	Ga0439461_0020382
2913	Ga0451787_664484
2914	Ga0451789_0205740
2915	Ga0451789_0668546
2916	Ga0451791_0533597
2917	Ga0451793_0259988
2918	Ga0451793_0300321
2919	Ga0451793_0779431
2920	Ga0451793_1098328
2921	Ga0451797_0814064
2922	Ga0451797_0960381
2923	Ga0451797_1287132
2924	Ga0451795_0037673
2925	Ga0451795_0302360
2926	Ga0451795_1093367
2927	Ga0451800_0531416
2928	Ga0451800_1143563
2929	Ga0451800_1336356
2930	Ga0451800_1347080
2931	Ga0451800_1453629
2932	Ga0451802_0737550
2933	Ga0451802_1791109
2934	Ga0451807_0109086
2935	Ga0451807_1015374
2936	Ga0451807_2127931
2937	Ga0451833_0875683
2938	Ga0451833_1495386
2939	Ga0451837_0954212
2940	Ga0451841_0278424
2941	Ga0451841_0659571
2942	Ga0451851_1274973
2943	Ga0451843_0108815
2944	Ga0451853_1190134
2945	Ga0451853_3865866
2946	Ga0451853_4036164
2947	Ga0439437_002898
2948	Ga0439442_050139
2949	Ga0439463_000609
2950	Ga0450911_020803
2951	Ga0450913_017850
2952	Ga0450917_002467
2953	Ga0450888_000480
2954	Ga0450890_000295
2955	Ga0450890_039658
2956	Ga0450892_001087
2957	Ga0450903_027492
2958	Ga0450904_014358
2959	Ga0450889_009573
2960	Ga0439446_0004039
2961	Ga0450893_0021574
2962	Ga0451577_0000013
2963	Ga0451577_0003554
2964	Ga0451577_0003789
2965	Ga0451577_0005413
2966	Ga0451577_0036543
2967	Ga0451577_0143508
2968	Ga0451577_0537562
2969	Ga0451577_1964921
2970	Ga0466969_0000036
2971	Ga0466969_0006230
2972	Ga0466969_0025156
2973	Ga0466969_0032912
2974	Ga0466969_0039565
2975	Ga0466972_0000282
2976	Ga0466972_0267270
2977	Ga0453683_0000059
2978	Ga0453683_0004047
2979	Ga0453683_1236468
2980	Ga0466965_0049757
2981	Ga0466965_0091575
2982	Ga0466965_0195039
2983	Ga0466965_0223023
2984	Ga0466965_0231324
2985	Ga0466966_0026011
2986	Ga0466966_0224184
2987	Ga0466961_0000406
2988	Ga0466961_0003921
2989	Ga0466961_0015938
2990	Ga0466961_0027523
2991	Ga0466961_0231567
2992	Ga0466963_0008785
2993	Ga0466963_0355516
2994	Ga0466963_1240527
2995	Ga0466964_0261218
2996	Ga0453684_0000040
2997	Ga0453684_0000085
2998	Ga0453684_0070718
2999	Ga0453684_1221549
3000	Ga0453684_1418603
3001	Ga0453684_1703371
3002	Ga0466971_0034131
3003	Ga0466970_0023540
3004	Ga0466970_0025771
3005	Ga0466970_0046693
3006	Ga0466970_0401824
3007	Ga0466957_0238191
3008	Ga0466959_0032407
3009	Ga0466959_0038662
3010	Ga0466959_0042728
3011	Ga0466959_0306609
3012	Ga0466959_0767138
3013	Ga0451576_0000018
3014	Ga0451576_0006036
3015	Ga0451576_0046314
3016	Ga0451576_0062742
3017	Ga0451576_0147519
3018	Ga0451576_0625897
3019	Ga0451576_1084978
3020	Ga0451576_1689404
3021	Ga0466967_1225235
3022	Ga0495617_171111
3023	Ga0495627_008265
3024	Ga0495592_0059971
3025	Ga0495590_0169163
3026	Ga0495591_002740
3027	Ga0495629_0016220
3028	Ga0495629_0107860
3029	Ga0495629_0252120
3030	Ga0495629_0480371
3031	Ga0495638_0060421
3032	Ga0495638_0088234
3033	Ga0495638_0115806
3034	Ga0495638_0550317
3035	Ga0495653_0019297
3036	Ga0495650_0008829
3037	Ga0495650_0059084
3038	Ga0495580_0100343
3039	Ga0495580_0206695
3040	Ga0495580_0210191
3041	Ga0495580_0234349
3042	Ga0495580_0365861
3043	Ga0495580_0383443
3044	Ga0495580_0468007
3045	Ga0495582_0014361
3046	Ga0495582_0117472
3047	Ga0495582_0355075
3048	Ga0495605_0000079
3049	Ga0495605_0010273
3050	Ga0495664_0023776
3051	Ga0495664_0098878
3052	Ga0495584_0053064
3053	Ga0495594_0002116
3054	Ga0495596_0116045
3055	Ga0495607_0005948
3056	Ga0495607_0024242
3057	Ga0495607_0027845
3058	Ga0495607_0187075
3059	Ga0495607_0191961
3060	Ga0495583_0006278
3061	Ga0495583_0138597
3062	Ga0495606_0000018
3063	Ga0495606_0001693
3064	Ga0495606_0004808
3065	Ga0495606_0012829
3066	Ga0495606_0086766
3067	Ga0495608_0532451
3068	Ga0495610_0039322
3069	Ga0495610_0063754
3070	Ga0495610_0112226
3071	Ga0495610_0151459
3072	Ga0495610_0237895
3073	Ga0495618_0690362
3074	Ga0495620_0013339
3075	Ga0495620_0048024
3076	Ga0495620_0092085
3077	Ga0495620_0300239
3078	Ga0495628_0245793
3079	Ga0495631_0048144
3080	Ga0495632_0004573
3081	Ga0495632_0005877
3082	Ga0495632_0019284
3083	Ga0495632_0055251
3084	Ga0495632_0067376
3085	Ga0495632_0146319
3086	Ga0495643_0004561
3087	Ga0495643_0277504
3088	Ga0495644_0040888
3089	Ga0495644_0187454
3090	Ga0495642_0010968
3091	Ga0495642_0126278
3092	Ga0495652_0474867
3093	Ga0495654_0091204
3094	Ga0495640_0152833
3095	Ga0495586_0199579
3096	Ga0495598_0126453
3097	Ga0495598_0273086
3098	Ga0495598_0363899
3099	Ga0495609_0124522
3100	Ga0495621_0064902
3101	Ga0495597_0092634
3102	Ga0495597_0278207
3103	Ga0495645_0074164
3104	Ga0495645_0245104
3105	Ga0495622_0027086
3106	Ga0495656_0124763
3107	Ga0495668_0026531
3108	Ga0495668_0273037
3109	Ga0495668_0291160
3110	Ga0495668_0603867
3111	Ga0495611_0001249
3112	Ga0495611_0063900
3113	Ga0495611_0088526
3114	Ga0495611_0270890
3115	Ga0495625_0010777
3116	Ga0495625_0128312
3117	Ga0495625_0180493
3118	Ga0495625_0609068
3119	Ga0495635_0074733
3120	Ga0495635_0115894
3121	Ga0495659_0338654
3122	Ga0495661_0025068
3123	Ga0495661_0226445
3124	Ga0495657_0082973
3125	Ga0495599_0161085
3126	Ga0495646_0073389
3127	Ga0495647_0021435
3128	Ga0495647_0021548
3129	Ga0495658_0018582
3130	Ga0495658_0032930
3131	Ga0495658_0254946
3132	Ga0495658_0263091
3133	Ga0495669_0015535
3134	Ga0495613_0339900
3135	Ga0495613_0420755
3136	Ga0495670_0007900
3137	Ga0495671_0020895
3138	Ga0495671_0053956
3139	Ga0495671_0397257
3140	Ga0495649_0003794
3141	Ga0495649_0222559
3142	Ga0495589_0017714
3143	Ga0495589_0272469
3144	Ga0495600_0286469
3145	Ga0495660_0025217
3146	Ga0495660_0394460
3147	Ga0495604_0192249
3148	Ga0495636_0060240
3149	Ga0495674_0111820
3150	Ga0495672_0009983
3151	Ga0495680_0255245
3152	Ga0495687_000912
3153	Ga0495687_011633
3154	Ga0495677_0019763
3155	Ga0495679_066707
3156	Ga0495673_0010730
3157	Ga0495673_0021951
3158	Ga0495681_0145242
3159	Ga0495684_0163503
3160	Ga0495686_0337769
3161	Ga0495686_0549571
3162	Ga0495614_0242387
3163	Ga0495626_0111959
3164	Ga0495626_0124367
3165	Ga0496100_0832195
3166	Ga0496101_0024961
3167	Ga0496101_0297444
3168	Ga0496101_0364831
3169	Ga0496102_0021149
3170	Ga0496102_0039318
3171	Ga0496102_0079561
3172	Ga0496102_0136772
3173	Ga0496102_0439587
3174	Ga0496102_1093602
3175	Ga0496104_0013206
3176	Ga0496104_0085647
3177	Ga0496104_0124767
3178	Ga0496105_0745533
3179	Ga0496106_0057379
3180	Ga0496106_0084887
3181	Ga0496106_0185495
3182	Ga0496106_0299452
3183	Ga0496107_0088189
3184	Ga0496108_0543160
3185	Ga0496108_1625881
3186	Ga0496108_1737401
3187	Ga0496109_0125768
3188	Ga0496109_0520052
3189	Ga0496109_0592397
3190	Ga0496109_0940342
3191	Ga0496110_0069135
3192	Ga0496110_0132413
3193	Ga0496110_0218016
3194	Ga0496110_0262072
3195	Ga0496110_0546433
3196	Ga0496110_1333805
3197	Ga0496112_0005059
3198	Ga0496113_0007024
3199	Ga0496114_0001047
3200	Ga0496114_0008159
3201	Ga0496114_0028612
3202	Ga0496114_0061024
3203	Ga0496114_0352539
3204	Ga0496115_0204471
3205	Ga0496115_0375720
3206	Ga0496116_0020148
3207	Ga0496117_0056774
3208	Ga0496118_0142551
3209	Ga0496119_0000834
3210	Ga0496120_0000718
3211	Ga0496121_0026934
3212	Ga0496122_0000592
3213	Ga0496122_0016985
3214	Ga0496123_0000656
3215	Ga0496123_0030819
3216	Ga0496124_0003362
3217	Ga0496124_0010223
3218	Ga0496124_0022120
3219	Ga0496124_0078596
3220	Ga0496124_0079168
3221	Ga0496124_0091501
3222	Ga0496124_0437474
3223	Ga0496125_0022697
3224	Ga0496125_0062565
3225	Ga0496125_0137894
3226	Ga0496126_0011307
3227	Ga0496126_0047047
3228	Ga0496126_0293202
3229	Ga0501309_010432
3230	Ga0495678_023711
3231	Ga0495678_036235
3232	Ga0495678_119543
3233	Ga0495682_0002074
3234	Ga0495682_0340000
3235	Ga0501299_012430
3236	Ga0501299_040320
3237	Ga0501314_003354
3238	Ga0501031_0001649
3239	Ga0501031_1003052
3240	Ga0501032_0125464
3241	Ga0501032_0142264
3242	Ga0501032_0750232
3243	Ga0501033_0082237
3244	Ga0501034_0130008
3245	Ga0501034_0172250
3246	Ga0501034_0199961
3247	Ga0501034_0364902
3248	Ga0501036_0245252
3249	Ga0501036_0640592
3250	Ga0501036_0820355
3251	Ga0501037_0013659
3252	Ga0501038_0120063
3253	Ga0501038_0348001
3254	Ga0501038_0891020
3255	Ga0501039_0032761
3256	Ga0501039_0052269
3257	Ga0501039_0188149
3258	Ga0501040_0103737
3259	Ga0501040_0165251
3260	Ga0501040_0675638
3261	Ga0501040_0735400
3262	Ga0501042_1075571
3263	Ga0501043_0000004
3264	Ga0501043_0088959
3265	Ga0501046_0000016
3266	Ga0501046_0201970
3267	Ga0501046_0218551
3268	Ga0501047_0000012
3269	Ga0501047_0002537
3270	Ga0501047_0122948
3271	Ga0501047_0287570
3272	Ga0501047_0293404
3273	Ga0501047_0335198
3274	Ga0501047_0335504
3275	Ga0501047_0625024
3276	Ga0501047_1051994
3277	Ga0501048_0010438
3278	Ga0501068_0275027
3279	Ga0501069_0011816
3280	Ga0501070_0013166
3281	Ga0501070_0050947
3282	Ga0501070_0734822
3283	Ga0501071_0008835
3284	Ga0501071_0410886
3285	Ga0501073_0025636
3286	Ga0501074_0002091
3287	Ga0501076_0373427
3288	Ga0501199_005273
3289	Ga0501202_013977
3290	Ga0501211_000722
3291	Ga0501222_001247
3292	Ga0501249_087284
3293	Ga0501253_028874
3294	Ga0501080_0033654
3295	Ga0501080_0047008
3296	Ga0501080_0175561
3297	Ga0501080_0527557
3298	Ga0501080_1094767
3299	Ga0501081_0217634
3300	Ga0501083_0014526
3301	Ga0501264_006472
3302	Ga0501266_008842
3303	Ga0501267_006197
3304	Ga0501272_005513
3305	Ga0501278_010212
3306	Ga0501279_003394
3307	Ga0501035_0016682
3308	Ga0501035_0068118
3309	Ga0501035_0103549
3310	Ga0501044_0007417
3311	Ga0501044_0064676
3312	Ga0501044_0139113
3313	Ga0501044_0191635
3314	Ga0501044_0247169
3315	Ga0501045_0009097
3316	Ga0501045_0434923
3317	Ga0501226_004955
3318	Ga0501226_006472
3319	nmdc:mga03683_102014_c1
3320	nmdc:mga03683_115789_c1
3321	nmdc:mga03683_307019_c1
3322	nmdc:mga03683_313614_c1
3323	nmdc:mga03683_54553_c1
3324	nmdc:mga03n38_41237_c1
3325	nmdc:mga03n38_827733_c1
3326	nmdc:mga00v17_127984_c1
3327	nmdc:mga00v17_143688_c1
3328	nmdc:mga00v17_186953_c1
3329	nmdc:mga00v17_828904_c1
3330	nmdc:mga0yw44_30213_c1
3331	nmdc:mga0yw44_459892_c1
3332	nmdc:mga0k408_109179_c1
3333	nmdc:mga0k408_11211_c1
3334	nmdc:mga0k408_114833_c1
3335	nmdc:mga0k408_136285_c1
3336	nmdc:mga0k408_14639_c1
3337	nmdc:mga0k408_152829_c1
3338	nmdc:mga0k408_15620_c1
3339	nmdc:mga0k408_263616_c1
3340	nmdc:mga0k408_2673_c1
3341	nmdc:mga0k408_47503_c1
3342	nmdc:mga0k408_60046_c1
3343	nmdc:mga0k408_607146_c1
3344	nmdc:mga0k408_63531_c1
3345	nmdc:mga0k408_92973_c1
3346	nmdc:mga0k408_96201_c1
3347	nmdc:mga06z11_23782_c1
3348	nmdc:mga06z11_27127_c1
3349	nmdc:mga06z11_51754_c1
3350	nmdc:mga06z11_551408_c1
3351	nmdc:mga06z11_65667_c1
3352	nmdc:mga07m45_1019_c1
3353	nmdc:mga07m45_103975_c1
3354	nmdc:mga07m45_1241_c1
3355	nmdc:mga07m45_144604_c1
3356	nmdc:mga07m45_215893_c1
3357	nmdc:mga07m45_22037_c1
3358	nmdc:mga07m45_4444_c1
3359	nmdc:mga07m45_46325_c1
3360	nmdc:mga07m45_650_c1
3361	nmdc:mga07m45_687772_c1
3362	nmdc:mga05p37_1697299_c1
3363	nmdc:mga05p37_566117_c1
3364	nmdc:mga09592_349395_c1
3365	nmdc:mga09592_522300_c1
3366	nmdc:mga0qj67_453007_c1
3367	nmdc:mga0qj67_639730_c1
3368	nmdc:mga06r32_352_c1
3369	nmdc:mga06r32_77840_c1
3370	nmdc:mga08y16_304961_c1
3371	nmdc:mga08y16_465913_c1
3372	nmdc:mga08y16_674920_c1
3373	nmdc:mga0sz30_45120_c1
3374	Ga0495601_0057819
3375	Ga0495601_0448656
3376	Ga0495612_0038847
3377	Ga0495612_0040355
3378	Ga0495619_0119836
3379	Ga0495619_0734208
3380	Ga0500578_0000049
3381	Ga0500644_0032189
3382	Ga0500644_0099111
3383	Ga0500646_0003195
3384	Ga0500647_0132189
3385	Ga0500583_0389368
3386	Ga0500583_0532016
3387	Ga0500651_0097062
3388	Ga0500651_0114859
3389	Ga0500651_0406196
3390	Ga0500650_0057076
3391	Ga0500650_0183909
3392	Ga0500660_124303
3393	Ga0500555_089260
3394	Ga0500562_007913
3395	Ga0500569_105324
3396	Ga0500591_075673
3397	Ga0500593_000729
3398	Ga0500593_030750
3399	Ga0500594_0054739
3400	Ga0500594_0058307
3401	Ga0500628_000439
3402	Ga0500642_0006244
3403	Ga0500652_000044
3404	Ga0500652_023494
3405	Ga0500655_029979
3406	Ga0500658_0002543
3407	Ga0500658_0015441
3408	Ga0500658_0074183
3409	Ga0500658_0128090
3410	Ga0500559_0006184
3411	Ga0500559_0327048
3412	Ga0500561_0058022
3413	Ga0500568_0001263
3414	Ga0500568_0016548
3415	Ga0500568_0027522
3416	Ga0500568_0038336
3417	Ga0500577_0003546
3418	Ga0500577_0347215
3419	Ga0500588_0033202
3420	Ga0500604_0012951
3421	Ga0500604_0112477
3422	Ga0500619_000120
3423	Ga0500622_0000002
3424	Ga0500622_0000128
3425	Ga0500622_0001173
3426	Ga0500622_0001549
3427	Ga0500622_0007550
3428	Ga0500622_0071964
3429	Ga0500622_0170851
3430	Ga0500645_000413
3431	Ga0500645_014269
3432	Ga0500565_014417
3433	Ga0500587_005732
3434	Ga0500587_011776
3435	Ga0501084_0054143
3436	Ga0590071_001980
3437	Ga0501082_0821023
3438	2599971989
3439	2644363260
3440	2765586689
3441	2855021425
3442	2861695613
3443	2919156000
3444	2928516354
3445	2952254092
3446	3003670766
3447	8056163744

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00692

dUTPase

15

158

0.88 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
4lhr-assembly1.cif.gz_A	crystal structure of a deoxyuridine 5'-triphosphate nucleotidohydrolase from burkholderia thailandensis	0.9693	2	135
4lhr-assembly1.cif.gz_A	crystal structure of a deoxyuridine 5'-triphosphate nucleotidohydrolase from burkholderia thailandensis	0.9623	2	135
1dup-assembly1.cif.gz_A	deoxyuridine 5'-triphosphate nucleotido hydrolase (d-utpase)	0.9611	2	135
1rnj-assembly1.cif.gz_A	crystal structure of inactive mutant dutpase complexed with substrate analogue imido-dutp	0.9586	2	135
6mai-assembly1.cif.gz_A	crystal structure of deoxyuridine 5'-triphosphate nucleotidohydrolase from legionella pneumophila philadelphia 1	0.9553	3	137

ID	Description	Score	Start	End	Superfamily
3tqzA00	Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase)	0.9468	3	137	2.70.40.10
1snfC00	Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase)	0.9402	3	135	2.70.40.10
3tqzA00	Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase)	0.9334	3	137	2.70.40.10
1snfC00	Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase)	0.9332	3	135	2.70.40.10
3mbqA00	Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase)	0.9118	3	136	2.70.40.10

ID	Description	Score	Start	End	GO Terms
AF-A0A259EVG0-F1-model_v4	dUTP diphosphatase (EC 3.6.1.23)	0.9941	5	118	GO:0000287 GO:0004170 GO:0006226 GO:0046081
AF-A0A534E2N6-F1-model_v4	deleted	0.9899	19	118
AF-A0A661CKF5-F1-model_v4	dUTP diphosphatase (EC 3.6.1.23)	0.9846	3	126	GO:0000287 GO:0004170 GO:0006226 GO:0046081
AF-A0A356SLM4-F1-model_v4	deleted	0.9808	2	135
AF-A0A447QL67-F1-model_v4	dUTP diphosphatase (EC 3.6.1.23)	0.9788	2	122	GO:0000287 GO:0004170 GO:0006226 GO:0046081

F495478

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00692

dUTPase

dUTPase

15

158

0.88

Structural Annotation

Top 5 Hits

Map