F495478
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1723 | 592 | 3447 | 152 |
Family's Representative Sequence
| Representative Sequence | 3300005458|Ga0070681_10898991|Ga0070681_108989912 |
| Length | 187 |
| Sequence | MTVRIELKVLDPRLAGWGFPHYGSELAAGLDLHACIDEPLLLRPQAPAVLISSGIAVRIGDPGWCALVLPRSGLGHREGLVLGNAVGLIDADYEGPCLVSAWNRNPASANRTDEGILIRPGDRIAQLVVTSVARPAFTVVAEFSARGGRQAGGFGSTGTAAADANACSDPAAGRHYPEREDPAARKP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 4 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 5 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 6 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 7 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 8 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 9 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 10 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 11 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 12 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 13 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 14 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 15 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 16 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 17 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 18 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 19 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 20 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 21 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 22 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 23 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 24 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 25 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 26 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 27 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 28 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 29 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 36 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 39 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 41 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 51 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 65 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 66 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 71 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 72 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 73 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 75 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 80 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 82 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 83 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 84 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 86 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 87 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 88 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 89 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 90 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 91 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 92 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 93 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 94 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 95 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 96 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 97 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 98 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 99 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 100 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 101 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 102 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 103 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 104 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 105 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 106 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 107 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 108 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 109 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 110 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 112 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 113 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 114 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 115 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 116 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 117 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 118 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 120 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 121 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 122 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300012475 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 | Metagenome | Rhizosphere |
| 140 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 141 | 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Metagenome | Rhizosphere |
| 142 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 143 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 155 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 159 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 160 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 162 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 163 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 164 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 165 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 168 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 169 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 170 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 171 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 172 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 173 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 174 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 176 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 177 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 178 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 179 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 180 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 182 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 183 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 184 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 185 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 250 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 251 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 253 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 257 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 258 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 259 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 260 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 261 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 262 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 263 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 264 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 265 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 266 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 267 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 268 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 269 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 270 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 271 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 272 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 273 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 274 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 275 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 276 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 277 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 278 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 279 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 280 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 281 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 282 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 283 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 284 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 285 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 286 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 287 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 288 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 289 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 290 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 291 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 292 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 293 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 294 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 295 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 296 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 297 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 298 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 299 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 300 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 301 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 302 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 303 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 304 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 305 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 306 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 307 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 308 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 309 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 310 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 311 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 312 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 313 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 314 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 315 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 316 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 317 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 318 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 319 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 320 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 321 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 322 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 323 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 324 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 325 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 326 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 327 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 328 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 329 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 330 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 331 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 332 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 333 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 334 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 335 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 336 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 337 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 338 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 339 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 340 | 3300039145 | Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 | Metagenome | Unclassified |
| 341 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 342 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 343 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 344 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 345 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 346 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 347 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 348 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 349 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 350 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 351 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 352 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 353 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 354 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 355 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 356 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 357 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 358 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 359 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 360 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 361 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 362 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 363 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 364 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 365 | 3300042117 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 | Metagenome | Rhizosphere |
| 366 | 3300042120 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 | Metagenome | Rhizosphere |
| 367 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 368 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 369 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 370 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 371 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 372 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 373 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 374 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 375 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 376 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 377 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 378 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 379 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 380 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 381 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 382 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 383 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 384 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 385 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 386 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 387 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 388 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 389 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 390 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 391 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 455 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 456 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 458 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 459 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 462 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 464 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 465 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 466 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 467 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 468 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 469 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 470 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 471 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 472 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 473 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 474 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 475 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 476 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 477 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 478 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 479 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 480 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 481 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 482 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 483 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 484 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 485 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 486 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 487 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 488 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 489 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 490 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 491 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 492 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 493 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 494 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 495 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 496 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 497 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 498 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 499 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 500 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 501 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 502 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 503 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 504 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 505 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 506 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 507 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 508 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 509 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 510 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 511 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 512 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 513 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 514 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 515 | 3300049650 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought | Metagenome | Rhizosphere |
| 516 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 517 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 518 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 519 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 520 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 521 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 522 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 523 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 524 | 3300049761 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control | Metagenome | Rhizosphere |
| 525 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 526 | 3300049764 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control | Metagenome | Rhizosphere |
| 527 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 528 | 3300049774 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought | Metagenome | Rhizosphere |
| 529 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 530 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 531 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 532 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 533 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 534 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 535 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 536 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 537 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 538 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 539 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 540 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 541 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 542 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 543 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 544 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 545 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 546 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 547 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 548 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 549 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 550 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 551 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 552 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 553 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 554 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 555 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 556 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 557 | 3300053100 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere | Metagenome | Endosphere |
| 558 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 559 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 560 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 561 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 562 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 563 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 564 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 565 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 566 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 567 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 568 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 569 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 570 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 571 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 572 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 573 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 574 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 575 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 576 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 577 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 578 | 3300053734 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere | Metagenome | Endosphere |
| 579 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 580 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 581 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 582 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 583 | 2599185307 | Pseudomonas sp. NFACC02 | Isolate | Rhizoplane |
| 584 | 2643221665 | Acinetobacter sp. Root1280 | Isolate | Unclassified |
| 585 | 2765235841 | Pseudomonas putida AA7 | Isolate | Unclassified |
| 586 | 2855020534 | Paracoccus endophyticus SYSUP0003 | Isolate | Stem Tuber |
| 587 | 2861691609 | Methylorubrum thiocyanatum DSM 11490 | Isolate | Rhizosphere |
| 588 | 2919155634 | Pseudomonas fulva 1992 | Isolate | Unclassified |
| 589 | 2928515477 | Acinetobacter bereziniae 1375 | Isolate | Rhizosphere |
| 590 | 2952252522 | Salinicola sp. DM10 | Isolate | Unclassified |
| 591 | 3003665799 | Methylobacterium aquaticum BG2 | Isolate | Unclassified |
| 592 | 8056161164 | Pseudomonas azadiae SWRI103 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.25 |
| Metatranscriptomes | 0.17 |
| Isolates | 0.58 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 15.21 |
| Nodule | 0.41 |
| Rhizoplane | 3.83 |
| Rhizosphere | 74.41 |
| Stem | 0 |
| Stem Tuber | 0.06 |
| Unclassified | 0.23 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070681_10898991 | 3300005458 | Bacteria | 804 |
| 2 | JGI24740J21852_10012529 | 3300001979 | Bacteria | 3194 |
| 3 | JGI25155J39150_1000079 | 3300002704 | Bacteria | 56287 |
| 4 | JGI25156J39149_1000125 | 3300002705 | Bacteria | 56308 |
| 5 | JGI25154J39366_1000141 | 3300002738 | Bacteria | 56305 |
| 6 | JGI25157J39369_1000159 | 3300002741 | Bacteria | 56308 |
| 7 | JGI25150J39212_1006333 | 3300002774 | Bacteria | 2452 |
| 8 | JGI25150J39212_1007862 | 3300002774 | Bacteria | 2120 |
| 9 | JGI25159J45721_1000638 | 3300002987 | Bacteria | 15559 |
| 10 | JGI25159J45721_1002502 | 3300002987 | Bacteria | 6925 |
| 11 | JGI25151J46595_10019053 | 3300003187 | Bacteria | 2928 |
| 12 | JGI25406J46586_10000015 | 3300003203 | Bacteria | 91406 |
| 13 | JGI25153J46596_10002603 | 3300003215 | Bacteria | 10329 |
| 14 | JGI25153J46596_10002737 | 3300003215 | Bacteria | 10048 |
| 15 | rootL2_10048698 | 3300003322 | Bacteria | 6451 |
| 16 | rootH1_10008298 | 3300003316 | Bacteria | 7116 |
| 17 | rootH1_10008298 | 3300003323 | Bacteria | 13422 |
| 18 | rootH1_10032418 | 3300003323 | Bacteria | 4244 |
| 19 | rootH1_10219628 | 3300003323 | Bacteria | 1059 |
| 20 | rootH1_10235640 | 3300003323 | Bacteria | 3076 |
| 21 | JGI25160J50197_1000067 | 3300003354 | Bacteria | 113436 |
| 22 | JGI25161J50226_1000035 | 3300003374 | Bacteria | 133666 |
| 23 | Ga0055526_1000542 | 3300003771 | Bacteria | 29770 |
| 24 | Ga0055526_1007532 | 3300003771 | Bacteria | 5632 |
| 25 | Ga0055526_1007544 | 3300003771 | Bacteria | 5625 |
| 26 | Ga0055537_1001739 | 3300003773 | Bacteria | 8036 |
| 27 | Ga0055537_1024062 | 3300003773 | Bacteria | 861 |
| 28 | Ga0055524_1000006 | 3300003775 | Bacteria | 324702 |
| 29 | Ga0055524_1000079 | 3300003775 | Bacteria | 120203 |
| 30 | Ga0055524_1001129 | 3300003775 | Bacteria | 16068 |
| 31 | Ga0055536_1000447 | 3300003781 | Bacteria | 29029 |
| 32 | Ga0055534_1001178 | 3300003784 | Bacteria | 10992 |
| 33 | Ga0055534_1003541 | 3300003784 | Bacteria | 4874 |
| 34 | Ga0055528_1000374 | 3300003790 | Bacteria | 36367 |
| 35 | Ga0055530_10000346 | 3300003791 | Bacteria | 41934 |
| 36 | Ga0055530_10002750 | 3300003791 | Bacteria | 10882 |
| 37 | Ga0055530_10013673 | 3300003791 | Bacteria | 2755 |
| 38 | Ga0055530_10018865 | 3300003791 | Bacteria | 2110 |
| 39 | Ga0055540_1000005 | 3300003792 | Bacteria | 378126 |
| 40 | Ga0055540_1000086 | 3300003792 | Bacteria | 102576 |
| 41 | Ga0055540_1056259 | 3300003792 | Bacteria | 797 |
| 42 | Ga0055531_10000604 | 3300003794 | Bacteria | 31172 |
| 43 | Ga0055531_10000607 | 3300003794 | Bacteria | 31111 |
| 44 | Ga0055531_10002992 | 3300003794 | Bacteria | 10972 |
| 45 | Ga0055531_10003346 | 3300003794 | Bacteria | 10256 |
| 46 | Ga0055531_10005016 | 3300003794 | Bacteria | 7847 |
| 47 | Ga0055531_10009416 | 3300003794 | Bacteria | 4992 |
| 48 | Ga0055543_1001289 | 3300004625 | Bacteria | 10317 |
| 49 | Ga0065165_1010114 | 3300005262 | Bacteria | 4130 |
| 50 | Ga0065165_1014561 | 3300005262 | Bacteria | 3047 |
| 51 | Ga0065165_1018974 | 3300005262 | Bacteria | 2470 |
| 52 | Ga0065165_1021684 | 3300005262 | Bacteria | 2223 |
| 53 | Ga0065712_10188573 | 3300005290 | Bacteria | 1148 |
| 54 | Ga0065707_10242902 | 3300005295 | Bacteria | 1150 |
| 55 | Ga0070658_10165783 | 3300005327 | Bacteria | 1855 |
| 56 | Ga0070658_10178500 | 3300005327 | Bacteria | 1787 |
| 57 | Ga0070658_10376755 | 3300005327 | Bacteria | 1217 |
| 58 | Ga0070676_10002509 | 3300005328 | Bacteria | 9418 |
| 59 | Ga0070676_10025454 | 3300005328 | Bacteria | 3345 |
| 60 | Ga0070676_10075715 | 3300005328 | Bacteria | 2030 |
| 61 | Ga0070676_10224705 | 3300005328 | Bacteria | 1242 |
| 62 | Ga0070683_100037706 | 3300005329 | Bacteria | 4425 |
| 63 | Ga0070683_100121661 | 3300005329 | Bacteria | 2466 |
| 64 | Ga0070690_100010662 | 3300005330 | Bacteria | 5354 |
| 65 | Ga0070690_100239905 | 3300005330 | Bacteria | 1278 |
| 66 | Ga0070670_100024964 | 3300005331 | Bacteria | 5142 |
| 67 | Ga0070670_100046533 | 3300005331 | Bacteria | 3731 |
| 68 | Ga0070670_100949901 | 3300005331 | Bacteria | 780 |
| 69 | Ga0070670_101241508 | 3300005331 | Bacteria | 681 |
| 70 | Ga0070670_101617950 | 3300005331 | Bacteria | 595 |
| 71 | Ga0070677_10006749 | 3300005333 | Bacteria | 3821 |
| 72 | Ga0070677_10012615 | 3300005333 | Bacteria | 2937 |
| 73 | Ga0070677_10017639 | 3300005333 | Bacteria | 2559 |
| 74 | Ga0070677_10092265 | 3300005333 | Bacteria | 1319 |
| 75 | Ga0070677_10334597 | 3300005333 | Bacteria | 780 |
| 76 | Ga0068869_100012500 | 3300005334 | Bacteria | 5614 |
| 77 | Ga0068869_100096147 | 3300005334 | Bacteria | 2235 |
| 78 | Ga0070666_10000910 | 3300005335 | Bacteria | 17957 |
| 79 | Ga0070666_10004166 | 3300005335 | Bacteria | 8775 |
| 80 | Ga0070666_10241796 | 3300005335 | Bacteria | 1277 |
| 81 | Ga0070666_10429708 | 3300005335 | Bacteria | 952 |
| 82 | Ga0070666_10457645 | 3300005335 | Bacteria | 922 |
| 83 | Ga0070680_100056960 | 3300005336 | Bacteria | 3194 |
| 84 | Ga0070680_100157655 | 3300005336 | Bacteria | 1907 |
| 85 | Ga0070680_100573155 | 3300005336 | Bacteria | 968 |
| 86 | Ga0068868_100004895 | 3300005338 | Bacteria | 9402 |
| 87 | Ga0068868_100019803 | 3300005338 | Bacteria | 5048 |
| 88 | Ga0068868_100615315 | 3300005338 | Bacteria | 964 |
| 89 | Ga0068868_101493088 | 3300005338 | Bacteria | 632 |
| 90 | Ga0070660_100019427 | 3300005339 | Bacteria | 4980 |
| 91 | Ga0070689_100103553 | 3300005340 | Bacteria | 2256 |
| 92 | Ga0070689_101208455 | 3300005340 | Bacteria | 679 |
| 93 | Ga0070691_10049116 | 3300005341 | Bacteria | 2009 |
| 94 | Ga0070687_100107854 | 3300005343 | Bacteria | 1571 |
| 95 | Ga0070661_100000925 | 3300005344 | Bacteria | 21020 |
| 96 | Ga0070668_100000411 | 3300005347 | Bacteria | 28460 |
| 97 | Ga0070668_100253166 | 3300005347 | Bacteria | 1463 |
| 98 | Ga0070669_100005882 | 3300005353 | Bacteria | 8848 |
| 99 | Ga0070669_100007708 | 3300005353 | Bacteria | 7696 |
| 100 | Ga0070669_100153600 | 3300005353 | Bacteria | 1783 |
| 101 | Ga0070669_100197215 | 3300005353 | Bacteria | 1582 |
| 102 | Ga0070669_100442007 | 3300005353 | Bacteria | 1070 |
| 103 | Ga0070675_100000199 | 3300005354 | Bacteria | 37845 |
| 104 | Ga0070675_100003618 | 3300005354 | Bacteria | 11759 |
| 105 | Ga0070675_100016158 | 3300005354 | Bacteria | 5918 |
| 106 | Ga0070675_100025060 | 3300005354 | Bacteria | 4781 |
| 107 | Ga0070675_100059825 | 3300005354 | Bacteria | 3144 |
| 108 | Ga0070675_100063020 | 3300005354 | Bacteria | 3064 |
| 109 | Ga0070675_100129478 | 3300005354 | Bacteria | 2149 |
| 110 | Ga0070675_100175593 | 3300005354 | Bacteria | 1850 |
| 111 | Ga0070675_100234314 | 3300005354 | Bacteria | 1602 |
| 112 | Ga0070675_100261486 | 3300005354 | Bacteria | 1517 |
| 113 | Ga0070675_100304386 | 3300005354 | Bacteria | 1405 |
| 114 | Ga0070675_100605865 | 3300005354 | Bacteria | 993 |
| 115 | Ga0070671_100068600 | 3300005355 | Bacteria | 2958 |
| 116 | Ga0070671_100082092 | 3300005355 | Bacteria | 2695 |
| 117 | Ga0070671_100119592 | 3300005355 | Bacteria | 2216 |
| 118 | Ga0070671_100174389 | 3300005355 | Bacteria | 1819 |
| 119 | Ga0070671_100282123 | 3300005355 | Bacteria | 1413 |
| 120 | Ga0070671_100558339 | 3300005355 | Bacteria | 988 |
| 121 | Ga0070671_100577438 | 3300005355 | Bacteria | 971 |
| 122 | Ga0070671_100751456 | 3300005355 | Bacteria | 848 |
| 123 | Ga0070674_100008421 | 3300005356 | Bacteria | 6142 |
| 124 | Ga0070674_100009710 | 3300005356 | Bacteria | 5777 |
| 125 | Ga0070674_100076188 | 3300005356 | Bacteria | 2384 |
| 126 | Ga0070674_100171882 | 3300005356 | Bacteria | 1653 |
| 127 | Ga0070674_100191479 | 3300005356 | Bacteria | 1574 |
| 128 | Ga0070674_100224656 | 3300005356 | Bacteria | 1462 |
| 129 | Ga0070674_100803409 | 3300005356 | Bacteria | 812 |
| 130 | Ga0070674_101195863 | 3300005356 | Bacteria | 675 |
| 131 | Ga0070673_100001468 | 3300005364 | Bacteria | 13793 |
| 132 | Ga0070673_100008853 | 3300005364 | Bacteria | 6723 |
| 133 | Ga0070673_100028271 | 3300005364 | Bacteria | 4167 |
| 134 | Ga0070673_100070117 | 3300005364 | Bacteria | 2812 |
| 135 | Ga0070673_100147698 | 3300005364 | Bacteria | 1988 |
| 136 | Ga0070673_100150088 | 3300005364 | Bacteria | 1973 |
| 137 | Ga0070673_100177443 | 3300005364 | Bacteria | 1822 |
| 138 | Ga0070673_100319302 | 3300005364 | Bacteria | 1371 |
| 139 | Ga0070688_100317323 | 3300005365 | Bacteria | 1131 |
| 140 | Ga0070659_100001694 | 3300005366 | Bacteria | 15853 |
| 141 | Ga0070659_100788685 | 3300005366 | Bacteria | 826 |
| 142 | Ga0070667_100000463 | 3300005367 | Bacteria | 41711 |
| 143 | Ga0070667_100003988 | 3300005367 | Bacteria | 12507 |
| 144 | Ga0070667_100019707 | 3300005367 | Bacteria | 5596 |
| 145 | Ga0070667_100044588 | 3300005367 | Bacteria | 3725 |
| 146 | Ga0070667_100088182 | 3300005367 | Bacteria | 2664 |
| 147 | Ga0070667_100162405 | 3300005367 | Bacteria | 1968 |
| 148 | Ga0070667_100274337 | 3300005367 | Bacteria | 1513 |
| 149 | Ga0070667_100857417 | 3300005367 | Bacteria | 844 |
| 150 | Ga0070714_100085415 | 3300005435 | Bacteria | 2756 |
| 151 | Ga0070714_100940801 | 3300005435 | Bacteria | 840 |
| 152 | Ga0070713_100150212 | 3300005436 | Bacteria | 2071 |
| 153 | Ga0070713_100276595 | 3300005436 | Bacteria | 1539 |
| 154 | Ga0070713_100473741 | 3300005436 | Bacteria | 1179 |
| 155 | Ga0070713_100495254 | 3300005436 | Bacteria | 1153 |
| 156 | Ga0070713_100626243 | 3300005436 | Bacteria | 1023 |
| 157 | Ga0070713_100753871 | 3300005436 | Bacteria | 931 |
| 158 | Ga0070710_10007341 | 3300005437 | Bacteria | 5334 |
| 159 | Ga0070710_10065129 | 3300005437 | Bacteria | 2087 |
| 160 | Ga0070710_10506754 | 3300005437 | Bacteria | 827 |
| 161 | Ga0070710_10549970 | 3300005437 | Bacteria | 797 |
| 162 | Ga0070701_10346409 | 3300005438 | Bacteria | 927 |
| 163 | Ga0070711_100061388 | 3300005439 | Bacteria | 2617 |
| 164 | Ga0070705_100857867 | 3300005440 | Bacteria | 727 |
| 165 | Ga0070705_100978965 | 3300005440 | Bacteria | 685 |
| 166 | Ga0070700_100054257 | 3300005441 | Bacteria | 2504 |
| 167 | Ga0070700_100081321 | 3300005441 | Bacteria | 2093 |
| 168 | Ga0070708_100104465 | 3300005445 | Bacteria | 2598 |
| 169 | Ga0070708_100595274 | 3300005445 | Bacteria | 1042 |
| 170 | Ga0070663_100003243 | 3300005455 | Bacteria | 9358 |
| 171 | Ga0070663_100003886 | 3300005455 | Bacteria | 8706 |
| 172 | Ga0070663_100850583 | 3300005455 | Bacteria | 785 |
| 173 | Ga0070663_101262511 | 3300005455 | Bacteria | 651 |
| 174 | Ga0070678_100001786 | 3300005456 | Bacteria | 11591 |
| 175 | Ga0070678_100025816 | 3300005456 | Bacteria | 3960 |
| 176 | Ga0070678_100028458 | 3300005456 | Bacteria | 3812 |
| 177 | Ga0070678_100087358 | 3300005456 | Bacteria | 2381 |
| 178 | Ga0070678_100289859 | 3300005456 | Bacteria | 1387 |
| 179 | Ga0070678_100338210 | 3300005456 | Bacteria | 1290 |
| 180 | Ga0070678_101232293 | 3300005456 | Bacteria | 695 |
| 181 | Ga0070678_101284639 | 3300005456 | Bacteria | 681 |
| 182 | Ga0070662_100034028 | 3300005457 | Bacteria | 3591 |
| 183 | Ga0070662_100093049 | 3300005457 | Bacteria | 2267 |
| 184 | Ga0070662_100182623 | 3300005457 | Bacteria | 1655 |
| 185 | Ga0070662_100183998 | 3300005457 | Bacteria | 1649 |
| 186 | Ga0070662_100509332 | 3300005457 | Bacteria | 1005 |
| 187 | Ga0070681_10005119 | 3300005458 | Bacteria | 12655 |
| 188 | Ga0070681_10188912 | 3300005458 | Bacteria | 1980 |
| 189 | Ga0070681_10239500 | 3300005458 | Bacteria | 1728 |
| 190 | Ga0070681_10675550 | 3300005458 | Bacteria | 948 |
| 191 | Ga0068867_100000077 | 3300005459 | Bacteria | 59836 |
| 192 | Ga0068867_100000932 | 3300005459 | Bacteria | 19916 |
| 193 | Ga0068867_100012398 | 3300005459 | Bacteria | 6029 |
| 194 | Ga0068867_100038819 | 3300005459 | Bacteria | 3468 |
| 195 | Ga0068867_100054825 | 3300005459 | Bacteria | 2945 |
| 196 | Ga0068867_100136111 | 3300005459 | Bacteria | 1915 |
| 197 | Ga0068867_100213688 | 3300005459 | Bacteria | 1550 |
| 198 | Ga0068867_100411850 | 3300005459 | Bacteria | 1143 |
| 199 | Ga0068867_100569602 | 3300005459 | Bacteria | 983 |
| 200 | Ga0070685_10111492 | 3300005466 | Bacteria | 1686 |
| 201 | Ga0070706_100001777 | 3300005467 | Bacteria | 22328 |
| 202 | Ga0070706_100375056 | 3300005467 | Bacteria | 1325 |
| 203 | Ga0070706_100855603 | 3300005467 | Bacteria | 841 |
| 204 | Ga0070707_100036485 | 3300005468 | Bacteria | 4691 |
| 205 | Ga0070707_100417757 | 3300005468 | Bacteria | 1302 |
| 206 | Ga0070698_100933444 | 3300005471 | Unclassified | 814 |
| 207 | Ga0070699_100232285 | 3300005518 | Bacteria | 1645 |
| 208 | Ga0070679_100077785 | 3300005530 | Bacteria | 3307 |
| 209 | Ga0070679_100120419 | 3300005530 | Bacteria | 2609 |
| 210 | Ga0070679_100128179 | 3300005530 | Bacteria | 2519 |
| 211 | Ga0070679_100337587 | 3300005530 | Bacteria | 1455 |
| 212 | Ga0070684_100039305 | 3300005535 | Bacteria | 4068 |
| 213 | Ga0068853_100006065 | 3300005539 | Bacteria | 9563 |
| 214 | Ga0068853_100034477 | 3300005539 | Bacteria | 4296 |
| 215 | Ga0068853_100071781 | 3300005539 | Bacteria | 3015 |
| 216 | Ga0068853_100078556 | 3300005539 | Bacteria | 2884 |
| 217 | Ga0070672_100000674 | 3300005543 | Bacteria | 20065 |
| 218 | Ga0070672_100001496 | 3300005543 | Bacteria | 14501 |
| 219 | Ga0070672_100027912 | 3300005543 | Bacteria | 4216 |
| 220 | Ga0070672_100029785 | 3300005543 | Bacteria | 4096 |
| 221 | Ga0070672_100112138 | 3300005543 | Bacteria | 2224 |
| 222 | Ga0070672_100130914 | 3300005543 | Bacteria | 2061 |
| 223 | Ga0070672_100689912 | 3300005543 | Bacteria | 894 |
| 224 | Ga0070672_100693904 | 3300005543 | Bacteria | 891 |
| 225 | Ga0070672_101302960 | 3300005543 | Bacteria | 649 |
| 226 | Ga0070686_100089925 | 3300005544 | Bacteria | 2052 |
| 227 | Ga0070686_100533423 | 3300005544 | Bacteria | 916 |
| 228 | Ga0070696_100166665 | 3300005546 | Bacteria | 1626 |
| 229 | Ga0070693_100220427 | 3300005547 | Bacteria | 1243 |
| 230 | Ga0070665_101304575 | 3300005548 | Bacteria | 736 |
| 231 | Ga0070704_101847512 | 3300005549 | Bacteria | 559 |
| 232 | Ga0068855_100022408 | 3300005563 | Bacteria | 7571 |
| 233 | Ga0068855_100039828 | 3300005563 | Bacteria | 5578 |
| 234 | Ga0068855_100077143 | 3300005563 | Bacteria | 3866 |
| 235 | Ga0068855_100092900 | 3300005563 | Bacteria | 3479 |
| 236 | Ga0068855_100256710 | 3300005563 | Bacteria | 1948 |
| 237 | Ga0070664_100000939 | 3300005564 | Bacteria | 22774 |
| 238 | Ga0070664_100025855 | 3300005564 | Bacteria | 4867 |
| 239 | Ga0070664_100063541 | 3300005564 | Bacteria | 3148 |
| 240 | Ga0070664_100091218 | 3300005564 | Bacteria | 2637 |
| 241 | Ga0070664_100532892 | 3300005564 | Bacteria | 1085 |
| 242 | Ga0068857_100117060 | 3300005577 | Bacteria | 2398 |
| 243 | Ga0068857_100131701 | 3300005577 | Bacteria | 2255 |
| 244 | Ga0068857_100655455 | 3300005577 | Bacteria | 995 |
| 245 | Ga0068857_101040811 | 3300005577 | Bacteria | 789 |
| 246 | Ga0068854_100069996 | 3300005578 | Bacteria | 2563 |
| 247 | Ga0068854_100882064 | 3300005578 | Bacteria | 785 |
| 248 | Ga0068856_100012917 | 3300005614 | Bacteria | 8084 |
| 249 | Ga0068856_100289670 | 3300005614 | Bacteria | 1654 |
| 250 | Ga0068856_100447216 | 3300005614 | Bacteria | 1313 |
| 251 | Ga0070702_100474759 | 3300005615 | Bacteria | 913 |
| 252 | Ga0068852_100014816 | 3300005616 | Bacteria | 6022 |
| 253 | Ga0068852_100018603 | 3300005616 | Bacteria | 5475 |
| 254 | Ga0068852_100027821 | 3300005616 | Bacteria | 4615 |
| 255 | Ga0068852_100044259 | 3300005616 | Bacteria | 3779 |
| 256 | Ga0068852_100046620 | 3300005616 | Bacteria | 3694 |
| 257 | Ga0068852_100198851 | 3300005616 | Bacteria | 1896 |
| 258 | Ga0068852_100252895 | 3300005616 | Bacteria | 1689 |
| 259 | Ga0068852_100466299 | 3300005616 | Bacteria | 1253 |
| 260 | Ga0068852_100526853 | 3300005616 | Bacteria | 1179 |
| 261 | Ga0068859_100007180 | 3300005617 | Bacteria | 11309 |
| 262 | Ga0068859_100032232 | 3300005617 | Bacteria | 5264 |
| 263 | Ga0068859_100183101 | 3300005617 | Bacteria | 2178 |
| 264 | Ga0068859_100468786 | 3300005617 | Bacteria | 1355 |
| 265 | Ga0068864_100000354 | 3300005618 | Bacteria | 40336 |
| 266 | Ga0068864_100002399 | 3300005618 | Bacteria | 15473 |
| 267 | Ga0068864_100037250 | 3300005618 | Bacteria | 4150 |
| 268 | Ga0068864_100055665 | 3300005618 | Bacteria | 3416 |
| 269 | Ga0068864_100115684 | 3300005618 | Bacteria | 2392 |
| 270 | Ga0068864_101070786 | 3300005618 | Bacteria | 802 |
| 271 | Ga0068864_102265800 | 3300005618 | Bacteria | 550 |
| 272 | Ga0068866_10002910 | 3300005718 | Bacteria | 7059 |
| 273 | Ga0068866_10456408 | 3300005718 | Bacteria | 837 |
| 274 | Ga0068861_100003227 | 3300005719 | Bacteria | 10790 |
| 275 | Ga0068861_100026530 | 3300005719 | Bacteria | 4212 |
| 276 | Ga0068861_100268015 | 3300005719 | Bacteria | 1465 |
| 277 | Ga0068851_10004231 | 3300005834 | Bacteria | 6460 |
| 278 | Ga0068851_10065962 | 3300005834 | Bacteria | 1864 |
| 279 | Ga0068851_10351275 | 3300005834 | Bacteria | 858 |
| 280 | Ga0068870_10012786 | 3300005840 | Bacteria | 3931 |
| 281 | Ga0068870_10029084 | 3300005840 | Bacteria | 2781 |
| 282 | Ga0068870_10292604 | 3300005840 | Bacteria | 1025 |
| 283 | Ga0068863_100003312 | 3300005841 | Bacteria | 15900 |
| 284 | Ga0068863_100034898 | 3300005841 | Bacteria | 4791 |
| 285 | Ga0068863_100037190 | 3300005841 | Bacteria | 4635 |
| 286 | Ga0068863_100044132 | 3300005841 | Bacteria | 4232 |
| 287 | Ga0068863_100100578 | 3300005841 | Bacteria | 2748 |
| 288 | Ga0068863_100178913 | 3300005841 | Bacteria | 2036 |
| 289 | Ga0068863_100206566 | 3300005841 | Bacteria | 1890 |
| 290 | Ga0068858_100000262 | 3300005842 | Bacteria | 56062 |
| 291 | Ga0068858_100005749 | 3300005842 | Bacteria | 12118 |
| 292 | Ga0068858_100009778 | 3300005842 | Bacteria | 9130 |
| 293 | Ga0068858_100044019 | 3300005842 | Bacteria | 4139 |
| 294 | Ga0068858_101045860 | 3300005842 | Bacteria | 801 |
| 295 | Ga0068860_100006843 | 3300005843 | Bacteria | 11430 |
| 296 | Ga0068860_100085476 | 3300005843 | Bacteria | 3002 |
| 297 | Ga0068860_100089805 | 3300005843 | Bacteria | 2926 |
| 298 | Ga0068862_100019197 | 3300005844 | Bacteria | 5701 |
| 299 | Ga0068862_100023970 | 3300005844 | Bacteria | 5115 |
| 300 | Ga0068862_100028761 | 3300005844 | Bacteria | 4681 |
| 301 | Ga0068862_100058582 | 3300005844 | Bacteria | 3304 |
| 302 | Ga0068862_100059433 | 3300005844 | Bacteria | 3283 |
| 303 | Ga0068862_100094485 | 3300005844 | Bacteria | 2608 |
| 304 | Ga0068862_100126510 | 3300005844 | Bacteria | 2257 |
| 305 | Ga0068862_100784788 | 3300005844 | Bacteria | 929 |
| 306 | Ga0081455_10004966 | 3300005937 | Bacteria | 14710 |
| 307 | Ga0081455_10488458 | 3300005937 | Bacteria | 830 |
| 308 | Ga0081455_10588779 | 3300005937 | Bacteria | 727 |
| 309 | Ga0081540_1012498 | 3300005983 | Bacteria | 5582 |
| 310 | Ga0075365_10070149 | 3300006038 | Bacteria | 2357 |
| 311 | Ga0075365_10110299 | 3300006038 | Bacteria | 1890 |
| 312 | Ga0075368_10029146 | 3300006042 | Bacteria | 2133 |
| 313 | Ga0075368_10109207 | 3300006042 | Bacteria | 1139 |
| 314 | Ga0075368_10192943 | 3300006042 | Bacteria | 861 |
| 315 | Ga0075363_100537181 | 3300006048 | Bacteria | 697 |
| 316 | Ga0075364_10129145 | 3300006051 | Bacteria | 1695 |
| 317 | Ga0075364_10139836 | 3300006051 | Bacteria | 1628 |
| 318 | Ga0075364_10154009 | 3300006051 | Bacteria | 1550 |
| 319 | Ga0075432_10154894 | 3300006058 | Bacteria | 883 |
| 320 | Ga0075432_10596429 | 3300006058 | Bacteria | 505 |
| 321 | Ga0070715_10036873 | 3300006163 | Bacteria | 2020 |
| 322 | Ga0070716_100270348 | 3300006173 | Bacteria | 1168 |
| 323 | Ga0070716_101375385 | 3300006173 | Bacteria | 573 |
| 324 | Ga0070712_100133058 | 3300006175 | Bacteria | 1887 |
| 325 | Ga0075362_10005748 | 3300006177 | Bacteria | 4566 |
| 326 | Ga0075362_10015938 | 3300006177 | Bacteria | 3067 |
| 327 | Ga0075362_10030414 | 3300006177 | Bacteria | 2332 |
| 328 | Ga0075362_10040413 | 3300006177 | Bacteria | 2053 |
| 329 | Ga0075362_10131295 | 3300006177 | Bacteria | 1192 |
| 330 | Ga0075362_10165182 | 3300006177 | Bacteria | 1067 |
| 331 | Ga0075362_10294084 | 3300006177 | Bacteria | 805 |
| 332 | Ga0075362_10315725 | 3300006177 | Bacteria | 778 |
| 333 | Ga0075367_10008021 | 3300006178 | Bacteria | 5445 |
| 334 | Ga0075367_10038031 | 3300006178 | Bacteria | 2799 |
| 335 | Ga0075367_10052397 | 3300006178 | Bacteria | 2415 |
| 336 | Ga0075367_10113141 | 3300006178 | Bacteria | 1667 |
| 337 | Ga0075367_10309550 | 3300006178 | Bacteria | 995 |
| 338 | Ga0075369_10025461 | 3300006186 | Bacteria | 2460 |
| 339 | Ga0075369_10089557 | 3300006186 | Bacteria | 1372 |
| 340 | Ga0075366_10001921 | 3300006195 | Bacteria | 10509 |
| 341 | Ga0075366_10002417 | 3300006195 | Bacteria | 9579 |
| 342 | Ga0075366_10009102 | 3300006195 | Bacteria | 5537 |
| 343 | Ga0075366_10022250 | 3300006195 | Bacteria | 3687 |
| 344 | Ga0075366_10023025 | 3300006195 | Bacteria | 3628 |
| 345 | Ga0075366_10043968 | 3300006195 | Bacteria | 2647 |
| 346 | Ga0075366_10087477 | 3300006195 | Bacteria | 1865 |
| 347 | Ga0075366_10099101 | 3300006195 | Bacteria | 1748 |
| 348 | Ga0075366_10106906 | 3300006195 | Bacteria | 1682 |
| 349 | Ga0075366_10190494 | 3300006195 | Bacteria | 1246 |
| 350 | Ga0075366_10194245 | 3300006195 | Bacteria | 1234 |
| 351 | Ga0075366_10282479 | 3300006195 | Bacteria | 1014 |
| 352 | Ga0075366_10320595 | 3300006195 | Bacteria | 949 |
| 353 | Ga0075366_10641719 | 3300006195 | Bacteria | 659 |
| 354 | Ga0097621_100006883 | 3300006237 | Bacteria | 8088 |
| 355 | Ga0097621_100016215 | 3300006237 | Bacteria | 5627 |
| 356 | Ga0097621_100034883 | 3300006237 | Bacteria | 4016 |
| 357 | Ga0097621_100133582 | 3300006237 | Bacteria | 2114 |
| 358 | Ga0097621_100207916 | 3300006237 | Bacteria | 1701 |
| 359 | Ga0097621_100222507 | 3300006237 | Bacteria | 1645 |
| 360 | Ga0097621_100800847 | 3300006237 | Bacteria | 873 |
| 361 | Ga0075370_10005490 | 3300006353 | Bacteria | 6312 |
| 362 | Ga0075370_10005571 | 3300006353 | Bacteria | 6276 |
| 363 | Ga0075370_10008637 | 3300006353 | Bacteria | 5251 |
| 364 | Ga0075370_10015091 | 3300006353 | Bacteria | 4129 |
| 365 | Ga0075370_10059640 | 3300006353 | Bacteria | 2172 |
| 366 | Ga0075370_10136023 | 3300006353 | Bacteria | 1436 |
| 367 | Ga0075370_10490564 | 3300006353 | Bacteria | 741 |
| 368 | Ga0068871_100008710 | 3300006358 | Bacteria | 7297 |
| 369 | Ga0068871_100065266 | 3300006358 | Bacteria | 2981 |
| 370 | Ga0068871_100075803 | 3300006358 | Bacteria | 2777 |
| 371 | Ga0068871_100400827 | 3300006358 | Bacteria | 1222 |
| 372 | Ga0068871_100703754 | 3300006358 | Bacteria | 926 |
| 373 | Ga0068871_101192775 | 3300006358 | Bacteria | 714 |
| 374 | Ga0075428_100036897 | 3300006844 | Bacteria | 5382 |
| 375 | Ga0075430_100496766 | 3300006846 | Bacteria | 1007 |
| 376 | Ga0075431_100005587 | 3300006847 | Bacteria | 12415 |
| 377 | Ga0075429_100401840 | 3300006880 | Bacteria | 1200 |
| 378 | Ga0075429_100444789 | 3300006880 | Bacteria | 1136 |
| 379 | Ga0068865_100010698 | 3300006881 | Bacteria | 5719 |
| 380 | Ga0068865_100015466 | 3300006881 | Bacteria | 4867 |
| 381 | Ga0068865_100418978 | 3300006881 | Bacteria | 1100 |
| 382 | Ga0097620_100007180 | 3300006931 | Bacteria | 11309 |
| 383 | Ga0097620_100032233 | 3300006931 | Bacteria | 5264 |
| 384 | Ga0097620_100183102 | 3300006931 | Bacteria | 2178 |
| 385 | Ga0097620_100468776 | 3300006931 | Bacteria | 1355 |
| 386 | Ga0099823_1002035 | 3300006944 | Bacteria | 17811 |
| 387 | Ga0079104_1000100 | 3300006946 | Bacteria | 126924 |
| 388 | Ga0079104_1006080 | 3300006946 | Bacteria | 4667 |
| 389 | Ga0099826_10166791 | 3300006948 | Bacteria | 1241 |
| 390 | Ga0105251_10000309 | 3300009011 | Bacteria | 48873 |
| 391 | Ga0105251_10043577 | 3300009011 | Bacteria | 2172 |
| 392 | Ga0105251_10098387 | 3300009011 | Bacteria | 1339 |
| 393 | Ga0105251_10123778 | 3300009011 | Bacteria | 1174 |
| 394 | Ga0105244_10019485 | 3300009036 | Bacteria | 3785 |
| 395 | Ga0105244_10019533 | 3300009036 | Bacteria | 3779 |
| 396 | Ga0105244_10121111 | 3300009036 | Bacteria | 1267 |
| 397 | Ga0105244_10165564 | 3300009036 | Bacteria | 1054 |
| 398 | Ga0105244_10176417 | 3300009036 | Bacteria | 1015 |
| 399 | Ga0105250_10010061 | 3300009092 | Bacteria | 3954 |
| 400 | Ga0105250_10159959 | 3300009092 | Bacteria | 940 |
| 401 | Ga0105240_10007299 | 3300009093 | Bacteria | 16087 |
| 402 | Ga0105240_10031265 | 3300009093 | Bacteria | 6906 |
| 403 | Ga0105240_10034862 | 3300009093 | Bacteria | 6488 |
| 404 | Ga0105240_10041587 | 3300009093 | Bacteria | 5865 |
| 405 | Ga0105240_10079757 | 3300009093 | Bacteria | 4028 |
| 406 | Ga0105240_10377581 | 3300009093 | Bacteria | 1601 |
| 407 | Ga0105240_10432590 | 3300009093 | Bacteria | 1476 |
| 408 | Ga0111539_10322283 | 3300009094 | Bacteria | 1798 |
| 409 | Ga0111539_10558638 | 3300009094 | Bacteria | 1333 |
| 410 | Ga0111539_10627877 | 3300009094 | Bacteria | 1251 |
| 411 | Ga0105245_10307238 | 3300009098 | Bacteria | 1558 |
| 412 | Ga0105245_10856702 | 3300009098 | Bacteria | 949 |
| 413 | Ga0105245_11120787 | 3300009098 | Bacteria | 833 |
| 414 | Ga0105247_10431794 | 3300009101 | Bacteria | 945 |
| 415 | Ga0105247_10977890 | 3300009101 | Bacteria | 659 |
| 416 | Ga0114129_10491018 | 3300009147 | Bacteria | 1605 |
| 417 | Ga0114129_11031304 | 3300009147 | Bacteria | 1034 |
| 418 | Ga0105243_10002591 | 3300009148 | Bacteria | 15085 |
| 419 | Ga0105243_10068864 | 3300009148 | Bacteria | 2853 |
| 420 | Ga0105243_10075438 | 3300009148 | Bacteria | 2737 |
| 421 | Ga0105243_10386578 | 3300009148 | Bacteria | 1296 |
| 422 | Ga0105243_11957074 | 3300009148 | Bacteria | 620 |
| 423 | Ga0105241_10015147 | 3300009174 | Bacteria | 5648 |
| 424 | Ga0105241_10434571 | 3300009174 | Bacteria | 1158 |
| 425 | Ga0105242_10587584 | 3300009176 | Bacteria | 1074 |
| 426 | Ga0105242_11152775 | 3300009176 | Bacteria | 792 |
| 427 | Ga0105248_10007009 | 3300009177 | Bacteria | 12342 |
| 428 | Ga0105248_10056848 | 3300009177 | Bacteria | 4390 |
| 429 | Ga0105248_10064841 | 3300009177 | Bacteria | 4100 |
| 430 | Ga0105248_10088653 | 3300009177 | Bacteria | 3482 |
| 431 | Ga0105248_10130214 | 3300009177 | Bacteria | 2838 |
| 432 | Ga0105248_10191639 | 3300009177 | Bacteria | 2304 |
| 433 | Ga0105248_10245116 | 3300009177 | Bacteria | 2017 |
| 434 | Ga0105248_10387556 | 3300009177 | Bacteria | 1573 |
| 435 | Ga0105248_10454797 | 3300009177 | Bacteria | 1443 |
| 436 | Ga0105248_10958676 | 3300009177 | Bacteria | 966 |
| 437 | Ga0105237_10000998 | 3300009545 | Bacteria | 38080 |
| 438 | Ga0105237_10105952 | 3300009545 | Bacteria | 2803 |
| 439 | Ga0105237_10179800 | 3300009545 | Bacteria | 2116 |
| 440 | Ga0105237_11091736 | 3300009545 | Bacteria | 805 |
| 441 | Ga0105238_10012661 | 3300009551 | Bacteria | 8514 |
| 442 | Ga0105238_10018725 | 3300009551 | Bacteria | 7051 |
| 443 | Ga0105238_10019715 | 3300009551 | Bacteria | 6868 |
| 444 | Ga0105238_10033490 | 3300009551 | Bacteria | 5230 |
| 445 | Ga0105238_10046675 | 3300009551 | Bacteria | 4370 |
| 446 | Ga0105238_10244541 | 3300009551 | Bacteria | 1772 |
| 447 | Ga0105238_10638696 | 3300009551 | Bacteria | 1074 |
| 448 | Ga0105249_10000342 | 3300009553 | Bacteria | 47083 |
| 449 | Ga0105249_10044280 | 3300009553 | Bacteria | 4047 |
| 450 | Ga0105249_10104287 | 3300009553 | Bacteria | 2672 |
| 451 | Ga0105249_10151394 | 3300009553 | Bacteria | 2234 |
| 452 | Ga0105249_10318448 | 3300009553 | Bacteria | 1566 |
| 453 | Ga0105239_10000318 | 3300010375 | Bacteria | 71045 |
| 454 | Ga0105239_10509498 | 3300010375 | Bacteria | 1368 |
| 455 | Ga0105239_11138897 | 3300010375 | Bacteria | 898 |
| 456 | Ga0105246_12327865 | 3300011119 | Bacteria | 524 |
| 457 | Ga0157317_1000493 | 3300012475 | Bacteria | 1713 |
| 458 | Ga0157319_1000035 | 3300012497 | Bacteria | 40594 |
| 459 | Ga0157314_1005544 | 3300012500 | Bacteria | 961 |
| 460 | Ga0157326_1005406 | 3300012513 | Bacteria | 1351 |
| 461 | Ga0157373_10486659 | 3300013100 | Bacteria | 890 |
| 462 | Ga0157371_10005864 | 3300013102 | Bacteria | 10264 |
| 463 | Ga0157371_10650304 | 3300013102 | Bacteria | 787 |
| 464 | Ga0157370_10438793 | 3300013104 | Bacteria | 1201 |
| 465 | Ga0157370_10815178 | 3300013104 | Bacteria | 849 |
| 466 | Ga0157370_11080649 | 3300013104 | Bacteria | 725 |
| 467 | Ga0157369_10031818 | 3300013105 | Bacteria | 5805 |
| 468 | Ga0157369_10037600 | 3300013105 | Bacteria | 5299 |
| 469 | Ga0157369_11072985 | 3300013105 | Bacteria | 823 |
| 470 | Ga0157374_10025164 | 3300013296 | Bacteria | 5341 |
| 471 | Ga0157374_10125887 | 3300013296 | Bacteria | 2477 |
| 472 | Ga0157374_10221280 | 3300013296 | Bacteria | 1857 |
| 473 | Ga0157374_10646021 | 3300013296 | Bacteria | 1070 |
| 474 | Ga0157378_10180665 | 3300013297 | Bacteria | 1985 |
| 475 | Ga0157378_10308886 | 3300013297 | Bacteria | 1533 |
| 476 | Ga0157378_10445647 | 3300013297 | Bacteria | 1284 |
| 477 | Ga0157378_10492593 | 3300013297 | Bacteria | 1223 |
| 478 | Ga0157378_11466363 | 3300013297 | Bacteria | 726 |
| 479 | Ga0163162_10000679 | 3300013306 | Bacteria | 31608 |
| 480 | Ga0163162_10012705 | 3300013306 | Bacteria | 8221 |
| 481 | Ga0163162_10025634 | 3300013306 | Bacteria | 5828 |
| 482 | Ga0163162_10048557 | 3300013306 | Bacteria | 4253 |
| 483 | Ga0163162_10053465 | 3300013306 | Bacteria | 4059 |
| 484 | Ga0163162_10086236 | 3300013306 | Bacteria | 3217 |
| 485 | Ga0163162_10871690 | 3300013306 | Bacteria | 1015 |
| 486 | Ga0157372_10000718 | 3300013307 | Bacteria | 36311 |
| 487 | Ga0157372_10035925 | 3300013307 | Bacteria | 5457 |
| 488 | Ga0157372_10102543 | 3300013307 | Bacteria | 3269 |
| 489 | Ga0157372_10117708 | 3300013307 | Bacteria | 3047 |
| 490 | Ga0157372_10699447 | 3300013307 | Bacteria | 1179 |
| 491 | Ga0157372_10743795 | 3300013307 | Bacteria | 1140 |
| 492 | Ga0157375_10004728 | 3300013308 | Bacteria | 11830 |
| 493 | Ga0157375_10018087 | 3300013308 | Bacteria | 6385 |
| 494 | Ga0157375_10019246 | 3300013308 | Bacteria | 6206 |
| 495 | Ga0157375_10034066 | 3300013308 | Bacteria | 4847 |
| 496 | Ga0157375_10056743 | 3300013308 | Bacteria | 3868 |
| 497 | Ga0157375_10207553 | 3300013308 | Bacteria | 2116 |
| 498 | Ga0157375_10261577 | 3300013308 | Bacteria | 1892 |
| 499 | Ga0157375_10275214 | 3300013308 | Bacteria | 1846 |
| 500 | Ga0157375_10308210 | 3300013308 | Bacteria | 1747 |
| 501 | Ga0157375_10592298 | 3300013308 | Bacteria | 1268 |
| 502 | Ga0157375_10746747 | 3300013308 | Bacteria | 1130 |
| 503 | Ga0157375_11075442 | 3300013308 | Bacteria | 941 |
| 504 | Ga0163163_10004764 | 3300014325 | Bacteria | 11640 |
| 505 | Ga0163163_10098591 | 3300014325 | Bacteria | 2944 |
| 506 | Ga0163163_10107334 | 3300014325 | Bacteria | 2819 |
| 507 | Ga0163163_10246292 | 3300014325 | Bacteria | 1837 |
| 508 | Ga0163163_10526712 | 3300014325 | Bacteria | 1244 |
| 509 | Ga0163163_10560854 | 3300014325 | Bacteria | 1205 |
| 510 | Ga0163163_11979705 | 3300014325 | Bacteria | 642 |
| 511 | Ga0157380_10022857 | 3300014326 | Bacteria | 4715 |
| 512 | Ga0157380_10023566 | 3300014326 | Bacteria | 4645 |
| 513 | Ga0157380_10048088 | 3300014326 | Bacteria | 3358 |
| 514 | Ga0157380_10062916 | 3300014326 | Bacteria | 2974 |
| 515 | Ga0157380_10069002 | 3300014326 | Bacteria | 2851 |
| 516 | Ga0157380_10148857 | 3300014326 | Bacteria | 2021 |
| 517 | Ga0157380_10202571 | 3300014326 | Bacteria | 1762 |
| 518 | Ga0157380_10205600 | 3300014326 | Bacteria | 1750 |
| 519 | Ga0157380_11222749 | 3300014326 | Bacteria | 796 |
| 520 | Ga0157380_11258212 | 3300014326 | Bacteria | 786 |
| 521 | Ga0157380_11438656 | 3300014326 | Bacteria | 741 |
| 522 | Ga0157380_12702528 | 3300014326 | Bacteria | 563 |
| 523 | Ga0182008_10003595 | 3300014497 | Bacteria | 9279 |
| 524 | Ga0182008_10366545 | 3300014497 | Bacteria | 767 |
| 525 | Ga0157377_10000094 | 3300014745 | Bacteria | 64283 |
| 526 | Ga0157377_10521026 | 3300014745 | Bacteria | 834 |
| 527 | Ga0157379_10004559 | 3300014968 | Bacteria | 11882 |
| 528 | Ga0157379_10091048 | 3300014968 | Bacteria | 2736 |
| 529 | Ga0157379_10157624 | 3300014968 | Bacteria | 2048 |
| 530 | Ga0157376_10002171 | 3300014969 | Bacteria | 13216 |
| 531 | Ga0157376_10016007 | 3300014969 | Bacteria | 5683 |
| 532 | Ga0157376_10098229 | 3300014969 | Bacteria | 2552 |
| 533 | Ga0157376_10151948 | 3300014969 | Bacteria | 2089 |
| 534 | Ga0157376_10285856 | 3300014969 | Bacteria | 1555 |
| 535 | Ga0157376_10374167 | 3300014969 | Bacteria | 1370 |
| 536 | Ga0157376_10420659 | 3300014969 | Bacteria | 1297 |
| 537 | Ga0157376_10451251 | 3300014969 | Bacteria | 1254 |
| 538 | Ga0157376_10556812 | 3300014969 | Bacteria | 1135 |
| 539 | Ga0157376_10803234 | 3300014969 | Bacteria | 953 |
| 540 | Ga0182007_10035004 | 3300015262 | Bacteria | 1693 |
| 541 | Ga0182005_1095988 | 3300015265 | Bacteria | 828 |
| 542 | Ga0163161_10041756 | 3300017792 | Bacteria | 3296 |
| 543 | Ga0163161_10073964 | 3300017792 | Bacteria | 2498 |
| 544 | Ga0163161_10118524 | 3300017792 | Bacteria | 1987 |
| 545 | Ga0163161_10153661 | 3300017792 | Bacteria | 1750 |
| 546 | Ga0206354_11363812 | 3300020081 | Bacteria | 611 |
| 547 | Ga0213872_10004955 | 3300021361 | Bacteria | 6924 |
| 548 | Ga0213872_10026335 | 3300021361 | Bacteria | 2671 |
| 549 | Ga0213875_10000114 | 3300021388 | Bacteria | 91363 |
| 550 | Ga0213875_10008122 | 3300021388 | Bacteria | 5388 |
| 551 | Ga0213875_10255900 | 3300021388 | Bacteria | 826 |
| 552 | Ga0209435_100001 | 3300025206 | Bacteria | 1424171 |
| 553 | Ga0209436_113645 | 3300025208 | Bacteria | 1320 |
| 554 | Ga0209258_110482 | 3300025242 | Bacteria | 1201 |
| 555 | Ga0207425_1002625 | 3300025245 | Bacteria | 6213 |
| 556 | Ga0207425_1008135 | 3300025245 | Bacteria | 2710 |
| 557 | Ga0207425_1008784 | 3300025245 | Bacteria | 2557 |
| 558 | Ga0209646_1000001 | 3300025246 | Bacteria | 3092932 |
| 559 | Ga0209026_1000003 | 3300025250 | Bacteria | 1060571 |
| 560 | Ga0209759_1000001 | 3300025256 | Bacteria | 2799452 |
| 561 | Ga0209129_1000041 | 3300025258 | Bacteria | 307590 |
| 562 | Ga0209129_1003651 | 3300025258 | Bacteria | 6553 |
| 563 | Ga0209129_1018536 | 3300025258 | Bacteria | 1334 |
| 564 | Ga0209565_1000124 | 3300025263 | Bacteria | 110789 |
| 565 | Ga0209565_1000498 | 3300025263 | Bacteria | 28727 |
| 566 | Ga0209565_1009374 | 3300025263 | Bacteria | 2490 |
| 567 | Ga0209565_1024593 | 3300025263 | Bacteria | 1224 |
| 568 | Ga0209673_1000043 | 3300025273 | Bacteria | 291503 |
| 569 | Ga0209673_1001809 | 3300025273 | Bacteria | 17590 |
| 570 | Ga0209673_1007730 | 3300025273 | Bacteria | 4896 |
| 571 | Ga0209673_1010237 | 3300025273 | Bacteria | 3970 |
| 572 | Ga0209673_1010311 | 3300025273 | Bacteria | 3944 |
| 573 | Ga0209673_1044280 | 3300025273 | Bacteria | 1233 |
| 574 | Ga0209673_1049602 | 3300025273 | Bacteria | 1121 |
| 575 | Ga0209130_1000442 | 3300025284 | Bacteria | 43829 |
| 576 | Ga0209130_1000620 | 3300025284 | Bacteria | 33992 |
| 577 | Ga0209130_1001702 | 3300025284 | Bacteria | 13299 |
| 578 | Ga0209130_1055162 | 3300025284 | Bacteria | 708 |
| 579 | Ga0209675_1000309 | 3300025291 | Bacteria | 44113 |
| 580 | Ga0209675_1008560 | 3300025291 | Bacteria | 3738 |
| 581 | Ga0209675_1031186 | 3300025291 | Bacteria | 1263 |
| 582 | Ga0209675_1064089 | 3300025291 | Bacteria | 717 |
| 583 | Ga0209676_1000007 | 3300025292 | Bacteria | 1029371 |
| 584 | Ga0209676_1005708 | 3300025292 | Bacteria | 6399 |
| 585 | Ga0209025_1002427 | 3300025294 | Bacteria | 19781 |
| 586 | Ga0209025_1004916 | 3300025294 | Bacteria | 11238 |
| 587 | Ga0209025_1024249 | 3300025294 | Bacteria | 3138 |
| 588 | Ga0209025_1025283 | 3300025294 | Bacteria | 3028 |
| 589 | Ga0209025_1095108 | 3300025294 | Bacteria | 960 |
| 590 | Ga0209564_1000003 | 3300025295 | Bacteria | 1585848 |
| 591 | Ga0209564_1000029 | 3300025295 | Bacteria | 505995 |
| 592 | Ga0209564_1000268 | 3300025295 | Bacteria | 109101 |
| 593 | Ga0209564_1000476 | 3300025295 | Bacteria | 67062 |
| 594 | Ga0209564_1003314 | 3300025295 | Bacteria | 11188 |
| 595 | Ga0209758_1000043 | 3300025297 | Bacteria | 402310 |
| 596 | Ga0209758_1000167 | 3300025297 | Bacteria | 151074 |
| 597 | Ga0209758_1043883 | 3300025297 | Bacteria | 1641 |
| 598 | Ga0209758_1045258 | 3300025297 | Bacteria | 1599 |
| 599 | Ga0209758_1061488 | 3300025297 | Bacteria | 1236 |
| 600 | Ga0209050_1000003 | 3300025298 | Bacteria | 1609245 |
| 601 | Ga0209050_1000467 | 3300025298 | Bacteria | 71711 |
| 602 | Ga0209050_1000808 | 3300025298 | Bacteria | 44058 |
| 603 | Ga0209050_1001494 | 3300025298 | Bacteria | 24797 |
| 604 | Ga0209050_1003886 | 3300025298 | Bacteria | 10607 |
| 605 | Ga0209050_1004391 | 3300025298 | Bacteria | 9566 |
| 606 | Ga0209050_1016100 | 3300025298 | Bacteria | 3084 |
| 607 | Ga0209050_1021541 | 3300025298 | Bacteria | 2346 |
| 608 | Ga0209050_1096249 | 3300025298 | Bacteria | 595 |
| 609 | Ga0209256_1000001 | 3300025299 | Bacteria | 2166974 |
| 610 | Ga0209256_1000011 | 3300025299 | Bacteria | 865309 |
| 611 | Ga0209256_1000398 | 3300025299 | Bacteria | 68796 |
| 612 | Ga0209256_1002559 | 3300025299 | Bacteria | 14528 |
| 613 | Ga0209256_1017854 | 3300025299 | Bacteria | 2335 |
| 614 | Ga0209256_1021626 | 3300025299 | Bacteria | 1969 |
| 615 | Ga0209256_1043431 | 3300025299 | Bacteria | 1129 |
| 616 | Ga0207426_1000247 | 3300025302 | Bacteria | 119659 |
| 617 | Ga0207426_1009688 | 3300025302 | Bacteria | 3790 |
| 618 | Ga0207426_1046867 | 3300025302 | Bacteria | 1307 |
| 619 | Ga0207426_1067929 | 3300025302 | Bacteria | 1003 |
| 620 | Ga0209051_1000003 | 3300025303 | Bacteria | 1609245 |
| 621 | Ga0209051_1000210 | 3300025303 | Bacteria | 102629 |
| 622 | Ga0209051_1000320 | 3300025303 | Bacteria | 72764 |
| 623 | Ga0209051_1001335 | 3300025303 | Bacteria | 21466 |
| 624 | Ga0209051_1007045 | 3300025303 | Bacteria | 6221 |
| 625 | Ga0209051_1012479 | 3300025303 | Bacteria | 4107 |
| 626 | Ga0209051_1017118 | 3300025303 | Bacteria | 3250 |
| 627 | Ga0209257_1000017 | 3300025304 | Bacteria | 866287 |
| 628 | Ga0209257_1000020 | 3300025304 | Bacteria | 773356 |
| 629 | Ga0209257_1000161 | 3300025304 | Bacteria | 176089 |
| 630 | Ga0209257_1000314 | 3300025304 | Bacteria | 102629 |
| 631 | Ga0209257_1000799 | 3300025304 | Bacteria | 45956 |
| 632 | Ga0209257_1005062 | 3300025304 | Bacteria | 9572 |
| 633 | Ga0209257_1005554 | 3300025304 | Bacteria | 8781 |
| 634 | Ga0209257_1016941 | 3300025304 | Bacteria | 2905 |
| 635 | Ga0207656_10005941 | 3300025321 | Bacteria | 4356 |
| 636 | Ga0207655_1005008 | 3300025728 | Bacteria | 9169 |
| 637 | Ga0207655_1005064 | 3300025728 | Bacteria | 9110 |
| 638 | Ga0207655_1083830 | 3300025728 | Bacteria | 1141 |
| 639 | Ga0207655_1105079 | 3300025728 | Bacteria | 965 |
| 640 | Ga0207655_1107523 | 3300025728 | Bacteria | 948 |
| 641 | Ga0207713_1069190 | 3300025735 | Bacteria | 1309 |
| 642 | Ga0207713_1116723 | 3300025735 | Bacteria | 900 |
| 643 | Ga0207713_1124951 | 3300025735 | Bacteria | 858 |
| 644 | Ga0207653_10200309 | 3300025885 | Bacteria | 752 |
| 645 | Ga0207682_10001767 | 3300025893 | Bacteria | 9913 |
| 646 | Ga0207682_10001984 | 3300025893 | Bacteria | 9267 |
| 647 | Ga0207682_10009729 | 3300025893 | Bacteria | 3787 |
| 648 | Ga0207682_10013197 | 3300025893 | Bacteria | 3221 |
| 649 | Ga0207692_10105491 | 3300025898 | Bacteria | 1554 |
| 650 | Ga0207642_10006842 | 3300025899 | Bacteria | 3816 |
| 651 | Ga0207642_10080122 | 3300025899 | Bacteria | 1583 |
| 652 | Ga0207642_10115095 | 3300025899 | Bacteria | 1377 |
| 653 | Ga0207642_10218813 | 3300025899 | Bacteria | 1063 |
| 654 | Ga0207680_10003848 | 3300025903 | Bacteria | 7066 |
| 655 | Ga0207680_10024370 | 3300025903 | Bacteria | 3320 |
| 656 | Ga0207680_10025961 | 3300025903 | Bacteria | 3239 |
| 657 | Ga0207699_10030917 | 3300025906 | Bacteria | 3001 |
| 658 | Ga0207645_10012039 | 3300025907 | Bacteria | 5882 |
| 659 | Ga0207645_10032364 | 3300025907 | Bacteria | 3361 |
| 660 | Ga0207645_10727408 | 3300025907 | Bacteria | 675 |
| 661 | Ga0207643_10003782 | 3300025908 | Bacteria | 8136 |
| 662 | Ga0207643_10028009 | 3300025908 | Bacteria | 3127 |
| 663 | Ga0207643_10058785 | 3300025908 | Bacteria | 2192 |
| 664 | Ga0207643_10303128 | 3300025908 | Bacteria | 995 |
| 665 | Ga0207705_10106972 | 3300025909 | Bacteria | 2063 |
| 666 | Ga0207705_10339781 | 3300025909 | Bacteria | 1156 |
| 667 | Ga0207705_10551886 | 3300025909 | Bacteria | 896 |
| 668 | Ga0207684_10000743 | 3300025910 | Bacteria | 38135 |
| 669 | Ga0207684_10726554 | 3300025910 | Bacteria | 843 |
| 670 | Ga0207654_10044947 | 3300025911 | Bacteria | 2511 |
| 671 | Ga0207707_10002563 | 3300025912 | Bacteria | 16290 |
| 672 | Ga0207707_10078608 | 3300025912 | Bacteria | 2881 |
| 673 | Ga0207707_10176459 | 3300025912 | Bacteria | 1866 |
| 674 | Ga0207707_10529490 | 3300025912 | Bacteria | 1003 |
| 675 | Ga0207707_10772269 | 3300025912 | Unclassified | 802 |
| 676 | Ga0207695_10025991 | 3300025913 | Bacteria | 6542 |
| 677 | Ga0207695_10043173 | 3300025913 | Bacteria | 4807 |
| 678 | Ga0207695_10065868 | 3300025913 | Bacteria | 3723 |
| 679 | Ga0207695_10354968 | 3300025913 | Bacteria | 1353 |
| 680 | Ga0207671_10006034 | 3300025914 | Bacteria | 10939 |
| 681 | Ga0207671_10040022 | 3300025914 | Bacteria | 3470 |
| 682 | Ga0207671_10118785 | 3300025914 | Bacteria | 2019 |
| 683 | Ga0207671_10788372 | 3300025914 | Bacteria | 754 |
| 684 | Ga0207693_10061984 | 3300025915 | Bacteria | 2929 |
| 685 | Ga0207693_10448950 | 3300025915 | Unclassified | 1008 |
| 686 | Ga0207693_10461586 | 3300025915 | Bacteria | 992 |
| 687 | Ga0207663_10421691 | 3300025916 | Bacteria | 1024 |
| 688 | Ga0207660_10033235 | 3300025917 | Bacteria | 3566 |
| 689 | Ga0207660_10095087 | 3300025917 | Bacteria | 2216 |
| 690 | Ga0207660_10331851 | 3300025917 | Bacteria | 1216 |
| 691 | Ga0207662_10142406 | 3300025918 | Bacteria | 1519 |
| 692 | Ga0207662_10647713 | 3300025918 | Bacteria | 738 |
| 693 | Ga0207657_10034309 | 3300025919 | Bacteria | 4566 |
| 694 | Ga0207657_10062069 | 3300025919 | Bacteria | 3201 |
| 695 | Ga0207657_10094700 | 3300025919 | Bacteria | 2486 |
| 696 | Ga0207657_10358752 | 3300025919 | Bacteria | 1149 |
| 697 | Ga0207649_10001323 | 3300025920 | Bacteria | 14731 |
| 698 | Ga0207649_10122954 | 3300025920 | Bacteria | 1752 |
| 699 | Ga0207649_10186377 | 3300025920 | Bacteria | 1456 |
| 700 | Ga0207649_10789743 | 3300025920 | Bacteria | 740 |
| 701 | Ga0207652_10156540 | 3300025921 | Bacteria | 2041 |
| 702 | Ga0207652_10334427 | 3300025921 | Bacteria | 1367 |
| 703 | Ga0207646_10022087 | 3300025922 | Bacteria | 5869 |
| 704 | Ga0207646_10731365 | 3300025922 | Bacteria | 884 |
| 705 | Ga0207681_10000819 | 3300025923 | Bacteria | 20485 |
| 706 | Ga0207681_10014662 | 3300025923 | Bacteria | 4878 |
| 707 | Ga0207681_10032915 | 3300025923 | Bacteria | 3397 |
| 708 | Ga0207681_10224280 | 3300025923 | Bacteria | 1455 |
| 709 | Ga0207681_10753890 | 3300025923 | Bacteria | 812 |
| 710 | Ga0207681_10795349 | 3300025923 | Bacteria | 790 |
| 711 | Ga0207681_11504552 | 3300025923 | Bacteria | 564 |
| 712 | Ga0207694_10028662 | 3300025924 | Bacteria | 4245 |
| 713 | Ga0207694_10059195 | 3300025924 | Bacteria | 2979 |
| 714 | Ga0207694_10090675 | 3300025924 | Bacteria | 2412 |
| 715 | Ga0207694_10183514 | 3300025924 | Bacteria | 1697 |
| 716 | Ga0207694_10997260 | 3300025924 | Bacteria | 709 |
| 717 | Ga0207650_10001268 | 3300025925 | Bacteria | 18324 |
| 718 | Ga0207650_10005261 | 3300025925 | Bacteria | 8826 |
| 719 | Ga0207650_10040024 | 3300025925 | Bacteria | 3428 |
| 720 | Ga0207650_10064135 | 3300025925 | Bacteria | 2749 |
| 721 | Ga0207650_10182010 | 3300025925 | Bacteria | 1675 |
| 722 | Ga0207650_10500826 | 3300025925 | Bacteria | 1015 |
| 723 | Ga0207650_11165107 | 3300025925 | Bacteria | 656 |
| 724 | Ga0207659_10001423 | 3300025926 | Bacteria | 14256 |
| 725 | Ga0207659_10003128 | 3300025926 | Bacteria | 9889 |
| 726 | Ga0207659_10038727 | 3300025926 | Bacteria | 3319 |
| 727 | Ga0207659_10082489 | 3300025926 | Bacteria | 2380 |
| 728 | Ga0207659_10507491 | 3300025926 | Bacteria | 1021 |
| 729 | Ga0207659_10827396 | 3300025926 | Bacteria | 796 |
| 730 | Ga0207659_11065387 | 3300025926 | Bacteria | 696 |
| 731 | Ga0207687_10111231 | 3300025927 | Bacteria | 2033 |
| 732 | Ga0207687_10524916 | 3300025927 | Bacteria | 991 |
| 733 | Ga0207700_10001011 | 3300025928 | Bacteria | 16240 |
| 734 | Ga0207700_10147485 | 3300025928 | Bacteria | 1941 |
| 735 | Ga0207700_10387519 | 3300025928 | Bacteria | 1223 |
| 736 | Ga0207664_10489841 | 3300025929 | Bacteria | 1100 |
| 737 | Ga0207664_11067131 | 3300025929 | Bacteria | 723 |
| 738 | Ga0207644_10004489 | 3300025931 | Bacteria | 9062 |
| 739 | Ga0207644_10004958 | 3300025931 | Bacteria | 8685 |
| 740 | Ga0207644_10022737 | 3300025931 | Bacteria | 4286 |
| 741 | Ga0207644_10052099 | 3300025931 | Bacteria | 2940 |
| 742 | Ga0207644_10075325 | 3300025931 | Bacteria | 2480 |
| 743 | Ga0207644_10077977 | 3300025931 | Bacteria | 2441 |
| 744 | Ga0207644_10096958 | 3300025931 | Bacteria | 2208 |
| 745 | Ga0207644_10435136 | 3300025931 | Bacteria | 1076 |
| 746 | Ga0207644_11029242 | 3300025931 | Bacteria | 691 |
| 747 | Ga0207690_10004800 | 3300025932 | Bacteria | 7976 |
| 748 | Ga0207690_10187909 | 3300025932 | Bacteria | 1560 |
| 749 | Ga0207690_10464084 | 3300025932 | Bacteria | 1019 |
| 750 | Ga0207706_10002276 | 3300025933 | Bacteria | 18747 |
| 751 | Ga0207706_10026649 | 3300025933 | Bacteria | 5174 |
| 752 | Ga0207706_10027008 | 3300025933 | Bacteria | 5135 |
| 753 | Ga0207706_10032086 | 3300025933 | Bacteria | 4678 |
| 754 | Ga0207706_10039929 | 3300025933 | Bacteria | 4160 |
| 755 | Ga0207706_10164864 | 3300025933 | Bacteria | 1948 |
| 756 | Ga0207706_10822153 | 3300025933 | Bacteria | 788 |
| 757 | Ga0207706_10871904 | 3300025933 | Bacteria | 761 |
| 758 | Ga0207686_10173253 | 3300025934 | Bacteria | 1524 |
| 759 | Ga0207686_10246698 | 3300025934 | Bacteria | 1302 |
| 760 | Ga0207686_10302986 | 3300025934 | Bacteria | 1187 |
| 761 | Ga0207686_10390103 | 3300025934 | Bacteria | 1058 |
| 762 | Ga0207709_10001678 | 3300025935 | Bacteria | 14925 |
| 763 | Ga0207709_10010988 | 3300025935 | Bacteria | 4990 |
| 764 | Ga0207709_10079035 | 3300025935 | Bacteria | 2113 |
| 765 | Ga0207709_10874614 | 3300025935 | Bacteria | 729 |
| 766 | Ga0207670_10099553 | 3300025936 | Bacteria | 2074 |
| 767 | Ga0207670_10307801 | 3300025936 | Bacteria | 1243 |
| 768 | Ga0207669_10003846 | 3300025937 | Bacteria | 6543 |
| 769 | Ga0207669_10010270 | 3300025937 | Bacteria | 4501 |
| 770 | Ga0207669_10012607 | 3300025937 | Bacteria | 4163 |
| 771 | Ga0207669_10085268 | 3300025937 | Bacteria | 2038 |
| 772 | Ga0207669_10235698 | 3300025937 | Bacteria | 1353 |
| 773 | Ga0207669_10239937 | 3300025937 | Bacteria | 1343 |
| 774 | Ga0207669_10615124 | 3300025937 | Bacteria | 884 |
| 775 | Ga0207704_10006026 | 3300025938 | Bacteria | 5620 |
| 776 | Ga0207704_10014210 | 3300025938 | Bacteria | 4013 |
| 777 | Ga0207704_10017503 | 3300025938 | Bacteria | 3718 |
| 778 | Ga0207704_10681021 | 3300025938 | Bacteria | 850 |
| 779 | Ga0207704_11373056 | 3300025938 | Bacteria | 605 |
| 780 | Ga0207691_10001131 | 3300025940 | Bacteria | 26484 |
| 781 | Ga0207691_10001663 | 3300025940 | Bacteria | 21997 |
| 782 | Ga0207691_10012709 | 3300025940 | Bacteria | 8063 |
| 783 | Ga0207691_10022785 | 3300025940 | Bacteria | 5905 |
| 784 | Ga0207691_10023069 | 3300025940 | Bacteria | 5861 |
| 785 | Ga0207691_10033026 | 3300025940 | Bacteria | 4820 |
| 786 | Ga0207691_10035543 | 3300025940 | Bacteria | 4623 |
| 787 | Ga0207691_10059029 | 3300025940 | Bacteria | 3489 |
| 788 | Ga0207691_10222012 | 3300025940 | Bacteria | 1638 |
| 789 | Ga0207691_10419274 | 3300025940 | Bacteria | 1141 |
| 790 | Ga0207691_10513620 | 3300025940 | Bacteria | 1017 |
| 791 | Ga0207691_10632706 | 3300025940 | Bacteria | 905 |
| 792 | Ga0207691_10717664 | 3300025940 | Bacteria | 843 |
| 793 | Ga0207711_10003690 | 3300025941 | Bacteria | 13225 |
| 794 | Ga0207711_10036823 | 3300025941 | Bacteria | 4153 |
| 795 | Ga0207711_10049870 | 3300025941 | Bacteria | 3584 |
| 796 | Ga0207711_10131852 | 3300025941 | Bacteria | 2242 |
| 797 | Ga0207711_10154234 | 3300025941 | Bacteria | 2074 |
| 798 | Ga0207689_10006291 | 3300025942 | Bacteria | 10520 |
| 799 | Ga0207689_10026446 | 3300025942 | Bacteria | 4858 |
| 800 | Ga0207689_10164403 | 3300025942 | Bacteria | 1829 |
| 801 | Ga0207689_10479955 | 3300025942 | Bacteria | 1041 |
| 802 | Ga0207689_10481973 | 3300025942 | Bacteria | 1038 |
| 803 | Ga0207689_10935714 | 3300025942 | Bacteria | 731 |
| 804 | Ga0207661_10034192 | 3300025944 | Bacteria | 3951 |
| 805 | Ga0207661_11098916 | 3300025944 | Bacteria | 732 |
| 806 | Ga0207679_10000201 | 3300025945 | Bacteria | 48099 |
| 807 | Ga0207679_10156225 | 3300025945 | Bacteria | 1863 |
| 808 | Ga0207679_10205136 | 3300025945 | Bacteria | 1649 |
| 809 | Ga0207679_11014935 | 3300025945 | Bacteria | 761 |
| 810 | Ga0207679_11330367 | 3300025945 | Bacteria | 659 |
| 811 | Ga0207667_10002059 | 3300025949 | Bacteria | 25205 |
| 812 | Ga0207667_10751256 | 3300025949 | Bacteria | 975 |
| 813 | Ga0207667_11647900 | 3300025949 | Bacteria | 609 |
| 814 | Ga0207651_10000562 | 3300025960 | Bacteria | 15636 |
| 815 | Ga0207651_10007162 | 3300025960 | Bacteria | 5927 |
| 816 | Ga0207651_10066265 | 3300025960 | Bacteria | 2536 |
| 817 | Ga0207651_10239047 | 3300025960 | Bacteria | 1479 |
| 818 | Ga0207651_10271290 | 3300025960 | Bacteria | 1397 |
| 819 | Ga0207651_10613907 | 3300025960 | Bacteria | 952 |
| 820 | Ga0207651_10897019 | 3300025960 | Bacteria | 789 |
| 821 | Ga0207712_10014803 | 3300025961 | Bacteria | 5021 |
| 822 | Ga0207712_10142390 | 3300025961 | Bacteria | 1842 |
| 823 | Ga0207712_10188629 | 3300025961 | Bacteria | 1626 |
| 824 | Ga0207712_10284826 | 3300025961 | Bacteria | 1350 |
| 825 | Ga0207712_10793933 | 3300025961 | Bacteria | 832 |
| 826 | Ga0207668_10001789 | 3300025972 | Bacteria | 12552 |
| 827 | Ga0207668_10002933 | 3300025972 | Bacteria | 10010 |
| 828 | Ga0207668_10158500 | 3300025972 | Bacteria | 1761 |
| 829 | Ga0207640_10055882 | 3300025981 | Bacteria | 2588 |
| 830 | Ga0207640_10518385 | 3300025981 | Bacteria | 996 |
| 831 | Ga0207640_11196877 | 3300025981 | Bacteria | 675 |
| 832 | Ga0207640_11383352 | 3300025981 | Bacteria | 630 |
| 833 | Ga0207658_10000336 | 3300025986 | Bacteria | 47108 |
| 834 | Ga0207658_10002766 | 3300025986 | Bacteria | 12635 |
| 835 | Ga0207658_10009362 | 3300025986 | Bacteria | 6645 |
| 836 | Ga0207658_10051764 | 3300025986 | Bacteria | 3027 |
| 837 | Ga0207658_10174954 | 3300025986 | Bacteria | 1772 |
| 838 | Ga0207658_10252584 | 3300025986 | Bacteria | 1499 |
| 839 | Ga0207658_10492893 | 3300025986 | Bacteria | 1090 |
| 840 | Ga0207658_10670323 | 3300025986 | Bacteria | 936 |
| 841 | Ga0207677_10376693 | 3300026023 | Bacteria | 1197 |
| 842 | Ga0207677_10654372 | 3300026023 | Bacteria | 928 |
| 843 | Ga0207677_10948795 | 3300026023 | Bacteria | 778 |
| 844 | Ga0207677_11042000 | 3300026023 | Bacteria | 743 |
| 845 | Ga0207703_10000277 | 3300026035 | Bacteria | 56761 |
| 846 | Ga0207703_10000866 | 3300026035 | Bacteria | 29661 |
| 847 | Ga0207703_10031615 | 3300026035 | Bacteria | 4186 |
| 848 | Ga0207703_10042191 | 3300026035 | Bacteria | 3659 |
| 849 | Ga0207703_10983484 | 3300026035 | Bacteria | 809 |
| 850 | Ga0207639_10013995 | 3300026041 | Bacteria | 5629 |
| 851 | Ga0207639_10046007 | 3300026041 | Bacteria | 3290 |
| 852 | Ga0207639_10051308 | 3300026041 | Bacteria | 3137 |
| 853 | Ga0207639_10213011 | 3300026041 | Bacteria | 1664 |
| 854 | Ga0207639_10623822 | 3300026041 | Bacteria | 996 |
| 855 | Ga0207678_10007848 | 3300026067 | Bacteria | 9417 |
| 856 | Ga0207678_10009214 | 3300026067 | Bacteria | 8685 |
| 857 | Ga0207678_10253384 | 3300026067 | Bacteria | 1508 |
| 858 | Ga0207678_10492475 | 3300026067 | Bacteria | 1068 |
| 859 | Ga0207678_10516914 | 3300026067 | Bacteria | 1042 |
| 860 | Ga0207678_10563073 | 3300026067 | Bacteria | 997 |
| 861 | Ga0207678_11487702 | 3300026067 | Bacteria | 598 |
| 862 | Ga0207708_10104075 | 3300026075 | Bacteria | 2199 |
| 863 | Ga0207708_10990513 | 3300026075 | Bacteria | 730 |
| 864 | Ga0207702_10117957 | 3300026078 | Bacteria | 2371 |
| 865 | Ga0207702_10230662 | 3300026078 | Bacteria | 1730 |
| 866 | Ga0207702_10871672 | 3300026078 | Bacteria | 892 |
| 867 | Ga0207641_10001090 | 3300026088 | Bacteria | 27309 |
| 868 | Ga0207641_10002663 | 3300026088 | Bacteria | 16308 |
| 869 | Ga0207641_10007781 | 3300026088 | Bacteria | 8905 |
| 870 | Ga0207641_10049730 | 3300026088 | Bacteria | 3544 |
| 871 | Ga0207641_10269052 | 3300026088 | Bacteria | 1598 |
| 872 | Ga0207641_10576301 | 3300026088 | Bacteria | 1100 |
| 873 | Ga0207648_10000193 | 3300026089 | Bacteria | 64119 |
| 874 | Ga0207648_10000512 | 3300026089 | Bacteria | 43350 |
| 875 | Ga0207648_10015267 | 3300026089 | Bacteria | 7065 |
| 876 | Ga0207648_10026488 | 3300026089 | Bacteria | 5151 |
| 877 | Ga0207648_10080813 | 3300026089 | Bacteria | 2836 |
| 878 | Ga0207648_10083200 | 3300026089 | Bacteria | 2791 |
| 879 | Ga0207648_10147787 | 3300026089 | Bacteria | 2073 |
| 880 | Ga0207648_10193541 | 3300026089 | Bacteria | 1803 |
| 881 | Ga0207648_10234269 | 3300026089 | Bacteria | 1634 |
| 882 | Ga0207648_10238932 | 3300026089 | Bacteria | 1617 |
| 883 | Ga0207648_10428686 | 3300026089 | Bacteria | 1202 |
| 884 | Ga0207648_10857208 | 3300026089 | Bacteria | 847 |
| 885 | Ga0207676_10001342 | 3300026095 | Bacteria | 18294 |
| 886 | Ga0207676_10017194 | 3300026095 | Bacteria | 5240 |
| 887 | Ga0207676_10028849 | 3300026095 | Bacteria | 4150 |
| 888 | Ga0207676_10040743 | 3300026095 | Bacteria | 3561 |
| 889 | Ga0207676_10089162 | 3300026095 | Bacteria | 2527 |
| 890 | Ga0207676_10165480 | 3300026095 | Bacteria | 1921 |
| 891 | Ga0207676_10203090 | 3300026095 | Bacteria | 1753 |
| 892 | Ga0207676_10318130 | 3300026095 | Bacteria | 1427 |
| 893 | Ga0207676_10557604 | 3300026095 | Bacteria | 1095 |
| 894 | Ga0207674_10038832 | 3300026116 | Bacteria | 4939 |
| 895 | Ga0207674_10047553 | 3300026116 | Bacteria | 4396 |
| 896 | Ga0207674_10117981 | 3300026116 | Bacteria | 2624 |
| 897 | Ga0207674_10411923 | 3300026116 | Bacteria | 1306 |
| 898 | Ga0207675_100004491 | 3300026118 | Bacteria | 13479 |
| 899 | Ga0207675_100007449 | 3300026118 | Bacteria | 10340 |
| 900 | Ga0207675_100024043 | 3300026118 | Bacteria | 5664 |
| 901 | Ga0207675_100109797 | 3300026118 | Bacteria | 2603 |
| 902 | Ga0207675_100789046 | 3300026118 | Bacteria | 963 |
| 903 | Ga0207683_10003565 | 3300026121 | Bacteria | 13573 |
| 904 | Ga0207683_10011473 | 3300026121 | Bacteria | 7562 |
| 905 | Ga0207683_10026198 | 3300026121 | Bacteria | 5033 |
| 906 | Ga0207683_10054273 | 3300026121 | Bacteria | 3514 |
| 907 | Ga0207683_10058630 | 3300026121 | Bacteria | 3381 |
| 908 | Ga0207683_10063497 | 3300026121 | Bacteria | 3253 |
| 909 | Ga0207683_10069534 | 3300026121 | Bacteria | 3109 |
| 910 | Ga0207683_10102073 | 3300026121 | Bacteria | 2561 |
| 911 | Ga0207683_10177091 | 3300026121 | Bacteria | 1933 |
| 912 | Ga0207683_10241812 | 3300026121 | Bacteria | 1647 |
| 913 | Ga0207683_10328446 | 3300026121 | Bacteria | 1402 |
| 914 | Ga0207683_10465256 | 3300026121 | Bacteria | 1166 |
| 915 | Ga0207698_10014969 | 3300026142 | Bacteria | 5178 |
| 916 | Ga0207698_10026945 | 3300026142 | Bacteria | 4073 |
| 917 | Ga0207698_10031774 | 3300026142 | Bacteria | 3815 |
| 918 | Ga0207698_10057062 | 3300026142 | Bacteria | 3018 |
| 919 | Ga0207698_10218218 | 3300026142 | Bacteria | 1721 |
| 920 | Ga0207698_10356318 | 3300026142 | Bacteria | 1384 |
| 921 | Ga0207698_10426945 | 3300026142 | Bacteria | 1273 |
| 922 | Ga0207698_11044887 | 3300026142 | Bacteria | 828 |
| 923 | Ga0209281_1000084 | 3300027111 | Bacteria | 254215 |
| 924 | Ga0209281_1026166 | 3300027111 | Bacteria | 1081 |
| 925 | Ga0209389_1038266 | 3300027296 | Bacteria | 3781 |
| 926 | Ga0209974_10005575 | 3300027876 | Bacteria | 4423 |
| 927 | Ga0209974_10082990 | 3300027876 | Bacteria | 1105 |
| 928 | Ga0209974_10129742 | 3300027876 | Bacteria | 898 |
| 929 | Ga0209974_10347476 | 3300027876 | Bacteria | 575 |
| 930 | Ga0207428_10112389 | 3300027907 | Bacteria | 2095 |
| 931 | Ga0207428_10598606 | 3300027907 | Bacteria | 794 |
| 932 | Ga0268266_10003010 | 3300028379 | Bacteria | 17318 |
| 933 | Ga0268266_10319051 | 3300028379 | Bacteria | 1454 |
| 934 | Ga0268266_10422883 | 3300028379 | Bacteria | 1263 |
| 935 | Ga0268266_11609399 | 3300028379 | Bacteria | 625 |
| 936 | Ga0268265_10054074 | 3300028380 | Bacteria | 3044 |
| 937 | Ga0268265_10096117 | 3300028380 | Bacteria | 2380 |
| 938 | Ga0268265_10232084 | 3300028380 | Bacteria | 1622 |
| 939 | Ga0268265_10970838 | 3300028380 | Bacteria | 838 |
| 940 | Ga0268265_11083685 | 3300028380 | Bacteria | 795 |
| 941 | Ga0268265_11084055 | 3300028380 | Bacteria | 794 |
| 942 | Ga0268265_12360000 | 3300028380 | Bacteria | 538 |
| 943 | Ga0268264_10003687 | 3300028381 | Bacteria | 13142 |
| 944 | Ga0268264_10064917 | 3300028381 | Bacteria | 3073 |
| 945 | Ga0268264_10371228 | 3300028381 | Bacteria | 1367 |
| 946 | Ga0268264_10610115 | 3300028381 | Bacteria | 1076 |
| 947 | Ga0265326_10027167 | 3300028558 | Bacteria | 1632 |
| 948 | Ga0265319_1169895 | 3300028563 | Bacteria | 672 |
| 949 | Ga0265334_10025101 | 3300028573 | Bacteria | 2415 |
| 950 | Ga0265318_10000347 | 3300028577 | Bacteria | 36774 |
| 951 | Ga0307517_10137926 | 3300028786 | Bacteria | 1726 |
| 952 | Ga0307517_10149902 | 3300028786 | Bacteria | 1604 |
| 953 | Ga0307515_10000093 | 3300028794 | Bacteria | 212053 |
| 954 | Ga0307515_10001261 | 3300028794 | Bacteria | 57708 |
| 955 | Ga0307515_10001283 | 3300028794 | Bacteria | 57022 |
| 956 | Ga0307515_10002007 | 3300028794 | Bacteria | 45041 |
| 957 | Ga0307515_10004636 | 3300028794 | Bacteria | 28226 |
| 958 | Ga0307515_10009359 | 3300028794 | Bacteria | 18952 |
| 959 | Ga0307515_10020687 | 3300028794 | Bacteria | 11721 |
| 960 | Ga0307515_10026101 | 3300028794 | Bacteria | 10069 |
| 961 | Ga0307515_10033140 | 3300028794 | Bacteria | 8518 |
| 962 | Ga0307515_10097581 | 3300028794 | Bacteria | 3590 |
| 963 | Ga0307515_10601201 | 3300028794 | Bacteria | 710 |
| 964 | Ga0265324_10056156 | 3300029957 | Bacteria | 1349 |
| 965 | Ga0268256_1046721 | 3300030500 | Bacteria | 936 |
| 966 | Ga0307511_10023720 | 3300030521 | Bacteria | 5711 |
| 967 | Ga0265330_10001084 | 3300031235 | Bacteria | 16403 |
| 968 | Ga0265332_10000920 | 3300031238 | Bacteria | 17618 |
| 969 | Ga0265332_10032003 | 3300031238 | Bacteria | 2293 |
| 970 | Ga0265332_10037720 | 3300031238 | Bacteria | 2095 |
| 971 | Ga0265328_10000034 | 3300031239 | Bacteria | 99505 |
| 972 | Ga0265328_10007066 | 3300031239 | Bacteria | 4703 |
| 973 | Ga0265328_10047051 | 3300031239 | Bacteria | 1585 |
| 974 | Ga0265320_10000726 | 3300031240 | Bacteria | 25199 |
| 975 | Ga0265329_10002112 | 3300031242 | Bacteria | 9220 |
| 976 | Ga0265329_10009738 | 3300031242 | Bacteria | 3564 |
| 977 | Ga0265340_10053639 | 3300031247 | Bacteria | 1947 |
| 978 | Ga0265339_10140775 | 3300031249 | Bacteria | 1227 |
| 979 | Ga0265331_10000024 | 3300031250 | Bacteria | 235118 |
| 980 | Ga0265331_10001289 | 3300031250 | Bacteria | 18660 |
| 981 | Ga0265331_10170948 | 3300031250 | Bacteria | 983 |
| 982 | Ga0265327_10000079 | 3300031251 | Bacteria | 206892 |
| 983 | Ga0265327_10001928 | 3300031251 | Bacteria | 23964 |
| 984 | Ga0265327_10003163 | 3300031251 | Bacteria | 16124 |
| 985 | Ga0265316_10000181 | 3300031344 | Bacteria | 71764 |
| 986 | Ga0265316_10003160 | 3300031344 | Bacteria | 16764 |
| 987 | Ga0265316_10276769 | 3300031344 | Bacteria | 1227 |
| 988 | Ga0307513_10000054 | 3300031456 | Bacteria | 148887 |
| 989 | Ga0307513_10006568 | 3300031456 | Bacteria | 15190 |
| 990 | Ga0307513_10018646 | 3300031456 | Bacteria | 8286 |
| 991 | Ga0307513_10042813 | 3300031456 | Bacteria | 4980 |
| 992 | Ga0307513_10044622 | 3300031456 | Bacteria | 4854 |
| 993 | Ga0307513_10044801 | 3300031456 | Bacteria | 4842 |
| 994 | Ga0307513_10402559 | 3300031456 | Bacteria | 1103 |
| 995 | Ga0307513_10539573 | 3300031456 | Bacteria | 880 |
| 996 | Ga0307513_10693937 | 3300031456 | Bacteria | 724 |
| 997 | Ga0307509_10095877 | 3300031507 | Bacteria | 3021 |
| 998 | Ga0307509_10459073 | 3300031507 | Bacteria | 966 |
| 999 | Ga0307408_100000086 | 3300031548 | Bacteria | 101944 |
| 1000 | Ga0307408_100022993 | 3300031548 | Bacteria | 4242 |
| 1001 | Ga0307408_100046888 | 3300031548 | Bacteria | 3092 |
| 1002 | Ga0307408_100067163 | 3300031548 | Bacteria | 2636 |
| 1003 | Ga0307408_100160787 | 3300031548 | Bacteria | 1784 |
| 1004 | Ga0307408_100187706 | 3300031548 | Bacteria | 1663 |
| 1005 | Ga0307408_100378949 | 3300031548 | Bacteria | 1209 |
| 1006 | Ga0307408_100803196 | 3300031548 | Bacteria | 854 |
| 1007 | Ga0307508_10003350 | 3300031616 | Bacteria | 16262 |
| 1008 | Ga0307508_10192655 | 3300031616 | Bacteria | 1640 |
| 1009 | Ga0307514_10000795 | 3300031649 | Bacteria | 52015 |
| 1010 | Ga0307514_10001506 | 3300031649 | Bacteria | 27927 |
| 1011 | Ga0307514_10019015 | 3300031649 | Bacteria | 5624 |
| 1012 | Ga0316575_10011595 | 3300031665 | Bacteria | 3264 |
| 1013 | Ga0316575_10021874 | 3300031665 | Bacteria | 2465 |
| 1014 | Ga0316575_10229925 | 3300031665 | Bacteria | 775 |
| 1015 | Ga0316579_10101236 | 3300031691 | Bacteria | 1380 |
| 1016 | Ga0265314_10002818 | 3300031711 | Bacteria | 17343 |
| 1017 | Ga0265314_10030007 | 3300031711 | Bacteria | 4031 |
| 1018 | Ga0265314_10038203 | 3300031711 | Bacteria | 3471 |
| 1019 | Ga0265342_10013145 | 3300031712 | Bacteria | 5568 |
| 1020 | Ga0265342_10161854 | 3300031712 | Bacteria | 1236 |
| 1021 | Ga0265342_10179830 | 3300031712 | Bacteria | 1159 |
| 1022 | Ga0316576_10056045 | 3300031727 | Bacteria | 2878 |
| 1023 | Ga0316576_10056950 | 3300031727 | Bacteria | 2856 |
| 1024 | Ga0316576_10062960 | 3300031727 | Bacteria | 2722 |
| 1025 | Ga0316576_10133008 | 3300031727 | Bacteria | 1871 |
| 1026 | Ga0316576_10349662 | 3300031727 | Bacteria | 1100 |
| 1027 | Ga0316576_10369636 | 3300031727 | Bacteria | 1066 |
| 1028 | Ga0316576_10737003 | 3300031727 | Bacteria | 712 |
| 1029 | Ga0316578_10035518 | 3300031728 | Bacteria | 2866 |
| 1030 | Ga0316578_10043091 | 3300031728 | Bacteria | 2619 |
| 1031 | Ga0316578_10309484 | 3300031728 | Bacteria | 944 |
| 1032 | Ga0307516_10000383 | 3300031730 | Bacteria | 57684 |
| 1033 | Ga0307516_10004457 | 3300031730 | Bacteria | 17254 |
| 1034 | Ga0307516_10011720 | 3300031730 | Bacteria | 9515 |
| 1035 | Ga0307516_10017724 | 3300031730 | Bacteria | 7419 |
| 1036 | Ga0307405_10005414 | 3300031731 | Bacteria | 6156 |
| 1037 | Ga0307405_10461688 | 3300031731 | Bacteria | 1009 |
| 1038 | Ga0316577_10028286 | 3300031733 | Bacteria | 3126 |
| 1039 | Ga0316577_10092948 | 3300031733 | Bacteria | 1689 |
| 1040 | Ga0307413_10020005 | 3300031824 | Bacteria | 3550 |
| 1041 | Ga0307413_10445499 | 3300031824 | Bacteria | 1026 |
| 1042 | Ga0307413_10735437 | 3300031824 | Bacteria | 823 |
| 1043 | Ga0307410_10023516 | 3300031852 | Bacteria | 3832 |
| 1044 | Ga0307410_10270386 | 3300031852 | Bacteria | 1329 |
| 1045 | Ga0307410_10656781 | 3300031852 | Bacteria | 880 |
| 1046 | Ga0307406_10025180 | 3300031901 | Bacteria | 3560 |
| 1047 | Ga0307406_10086465 | 3300031901 | Bacteria | 2099 |
| 1048 | Ga0307406_10244742 | 3300031901 | Bacteria | 1347 |
| 1049 | Ga0307407_10034140 | 3300031903 | Bacteria | 2782 |
| 1050 | Ga0307407_11071374 | 3300031903 | Bacteria | 625 |
| 1051 | Ga0307412_10113378 | 3300031911 | Bacteria | 1940 |
| 1052 | Ga0307409_100009342 | 3300031995 | Bacteria | 6018 |
| 1053 | Ga0307409_100399816 | 3300031995 | Bacteria | 1312 |
| 1054 | Ga0307409_100539592 | 3300031995 | Bacteria | 1143 |
| 1055 | Ga0307409_100950063 | 3300031995 | Bacteria | 875 |
| 1056 | Ga0307409_101072765 | 3300031995 | Bacteria | 826 |
| 1057 | Ga0307416_100003992 | 3300032002 | Bacteria | 8796 |
| 1058 | Ga0307416_100909977 | 3300032002 | Bacteria | 980 |
| 1059 | Ga0307414_10148718 | 3300032004 | Bacteria | 1844 |
| 1060 | Ga0307414_10812751 | 3300032004 | Bacteria | 853 |
| 1061 | Ga0307414_11196898 | 3300032004 | Bacteria | 703 |
| 1062 | Ga0307414_11417309 | 3300032004 | Bacteria | 646 |
| 1063 | Ga0307414_11708164 | 3300032004 | Bacteria | 587 |
| 1064 | Ga0307411_10001320 | 3300032005 | Bacteria | 9982 |
| 1065 | Ga0307411_10005005 | 3300032005 | Bacteria | 6447 |
| 1066 | Ga0307411_10228908 | 3300032005 | Bacteria | 1447 |
| 1067 | Ga0307411_11399808 | 3300032005 | Bacteria | 640 |
| 1068 | Ga0307415_100006691 | 3300032126 | Bacteria | 6240 |
| 1069 | Ga0307415_100339325 | 3300032126 | Bacteria | 1260 |
| 1070 | Ga0307415_101042866 | 3300032126 | Bacteria | 762 |
| 1071 | Ga0316580_10012176 | 3300032139 | Bacteria | 2618 |
| 1072 | Ga0307507_10157523 | 3300033179 | Bacteria | 1688 |
| 1073 | Ga0307510_10113907 | 3300033180 | Bacteria | 2435 |
| 1074 | Ga0373948_0002019 | 3300034817 | Bacteria | 2929 |
| 1075 | Ga0373959_0051324 | 3300034820 | Bacteria | 891 |
| 1076 | Ga0373938_0101796 | 3300034957 | Bacteria | 722 |
| 1077 | Ga0373928_0096224 | 3300035084 | Bacteria | 766 |
| 1078 | Ga0373940_0019893 | 3300035088 | Bacteria | 1700 |
| 1079 | Ga0373940_0298720 | 3300035088 | Bacteria | 554 |
| 1080 | Ga0373949_0112347 | 3300035090 | Bacteria | 757 |
| 1081 | Ga0373951_0047822 | 3300035091 | Bacteria | 1046 |
| 1082 | Ga0373932_0187236 | 3300035112 | Bacteria | 729 |
| 1083 | Ga0373932_0226077 | 3300035112 | Bacteria | 674 |
| 1084 | Ga0373936_0108705 | 3300035113 | Bacteria | 1176 |
| 1085 | Ga0373939_0000017 | 3300035114 | Bacteria | 61924 |
| 1086 | Ga0373941_0085831 | 3300035115 | Bacteria | 1071 |
| 1087 | Ga0373945_0451096 | 3300035116 | Bacteria | 569 |
| 1088 | Ga0373960_0000109 | 3300035121 | Bacteria | 13152 |
| 1089 | Ga0373943_0130231 | 3300035170 | Bacteria | 1346 |
| 1090 | Ga0373943_0287586 | 3300035170 | Bacteria | 931 |
| 1091 | Ga0373943_0414377 | 3300035170 | Bacteria | 779 |
| 1092 | Ga0373946_0073518 | 3300035171 | Bacteria | 1482 |
| 1093 | Ga0373946_0227840 | 3300035171 | Bacteria | 902 |
| 1094 | Ga0373946_0283561 | 3300035171 | Bacteria | 815 |
| 1095 | Ga0373955_0006739 | 3300035172 | Bacteria | 5244 |
| 1096 | Ga0373955_0311201 | 3300035172 | Bacteria | 951 |
| 1097 | Ga0373955_0360841 | 3300035172 | Bacteria | 881 |
| 1098 | Ga0373955_0727802 | 3300035172 | Bacteria | 609 |
| 1099 | Ga0373961_0195318 | 3300035241 | Bacteria | 711 |
| 1100 | Ga0316574_0002109 | 3300035398 | Bacteria | 9863 |
| 1101 | Ga0316574_0004706 | 3300035398 | Bacteria | 7195 |
| 1102 | Ga0316574_0006307 | 3300035398 | Bacteria | 6398 |
| 1103 | Ga0316574_0106501 | 3300035398 | Bacteria | 1796 |
| 1104 | Ga0316574_0167217 | 3300035398 | Bacteria | 1416 |
| 1105 | Ga0316574_0280514 | 3300035398 | Bacteria | 1061 |
| 1106 | Ga0316574_0783821 | 3300035398 | Bacteria | 581 |
| 1107 | Ga0373924_0166644 | 3300035410 | Bacteria | 967 |
| 1108 | Ga0373924_0194584 | 3300035410 | Bacteria | 894 |
| 1109 | Ga0373924_0245055 | 3300035410 | Bacteria | 793 |
| 1110 | Ga0373931_0000641 | 3300035691 | Bacteria | 14534 |
| 1111 | Ga0373931_0014924 | 3300035691 | Bacteria | 3806 |
| 1112 | Ga0373935_0302056 | 3300035692 | Bacteria | 1132 |
| 1113 | Ga0373927_0286813 | 3300035695 | Bacteria | 1083 |
| 1114 | Ga0373933_0018395 | 3300035724 | Bacteria | 3929 |
| 1115 | Ga0373947_0215560 | 3300035725 | Bacteria | 1260 |
| 1116 | Ga0373937_0005971 | 3300036401 | Bacteria | 10483 |
| 1117 | Ga0373937_0052497 | 3300036401 | Bacteria | 3738 |
| 1118 | Ga0373937_0075221 | 3300036401 | Bacteria | 3117 |
| 1119 | Ga0373937_0150570 | 3300036401 | Bacteria | 2179 |
| 1120 | Ga0373937_0224658 | 3300036401 | Bacteria | 1767 |
| 1121 | Ga0373937_0293183 | 3300036401 | Bacteria | 1537 |
| 1122 | Ga0373937_0901458 | 3300036401 | Bacteria | 833 |
| 1123 | Ga0316582_0001870 | 3300036647 | Bacteria | 9560 |
| 1124 | Ga0316582_0034461 | 3300036647 | Bacteria | 3118 |
| 1125 | Ga0316582_0134775 | 3300036647 | Bacteria | 1661 |
| 1126 | Ga0316584_0027762 | 3300036712 | Bacteria | 4167 |
| 1127 | Ga0316584_0050235 | 3300036712 | Bacteria | 3117 |
| 1128 | Ga0316584_0127724 | 3300036712 | Bacteria | 1899 |
| 1129 | Ga0316584_0194067 | 3300036712 | Bacteria | 1500 |
| 1130 | Ga0373925_0100843 | 3300037068 | Bacteria | 2219 |
| 1131 | Ga0373925_0231330 | 3300037068 | Bacteria | 1478 |
| 1132 | Ga0373925_0521850 | 3300037068 | Bacteria | 976 |
| 1133 | Ga0373925_0801770 | 3300037068 | Bacteria | 776 |
| 1134 | Ga0373925_0954722 | 3300037068 | Bacteria | 706 |
| 1135 | Ga0373925_1242065 | 3300037068 | Bacteria | 612 |
| 1136 | Ga0395899_0000010 | 3300037312 | Bacteria | 523837 |
| 1137 | Ga0395899_0018492 | 3300037312 | Bacteria | 5297 |
| 1138 | Ga0395899_0235742 | 3300037312 | Bacteria | 1261 |
| 1139 | Ga0395900_0000005 | 3300037418 | Bacteria | 523836 |
| 1140 | Ga0395900_0008244 | 3300037418 | Bacteria | 10728 |
| 1141 | Ga0395900_0010948 | 3300037418 | Bacteria | 9276 |
| 1142 | Ga0395900_0105001 | 3300037418 | Bacteria | 2902 |
| 1143 | Ga0395900_0128127 | 3300037418 | Bacteria | 2602 |
| 1144 | Ga0395900_0139094 | 3300037418 | Bacteria | 2487 |
| 1145 | Ga0395900_0181050 | 3300037418 | Bacteria | 2142 |
| 1146 | Ga0395900_0229277 | 3300037418 | Bacteria | 1869 |
| 1147 | Ga0395900_0404011 | 3300037418 | Bacteria | 1329 |
| 1148 | Ga0395900_1492503 | 3300037418 | Bacteria | 588 |
| 1149 | Ga0395898_0013534 | 3300037466 | Bacteria | 8399 |
| 1150 | Ga0395898_0018082 | 3300037466 | Bacteria | 7192 |
| 1151 | Ga0395898_0109116 | 3300037466 | Bacteria | 2653 |
| 1152 | Ga0395898_0418814 | 3300037466 | Bacteria | 1277 |
| 1153 | Ga0395905_0000653 | 3300037471 | Bacteria | 46132 |
| 1154 | Ga0395905_0000733 | 3300037471 | Bacteria | 43190 |
| 1155 | Ga0395905_0000895 | 3300037471 | Bacteria | 38905 |
| 1156 | Ga0395905_0003480 | 3300037471 | Bacteria | 16823 |
| 1157 | Ga0395905_0018268 | 3300037471 | Bacteria | 6657 |
| 1158 | Ga0395905_0073034 | 3300037471 | Bacteria | 3215 |
| 1159 | Ga0395905_0102588 | 3300037471 | Bacteria | 2685 |
| 1160 | Ga0395905_0123164 | 3300037471 | Bacteria | 2438 |
| 1161 | Ga0395905_0203231 | 3300037471 | Bacteria | 1857 |
| 1162 | Ga0395905_0303223 | 3300037471 | Bacteria | 1485 |
| 1163 | Ga0395905_0355915 | 3300037471 | Bacteria | 1356 |
| 1164 | Ga0436364_0528735 | 3300037853 | Bacteria | 840 |
| 1165 | Ga0436364_0667041 | 3300037853 | Bacteria | 2536 |
| 1166 | Ga0436364_1043221 | 3300037853 | Bacteria | 42769 |
| 1167 | Ga0395901_0051281 | 3300038443 | Bacteria | 4289 |
| 1168 | Ga0395901_0052453 | 3300038443 | Bacteria | 4239 |
| 1169 | Ga0395901_0065113 | 3300038443 | Bacteria | 3794 |
| 1170 | Ga0395901_0081508 | 3300038443 | Bacteria | 3380 |
| 1171 | Ga0395901_0136710 | 3300038443 | Bacteria | 2575 |
| 1172 | Ga0395901_0175988 | 3300038443 | Bacteria | 2244 |
| 1173 | Ga0395901_0277755 | 3300038443 | Bacteria | 1741 |
| 1174 | Ga0395901_0529523 | 3300038443 | Bacteria | 1196 |
| 1175 | Ga0400490_35404 | 3300038726 | Bacteria | 4845 |
| 1176 | Ga0400488_10414 | 3300038741 | Bacteria | 1515 |
| 1177 | Ga0400483_115564 | 3300039062 | Bacteria | 1608 |
| 1178 | Ga0400483_167120 | 3300039062 | Bacteria | 1856 |
| 1179 | Ga0400489_77120 | 3300039093 | Bacteria | 1269 |
| 1180 | Ga0237816_00148 | 3300039145 | Bacteria | 5547 |
| 1181 | Ga0436365_0308506 | 3300039437 | Bacteria | 1267 |
| 1182 | Ga0436365_0805618 | 3300039437 | Bacteria | 2672 |
| 1183 | Ga0436365_0960828 | 3300039437 | Bacteria | 636 |
| 1184 | Ga0436365_1149228 | 3300039437 | Bacteria | 1437 |
| 1185 | Ga0436365_1378466 | 3300039437 | Bacteria | 1244 |
| 1186 | Ga0436361_0932343 | 3300039447 | Bacteria | 25287 |
| 1187 | Ga0436363_0998404 | 3300039450 | Bacteria | 907 |
| 1188 | Ga0439438_000268 | 3300041405 | Bacteria | 23335 |
| 1189 | Ga0439461_0020382 | 3300041410 | Bacteria | 1312 |
| 1190 | Ga0451787_664484 | 3300041441 | Bacteria | 1570 |
| 1191 | Ga0451789_0205740 | 3300041443 | Bacteria | 1201 |
| 1192 | Ga0451789_0668546 | 3300041443 | Bacteria | 777 |
| 1193 | Ga0451791_0533597 | 3300041451 | Bacteria | 2737 |
| 1194 | Ga0451793_0259988 | 3300041452 | Bacteria | 764 |
| 1195 | Ga0451793_0300321 | 3300041452 | Bacteria | 1572 |
| 1196 | Ga0451793_0779431 | 3300041452 | Bacteria | 589 |
| 1197 | Ga0451793_1098328 | 3300041452 | Bacteria | 1729 |
| 1198 | Ga0451797_0814064 | 3300041453 | Bacteria | 979 |
| 1199 | Ga0451797_0960381 | 3300041453 | Bacteria | 834 |
| 1200 | Ga0451797_1287132 | 3300041453 | Bacteria | 622 |
| 1201 | Ga0451795_0037673 | 3300041456 | Bacteria | 1169 |
| 1202 | Ga0451795_0302360 | 3300041456 | Bacteria | 632 |
| 1203 | Ga0451795_1093367 | 3300041456 | Bacteria | 773 |
| 1204 | Ga0451800_0531416 | 3300041459 | Bacteria | 707 |
| 1205 | Ga0451800_1143563 | 3300041459 | Bacteria | 861 |
| 1206 | Ga0451800_1336356 | 3300041459 | Bacteria | 716 |
| 1207 | Ga0451800_1347080 | 3300041459 | Bacteria | 1140 |
| 1208 | Ga0451800_1453629 | 3300041459 | Bacteria | 867 |
| 1209 | Ga0451802_0737550 | 3300041460 | Bacteria | 2476 |
| 1210 | Ga0451802_1791109 | 3300041460 | Bacteria | 1088 |
| 1211 | Ga0451807_0109086 | 3300041486 | Bacteria | 1433 |
| 1212 | Ga0451807_1015374 | 3300041486 | Bacteria | 4853 |
| 1213 | Ga0451807_2127931 | 3300041486 | Unclassified | 986 |
| 1214 | Ga0451833_0875683 | 3300041491 | Bacteria | 4595 |
| 1215 | Ga0451833_1495386 | 3300041491 | Bacteria | 2204 |
| 1216 | Ga0451837_0954212 | 3300041494 | Bacteria | 2847 |
| 1217 | Ga0451841_0278424 | 3300041498 | Bacteria | 942 |
| 1218 | Ga0451841_0659571 | 3300041498 | Bacteria | 861 |
| 1219 | Ga0451851_1274973 | 3300041507 | Bacteria | 1302 |
| 1220 | Ga0451843_0108815 | 3300041509 | Bacteria | 655 |
| 1221 | Ga0451853_1190134 | 3300041512 | Bacteria | 2455 |
| 1222 | Ga0451853_3865866 | 3300041512 | Bacteria | 1056 |
| 1223 | Ga0451853_4036164 | 3300041512 | Bacteria | 1608 |
| 1224 | Ga0439437_002898 | 3300042000 | Bacteria | 1848 |
| 1225 | Ga0439442_050139 | 3300042002 | Bacteria | 880 |
| 1226 | Ga0439463_000609 | 3300042016 | Bacteria | 9928 |
| 1227 | Ga0450911_020803 | 3300042115 | Bacteria | 856 |
| 1228 | Ga0450913_017850 | 3300042117 | Bacteria | 630 |
| 1229 | Ga0450917_002467 | 3300042120 | Bacteria | 1320 |
| 1230 | Ga0450888_000480 | 3300042126 | Bacteria | 3773 |
| 1231 | Ga0450890_000295 | 3300042127 | Bacteria | 7255 |
| 1232 | Ga0450890_039658 | 3300042127 | Bacteria | 693 |
| 1233 | Ga0450892_001087 | 3300042130 | Bacteria | 2844 |
| 1234 | Ga0450903_027492 | 3300042138 | Bacteria | 865 |
| 1235 | Ga0450904_014358 | 3300042139 | Bacteria | 790 |
| 1236 | Ga0450889_009573 | 3300042144 | Bacteria | 993 |
| 1237 | Ga0439446_0004039 | 3300042156 | Bacteria | 3691 |
| 1238 | Ga0450893_0021574 | 3300042532 | Bacteria | 1112 |
| 1239 | Ga0451577_0000013 | 3300042876 | Bacteria | 550689 |
| 1240 | Ga0451577_0003554 | 3300042876 | Bacteria | 17210 |
| 1241 | Ga0451577_0003789 | 3300042876 | Bacteria | 16461 |
| 1242 | Ga0451577_0005413 | 3300042876 | Bacteria | 13094 |
| 1243 | Ga0451577_0036543 | 3300042876 | Bacteria | 4421 |
| 1244 | Ga0451577_0143508 | 3300042876 | Bacteria | 2146 |
| 1245 | Ga0451577_0537562 | 3300042876 | Bacteria | 1061 |
| 1246 | Ga0451577_1964921 | 3300042876 | Bacteria | 512 |
| 1247 | Ga0466969_0000036 | 3300044656 | Bacteria | 75718 |
| 1248 | Ga0466969_0006230 | 3300044656 | Bacteria | 6352 |
| 1249 | Ga0466969_0025156 | 3300044656 | Bacteria | 3063 |
| 1250 | Ga0466969_0032912 | 3300044656 | Bacteria | 2634 |
| 1251 | Ga0466969_0039565 | 3300044656 | Bacteria | 2367 |
| 1252 | Ga0466972_0000282 | 3300044658 | Bacteria | 31733 |
| 1253 | Ga0466972_0267270 | 3300044658 | Bacteria | 799 |
| 1254 | Ga0453683_0000059 | 3300044673 | Bacteria | 187158 |
| 1255 | Ga0453683_0004047 | 3300044673 | Bacteria | 10564 |
| 1256 | Ga0453683_1236468 | 3300044673 | Bacteria | 501 |
| 1257 | Ga0466965_0049757 | 3300044683 | Bacteria | 2077 |
| 1258 | Ga0466965_0091575 | 3300044683 | Bacteria | 1547 |
| 1259 | Ga0466965_0195039 | 3300044683 | Bacteria | 1072 |
| 1260 | Ga0466965_0223023 | 3300044683 | Bacteria | 1005 |
| 1261 | Ga0466965_0231324 | 3300044683 | Bacteria | 987 |
| 1262 | Ga0466966_0026011 | 3300044684 | Bacteria | 3821 |
| 1263 | Ga0466966_0224184 | 3300044684 | Bacteria | 1134 |
| 1264 | Ga0466961_0000406 | 3300044693 | Bacteria | 27671 |
| 1265 | Ga0466961_0003921 | 3300044693 | Bacteria | 9308 |
| 1266 | Ga0466961_0015938 | 3300044693 | Bacteria | 4823 |
| 1267 | Ga0466961_0027523 | 3300044693 | Bacteria | 3657 |
| 1268 | Ga0466961_0231567 | 3300044693 | Bacteria | 1137 |
| 1269 | Ga0466963_0008785 | 3300044694 | Bacteria | 6068 |
| 1270 | Ga0466963_0355516 | 3300044694 | Bacteria | 1032 |
| 1271 | Ga0466963_1240527 | 3300044694 | Bacteria | 524 |
| 1272 | Ga0466964_0261218 | 3300044706 | Bacteria | 858 |
| 1273 | Ga0453684_0000040 | 3300044712 | Bacteria | 690210 |
| 1274 | Ga0453684_0000085 | 3300044712 | Bacteria | 397817 |
| 1275 | Ga0453684_0070718 | 3300044712 | Bacteria | 4417 |
| 1276 | Ga0453684_1221549 | 3300044712 | Bacteria | 788 |
| 1277 | Ga0453684_1418603 | 3300044712 | Bacteria | 719 |
| 1278 | Ga0453684_1703371 | 3300044712 | Bacteria | 644 |
| 1279 | Ga0466971_0034131 | 3300044719 | Bacteria | 2280 |
| 1280 | Ga0466970_0023540 | 3300044765 | Bacteria | 3218 |
| 1281 | Ga0466970_0025771 | 3300044765 | Bacteria | 3080 |
| 1282 | Ga0466970_0046693 | 3300044765 | Bacteria | 2307 |
| 1283 | Ga0466970_0401824 | 3300044765 | Bacteria | 782 |
| 1284 | Ga0466957_0238191 | 3300044842 | Bacteria | 1207 |
| 1285 | Ga0466959_0032407 | 3300045049 | Bacteria | 3868 |
| 1286 | Ga0466959_0038662 | 3300045049 | Bacteria | 3526 |
| 1287 | Ga0466959_0042728 | 3300045049 | Bacteria | 3343 |
| 1288 | Ga0466959_0306609 | 3300045049 | Bacteria | 1087 |
| 1289 | Ga0466959_0767138 | 3300045049 | Bacteria | 645 |
| 1290 | Ga0451576_0000018 | 3300045051 | Bacteria | 550689 |
| 1291 | Ga0451576_0006036 | 3300045051 | Bacteria | 14958 |
| 1292 | Ga0451576_0046314 | 3300045051 | Bacteria | 4580 |
| 1293 | Ga0451576_0062742 | 3300045051 | Bacteria | 3873 |
| 1294 | Ga0451576_0147519 | 3300045051 | Bacteria | 2453 |
| 1295 | Ga0451576_0625897 | 3300045051 | Bacteria | 1131 |
| 1296 | Ga0451576_1084978 | 3300045051 | Bacteria | 838 |
| 1297 | Ga0451576_1689404 | 3300045051 | Bacteria | 656 |
| 1298 | Ga0466967_1225235 | 3300045976 | Bacteria | 748 |
| 1299 | Ga0495617_171111 | 3300046452 | Bacteria | 686 |
| 1300 | Ga0495627_008265 | 3300046453 | Bacteria | 3915 |
| 1301 | Ga0495592_0059971 | 3300046454 | Bacteria | 2800 |
| 1302 | Ga0495590_0169163 | 3300046457 | Bacteria | 796 |
| 1303 | Ga0495591_002740 | 3300046458 | Bacteria | 9543 |
| 1304 | Ga0495629_0016220 | 3300046459 | Bacteria | 5348 |
| 1305 | Ga0495629_0107860 | 3300046459 | Bacteria | 1942 |
| 1306 | Ga0495629_0252120 | 3300046459 | Bacteria | 1214 |
| 1307 | Ga0495629_0480371 | 3300046459 | Bacteria | 839 |
| 1308 | Ga0495638_0060421 | 3300046460 | Bacteria | 2344 |
| 1309 | Ga0495638_0088234 | 3300046460 | Bacteria | 1872 |
| 1310 | Ga0495638_0115806 | 3300046460 | Bacteria | 1588 |
| 1311 | Ga0495638_0550317 | 3300046460 | Bacteria | 574 |
| 1312 | Ga0495653_0019297 | 3300046463 | Bacteria | 5528 |
| 1313 | Ga0495650_0008829 | 3300046471 | Bacteria | 5823 |
| 1314 | Ga0495650_0059084 | 3300046471 | Bacteria | 1545 |
| 1315 | Ga0495580_0100343 | 3300046472 | Bacteria | 2014 |
| 1316 | Ga0495580_0206695 | 3300046472 | Bacteria | 1352 |
| 1317 | Ga0495580_0210191 | 3300046472 | Bacteria | 1339 |
| 1318 | Ga0495580_0234349 | 3300046472 | Bacteria | 1260 |
| 1319 | Ga0495580_0365861 | 3300046472 | Bacteria | 975 |
| 1320 | Ga0495580_0383443 | 3300046472 | Bacteria | 949 |
| 1321 | Ga0495580_0468007 | 3300046472 | Bacteria | 844 |
| 1322 | Ga0495582_0014361 | 3300046473 | Bacteria | 4354 |
| 1323 | Ga0495582_0117472 | 3300046473 | Bacteria | 1497 |
| 1324 | Ga0495582_0355075 | 3300046473 | Bacteria | 844 |
| 1325 | Ga0495605_0000079 | 3300046474 | Bacteria | 126756 |
| 1326 | Ga0495605_0010273 | 3300046474 | Bacteria | 5242 |
| 1327 | Ga0495664_0023776 | 3300046477 | Bacteria | 3557 |
| 1328 | Ga0495664_0098878 | 3300046477 | Bacteria | 1757 |
| 1329 | Ga0495584_0053064 | 3300046491 | Bacteria | 2040 |
| 1330 | Ga0495594_0002116 | 3300046499 | Bacteria | 10340 |
| 1331 | Ga0495596_0116045 | 3300046500 | Bacteria | 1040 |
| 1332 | Ga0495607_0005948 | 3300046501 | Bacteria | 8652 |
| 1333 | Ga0495607_0024242 | 3300046501 | Bacteria | 3785 |
| 1334 | Ga0495607_0027845 | 3300046501 | Bacteria | 3490 |
| 1335 | Ga0495607_0187075 | 3300046501 | Bacteria | 1034 |
| 1336 | Ga0495607_0191961 | 3300046501 | Bacteria | 1017 |
| 1337 | Ga0495583_0006278 | 3300046506 | Bacteria | 7812 |
| 1338 | Ga0495583_0138597 | 3300046506 | Bacteria | 1014 |
| 1339 | Ga0495606_0000018 | 3300046507 | Bacteria | 281058 |
| 1340 | Ga0495606_0001693 | 3300046507 | Bacteria | 28471 |
| 1341 | Ga0495606_0004808 | 3300046507 | Bacteria | 13263 |
| 1342 | Ga0495606_0012829 | 3300046507 | Bacteria | 6677 |
| 1343 | Ga0495606_0086766 | 3300046507 | Bacteria | 1933 |
| 1344 | Ga0495608_0532451 | 3300046511 | Bacteria | 709 |
| 1345 | Ga0495610_0039322 | 3300046512 | Bacteria | 2393 |
| 1346 | Ga0495610_0063754 | 3300046512 | Bacteria | 1744 |
| 1347 | Ga0495610_0112226 | 3300046512 | Bacteria | 1206 |
| 1348 | Ga0495610_0151459 | 3300046512 | Bacteria | 989 |
| 1349 | Ga0495610_0237895 | 3300046512 | Bacteria | 727 |
| 1350 | Ga0495618_0690362 | 3300046514 | Bacteria | 601 |
| 1351 | Ga0495620_0013339 | 3300046515 | Bacteria | 4210 |
| 1352 | Ga0495620_0048024 | 3300046515 | Bacteria | 1834 |
| 1353 | Ga0495620_0092085 | 3300046515 | Bacteria | 1215 |
| 1354 | Ga0495620_0300239 | 3300046515 | Bacteria | 610 |
| 1355 | Ga0495628_0245793 | 3300046516 | Bacteria | 1337 |
| 1356 | Ga0495631_0048144 | 3300046518 | Bacteria | 1870 |
| 1357 | Ga0495632_0004573 | 3300046519 | Bacteria | 9377 |
| 1358 | Ga0495632_0005877 | 3300046519 | Bacteria | 8013 |
| 1359 | Ga0495632_0019284 | 3300046519 | Bacteria | 3720 |
| 1360 | Ga0495632_0055251 | 3300046519 | Bacteria | 1944 |
| 1361 | Ga0495632_0067376 | 3300046519 | Bacteria | 1726 |
| 1362 | Ga0495632_0146319 | 3300046519 | Bacteria | 1094 |
| 1363 | Ga0495643_0004561 | 3300046522 | Bacteria | 9647 |
| 1364 | Ga0495643_0277504 | 3300046522 | Bacteria | 772 |
| 1365 | Ga0495644_0040888 | 3300046523 | Bacteria | 1747 |
| 1366 | Ga0495644_0187454 | 3300046523 | Bacteria | 796 |
| 1367 | Ga0495642_0010968 | 3300046528 | Bacteria | 3474 |
| 1368 | Ga0495642_0126278 | 3300046528 | Bacteria | 1100 |
| 1369 | Ga0495652_0474867 | 3300046529 | Bacteria | 871 |
| 1370 | Ga0495654_0091204 | 3300046530 | Bacteria | 1414 |
| 1371 | Ga0495640_0152833 | 3300046533 | Bacteria | 1482 |
| 1372 | Ga0495586_0199579 | 3300046535 | Bacteria | 1134 |
| 1373 | Ga0495598_0126453 | 3300046537 | Bacteria | 872 |
| 1374 | Ga0495598_0273086 | 3300046537 | Bacteria | 632 |
| 1375 | Ga0495598_0363899 | 3300046537 | Bacteria | 559 |
| 1376 | Ga0495609_0124522 | 3300046538 | Bacteria | 1107 |
| 1377 | Ga0495621_0064902 | 3300046539 | Bacteria | 1333 |
| 1378 | Ga0495597_0092634 | 3300046542 | Bacteria | 1281 |
| 1379 | Ga0495597_0278207 | 3300046542 | Bacteria | 652 |
| 1380 | Ga0495645_0074164 | 3300046543 | Bacteria | 2451 |
| 1381 | Ga0495645_0245104 | 3300046543 | Bacteria | 1193 |
| 1382 | Ga0495622_0027086 | 3300046557 | Bacteria | 2675 |
| 1383 | Ga0495656_0124763 | 3300046615 | Bacteria | 1219 |
| 1384 | Ga0495668_0026531 | 3300046616 | Bacteria | 3287 |
| 1385 | Ga0495668_0273037 | 3300046616 | Bacteria | 926 |
| 1386 | Ga0495668_0291160 | 3300046616 | Bacteria | 895 |
| 1387 | Ga0495668_0603867 | 3300046616 | Bacteria | 606 |
| 1388 | Ga0495611_0001249 | 3300046648 | Bacteria | 13066 |
| 1389 | Ga0495611_0063900 | 3300046648 | Bacteria | 1676 |
| 1390 | Ga0495611_0088526 | 3300046648 | Bacteria | 1429 |
| 1391 | Ga0495611_0270890 | 3300046648 | Bacteria | 785 |
| 1392 | Ga0495625_0010777 | 3300046660 | Bacteria | 7524 |
| 1393 | Ga0495625_0128312 | 3300046660 | Bacteria | 1719 |
| 1394 | Ga0495625_0180493 | 3300046660 | Bacteria | 1404 |
| 1395 | Ga0495625_0609068 | 3300046660 | Bacteria | 655 |
| 1396 | Ga0495635_0074733 | 3300046663 | Bacteria | 2322 |
| 1397 | Ga0495635_0115894 | 3300046663 | Bacteria | 1829 |
| 1398 | Ga0495659_0338654 | 3300046664 | Bacteria | 641 |
| 1399 | Ga0495661_0025068 | 3300046665 | Bacteria | 3858 |
| 1400 | Ga0495661_0226445 | 3300046665 | Bacteria | 966 |
| 1401 | Ga0495657_0082973 | 3300046675 | Bacteria | 2070 |
| 1402 | Ga0495599_0161085 | 3300046678 | Bacteria | 1387 |
| 1403 | Ga0495646_0073389 | 3300046680 | Bacteria | 2010 |
| 1404 | Ga0495647_0021435 | 3300046681 | Bacteria | 2326 |
| 1405 | Ga0495647_0021548 | 3300046681 | Bacteria | 2321 |
| 1406 | Ga0495658_0018582 | 3300046683 | Bacteria | 3616 |
| 1407 | Ga0495658_0032930 | 3300046683 | Bacteria | 2834 |
| 1408 | Ga0495658_0254946 | 3300046683 | Bacteria | 1104 |
| 1409 | Ga0495658_0263091 | 3300046683 | Bacteria | 1086 |
| 1410 | Ga0495669_0015535 | 3300046684 | Bacteria | 3261 |
| 1411 | Ga0495613_0339900 | 3300046689 | Bacteria | 1033 |
| 1412 | Ga0495613_0420755 | 3300046689 | Bacteria | 909 |
| 1413 | Ga0495670_0007900 | 3300046691 | Bacteria | 5230 |
| 1414 | Ga0495671_0020895 | 3300046692 | Bacteria | 3445 |
| 1415 | Ga0495671_0053956 | 3300046692 | Bacteria | 1994 |
| 1416 | Ga0495671_0397257 | 3300046692 | Bacteria | 660 |
| 1417 | Ga0495649_0003794 | 3300046694 | Bacteria | 10019 |
| 1418 | Ga0495649_0222559 | 3300046694 | Bacteria | 976 |
| 1419 | Ga0495589_0017714 | 3300046794 | Bacteria | 3655 |
| 1420 | Ga0495589_0272469 | 3300046794 | Bacteria | 788 |
| 1421 | Ga0495600_0286469 | 3300046809 | Bacteria | 1042 |
| 1422 | Ga0495660_0025217 | 3300046810 | Bacteria | 3378 |
| 1423 | Ga0495660_0394460 | 3300046810 | Bacteria | 607 |
| 1424 | Ga0495604_0192249 | 3300047317 | Bacteria | 1421 |
| 1425 | Ga0495636_0060240 | 3300047318 | Bacteria | 1603 |
| 1426 | Ga0495674_0111820 | 3300047319 | Bacteria | 2315 |
| 1427 | Ga0495672_0009983 | 3300047320 | Bacteria | 6811 |
| 1428 | Ga0495680_0255245 | 3300047322 | Bacteria | 1241 |
| 1429 | Ga0495687_000912 | 3300047443 | Bacteria | 30787 |
| 1430 | Ga0495687_011633 | 3300047443 | Bacteria | 4715 |
| 1431 | Ga0495677_0019763 | 3300047445 | Bacteria | 2441 |
| 1432 | Ga0495679_066707 | 3300047446 | Bacteria | 1044 |
| 1433 | Ga0495673_0010730 | 3300047469 | Bacteria | 4964 |
| 1434 | Ga0495673_0021951 | 3300047469 | Bacteria | 3138 |
| 1435 | Ga0495681_0145242 | 3300047470 | Bacteria | 999 |
| 1436 | Ga0495684_0163503 | 3300047471 | Bacteria | 1659 |
| 1437 | Ga0495686_0337769 | 3300047472 | Bacteria | 822 |
| 1438 | Ga0495686_0549571 | 3300047472 | Bacteria | 603 |
| 1439 | Ga0495614_0242387 | 3300048089 | Bacteria | 823 |
| 1440 | Ga0495626_0111959 | 3300048091 | Bacteria | 1181 |
| 1441 | Ga0495626_0124367 | 3300048091 | Bacteria | 1106 |
| 1442 | Ga0496100_0832195 | 3300048903 | Bacteria | 724 |
| 1443 | Ga0496101_0024961 | 3300048904 | Bacteria | 4143 |
| 1444 | Ga0496101_0297444 | 3300048904 | Bacteria | 1264 |
| 1445 | Ga0496101_0364831 | 3300048904 | Bacteria | 1136 |
| 1446 | Ga0496102_0021149 | 3300048905 | Bacteria | 5753 |
| 1447 | Ga0496102_0039318 | 3300048905 | Bacteria | 4274 |
| 1448 | Ga0496102_0079561 | 3300048905 | Bacteria | 3019 |
| 1449 | Ga0496102_0136772 | 3300048905 | Bacteria | 2296 |
| 1450 | Ga0496102_0439587 | 3300048905 | Bacteria | 1224 |
| 1451 | Ga0496102_1093602 | 3300048905 | Bacteria | 717 |
| 1452 | Ga0496104_0013206 | 3300048907 | Bacteria | 7445 |
| 1453 | Ga0496104_0085647 | 3300048907 | Bacteria | 3008 |
| 1454 | Ga0496104_0124767 | 3300048907 | Bacteria | 2472 |
| 1455 | Ga0496105_0745533 | 3300048908 | Bacteria | 748 |
| 1456 | Ga0496106_0057379 | 3300048909 | Bacteria | 2944 |
| 1457 | Ga0496106_0084887 | 3300048909 | Bacteria | 2437 |
| 1458 | Ga0496106_0185495 | 3300048909 | Bacteria | 1653 |
| 1459 | Ga0496106_0299452 | 3300048909 | Bacteria | 1289 |
| 1460 | Ga0496107_0088189 | 3300048910 | Bacteria | 2265 |
| 1461 | Ga0496108_0543160 | 3300048911 | Bacteria | 1014 |
| 1462 | Ga0496108_1625881 | 3300048911 | Bacteria | 534 |
| 1463 | Ga0496108_1737401 | 3300048911 | Bacteria | 512 |
| 1464 | Ga0496109_0125768 | 3300048912 | Bacteria | 2390 |
| 1465 | Ga0496109_0520052 | 3300048912 | Bacteria | 1123 |
| 1466 | Ga0496109_0592397 | 3300048912 | Bacteria | 1045 |
| 1467 | Ga0496109_0940342 | 3300048912 | Bacteria | 802 |
| 1468 | Ga0496110_0069135 | 3300048913 | Bacteria | 3127 |
| 1469 | Ga0496110_0132413 | 3300048913 | Bacteria | 2252 |
| 1470 | Ga0496110_0218016 | 3300048913 | Bacteria | 1735 |
| 1471 | Ga0496110_0262072 | 3300048913 | Bacteria | 1573 |
| 1472 | Ga0496110_0546433 | 3300048913 | Bacteria | 1053 |
| 1473 | Ga0496110_1333805 | 3300048913 | Bacteria | 627 |
| 1474 | Ga0496112_0005059 | 3300048915 | Bacteria | 11325 |
| 1475 | Ga0496113_0007024 | 3300048916 | Bacteria | 7202 |
| 1476 | Ga0496114_0001047 | 3300048917 | Bacteria | 20785 |
| 1477 | Ga0496114_0008159 | 3300048917 | Bacteria | 8300 |
| 1478 | Ga0496114_0028612 | 3300048917 | Bacteria | 4575 |
| 1479 | Ga0496114_0061024 | 3300048917 | Bacteria | 3153 |
| 1480 | Ga0496114_0352539 | 3300048917 | Bacteria | 1302 |
| 1481 | Ga0496115_0204471 | 3300048918 | Bacteria | 1631 |
| 1482 | Ga0496115_0375720 | 3300048918 | Bacteria | 1156 |
| 1483 | Ga0496116_0020148 | 3300048919 | Bacteria | 5075 |
| 1484 | Ga0496117_0056774 | 3300048920 | Bacteria | 2724 |
| 1485 | Ga0496118_0142551 | 3300048921 | Bacteria | 1516 |
| 1486 | Ga0496119_0000834 | 3300048922 | Bacteria | 41096 |
| 1487 | Ga0496120_0000718 | 3300048923 | Bacteria | 48575 |
| 1488 | Ga0496121_0026934 | 3300048924 | Bacteria | 5396 |
| 1489 | Ga0496122_0000592 | 3300048925 | Bacteria | 74496 |
| 1490 | Ga0496122_0016985 | 3300048925 | Bacteria | 6837 |
| 1491 | Ga0496123_0000656 | 3300048926 | Bacteria | 57313 |
| 1492 | Ga0496123_0030819 | 3300048926 | Bacteria | 3917 |
| 1493 | Ga0496124_0003362 | 3300048927 | Bacteria | 19661 |
| 1494 | Ga0496124_0010223 | 3300048927 | Bacteria | 9532 |
| 1495 | Ga0496124_0022120 | 3300048927 | Bacteria | 5837 |
| 1496 | Ga0496124_0078596 | 3300048927 | Bacteria | 2718 |
| 1497 | Ga0496124_0079168 | 3300048927 | Bacteria | 2707 |
| 1498 | Ga0496124_0091501 | 3300048927 | Bacteria | 2479 |
| 1499 | Ga0496124_0437474 | 3300048927 | Bacteria | 896 |
| 1500 | Ga0496125_0022697 | 3300048928 | Bacteria | 5819 |
| 1501 | Ga0496125_0062565 | 3300048928 | Bacteria | 2975 |
| 1502 | Ga0496125_0137894 | 3300048928 | Bacteria | 1702 |
| 1503 | Ga0496126_0011307 | 3300048929 | Bacteria | 9260 |
| 1504 | Ga0496126_0047047 | 3300048929 | Bacteria | 3951 |
| 1505 | Ga0496126_0293202 | 3300048929 | Bacteria | 1345 |
| 1506 | Ga0501309_010432 | 3300049129 | Bacteria | 1198 |
| 1507 | Ga0495678_023711 | 3300049459 | Bacteria | 2662 |
| 1508 | Ga0495678_036235 | 3300049459 | Bacteria | 2014 |
| 1509 | Ga0495678_119543 | 3300049459 | Bacteria | 887 |
| 1510 | Ga0495682_0002074 | 3300049460 | Bacteria | 9792 |
| 1511 | Ga0495682_0340000 | 3300049460 | Bacteria | 529 |
| 1512 | Ga0501299_012430 | 3300049522 | Bacteria | 1453 |
| 1513 | Ga0501299_040320 | 3300049522 | Bacteria | 935 |
| 1514 | Ga0501314_003354 | 3300049530 | Bacteria | 1289 |
| 1515 | Ga0501031_0001649 | 3300049568 | Bacteria | 14009 |
| 1516 | Ga0501031_1003052 | 3300049568 | Bacteria | 534 |
| 1517 | Ga0501032_0125464 | 3300049569 | Bacteria | 1696 |
| 1518 | Ga0501032_0142264 | 3300049569 | Bacteria | 1580 |
| 1519 | Ga0501032_0750232 | 3300049569 | Bacteria | 617 |
| 1520 | Ga0501033_0082237 | 3300049570 | Bacteria | 2362 |
| 1521 | Ga0501034_0130008 | 3300049571 | Bacteria | 2502 |
| 1522 | Ga0501034_0172250 | 3300049571 | Bacteria | 2131 |
| 1523 | Ga0501034_0199961 | 3300049571 | Bacteria | 1957 |
| 1524 | Ga0501034_0364902 | 3300049571 | Bacteria | 1371 |
| 1525 | Ga0501036_0245252 | 3300049572 | Bacteria | 1502 |
| 1526 | Ga0501036_0640592 | 3300049572 | Bacteria | 880 |
| 1527 | Ga0501036_0820355 | 3300049572 | Bacteria | 765 |
| 1528 | Ga0501037_0013659 | 3300049573 | Bacteria | 5983 |
| 1529 | Ga0501038_0120063 | 3300049574 | Bacteria | 2169 |
| 1530 | Ga0501038_0348001 | 3300049574 | Bacteria | 1155 |
| 1531 | Ga0501038_0891020 | 3300049574 | Bacteria | 657 |
| 1532 | Ga0501039_0032761 | 3300049575 | Bacteria | 4008 |
| 1533 | Ga0501039_0052269 | 3300049575 | Bacteria | 3162 |
| 1534 | Ga0501039_0188149 | 3300049575 | Bacteria | 1624 |
| 1535 | Ga0501040_0103737 | 3300049576 | Bacteria | 1985 |
| 1536 | Ga0501040_0165251 | 3300049576 | Bacteria | 1566 |
| 1537 | Ga0501040_0675638 | 3300049576 | Bacteria | 747 |
| 1538 | Ga0501040_0735400 | 3300049576 | Bacteria | 714 |
| 1539 | Ga0501042_1075571 | 3300049578 | Bacteria | 586 |
| 1540 | Ga0501043_0000004 | 3300049579 | Bacteria | 291085 |
| 1541 | Ga0501043_0088959 | 3300049579 | Bacteria | 2427 |
| 1542 | Ga0501046_0000016 | 3300049580 | Bacteria | 234374 |
| 1543 | Ga0501046_0201970 | 3300049580 | Bacteria | 1479 |
| 1544 | Ga0501046_0218551 | 3300049580 | Bacteria | 1412 |
| 1545 | Ga0501047_0000012 | 3300049581 | Bacteria | 368824 |
| 1546 | Ga0501047_0002537 | 3300049581 | Bacteria | 17406 |
| 1547 | Ga0501047_0122948 | 3300049581 | Bacteria | 2476 |
| 1548 | Ga0501047_0287570 | 3300049581 | Bacteria | 1488 |
| 1549 | Ga0501047_0293404 | 3300049581 | Bacteria | 1470 |
| 1550 | Ga0501047_0335198 | 3300049581 | Bacteria | 1351 |
| 1551 | Ga0501047_0335504 | 3300049581 | Bacteria | 1350 |
| 1552 | Ga0501047_0625024 | 3300049581 | Bacteria | 898 |
| 1553 | Ga0501047_1051994 | 3300049581 | Bacteria | 627 |
| 1554 | Ga0501048_0010438 | 3300049582 | Bacteria | 6935 |
| 1555 | Ga0501068_0275027 | 3300049584 | Bacteria | 1075 |
| 1556 | Ga0501069_0011816 | 3300049585 | Bacteria | 4630 |
| 1557 | Ga0501070_0013166 | 3300049586 | Bacteria | 6971 |
| 1558 | Ga0501070_0050947 | 3300049586 | Bacteria | 3436 |
| 1559 | Ga0501070_0734822 | 3300049586 | Bacteria | 779 |
| 1560 | Ga0501071_0008835 | 3300049587 | Bacteria | 6679 |
| 1561 | Ga0501071_0410886 | 3300049587 | Bacteria | 1034 |
| 1562 | Ga0501073_0025636 | 3300049589 | Bacteria | 4225 |
| 1563 | Ga0501074_0002091 | 3300049590 | Bacteria | 13779 |
| 1564 | Ga0501076_0373427 | 3300049592 | Bacteria | 1172 |
| 1565 | Ga0501199_005273 | 3300049650 | Bacteria | 1297 |
| 1566 | Ga0501202_013977 | 3300049652 | Bacteria | 1533 |
| 1567 | Ga0501211_000722 | 3300049658 | Bacteria | 3372 |
| 1568 | Ga0501222_001247 | 3300049662 | Bacteria | 3582 |
| 1569 | Ga0501249_087284 | 3300049679 | Bacteria | 737 |
| 1570 | Ga0501253_028874 | 3300049683 | Bacteria | 1042 |
| 1571 | Ga0501080_0033654 | 3300049742 | Bacteria | 4783 |
| 1572 | Ga0501080_0047008 | 3300049742 | Bacteria | 4018 |
| 1573 | Ga0501080_0175561 | 3300049742 | Bacteria | 1974 |
| 1574 | Ga0501080_0527557 | 3300049742 | Bacteria | 1053 |
| 1575 | Ga0501080_1094767 | 3300049742 | Bacteria | 688 |
| 1576 | Ga0501081_0217634 | 3300049743 | Bacteria | 1388 |
| 1577 | Ga0501083_0014526 | 3300049744 | Bacteria | 5506 |
| 1578 | Ga0501264_006472 | 3300049761 | Bacteria | 1079 |
| 1579 | Ga0501266_008842 | 3300049763 | Bacteria | 1270 |
| 1580 | Ga0501267_006197 | 3300049764 | Bacteria | 1145 |
| 1581 | Ga0501272_005513 | 3300049769 | Bacteria | 1334 |
| 1582 | Ga0501278_010212 | 3300049774 | Bacteria | 746 |
| 1583 | Ga0501279_003394 | 3300049775 | Bacteria | 2079 |
| 1584 | Ga0501035_0016682 | 3300049822 | Bacteria | 6771 |
| 1585 | Ga0501035_0068118 | 3300049822 | Bacteria | 3156 |
| 1586 | Ga0501035_0103549 | 3300049822 | Bacteria | 2497 |
| 1587 | Ga0501044_0007417 | 3300049823 | Bacteria | 12064 |
| 1588 | Ga0501044_0064676 | 3300049823 | Bacteria | 3733 |
| 1589 | Ga0501044_0139113 | 3300049823 | Bacteria | 2417 |
| 1590 | Ga0501044_0191635 | 3300049823 | Bacteria | 2007 |
| 1591 | Ga0501044_0247169 | 3300049823 | Bacteria | 1726 |
| 1592 | Ga0501045_0009097 | 3300049824 | Bacteria | 6937 |
| 1593 | Ga0501045_0434923 | 3300049824 | Bacteria | 976 |
| 1594 | Ga0501226_004955 | 3300049853 | Bacteria | 1528 |
| 1595 | Ga0501226_006472 | 3300049853 | Bacteria | 1327 |
| 1596 | nmdc:mga03683_102014_c1 | 3300050489 | Bacteria | 1262 |
| 1597 | nmdc:mga03683_115789_c1 | 3300050489 | Bacteria | 1189 |
| 1598 | nmdc:mga03683_307019_c1 | 3300050489 | Bacteria | 745 |
| 1599 | nmdc:mga03683_313614_c1 | 3300050489 | Bacteria | 737 |
| 1600 | nmdc:mga03683_54553_c1 | 3300050489 | Bacteria | 1676 |
| 1601 | nmdc:mga03n38_41237_c1 | 3300050490 | Bacteria | 2011 |
| 1602 | nmdc:mga03n38_827733_c1 | 3300050490 | Bacteria | 540 |
| 1603 | nmdc:mga00v17_127984_c1 | 3300050491 | Bacteria | 1621 |
| 1604 | nmdc:mga00v17_143688_c1 | 3300050491 | Bacteria | 1531 |
| 1605 | nmdc:mga00v17_186953_c1 | 3300050491 | Bacteria | 1337 |
| 1606 | nmdc:mga00v17_828904_c1 | 3300050491 | Bacteria | 588 |
| 1607 | nmdc:mga0yw44_30213_c1 | 3300050492 | Bacteria | 3136 |
| 1608 | nmdc:mga0yw44_459892_c1 | 3300050492 | Bacteria | 862 |
| 1609 | nmdc:mga0k408_109179_c1 | 3300050493 | Bacteria | 1635 |
| 1610 | nmdc:mga0k408_11211_c1 | 3300050493 | Bacteria | 4875 |
| 1611 | nmdc:mga0k408_114833_c1 | 3300050493 | Bacteria | 1593 |
| 1612 | nmdc:mga0k408_136285_c1 | 3300050493 | Bacteria | 1459 |
| 1613 | nmdc:mga0k408_14639_c1 | 3300050493 | Bacteria | 4325 |
| 1614 | nmdc:mga0k408_152829_c1 | 3300050493 | Bacteria | 1375 |
| 1615 | nmdc:mga0k408_15620_c1 | 3300050493 | Bacteria | 4201 |
| 1616 | nmdc:mga0k408_263616_c1 | 3300050493 | Bacteria | 1029 |
| 1617 | nmdc:mga0k408_2673_c1 | 3300050493 | Bacteria | 9451 |
| 1618 | nmdc:mga0k408_47503_c1 | 3300050493 | Bacteria | 2481 |
| 1619 | nmdc:mga0k408_60046_c1 | 3300050493 | Bacteria | 2209 |
| 1620 | nmdc:mga0k408_607146_c1 | 3300050493 | Bacteria | 645 |
| 1621 | nmdc:mga0k408_63531_c1 | 3300050493 | Bacteria | 958 |
| 1622 | nmdc:mga0k408_92973_c1 | 3300050493 | Bacteria | 1773 |
| 1623 | nmdc:mga0k408_96201_c1 | 3300050493 | Bacteria | 1743 |
| 1624 | nmdc:mga06z11_23782_c1 | 3300050494 | Bacteria | 2883 |
| 1625 | nmdc:mga06z11_27127_c1 | 3300050494 | Bacteria | 2735 |
| 1626 | nmdc:mga06z11_51754_c1 | 3300050494 | Bacteria | 2104 |
| 1627 | nmdc:mga06z11_551408_c1 | 3300050494 | Bacteria | 700 |
| 1628 | nmdc:mga06z11_65667_c1 | 3300050494 | Bacteria | 1905 |
| 1629 | nmdc:mga07m45_1019_c1 | 3300050496 | Bacteria | 7575 |
| 1630 | nmdc:mga07m45_103975_c1 | 3300050496 | Bacteria | 1633 |
| 1631 | nmdc:mga07m45_1241_c1 | 3300050496 | Bacteria | 11565 |
| 1632 | nmdc:mga07m45_144604_c1 | 3300050496 | Bacteria | 1378 |
| 1633 | nmdc:mga07m45_215893_c1 | 3300050496 | Bacteria | 1116 |
| 1634 | nmdc:mga07m45_22037_c1 | 3300050496 | Bacteria | 3476 |
| 1635 | nmdc:mga07m45_4444_c1 | 3300050496 | Bacteria | 6863 |
| 1636 | nmdc:mga07m45_46325_c1 | 3300050496 | Bacteria | 2443 |
| 1637 | nmdc:mga07m45_650_c1 | 3300050496 | Bacteria | 14760 |
| 1638 | nmdc:mga07m45_687772_c1 | 3300050496 | Bacteria | 589 |
| 1639 | nmdc:mga05p37_1697299_c1 | 3300050507 | Bacteria | 616 |
| 1640 | nmdc:mga05p37_566117_c1 | 3300050507 | Bacteria | 1290 |
| 1641 | nmdc:mga09592_349395_c1 | 3300050508 | Bacteria | 1280 |
| 1642 | nmdc:mga09592_522300_c1 | 3300050508 | Bacteria | 1021 |
| 1643 | nmdc:mga0qj67_453007_c1 | 3300050509 | Bacteria | 1033 |
| 1644 | nmdc:mga0qj67_639730_c1 | 3300050509 | Bacteria | 849 |
| 1645 | nmdc:mga06r32_352_c1 | 3300050510 | Bacteria | 38408 |
| 1646 | nmdc:mga06r32_77840_c1 | 3300050510 | Bacteria | 3222 |
| 1647 | nmdc:mga08y16_304961_c1 | 3300050511 | Bacteria | 1641 |
| 1648 | nmdc:mga08y16_465913_c1 | 3300050511 | Bacteria | 1287 |
| 1649 | nmdc:mga08y16_674920_c1 | 3300050511 | Bacteria | 1035 |
| 1650 | nmdc:mga0sz30_45120_c1 | 3300050516 | Bacteria | 1859 |
| 1651 | Ga0495601_0057819 | 3300053077 | Bacteria | 2457 |
| 1652 | Ga0495601_0448656 | 3300053077 | Bacteria | 834 |
| 1653 | Ga0495612_0038847 | 3300053078 | Bacteria | 1935 |
| 1654 | Ga0495612_0040355 | 3300053078 | Bacteria | 1901 |
| 1655 | Ga0495619_0119836 | 3300053085 | Bacteria | 1804 |
| 1656 | Ga0495619_0734208 | 3300053085 | Bacteria | 670 |
| 1657 | Ga0500578_0000049 | 3300053086 | Bacteria | 124281 |
| 1658 | Ga0500644_0032189 | 3300053088 | Bacteria | 1674 |
| 1659 | Ga0500644_0099111 | 3300053088 | Bacteria | 1104 |
| 1660 | Ga0500646_0003195 | 3300053090 | Bacteria | 4205 |
| 1661 | Ga0500647_0132189 | 3300053091 | Bacteria | 1176 |
| 1662 | Ga0500583_0389368 | 3300053092 | Bacteria | 670 |
| 1663 | Ga0500583_0532016 | 3300053092 | Bacteria | 548 |
| 1664 | Ga0500651_0097062 | 3300053093 | Bacteria | 1810 |
| 1665 | Ga0500651_0114859 | 3300053093 | Bacteria | 1640 |
| 1666 | Ga0500651_0406196 | 3300053093 | Bacteria | 764 |
| 1667 | Ga0500650_0057076 | 3300053098 | Bacteria | 1820 |
| 1668 | Ga0500650_0183909 | 3300053098 | Bacteria | 957 |
| 1669 | Ga0500660_124303 | 3300053100 | Bacteria | 1066 |
| 1670 | Ga0500555_089260 | 3300053103 | Bacteria | 793 |
| 1671 | Ga0500562_007913 | 3300053108 | Bacteria | 2684 |
| 1672 | Ga0500569_105324 | 3300053109 | Bacteria | 928 |
| 1673 | Ga0500591_075673 | 3300053115 | Bacteria | 1512 |
| 1674 | Ga0500593_000729 | 3300053117 | Bacteria | 12456 |
| 1675 | Ga0500593_030750 | 3300053117 | Bacteria | 2399 |
| 1676 | Ga0500594_0054739 | 3300053118 | Bacteria | 1134 |
| 1677 | Ga0500594_0058307 | 3300053118 | Bacteria | 1106 |
| 1678 | Ga0500628_000439 | 3300053129 | Bacteria | 7917 |
| 1679 | Ga0500642_0006244 | 3300053130 | Bacteria | 3906 |
| 1680 | Ga0500652_000044 | 3300053131 | Bacteria | 64309 |
| 1681 | Ga0500652_023494 | 3300053131 | Bacteria | 2345 |
| 1682 | Ga0500655_029979 | 3300053133 | Bacteria | 1045 |
| 1683 | Ga0500658_0002543 | 3300053134 | Bacteria | 7066 |
| 1684 | Ga0500658_0015441 | 3300053134 | Bacteria | 2836 |
| 1685 | Ga0500658_0074183 | 3300053134 | Bacteria | 1442 |
| 1686 | Ga0500658_0128090 | 3300053134 | Bacteria | 1130 |
| 1687 | Ga0500559_0006184 | 3300053136 | Bacteria | 5418 |
| 1688 | Ga0500559_0327048 | 3300053136 | Bacteria | 718 |
| 1689 | Ga0500561_0058022 | 3300053137 | Bacteria | 1076 |
| 1690 | Ga0500568_0001263 | 3300053139 | Bacteria | 16721 |
| 1691 | Ga0500568_0016548 | 3300053139 | Bacteria | 3275 |
| 1692 | Ga0500568_0027522 | 3300053139 | Bacteria | 2376 |
| 1693 | Ga0500568_0038336 | 3300053139 | Bacteria | 1940 |
| 1694 | Ga0500577_0003546 | 3300053142 | Bacteria | 4058 |
| 1695 | Ga0500577_0347215 | 3300053142 | Bacteria | 649 |
| 1696 | Ga0500588_0033202 | 3300053146 | Bacteria | 1504 |
| 1697 | Ga0500604_0012951 | 3300053151 | Bacteria | 2257 |
| 1698 | Ga0500604_0112477 | 3300053151 | Bacteria | 905 |
| 1699 | Ga0500619_000120 | 3300053154 | Bacteria | 20611 |
| 1700 | Ga0500622_0000002 | 3300053156 | Bacteria | 646442 |
| 1701 | Ga0500622_0000128 | 3300053156 | Bacteria | 79659 |
| 1702 | Ga0500622_0001173 | 3300053156 | Bacteria | 21675 |
| 1703 | Ga0500622_0001549 | 3300053156 | Bacteria | 18205 |
| 1704 | Ga0500622_0007550 | 3300053156 | Bacteria | 6162 |
| 1705 | Ga0500622_0071964 | 3300053156 | Bacteria | 1746 |
| 1706 | Ga0500622_0170851 | 3300053156 | Bacteria | 1012 |
| 1707 | Ga0500645_000413 | 3300053730 | Bacteria | 29917 |
| 1708 | Ga0500645_014269 | 3300053730 | Bacteria | 2534 |
| 1709 | Ga0500565_014417 | 3300053734 | Bacteria | 872 |
| 1710 | Ga0500587_005732 | 3300053739 | Bacteria | 1663 |
| 1711 | Ga0500587_011776 | 3300053739 | Bacteria | 1104 |
| 1712 | Ga0501084_0054143 | 3300054114 | Bacteria | 3356 |
| 1713 | Ga0590071_001980 | 3300059421 | Bacteria | 5239 |
| 1714 | Ga0501082_0821023 | 3300060353 | Bacteria | 813 |
| 1715 | 2599971989 | 2599185307 | Bacteria | 6194719 |
| 1716 | 2644363260 | 2643221665 | Bacteria | 4699229 |
| 1717 | 2765586689 | 2765235841 | Bacteria | 6137024 |
| 1718 | 2855021425 | 2855020534 | Bacteria | 3204685 |
| 1719 | 2861695613 | 2861691609 | Bacteria | 5628931 |
| 1720 | 2919156000 | 2919155634 | Bacteria | 4860545 |
| 1721 | 2928516354 | 2928515477 | Bacteria | 4448421 |
| 1722 | 2952254092 | 2952252522 | Bacteria | 4171745 |
| 1723 | 3003670766 | 3003665799 | Bacteria | 7279786 |
| 1724 | 8056163744 | 8056161164 | Bacteria | 6106669 |
| 1725 | Ga0070681_10898991 | |||
| 1726 | JGI24740J21852_10012529 | |||
| 1727 | JGI25155J39150_1000079 | |||
| 1728 | JGI25156J39149_1000125 | |||
| 1729 | JGI25154J39366_1000141 | |||
| 1730 | JGI25157J39369_1000159 | |||
| 1731 | JGI25150J39212_1006333 | |||
| 1732 | JGI25150J39212_1007862 | |||
| 1733 | JGI25159J45721_1000638 | |||
| 1734 | JGI25159J45721_1002502 | |||
| 1735 | JGI25151J46595_10019053 | |||
| 1736 | JGI25406J46586_10000015 | |||
| 1737 | JGI25153J46596_10002603 | |||
| 1738 | JGI25153J46596_10002737 | |||
| 1739 | rootL2_10048698 | |||
| 1740 | rootH1_10008298 | |||
| 1741 | rootH1_10032418 | |||
| 1742 | rootH1_10219628 | |||
| 1743 | rootH1_10235640 | |||
| 1744 | JGI25160J50197_1000067 | |||
| 1745 | JGI25161J50226_1000035 | |||
| 1746 | Ga0055526_1000542 | |||
| 1747 | Ga0055526_1007532 | |||
| 1748 | Ga0055526_1007544 | |||
| 1749 | Ga0055537_1001739 | |||
| 1750 | Ga0055537_1024062 | |||
| 1751 | Ga0055524_1000006 | |||
| 1752 | Ga0055524_1000079 | |||
| 1753 | Ga0055524_1001129 | |||
| 1754 | Ga0055536_1000447 | |||
| 1755 | Ga0055534_1001178 | |||
| 1756 | Ga0055534_1003541 | |||
| 1757 | Ga0055528_1000374 | |||
| 1758 | Ga0055530_10000346 | |||
| 1759 | Ga0055530_10002750 | |||
| 1760 | Ga0055530_10013673 | |||
| 1761 | Ga0055530_10018865 | |||
| 1762 | Ga0055540_1000005 | |||
| 1763 | Ga0055540_1000086 | |||
| 1764 | Ga0055540_1056259 | |||
| 1765 | Ga0055531_10000604 | |||
| 1766 | Ga0055531_10000607 | |||
| 1767 | Ga0055531_10002992 | |||
| 1768 | Ga0055531_10003346 | |||
| 1769 | Ga0055531_10005016 | |||
| 1770 | Ga0055531_10009416 | |||
| 1771 | Ga0055543_1001289 | |||
| 1772 | Ga0065165_1010114 | |||
| 1773 | Ga0065165_1014561 | |||
| 1774 | Ga0065165_1018974 | |||
| 1775 | Ga0065165_1021684 | |||
| 1776 | Ga0065712_10188573 | |||
| 1777 | Ga0065707_10242902 | |||
| 1778 | Ga0070658_10165783 | |||
| 1779 | Ga0070658_10178500 | |||
| 1780 | Ga0070658_10376755 | |||
| 1781 | Ga0070676_10002509 | |||
| 1782 | Ga0070676_10025454 | |||
| 1783 | Ga0070676_10075715 | |||
| 1784 | Ga0070676_10224705 | |||
| 1785 | Ga0070683_100037706 | |||
| 1786 | Ga0070683_100121661 | |||
| 1787 | Ga0070690_100010662 | |||
| 1788 | Ga0070690_100239905 | |||
| 1789 | Ga0070670_100024964 | |||
| 1790 | Ga0070670_100046533 | |||
| 1791 | Ga0070670_100949901 | |||
| 1792 | Ga0070670_101241508 | |||
| 1793 | Ga0070670_101617950 | |||
| 1794 | Ga0070677_10006749 | |||
| 1795 | Ga0070677_10012615 | |||
| 1796 | Ga0070677_10017639 | |||
| 1797 | Ga0070677_10092265 | |||
| 1798 | Ga0070677_10334597 | |||
| 1799 | Ga0068869_100012500 | |||
| 1800 | Ga0068869_100096147 | |||
| 1801 | Ga0070666_10000910 | |||
| 1802 | Ga0070666_10004166 | |||
| 1803 | Ga0070666_10241796 | |||
| 1804 | Ga0070666_10429708 | |||
| 1805 | Ga0070666_10457645 | |||
| 1806 | Ga0070680_100056960 | |||
| 1807 | Ga0070680_100157655 | |||
| 1808 | Ga0070680_100573155 | |||
| 1809 | Ga0068868_100004895 | |||
| 1810 | Ga0068868_100019803 | |||
| 1811 | Ga0068868_100615315 | |||
| 1812 | Ga0068868_101493088 | |||
| 1813 | Ga0070660_100019427 | |||
| 1814 | Ga0070689_100103553 | |||
| 1815 | Ga0070689_101208455 | |||
| 1816 | Ga0070691_10049116 | |||
| 1817 | Ga0070687_100107854 | |||
| 1818 | Ga0070661_100000925 | |||
| 1819 | Ga0070668_100000411 | |||
| 1820 | Ga0070668_100253166 | |||
| 1821 | Ga0070669_100005882 | |||
| 1822 | Ga0070669_100007708 | |||
| 1823 | Ga0070669_100153600 | |||
| 1824 | Ga0070669_100197215 | |||
| 1825 | Ga0070669_100442007 | |||
| 1826 | Ga0070675_100000199 | |||
| 1827 | Ga0070675_100003618 | |||
| 1828 | Ga0070675_100016158 | |||
| 1829 | Ga0070675_100025060 | |||
| 1830 | Ga0070675_100059825 | |||
| 1831 | Ga0070675_100063020 | |||
| 1832 | Ga0070675_100129478 | |||
| 1833 | Ga0070675_100175593 | |||
| 1834 | Ga0070675_100234314 | |||
| 1835 | Ga0070675_100261486 | |||
| 1836 | Ga0070675_100304386 | |||
| 1837 | Ga0070675_100605865 | |||
| 1838 | Ga0070671_100068600 | |||
| 1839 | Ga0070671_100082092 | |||
| 1840 | Ga0070671_100119592 | |||
| 1841 | Ga0070671_100174389 | |||
| 1842 | Ga0070671_100282123 | |||
| 1843 | Ga0070671_100558339 | |||
| 1844 | Ga0070671_100577438 | |||
| 1845 | Ga0070671_100751456 | |||
| 1846 | Ga0070674_100008421 | |||
| 1847 | Ga0070674_100009710 | |||
| 1848 | Ga0070674_100076188 | |||
| 1849 | Ga0070674_100171882 | |||
| 1850 | Ga0070674_100191479 | |||
| 1851 | Ga0070674_100224656 | |||
| 1852 | Ga0070674_100803409 | |||
| 1853 | Ga0070674_101195863 | |||
| 1854 | Ga0070673_100001468 | |||
| 1855 | Ga0070673_100008853 | |||
| 1856 | Ga0070673_100028271 | |||
| 1857 | Ga0070673_100070117 | |||
| 1858 | Ga0070673_100147698 | |||
| 1859 | Ga0070673_100150088 | |||
| 1860 | Ga0070673_100177443 | |||
| 1861 | Ga0070673_100319302 | |||
| 1862 | Ga0070688_100317323 | |||
| 1863 | Ga0070659_100001694 | |||
| 1864 | Ga0070659_100788685 | |||
| 1865 | Ga0070667_100000463 | |||
| 1866 | Ga0070667_100003988 | |||
| 1867 | Ga0070667_100019707 | |||
| 1868 | Ga0070667_100044588 | |||
| 1869 | Ga0070667_100088182 | |||
| 1870 | Ga0070667_100162405 | |||
| 1871 | Ga0070667_100274337 | |||
| 1872 | Ga0070667_100857417 | |||
| 1873 | Ga0070714_100085415 | |||
| 1874 | Ga0070714_100940801 | |||
| 1875 | Ga0070713_100150212 | |||
| 1876 | Ga0070713_100276595 | |||
| 1877 | Ga0070713_100473741 | |||
| 1878 | Ga0070713_100495254 | |||
| 1879 | Ga0070713_100626243 | |||
| 1880 | Ga0070713_100753871 | |||
| 1881 | Ga0070710_10007341 | |||
| 1882 | Ga0070710_10065129 | |||
| 1883 | Ga0070710_10506754 | |||
| 1884 | Ga0070710_10549970 | |||
| 1885 | Ga0070701_10346409 | |||
| 1886 | Ga0070711_100061388 | |||
| 1887 | Ga0070705_100857867 | |||
| 1888 | Ga0070705_100978965 | |||
| 1889 | Ga0070700_100054257 | |||
| 1890 | Ga0070700_100081321 | |||
| 1891 | Ga0070708_100104465 | |||
| 1892 | Ga0070708_100595274 | |||
| 1893 | Ga0070663_100003243 | |||
| 1894 | Ga0070663_100003886 | |||
| 1895 | Ga0070663_100850583 | |||
| 1896 | Ga0070663_101262511 | |||
| 1897 | Ga0070678_100001786 | |||
| 1898 | Ga0070678_100025816 | |||
| 1899 | Ga0070678_100028458 | |||
| 1900 | Ga0070678_100087358 | |||
| 1901 | Ga0070678_100289859 | |||
| 1902 | Ga0070678_100338210 | |||
| 1903 | Ga0070678_101232293 | |||
| 1904 | Ga0070678_101284639 | |||
| 1905 | Ga0070662_100034028 | |||
| 1906 | Ga0070662_100093049 | |||
| 1907 | Ga0070662_100182623 | |||
| 1908 | Ga0070662_100183998 | |||
| 1909 | Ga0070662_100509332 | |||
| 1910 | Ga0070681_10005119 | |||
| 1911 | Ga0070681_10188912 | |||
| 1912 | Ga0070681_10239500 | |||
| 1913 | Ga0070681_10675550 | |||
| 1914 | Ga0068867_100000077 | |||
| 1915 | Ga0068867_100000932 | |||
| 1916 | Ga0068867_100012398 | |||
| 1917 | Ga0068867_100038819 | |||
| 1918 | Ga0068867_100054825 | |||
| 1919 | Ga0068867_100136111 | |||
| 1920 | Ga0068867_100213688 | |||
| 1921 | Ga0068867_100411850 | |||
| 1922 | Ga0068867_100569602 | |||
| 1923 | Ga0070685_10111492 | |||
| 1924 | Ga0070706_100001777 | |||
| 1925 | Ga0070706_100375056 | |||
| 1926 | Ga0070706_100855603 | |||
| 1927 | Ga0070707_100036485 | |||
| 1928 | Ga0070707_100417757 | |||
| 1929 | Ga0070698_100933444 | |||
| 1930 | Ga0070699_100232285 | |||
| 1931 | Ga0070679_100077785 | |||
| 1932 | Ga0070679_100120419 | |||
| 1933 | Ga0070679_100128179 | |||
| 1934 | Ga0070679_100337587 | |||
| 1935 | Ga0070684_100039305 | |||
| 1936 | Ga0068853_100006065 | |||
| 1937 | Ga0068853_100034477 | |||
| 1938 | Ga0068853_100071781 | |||
| 1939 | Ga0068853_100078556 | |||
| 1940 | Ga0070672_100000674 | |||
| 1941 | Ga0070672_100001496 | |||
| 1942 | Ga0070672_100027912 | |||
| 1943 | Ga0070672_100029785 | |||
| 1944 | Ga0070672_100112138 | |||
| 1945 | Ga0070672_100130914 | |||
| 1946 | Ga0070672_100689912 | |||
| 1947 | Ga0070672_100693904 | |||
| 1948 | Ga0070672_101302960 | |||
| 1949 | Ga0070686_100089925 | |||
| 1950 | Ga0070686_100533423 | |||
| 1951 | Ga0070696_100166665 | |||
| 1952 | Ga0070693_100220427 | |||
| 1953 | Ga0070665_101304575 | |||
| 1954 | Ga0070704_101847512 | |||
| 1955 | Ga0068855_100022408 | |||
| 1956 | Ga0068855_100039828 | |||
| 1957 | Ga0068855_100077143 | |||
| 1958 | Ga0068855_100092900 | |||
| 1959 | Ga0068855_100256710 | |||
| 1960 | Ga0070664_100000939 | |||
| 1961 | Ga0070664_100025855 | |||
| 1962 | Ga0070664_100063541 | |||
| 1963 | Ga0070664_100091218 | |||
| 1964 | Ga0070664_100532892 | |||
| 1965 | Ga0068857_100117060 | |||
| 1966 | Ga0068857_100131701 | |||
| 1967 | Ga0068857_100655455 | |||
| 1968 | Ga0068857_101040811 | |||
| 1969 | Ga0068854_100069996 | |||
| 1970 | Ga0068854_100882064 | |||
| 1971 | Ga0068856_100012917 | |||
| 1972 | Ga0068856_100289670 | |||
| 1973 | Ga0068856_100447216 | |||
| 1974 | Ga0070702_100474759 | |||
| 1975 | Ga0068852_100014816 | |||
| 1976 | Ga0068852_100018603 | |||
| 1977 | Ga0068852_100027821 | |||
| 1978 | Ga0068852_100044259 | |||
| 1979 | Ga0068852_100046620 | |||
| 1980 | Ga0068852_100198851 | |||
| 1981 | Ga0068852_100252895 | |||
| 1982 | Ga0068852_100466299 | |||
| 1983 | Ga0068852_100526853 | |||
| 1984 | Ga0068859_100007180 | |||
| 1985 | Ga0068859_100032232 | |||
| 1986 | Ga0068859_100183101 | |||
| 1987 | Ga0068859_100468786 | |||
| 1988 | Ga0068864_100000354 | |||
| 1989 | Ga0068864_100002399 | |||
| 1990 | Ga0068864_100037250 | |||
| 1991 | Ga0068864_100055665 | |||
| 1992 | Ga0068864_100115684 | |||
| 1993 | Ga0068864_101070786 | |||
| 1994 | Ga0068864_102265800 | |||
| 1995 | Ga0068866_10002910 | |||
| 1996 | Ga0068866_10456408 | |||
| 1997 | Ga0068861_100003227 | |||
| 1998 | Ga0068861_100026530 | |||
| 1999 | Ga0068861_100268015 | |||
| 2000 | Ga0068851_10004231 | |||
| 2001 | Ga0068851_10065962 | |||
| 2002 | Ga0068851_10351275 | |||
| 2003 | Ga0068870_10012786 | |||
| 2004 | Ga0068870_10029084 | |||
| 2005 | Ga0068870_10292604 | |||
| 2006 | Ga0068863_100003312 | |||
| 2007 | Ga0068863_100034898 | |||
| 2008 | Ga0068863_100037190 | |||
| 2009 | Ga0068863_100044132 | |||
| 2010 | Ga0068863_100100578 | |||
| 2011 | Ga0068863_100178913 | |||
| 2012 | Ga0068863_100206566 | |||
| 2013 | Ga0068858_100000262 | |||
| 2014 | Ga0068858_100005749 | |||
| 2015 | Ga0068858_100009778 | |||
| 2016 | Ga0068858_100044019 | |||
| 2017 | Ga0068858_101045860 | |||
| 2018 | Ga0068860_100006843 | |||
| 2019 | Ga0068860_100085476 | |||
| 2020 | Ga0068860_100089805 | |||
| 2021 | Ga0068862_100019197 | |||
| 2022 | Ga0068862_100023970 | |||
| 2023 | Ga0068862_100028761 | |||
| 2024 | Ga0068862_100058582 | |||
| 2025 | Ga0068862_100059433 | |||
| 2026 | Ga0068862_100094485 | |||
| 2027 | Ga0068862_100126510 | |||
| 2028 | Ga0068862_100784788 | |||
| 2029 | Ga0081455_10004966 | |||
| 2030 | Ga0081455_10488458 | |||
| 2031 | Ga0081455_10588779 | |||
| 2032 | Ga0081540_1012498 | |||
| 2033 | Ga0075365_10070149 | |||
| 2034 | Ga0075365_10110299 | |||
| 2035 | Ga0075368_10029146 | |||
| 2036 | Ga0075368_10109207 | |||
| 2037 | Ga0075368_10192943 | |||
| 2038 | Ga0075363_100537181 | |||
| 2039 | Ga0075364_10129145 | |||
| 2040 | Ga0075364_10139836 | |||
| 2041 | Ga0075364_10154009 | |||
| 2042 | Ga0075432_10154894 | |||
| 2043 | Ga0075432_10596429 | |||
| 2044 | Ga0070715_10036873 | |||
| 2045 | Ga0070716_100270348 | |||
| 2046 | Ga0070716_101375385 | |||
| 2047 | Ga0070712_100133058 | |||
| 2048 | Ga0075362_10005748 | |||
| 2049 | Ga0075362_10015938 | |||
| 2050 | Ga0075362_10030414 | |||
| 2051 | Ga0075362_10040413 | |||
| 2052 | Ga0075362_10131295 | |||
| 2053 | Ga0075362_10165182 | |||
| 2054 | Ga0075362_10294084 | |||
| 2055 | Ga0075362_10315725 | |||
| 2056 | Ga0075367_10008021 | |||
| 2057 | Ga0075367_10038031 | |||
| 2058 | Ga0075367_10052397 | |||
| 2059 | Ga0075367_10113141 | |||
| 2060 | Ga0075367_10309550 | |||
| 2061 | Ga0075369_10025461 | |||
| 2062 | Ga0075369_10089557 | |||
| 2063 | Ga0075366_10001921 | |||
| 2064 | Ga0075366_10002417 | |||
| 2065 | Ga0075366_10009102 | |||
| 2066 | Ga0075366_10022250 | |||
| 2067 | Ga0075366_10023025 | |||
| 2068 | Ga0075366_10043968 | |||
| 2069 | Ga0075366_10087477 | |||
| 2070 | Ga0075366_10099101 | |||
| 2071 | Ga0075366_10106906 | |||
| 2072 | Ga0075366_10190494 | |||
| 2073 | Ga0075366_10194245 | |||
| 2074 | Ga0075366_10282479 | |||
| 2075 | Ga0075366_10320595 | |||
| 2076 | Ga0075366_10641719 | |||
| 2077 | Ga0097621_100006883 | |||
| 2078 | Ga0097621_100016215 | |||
| 2079 | Ga0097621_100034883 | |||
| 2080 | Ga0097621_100133582 | |||
| 2081 | Ga0097621_100207916 | |||
| 2082 | Ga0097621_100222507 | |||
| 2083 | Ga0097621_100800847 | |||
| 2084 | Ga0075370_10005490 | |||
| 2085 | Ga0075370_10005571 | |||
| 2086 | Ga0075370_10008637 | |||
| 2087 | Ga0075370_10015091 | |||
| 2088 | Ga0075370_10059640 | |||
| 2089 | Ga0075370_10136023 | |||
| 2090 | Ga0075370_10490564 | |||
| 2091 | Ga0068871_100008710 | |||
| 2092 | Ga0068871_100065266 | |||
| 2093 | Ga0068871_100075803 | |||
| 2094 | Ga0068871_100400827 | |||
| 2095 | Ga0068871_100703754 | |||
| 2096 | Ga0068871_101192775 | |||
| 2097 | Ga0075428_100036897 | |||
| 2098 | Ga0075430_100496766 | |||
| 2099 | Ga0075431_100005587 | |||
| 2100 | Ga0075429_100401840 | |||
| 2101 | Ga0075429_100444789 | |||
| 2102 | Ga0068865_100010698 | |||
| 2103 | Ga0068865_100015466 | |||
| 2104 | Ga0068865_100418978 | |||
| 2105 | Ga0097620_100007180 | |||
| 2106 | Ga0097620_100032233 | |||
| 2107 | Ga0097620_100183102 | |||
| 2108 | Ga0097620_100468776 | |||
| 2109 | Ga0099823_1002035 | |||
| 2110 | Ga0079104_1000100 | |||
| 2111 | Ga0079104_1006080 | |||
| 2112 | Ga0099826_10166791 | |||
| 2113 | Ga0105251_10000309 | |||
| 2114 | Ga0105251_10043577 | |||
| 2115 | Ga0105251_10098387 | |||
| 2116 | Ga0105251_10123778 | |||
| 2117 | Ga0105244_10019485 | |||
| 2118 | Ga0105244_10019533 | |||
| 2119 | Ga0105244_10121111 | |||
| 2120 | Ga0105244_10165564 | |||
| 2121 | Ga0105244_10176417 | |||
| 2122 | Ga0105250_10010061 | |||
| 2123 | Ga0105250_10159959 | |||
| 2124 | Ga0105240_10007299 | |||
| 2125 | Ga0105240_10031265 | |||
| 2126 | Ga0105240_10034862 | |||
| 2127 | Ga0105240_10041587 | |||
| 2128 | Ga0105240_10079757 | |||
| 2129 | Ga0105240_10377581 | |||
| 2130 | Ga0105240_10432590 | |||
| 2131 | Ga0111539_10322283 | |||
| 2132 | Ga0111539_10558638 | |||
| 2133 | Ga0111539_10627877 | |||
| 2134 | Ga0105245_10307238 | |||
| 2135 | Ga0105245_10856702 | |||
| 2136 | Ga0105245_11120787 | |||
| 2137 | Ga0105247_10431794 | |||
| 2138 | Ga0105247_10977890 | |||
| 2139 | Ga0114129_10491018 | |||
| 2140 | Ga0114129_11031304 | |||
| 2141 | Ga0105243_10002591 | |||
| 2142 | Ga0105243_10068864 | |||
| 2143 | Ga0105243_10075438 | |||
| 2144 | Ga0105243_10386578 | |||
| 2145 | Ga0105243_11957074 | |||
| 2146 | Ga0105241_10015147 | |||
| 2147 | Ga0105241_10434571 | |||
| 2148 | Ga0105242_10587584 | |||
| 2149 | Ga0105242_11152775 | |||
| 2150 | Ga0105248_10007009 | |||
| 2151 | Ga0105248_10056848 | |||
| 2152 | Ga0105248_10064841 | |||
| 2153 | Ga0105248_10088653 | |||
| 2154 | Ga0105248_10130214 | |||
| 2155 | Ga0105248_10191639 | |||
| 2156 | Ga0105248_10245116 | |||
| 2157 | Ga0105248_10387556 | |||
| 2158 | Ga0105248_10454797 | |||
| 2159 | Ga0105248_10958676 | |||
| 2160 | Ga0105237_10000998 | |||
| 2161 | Ga0105237_10105952 | |||
| 2162 | Ga0105237_10179800 | |||
| 2163 | Ga0105237_11091736 | |||
| 2164 | Ga0105238_10012661 | |||
| 2165 | Ga0105238_10018725 | |||
| 2166 | Ga0105238_10019715 | |||
| 2167 | Ga0105238_10033490 | |||
| 2168 | Ga0105238_10046675 | |||
| 2169 | Ga0105238_10244541 | |||
| 2170 | Ga0105238_10638696 | |||
| 2171 | Ga0105249_10000342 | |||
| 2172 | Ga0105249_10044280 | |||
| 2173 | Ga0105249_10104287 | |||
| 2174 | Ga0105249_10151394 | |||
| 2175 | Ga0105249_10318448 | |||
| 2176 | Ga0105239_10000318 | |||
| 2177 | Ga0105239_10509498 | |||
| 2178 | Ga0105239_11138897 | |||
| 2179 | Ga0105246_12327865 | |||
| 2180 | Ga0157317_1000493 | |||
| 2181 | Ga0157319_1000035 | |||
| 2182 | Ga0157314_1005544 | |||
| 2183 | Ga0157326_1005406 | |||
| 2184 | Ga0157373_10486659 | |||
| 2185 | Ga0157371_10005864 | |||
| 2186 | Ga0157371_10650304 | |||
| 2187 | Ga0157370_10438793 | |||
| 2188 | Ga0157370_10815178 | |||
| 2189 | Ga0157370_11080649 | |||
| 2190 | Ga0157369_10031818 | |||
| 2191 | Ga0157369_10037600 | |||
| 2192 | Ga0157369_11072985 | |||
| 2193 | Ga0157374_10025164 | |||
| 2194 | Ga0157374_10125887 | |||
| 2195 | Ga0157374_10221280 | |||
| 2196 | Ga0157374_10646021 | |||
| 2197 | Ga0157378_10180665 | |||
| 2198 | Ga0157378_10308886 | |||
| 2199 | Ga0157378_10445647 | |||
| 2200 | Ga0157378_10492593 | |||
| 2201 | Ga0157378_11466363 | |||
| 2202 | Ga0163162_10000679 | |||
| 2203 | Ga0163162_10012705 | |||
| 2204 | Ga0163162_10025634 | |||
| 2205 | Ga0163162_10048557 | |||
| 2206 | Ga0163162_10053465 | |||
| 2207 | Ga0163162_10086236 | |||
| 2208 | Ga0163162_10871690 | |||
| 2209 | Ga0157372_10000718 | |||
| 2210 | Ga0157372_10035925 | |||
| 2211 | Ga0157372_10102543 | |||
| 2212 | Ga0157372_10117708 | |||
| 2213 | Ga0157372_10699447 | |||
| 2214 | Ga0157372_10743795 | |||
| 2215 | Ga0157375_10004728 | |||
| 2216 | Ga0157375_10018087 | |||
| 2217 | Ga0157375_10019246 | |||
| 2218 | Ga0157375_10034066 | |||
| 2219 | Ga0157375_10056743 | |||
| 2220 | Ga0157375_10207553 | |||
| 2221 | Ga0157375_10261577 | |||
| 2222 | Ga0157375_10275214 | |||
| 2223 | Ga0157375_10308210 | |||
| 2224 | Ga0157375_10592298 | |||
| 2225 | Ga0157375_10746747 | |||
| 2226 | Ga0157375_11075442 | |||
| 2227 | Ga0163163_10004764 | |||
| 2228 | Ga0163163_10098591 | |||
| 2229 | Ga0163163_10107334 | |||
| 2230 | Ga0163163_10246292 | |||
| 2231 | Ga0163163_10526712 | |||
| 2232 | Ga0163163_10560854 | |||
| 2233 | Ga0163163_11979705 | |||
| 2234 | Ga0157380_10022857 | |||
| 2235 | Ga0157380_10023566 | |||
| 2236 | Ga0157380_10048088 | |||
| 2237 | Ga0157380_10062916 | |||
| 2238 | Ga0157380_10069002 | |||
| 2239 | Ga0157380_10148857 | |||
| 2240 | Ga0157380_10202571 | |||
| 2241 | Ga0157380_10205600 | |||
| 2242 | Ga0157380_11222749 | |||
| 2243 | Ga0157380_11258212 | |||
| 2244 | Ga0157380_11438656 | |||
| 2245 | Ga0157380_12702528 | |||
| 2246 | Ga0182008_10003595 | |||
| 2247 | Ga0182008_10366545 | |||
| 2248 | Ga0157377_10000094 | |||
| 2249 | Ga0157377_10521026 | |||
| 2250 | Ga0157379_10004559 | |||
| 2251 | Ga0157379_10091048 | |||
| 2252 | Ga0157379_10157624 | |||
| 2253 | Ga0157376_10002171 | |||
| 2254 | Ga0157376_10016007 | |||
| 2255 | Ga0157376_10098229 | |||
| 2256 | Ga0157376_10151948 | |||
| 2257 | Ga0157376_10285856 | |||
| 2258 | Ga0157376_10374167 | |||
| 2259 | Ga0157376_10420659 | |||
| 2260 | Ga0157376_10451251 | |||
| 2261 | Ga0157376_10556812 | |||
| 2262 | Ga0157376_10803234 | |||
| 2263 | Ga0182007_10035004 | |||
| 2264 | Ga0182005_1095988 | |||
| 2265 | Ga0163161_10041756 | |||
| 2266 | Ga0163161_10073964 | |||
| 2267 | Ga0163161_10118524 | |||
| 2268 | Ga0163161_10153661 | |||
| 2269 | Ga0206354_11363812 | |||
| 2270 | Ga0213872_10004955 | |||
| 2271 | Ga0213872_10026335 | |||
| 2272 | Ga0213875_10000114 | |||
| 2273 | Ga0213875_10008122 | |||
| 2274 | Ga0213875_10255900 | |||
| 2275 | Ga0209435_100001 | |||
| 2276 | Ga0209436_113645 | |||
| 2277 | Ga0209258_110482 | |||
| 2278 | Ga0207425_1002625 | |||
| 2279 | Ga0207425_1008135 | |||
| 2280 | Ga0207425_1008784 | |||
| 2281 | Ga0209646_1000001 | |||
| 2282 | Ga0209026_1000003 | |||
| 2283 | Ga0209759_1000001 | |||
| 2284 | Ga0209129_1000041 | |||
| 2285 | Ga0209129_1003651 | |||
| 2286 | Ga0209129_1018536 | |||
| 2287 | Ga0209565_1000124 | |||
| 2288 | Ga0209565_1000498 | |||
| 2289 | Ga0209565_1009374 | |||
| 2290 | Ga0209565_1024593 | |||
| 2291 | Ga0209673_1000043 | |||
| 2292 | Ga0209673_1001809 | |||
| 2293 | Ga0209673_1007730 | |||
| 2294 | Ga0209673_1010237 | |||
| 2295 | Ga0209673_1010311 | |||
| 2296 | Ga0209673_1044280 | |||
| 2297 | Ga0209673_1049602 | |||
| 2298 | Ga0209130_1000442 | |||
| 2299 | Ga0209130_1000620 | |||
| 2300 | Ga0209130_1001702 | |||
| 2301 | Ga0209130_1055162 | |||
| 2302 | Ga0209675_1000309 | |||
| 2303 | Ga0209675_1008560 | |||
| 2304 | Ga0209675_1031186 | |||
| 2305 | Ga0209675_1064089 | |||
| 2306 | Ga0209676_1000007 | |||
| 2307 | Ga0209676_1005708 | |||
| 2308 | Ga0209025_1002427 | |||
| 2309 | Ga0209025_1004916 | |||
| 2310 | Ga0209025_1024249 | |||
| 2311 | Ga0209025_1025283 | |||
| 2312 | Ga0209025_1095108 | |||
| 2313 | Ga0209564_1000003 | |||
| 2314 | Ga0209564_1000029 | |||
| 2315 | Ga0209564_1000268 | |||
| 2316 | Ga0209564_1000476 | |||
| 2317 | Ga0209564_1003314 | |||
| 2318 | Ga0209758_1000043 | |||
| 2319 | Ga0209758_1000167 | |||
| 2320 | Ga0209758_1043883 | |||
| 2321 | Ga0209758_1045258 | |||
| 2322 | Ga0209758_1061488 | |||
| 2323 | Ga0209050_1000003 | |||
| 2324 | Ga0209050_1000467 | |||
| 2325 | Ga0209050_1000808 | |||
| 2326 | Ga0209050_1001494 | |||
| 2327 | Ga0209050_1003886 | |||
| 2328 | Ga0209050_1004391 | |||
| 2329 | Ga0209050_1016100 | |||
| 2330 | Ga0209050_1021541 | |||
| 2331 | Ga0209050_1096249 | |||
| 2332 | Ga0209256_1000001 | |||
| 2333 | Ga0209256_1000011 | |||
| 2334 | Ga0209256_1000398 | |||
| 2335 | Ga0209256_1002559 | |||
| 2336 | Ga0209256_1017854 | |||
| 2337 | Ga0209256_1021626 | |||
| 2338 | Ga0209256_1043431 | |||
| 2339 | Ga0207426_1000247 | |||
| 2340 | Ga0207426_1009688 | |||
| 2341 | Ga0207426_1046867 | |||
| 2342 | Ga0207426_1067929 | |||
| 2343 | Ga0209051_1000003 | |||
| 2344 | Ga0209051_1000210 | |||
| 2345 | Ga0209051_1000320 | |||
| 2346 | Ga0209051_1001335 | |||
| 2347 | Ga0209051_1007045 | |||
| 2348 | Ga0209051_1012479 | |||
| 2349 | Ga0209051_1017118 | |||
| 2350 | Ga0209257_1000017 | |||
| 2351 | Ga0209257_1000020 | |||
| 2352 | Ga0209257_1000161 | |||
| 2353 | Ga0209257_1000314 | |||
| 2354 | Ga0209257_1000799 | |||
| 2355 | Ga0209257_1005062 | |||
| 2356 | Ga0209257_1005554 | |||
| 2357 | Ga0209257_1016941 | |||
| 2358 | Ga0207656_10005941 | |||
| 2359 | Ga0207655_1005008 | |||
| 2360 | Ga0207655_1005064 | |||
| 2361 | Ga0207655_1083830 | |||
| 2362 | Ga0207655_1105079 | |||
| 2363 | Ga0207655_1107523 | |||
| 2364 | Ga0207713_1069190 | |||
| 2365 | Ga0207713_1116723 | |||
| 2366 | Ga0207713_1124951 | |||
| 2367 | Ga0207653_10200309 | |||
| 2368 | Ga0207682_10001767 | |||
| 2369 | Ga0207682_10001984 | |||
| 2370 | Ga0207682_10009729 | |||
| 2371 | Ga0207682_10013197 | |||
| 2372 | Ga0207692_10105491 | |||
| 2373 | Ga0207642_10006842 | |||
| 2374 | Ga0207642_10080122 | |||
| 2375 | Ga0207642_10115095 | |||
| 2376 | Ga0207642_10218813 | |||
| 2377 | Ga0207680_10003848 | |||
| 2378 | Ga0207680_10024370 | |||
| 2379 | Ga0207680_10025961 | |||
| 2380 | Ga0207699_10030917 | |||
| 2381 | Ga0207645_10012039 | |||
| 2382 | Ga0207645_10032364 | |||
| 2383 | Ga0207645_10727408 | |||
| 2384 | Ga0207643_10003782 | |||
| 2385 | Ga0207643_10028009 | |||
| 2386 | Ga0207643_10058785 | |||
| 2387 | Ga0207643_10303128 | |||
| 2388 | Ga0207705_10106972 | |||
| 2389 | Ga0207705_10339781 | |||
| 2390 | Ga0207705_10551886 | |||
| 2391 | Ga0207684_10000743 | |||
| 2392 | Ga0207684_10726554 | |||
| 2393 | Ga0207654_10044947 | |||
| 2394 | Ga0207707_10002563 | |||
| 2395 | Ga0207707_10078608 | |||
| 2396 | Ga0207707_10176459 | |||
| 2397 | Ga0207707_10529490 | |||
| 2398 | Ga0207707_10772269 | |||
| 2399 | Ga0207695_10025991 | |||
| 2400 | Ga0207695_10043173 | |||
| 2401 | Ga0207695_10065868 | |||
| 2402 | Ga0207695_10354968 | |||
| 2403 | Ga0207671_10006034 | |||
| 2404 | Ga0207671_10040022 | |||
| 2405 | Ga0207671_10118785 | |||
| 2406 | Ga0207671_10788372 | |||
| 2407 | Ga0207693_10061984 | |||
| 2408 | Ga0207693_10448950 | |||
| 2409 | Ga0207693_10461586 | |||
| 2410 | Ga0207663_10421691 | |||
| 2411 | Ga0207660_10033235 | |||
| 2412 | Ga0207660_10095087 | |||
| 2413 | Ga0207660_10331851 | |||
| 2414 | Ga0207662_10142406 | |||
| 2415 | Ga0207662_10647713 | |||
| 2416 | Ga0207657_10034309 | |||
| 2417 | Ga0207657_10062069 | |||
| 2418 | Ga0207657_10094700 | |||
| 2419 | Ga0207657_10358752 | |||
| 2420 | Ga0207649_10001323 | |||
| 2421 | Ga0207649_10122954 | |||
| 2422 | Ga0207649_10186377 | |||
| 2423 | Ga0207649_10789743 | |||
| 2424 | Ga0207652_10156540 | |||
| 2425 | Ga0207652_10334427 | |||
| 2426 | Ga0207646_10022087 | |||
| 2427 | Ga0207646_10731365 | |||
| 2428 | Ga0207681_10000819 | |||
| 2429 | Ga0207681_10014662 | |||
| 2430 | Ga0207681_10032915 | |||
| 2431 | Ga0207681_10224280 | |||
| 2432 | Ga0207681_10753890 | |||
| 2433 | Ga0207681_10795349 | |||
| 2434 | Ga0207681_11504552 | |||
| 2435 | Ga0207694_10028662 | |||
| 2436 | Ga0207694_10059195 | |||
| 2437 | Ga0207694_10090675 | |||
| 2438 | Ga0207694_10183514 | |||
| 2439 | Ga0207694_10997260 | |||
| 2440 | Ga0207650_10001268 | |||
| 2441 | Ga0207650_10005261 | |||
| 2442 | Ga0207650_10040024 | |||
| 2443 | Ga0207650_10064135 | |||
| 2444 | Ga0207650_10182010 | |||
| 2445 | Ga0207650_10500826 | |||
| 2446 | Ga0207650_11165107 | |||
| 2447 | Ga0207659_10001423 | |||
| 2448 | Ga0207659_10003128 | |||
| 2449 | Ga0207659_10038727 | |||
| 2450 | Ga0207659_10082489 | |||
| 2451 | Ga0207659_10507491 | |||
| 2452 | Ga0207659_10827396 | |||
| 2453 | Ga0207659_11065387 | |||
| 2454 | Ga0207687_10111231 | |||
| 2455 | Ga0207687_10524916 | |||
| 2456 | Ga0207700_10001011 | |||
| 2457 | Ga0207700_10147485 | |||
| 2458 | Ga0207700_10387519 | |||
| 2459 | Ga0207664_10489841 | |||
| 2460 | Ga0207664_11067131 | |||
| 2461 | Ga0207644_10004489 | |||
| 2462 | Ga0207644_10004958 | |||
| 2463 | Ga0207644_10022737 | |||
| 2464 | Ga0207644_10052099 | |||
| 2465 | Ga0207644_10075325 | |||
| 2466 | Ga0207644_10077977 | |||
| 2467 | Ga0207644_10096958 | |||
| 2468 | Ga0207644_10435136 | |||
| 2469 | Ga0207644_11029242 | |||
| 2470 | Ga0207690_10004800 | |||
| 2471 | Ga0207690_10187909 | |||
| 2472 | Ga0207690_10464084 | |||
| 2473 | Ga0207706_10002276 | |||
| 2474 | Ga0207706_10026649 | |||
| 2475 | Ga0207706_10027008 | |||
| 2476 | Ga0207706_10032086 | |||
| 2477 | Ga0207706_10039929 | |||
| 2478 | Ga0207706_10164864 | |||
| 2479 | Ga0207706_10822153 | |||
| 2480 | Ga0207706_10871904 | |||
| 2481 | Ga0207686_10173253 | |||
| 2482 | Ga0207686_10246698 | |||
| 2483 | Ga0207686_10302986 | |||
| 2484 | Ga0207686_10390103 | |||
| 2485 | Ga0207709_10001678 | |||
| 2486 | Ga0207709_10010988 | |||
| 2487 | Ga0207709_10079035 | |||
| 2488 | Ga0207709_10874614 | |||
| 2489 | Ga0207670_10099553 | |||
| 2490 | Ga0207670_10307801 | |||
| 2491 | Ga0207669_10003846 | |||
| 2492 | Ga0207669_10010270 | |||
| 2493 | Ga0207669_10012607 | |||
| 2494 | Ga0207669_10085268 | |||
| 2495 | Ga0207669_10235698 | |||
| 2496 | Ga0207669_10239937 | |||
| 2497 | Ga0207669_10615124 | |||
| 2498 | Ga0207704_10006026 | |||
| 2499 | Ga0207704_10014210 | |||
| 2500 | Ga0207704_10017503 | |||
| 2501 | Ga0207704_10681021 | |||
| 2502 | Ga0207704_11373056 | |||
| 2503 | Ga0207691_10001131 | |||
| 2504 | Ga0207691_10001663 | |||
| 2505 | Ga0207691_10012709 | |||
| 2506 | Ga0207691_10022785 | |||
| 2507 | Ga0207691_10023069 | |||
| 2508 | Ga0207691_10033026 | |||
| 2509 | Ga0207691_10035543 | |||
| 2510 | Ga0207691_10059029 | |||
| 2511 | Ga0207691_10222012 | |||
| 2512 | Ga0207691_10419274 | |||
| 2513 | Ga0207691_10513620 | |||
| 2514 | Ga0207691_10632706 | |||
| 2515 | Ga0207691_10717664 | |||
| 2516 | Ga0207711_10003690 | |||
| 2517 | Ga0207711_10036823 | |||
| 2518 | Ga0207711_10049870 | |||
| 2519 | Ga0207711_10131852 | |||
| 2520 | Ga0207711_10154234 | |||
| 2521 | Ga0207689_10006291 | |||
| 2522 | Ga0207689_10026446 | |||
| 2523 | Ga0207689_10164403 | |||
| 2524 | Ga0207689_10479955 | |||
| 2525 | Ga0207689_10481973 | |||
| 2526 | Ga0207689_10935714 | |||
| 2527 | Ga0207661_10034192 | |||
| 2528 | Ga0207661_11098916 | |||
| 2529 | Ga0207679_10000201 | |||
| 2530 | Ga0207679_10156225 | |||
| 2531 | Ga0207679_10205136 | |||
| 2532 | Ga0207679_11014935 | |||
| 2533 | Ga0207679_11330367 | |||
| 2534 | Ga0207667_10002059 | |||
| 2535 | Ga0207667_10751256 | |||
| 2536 | Ga0207667_11647900 | |||
| 2537 | Ga0207651_10000562 | |||
| 2538 | Ga0207651_10007162 | |||
| 2539 | Ga0207651_10066265 | |||
| 2540 | Ga0207651_10239047 | |||
| 2541 | Ga0207651_10271290 | |||
| 2542 | Ga0207651_10613907 | |||
| 2543 | Ga0207651_10897019 | |||
| 2544 | Ga0207712_10014803 | |||
| 2545 | Ga0207712_10142390 | |||
| 2546 | Ga0207712_10188629 | |||
| 2547 | Ga0207712_10284826 | |||
| 2548 | Ga0207712_10793933 | |||
| 2549 | Ga0207668_10001789 | |||
| 2550 | Ga0207668_10002933 | |||
| 2551 | Ga0207668_10158500 | |||
| 2552 | Ga0207640_10055882 | |||
| 2553 | Ga0207640_10518385 | |||
| 2554 | Ga0207640_11196877 | |||
| 2555 | Ga0207640_11383352 | |||
| 2556 | Ga0207658_10000336 | |||
| 2557 | Ga0207658_10002766 | |||
| 2558 | Ga0207658_10009362 | |||
| 2559 | Ga0207658_10051764 | |||
| 2560 | Ga0207658_10174954 | |||
| 2561 | Ga0207658_10252584 | |||
| 2562 | Ga0207658_10492893 | |||
| 2563 | Ga0207658_10670323 | |||
| 2564 | Ga0207677_10376693 | |||
| 2565 | Ga0207677_10654372 | |||
| 2566 | Ga0207677_10948795 | |||
| 2567 | Ga0207677_11042000 | |||
| 2568 | Ga0207703_10000277 | |||
| 2569 | Ga0207703_10000866 | |||
| 2570 | Ga0207703_10031615 | |||
| 2571 | Ga0207703_10042191 | |||
| 2572 | Ga0207703_10983484 | |||
| 2573 | Ga0207639_10013995 | |||
| 2574 | Ga0207639_10046007 | |||
| 2575 | Ga0207639_10051308 | |||
| 2576 | Ga0207639_10213011 | |||
| 2577 | Ga0207639_10623822 | |||
| 2578 | Ga0207678_10007848 | |||
| 2579 | Ga0207678_10009214 | |||
| 2580 | Ga0207678_10253384 | |||
| 2581 | Ga0207678_10492475 | |||
| 2582 | Ga0207678_10516914 | |||
| 2583 | Ga0207678_10563073 | |||
| 2584 | Ga0207678_11487702 | |||
| 2585 | Ga0207708_10104075 | |||
| 2586 | Ga0207708_10990513 | |||
| 2587 | Ga0207702_10117957 | |||
| 2588 | Ga0207702_10230662 | |||
| 2589 | Ga0207702_10871672 | |||
| 2590 | Ga0207641_10001090 | |||
| 2591 | Ga0207641_10002663 | |||
| 2592 | Ga0207641_10007781 | |||
| 2593 | Ga0207641_10049730 | |||
| 2594 | Ga0207641_10269052 | |||
| 2595 | Ga0207641_10576301 | |||
| 2596 | Ga0207648_10000193 | |||
| 2597 | Ga0207648_10000512 | |||
| 2598 | Ga0207648_10015267 | |||
| 2599 | Ga0207648_10026488 | |||
| 2600 | Ga0207648_10080813 | |||
| 2601 | Ga0207648_10083200 | |||
| 2602 | Ga0207648_10147787 | |||
| 2603 | Ga0207648_10193541 | |||
| 2604 | Ga0207648_10234269 | |||
| 2605 | Ga0207648_10238932 | |||
| 2606 | Ga0207648_10428686 | |||
| 2607 | Ga0207648_10857208 | |||
| 2608 | Ga0207676_10001342 | |||
| 2609 | Ga0207676_10017194 | |||
| 2610 | Ga0207676_10028849 | |||
| 2611 | Ga0207676_10040743 | |||
| 2612 | Ga0207676_10089162 | |||
| 2613 | Ga0207676_10165480 | |||
| 2614 | Ga0207676_10203090 | |||
| 2615 | Ga0207676_10318130 | |||
| 2616 | Ga0207676_10557604 | |||
| 2617 | Ga0207674_10038832 | |||
| 2618 | Ga0207674_10047553 | |||
| 2619 | Ga0207674_10117981 | |||
| 2620 | Ga0207674_10411923 | |||
| 2621 | Ga0207675_100004491 | |||
| 2622 | Ga0207675_100007449 | |||
| 2623 | Ga0207675_100024043 | |||
| 2624 | Ga0207675_100109797 | |||
| 2625 | Ga0207675_100789046 | |||
| 2626 | Ga0207683_10003565 | |||
| 2627 | Ga0207683_10011473 | |||
| 2628 | Ga0207683_10026198 | |||
| 2629 | Ga0207683_10054273 | |||
| 2630 | Ga0207683_10058630 | |||
| 2631 | Ga0207683_10063497 | |||
| 2632 | Ga0207683_10069534 | |||
| 2633 | Ga0207683_10102073 | |||
| 2634 | Ga0207683_10177091 | |||
| 2635 | Ga0207683_10241812 | |||
| 2636 | Ga0207683_10328446 | |||
| 2637 | Ga0207683_10465256 | |||
| 2638 | Ga0207698_10014969 | |||
| 2639 | Ga0207698_10026945 | |||
| 2640 | Ga0207698_10031774 | |||
| 2641 | Ga0207698_10057062 | |||
| 2642 | Ga0207698_10218218 | |||
| 2643 | Ga0207698_10356318 | |||
| 2644 | Ga0207698_10426945 | |||
| 2645 | Ga0207698_11044887 | |||
| 2646 | Ga0209281_1000084 | |||
| 2647 | Ga0209281_1026166 | |||
| 2648 | Ga0209389_1038266 | |||
| 2649 | Ga0209974_10005575 | |||
| 2650 | Ga0209974_10082990 | |||
| 2651 | Ga0209974_10129742 | |||
| 2652 | Ga0209974_10347476 | |||
| 2653 | Ga0207428_10112389 | |||
| 2654 | Ga0207428_10598606 | |||
| 2655 | Ga0268266_10003010 | |||
| 2656 | Ga0268266_10319051 | |||
| 2657 | Ga0268266_10422883 | |||
| 2658 | Ga0268266_11609399 | |||
| 2659 | Ga0268265_10054074 | |||
| 2660 | Ga0268265_10096117 | |||
| 2661 | Ga0268265_10232084 | |||
| 2662 | Ga0268265_10970838 | |||
| 2663 | Ga0268265_11083685 | |||
| 2664 | Ga0268265_11084055 | |||
| 2665 | Ga0268265_12360000 | |||
| 2666 | Ga0268264_10003687 | |||
| 2667 | Ga0268264_10064917 | |||
| 2668 | Ga0268264_10371228 | |||
| 2669 | Ga0268264_10610115 | |||
| 2670 | Ga0265326_10027167 | |||
| 2671 | Ga0265319_1169895 | |||
| 2672 | Ga0265334_10025101 | |||
| 2673 | Ga0265318_10000347 | |||
| 2674 | Ga0307517_10137926 | |||
| 2675 | Ga0307517_10149902 | |||
| 2676 | Ga0307515_10000093 | |||
| 2677 | Ga0307515_10001261 | |||
| 2678 | Ga0307515_10001283 | |||
| 2679 | Ga0307515_10002007 | |||
| 2680 | Ga0307515_10004636 | |||
| 2681 | Ga0307515_10009359 | |||
| 2682 | Ga0307515_10020687 | |||
| 2683 | Ga0307515_10026101 | |||
| 2684 | Ga0307515_10033140 | |||
| 2685 | Ga0307515_10097581 | |||
| 2686 | Ga0307515_10601201 | |||
| 2687 | Ga0265324_10056156 | |||
| 2688 | Ga0268256_1046721 | |||
| 2689 | Ga0307511_10023720 | |||
| 2690 | Ga0265330_10001084 | |||
| 2691 | Ga0265332_10000920 | |||
| 2692 | Ga0265332_10032003 | |||
| 2693 | Ga0265332_10037720 | |||
| 2694 | Ga0265328_10000034 | |||
| 2695 | Ga0265328_10007066 | |||
| 2696 | Ga0265328_10047051 | |||
| 2697 | Ga0265320_10000726 | |||
| 2698 | Ga0265329_10002112 | |||
| 2699 | Ga0265329_10009738 | |||
| 2700 | Ga0265340_10053639 | |||
| 2701 | Ga0265339_10140775 | |||
| 2702 | Ga0265331_10000024 | |||
| 2703 | Ga0265331_10001289 | |||
| 2704 | Ga0265331_10170948 | |||
| 2705 | Ga0265327_10000079 | |||
| 2706 | Ga0265327_10001928 | |||
| 2707 | Ga0265327_10003163 | |||
| 2708 | Ga0265316_10000181 | |||
| 2709 | Ga0265316_10003160 | |||
| 2710 | Ga0265316_10276769 | |||
| 2711 | Ga0307513_10000054 | |||
| 2712 | Ga0307513_10006568 | |||
| 2713 | Ga0307513_10018646 | |||
| 2714 | Ga0307513_10042813 | |||
| 2715 | Ga0307513_10044622 | |||
| 2716 | Ga0307513_10044801 | |||
| 2717 | Ga0307513_10402559 | |||
| 2718 | Ga0307513_10539573 | |||
| 2719 | Ga0307513_10693937 | |||
| 2720 | Ga0307509_10095877 | |||
| 2721 | Ga0307509_10459073 | |||
| 2722 | Ga0307408_100000086 | |||
| 2723 | Ga0307408_100022993 | |||
| 2724 | Ga0307408_100046888 | |||
| 2725 | Ga0307408_100067163 | |||
| 2726 | Ga0307408_100160787 | |||
| 2727 | Ga0307408_100187706 | |||
| 2728 | Ga0307408_100378949 | |||
| 2729 | Ga0307408_100803196 | |||
| 2730 | Ga0307508_10003350 | |||
| 2731 | Ga0307508_10192655 | |||
| 2732 | Ga0307514_10000795 | |||
| 2733 | Ga0307514_10001506 | |||
| 2734 | Ga0307514_10019015 | |||
| 2735 | Ga0316575_10011595 | |||
| 2736 | Ga0316575_10021874 | |||
| 2737 | Ga0316575_10229925 | |||
| 2738 | Ga0316579_10101236 | |||
| 2739 | Ga0265314_10002818 | |||
| 2740 | Ga0265314_10030007 | |||
| 2741 | Ga0265314_10038203 | |||
| 2742 | Ga0265342_10013145 | |||
| 2743 | Ga0265342_10161854 | |||
| 2744 | Ga0265342_10179830 | |||
| 2745 | Ga0316576_10056045 | |||
| 2746 | Ga0316576_10056950 | |||
| 2747 | Ga0316576_10062960 | |||
| 2748 | Ga0316576_10133008 | |||
| 2749 | Ga0316576_10349662 | |||
| 2750 | Ga0316576_10369636 | |||
| 2751 | Ga0316576_10737003 | |||
| 2752 | Ga0316578_10035518 | |||
| 2753 | Ga0316578_10043091 | |||
| 2754 | Ga0316578_10309484 | |||
| 2755 | Ga0307516_10000383 | |||
| 2756 | Ga0307516_10004457 | |||
| 2757 | Ga0307516_10011720 | |||
| 2758 | Ga0307516_10017724 | |||
| 2759 | Ga0307405_10005414 | |||
| 2760 | Ga0307405_10461688 | |||
| 2761 | Ga0316577_10028286 | |||
| 2762 | Ga0316577_10092948 | |||
| 2763 | Ga0307413_10020005 | |||
| 2764 | Ga0307413_10445499 | |||
| 2765 | Ga0307413_10735437 | |||
| 2766 | Ga0307410_10023516 | |||
| 2767 | Ga0307410_10270386 | |||
| 2768 | Ga0307410_10656781 | |||
| 2769 | Ga0307406_10025180 | |||
| 2770 | Ga0307406_10086465 | |||
| 2771 | Ga0307406_10244742 | |||
| 2772 | Ga0307407_10034140 | |||
| 2773 | Ga0307407_11071374 | |||
| 2774 | Ga0307412_10113378 | |||
| 2775 | Ga0307409_100009342 | |||
| 2776 | Ga0307409_100399816 | |||
| 2777 | Ga0307409_100539592 | |||
| 2778 | Ga0307409_100950063 | |||
| 2779 | Ga0307409_101072765 | |||
| 2780 | Ga0307416_100003992 | |||
| 2781 | Ga0307416_100909977 | |||
| 2782 | Ga0307414_10148718 | |||
| 2783 | Ga0307414_10812751 | |||
| 2784 | Ga0307414_11196898 | |||
| 2785 | Ga0307414_11417309 | |||
| 2786 | Ga0307414_11708164 | |||
| 2787 | Ga0307411_10001320 | |||
| 2788 | Ga0307411_10005005 | |||
| 2789 | Ga0307411_10228908 | |||
| 2790 | Ga0307411_11399808 | |||
| 2791 | Ga0307415_100006691 | |||
| 2792 | Ga0307415_100339325 | |||
| 2793 | Ga0307415_101042866 | |||
| 2794 | Ga0316580_10012176 | |||
| 2795 | Ga0307507_10157523 | |||
| 2796 | Ga0307510_10113907 | |||
| 2797 | Ga0373948_0002019 | |||
| 2798 | Ga0373959_0051324 | |||
| 2799 | Ga0373938_0101796 | |||
| 2800 | Ga0373928_0096224 | |||
| 2801 | Ga0373940_0019893 | |||
| 2802 | Ga0373940_0298720 | |||
| 2803 | Ga0373949_0112347 | |||
| 2804 | Ga0373951_0047822 | |||
| 2805 | Ga0373932_0187236 | |||
| 2806 | Ga0373932_0226077 | |||
| 2807 | Ga0373936_0108705 | |||
| 2808 | Ga0373939_0000017 | |||
| 2809 | Ga0373941_0085831 | |||
| 2810 | Ga0373945_0451096 | |||
| 2811 | Ga0373960_0000109 | |||
| 2812 | Ga0373943_0130231 | |||
| 2813 | Ga0373943_0287586 | |||
| 2814 | Ga0373943_0414377 | |||
| 2815 | Ga0373946_0073518 | |||
| 2816 | Ga0373946_0227840 | |||
| 2817 | Ga0373946_0283561 | |||
| 2818 | Ga0373955_0006739 | |||
| 2819 | Ga0373955_0311201 | |||
| 2820 | Ga0373955_0360841 | |||
| 2821 | Ga0373955_0727802 | |||
| 2822 | Ga0373961_0195318 | |||
| 2823 | Ga0316574_0002109 | |||
| 2824 | Ga0316574_0004706 | |||
| 2825 | Ga0316574_0006307 | |||
| 2826 | Ga0316574_0106501 | |||
| 2827 | Ga0316574_0167217 | |||
| 2828 | Ga0316574_0280514 | |||
| 2829 | Ga0316574_0783821 | |||
| 2830 | Ga0373924_0166644 | |||
| 2831 | Ga0373924_0194584 | |||
| 2832 | Ga0373924_0245055 | |||
| 2833 | Ga0373931_0000641 | |||
| 2834 | Ga0373931_0014924 | |||
| 2835 | Ga0373935_0302056 | |||
| 2836 | Ga0373927_0286813 | |||
| 2837 | Ga0373933_0018395 | |||
| 2838 | Ga0373947_0215560 | |||
| 2839 | Ga0373937_0005971 | |||
| 2840 | Ga0373937_0052497 | |||
| 2841 | Ga0373937_0075221 | |||
| 2842 | Ga0373937_0150570 | |||
| 2843 | Ga0373937_0224658 | |||
| 2844 | Ga0373937_0293183 | |||
| 2845 | Ga0373937_0901458 | |||
| 2846 | Ga0316582_0001870 | |||
| 2847 | Ga0316582_0034461 | |||
| 2848 | Ga0316582_0134775 | |||
| 2849 | Ga0316584_0027762 | |||
| 2850 | Ga0316584_0050235 | |||
| 2851 | Ga0316584_0127724 | |||
| 2852 | Ga0316584_0194067 | |||
| 2853 | Ga0373925_0100843 | |||
| 2854 | Ga0373925_0231330 | |||
| 2855 | Ga0373925_0521850 | |||
| 2856 | Ga0373925_0801770 | |||
| 2857 | Ga0373925_0954722 | |||
| 2858 | Ga0373925_1242065 | |||
| 2859 | Ga0395899_0000010 | |||
| 2860 | Ga0395899_0018492 | |||
| 2861 | Ga0395899_0235742 | |||
| 2862 | Ga0395900_0000005 | |||
| 2863 | Ga0395900_0008244 | |||
| 2864 | Ga0395900_0010948 | |||
| 2865 | Ga0395900_0105001 | |||
| 2866 | Ga0395900_0128127 | |||
| 2867 | Ga0395900_0139094 | |||
| 2868 | Ga0395900_0181050 | |||
| 2869 | Ga0395900_0229277 | |||
| 2870 | Ga0395900_0404011 | |||
| 2871 | Ga0395900_1492503 | |||
| 2872 | Ga0395898_0013534 | |||
| 2873 | Ga0395898_0018082 | |||
| 2874 | Ga0395898_0109116 | |||
| 2875 | Ga0395898_0418814 | |||
| 2876 | Ga0395905_0000653 | |||
| 2877 | Ga0395905_0000733 | |||
| 2878 | Ga0395905_0000895 | |||
| 2879 | Ga0395905_0003480 | |||
| 2880 | Ga0395905_0018268 | |||
| 2881 | Ga0395905_0073034 | |||
| 2882 | Ga0395905_0102588 | |||
| 2883 | Ga0395905_0123164 | |||
| 2884 | Ga0395905_0203231 | |||
| 2885 | Ga0395905_0303223 | |||
| 2886 | Ga0395905_0355915 | |||
| 2887 | Ga0436364_0528735 | |||
| 2888 | Ga0436364_0667041 | |||
| 2889 | Ga0436364_1043221 | |||
| 2890 | Ga0395901_0051281 | |||
| 2891 | Ga0395901_0052453 | |||
| 2892 | Ga0395901_0065113 | |||
| 2893 | Ga0395901_0081508 | |||
| 2894 | Ga0395901_0136710 | |||
| 2895 | Ga0395901_0175988 | |||
| 2896 | Ga0395901_0277755 | |||
| 2897 | Ga0395901_0529523 | |||
| 2898 | Ga0400490_35404 | |||
| 2899 | Ga0400488_10414 | |||
| 2900 | Ga0400483_115564 | |||
| 2901 | Ga0400483_167120 | |||
| 2902 | Ga0400489_77120 | |||
| 2903 | Ga0237816_00148 | |||
| 2904 | Ga0436365_0308506 | |||
| 2905 | Ga0436365_0805618 | |||
| 2906 | Ga0436365_0960828 | |||
| 2907 | Ga0436365_1149228 | |||
| 2908 | Ga0436365_1378466 | |||
| 2909 | Ga0436361_0932343 | |||
| 2910 | Ga0436363_0998404 | |||
| 2911 | Ga0439438_000268 | |||
| 2912 | Ga0439461_0020382 | |||
| 2913 | Ga0451787_664484 | |||
| 2914 | Ga0451789_0205740 | |||
| 2915 | Ga0451789_0668546 | |||
| 2916 | Ga0451791_0533597 | |||
| 2917 | Ga0451793_0259988 | |||
| 2918 | Ga0451793_0300321 | |||
| 2919 | Ga0451793_0779431 | |||
| 2920 | Ga0451793_1098328 | |||
| 2921 | Ga0451797_0814064 | |||
| 2922 | Ga0451797_0960381 | |||
| 2923 | Ga0451797_1287132 | |||
| 2924 | Ga0451795_0037673 | |||
| 2925 | Ga0451795_0302360 | |||
| 2926 | Ga0451795_1093367 | |||
| 2927 | Ga0451800_0531416 | |||
| 2928 | Ga0451800_1143563 | |||
| 2929 | Ga0451800_1336356 | |||
| 2930 | Ga0451800_1347080 | |||
| 2931 | Ga0451800_1453629 | |||
| 2932 | Ga0451802_0737550 | |||
| 2933 | Ga0451802_1791109 | |||
| 2934 | Ga0451807_0109086 | |||
| 2935 | Ga0451807_1015374 | |||
| 2936 | Ga0451807_2127931 | |||
| 2937 | Ga0451833_0875683 | |||
| 2938 | Ga0451833_1495386 | |||
| 2939 | Ga0451837_0954212 | |||
| 2940 | Ga0451841_0278424 | |||
| 2941 | Ga0451841_0659571 | |||
| 2942 | Ga0451851_1274973 | |||
| 2943 | Ga0451843_0108815 | |||
| 2944 | Ga0451853_1190134 | |||
| 2945 | Ga0451853_3865866 | |||
| 2946 | Ga0451853_4036164 | |||
| 2947 | Ga0439437_002898 | |||
| 2948 | Ga0439442_050139 | |||
| 2949 | Ga0439463_000609 | |||
| 2950 | Ga0450911_020803 | |||
| 2951 | Ga0450913_017850 | |||
| 2952 | Ga0450917_002467 | |||
| 2953 | Ga0450888_000480 | |||
| 2954 | Ga0450890_000295 | |||
| 2955 | Ga0450890_039658 | |||
| 2956 | Ga0450892_001087 | |||
| 2957 | Ga0450903_027492 | |||
| 2958 | Ga0450904_014358 | |||
| 2959 | Ga0450889_009573 | |||
| 2960 | Ga0439446_0004039 | |||
| 2961 | Ga0450893_0021574 | |||
| 2962 | Ga0451577_0000013 | |||
| 2963 | Ga0451577_0003554 | |||
| 2964 | Ga0451577_0003789 | |||
| 2965 | Ga0451577_0005413 | |||
| 2966 | Ga0451577_0036543 | |||
| 2967 | Ga0451577_0143508 | |||
| 2968 | Ga0451577_0537562 | |||
| 2969 | Ga0451577_1964921 | |||
| 2970 | Ga0466969_0000036 | |||
| 2971 | Ga0466969_0006230 | |||
| 2972 | Ga0466969_0025156 | |||
| 2973 | Ga0466969_0032912 | |||
| 2974 | Ga0466969_0039565 | |||
| 2975 | Ga0466972_0000282 | |||
| 2976 | Ga0466972_0267270 | |||
| 2977 | Ga0453683_0000059 | |||
| 2978 | Ga0453683_0004047 | |||
| 2979 | Ga0453683_1236468 | |||
| 2980 | Ga0466965_0049757 | |||
| 2981 | Ga0466965_0091575 | |||
| 2982 | Ga0466965_0195039 | |||
| 2983 | Ga0466965_0223023 | |||
| 2984 | Ga0466965_0231324 | |||
| 2985 | Ga0466966_0026011 | |||
| 2986 | Ga0466966_0224184 | |||
| 2987 | Ga0466961_0000406 | |||
| 2988 | Ga0466961_0003921 | |||
| 2989 | Ga0466961_0015938 | |||
| 2990 | Ga0466961_0027523 | |||
| 2991 | Ga0466961_0231567 | |||
| 2992 | Ga0466963_0008785 | |||
| 2993 | Ga0466963_0355516 | |||
| 2994 | Ga0466963_1240527 | |||
| 2995 | Ga0466964_0261218 | |||
| 2996 | Ga0453684_0000040 | |||
| 2997 | Ga0453684_0000085 | |||
| 2998 | Ga0453684_0070718 | |||
| 2999 | Ga0453684_1221549 | |||
| 3000 | Ga0453684_1418603 | |||
| 3001 | Ga0453684_1703371 | |||
| 3002 | Ga0466971_0034131 | |||
| 3003 | Ga0466970_0023540 | |||
| 3004 | Ga0466970_0025771 | |||
| 3005 | Ga0466970_0046693 | |||
| 3006 | Ga0466970_0401824 | |||
| 3007 | Ga0466957_0238191 | |||
| 3008 | Ga0466959_0032407 | |||
| 3009 | Ga0466959_0038662 | |||
| 3010 | Ga0466959_0042728 | |||
| 3011 | Ga0466959_0306609 | |||
| 3012 | Ga0466959_0767138 | |||
| 3013 | Ga0451576_0000018 | |||
| 3014 | Ga0451576_0006036 | |||
| 3015 | Ga0451576_0046314 | |||
| 3016 | Ga0451576_0062742 | |||
| 3017 | Ga0451576_0147519 | |||
| 3018 | Ga0451576_0625897 | |||
| 3019 | Ga0451576_1084978 | |||
| 3020 | Ga0451576_1689404 | |||
| 3021 | Ga0466967_1225235 | |||
| 3022 | Ga0495617_171111 | |||
| 3023 | Ga0495627_008265 | |||
| 3024 | Ga0495592_0059971 | |||
| 3025 | Ga0495590_0169163 | |||
| 3026 | Ga0495591_002740 | |||
| 3027 | Ga0495629_0016220 | |||
| 3028 | Ga0495629_0107860 | |||
| 3029 | Ga0495629_0252120 | |||
| 3030 | Ga0495629_0480371 | |||
| 3031 | Ga0495638_0060421 | |||
| 3032 | Ga0495638_0088234 | |||
| 3033 | Ga0495638_0115806 | |||
| 3034 | Ga0495638_0550317 | |||
| 3035 | Ga0495653_0019297 | |||
| 3036 | Ga0495650_0008829 | |||
| 3037 | Ga0495650_0059084 | |||
| 3038 | Ga0495580_0100343 | |||
| 3039 | Ga0495580_0206695 | |||
| 3040 | Ga0495580_0210191 | |||
| 3041 | Ga0495580_0234349 | |||
| 3042 | Ga0495580_0365861 | |||
| 3043 | Ga0495580_0383443 | |||
| 3044 | Ga0495580_0468007 | |||
| 3045 | Ga0495582_0014361 | |||
| 3046 | Ga0495582_0117472 | |||
| 3047 | Ga0495582_0355075 | |||
| 3048 | Ga0495605_0000079 | |||
| 3049 | Ga0495605_0010273 | |||
| 3050 | Ga0495664_0023776 | |||
| 3051 | Ga0495664_0098878 | |||
| 3052 | Ga0495584_0053064 | |||
| 3053 | Ga0495594_0002116 | |||
| 3054 | Ga0495596_0116045 | |||
| 3055 | Ga0495607_0005948 | |||
| 3056 | Ga0495607_0024242 | |||
| 3057 | Ga0495607_0027845 | |||
| 3058 | Ga0495607_0187075 | |||
| 3059 | Ga0495607_0191961 | |||
| 3060 | Ga0495583_0006278 | |||
| 3061 | Ga0495583_0138597 | |||
| 3062 | Ga0495606_0000018 | |||
| 3063 | Ga0495606_0001693 | |||
| 3064 | Ga0495606_0004808 | |||
| 3065 | Ga0495606_0012829 | |||
| 3066 | Ga0495606_0086766 | |||
| 3067 | Ga0495608_0532451 | |||
| 3068 | Ga0495610_0039322 | |||
| 3069 | Ga0495610_0063754 | |||
| 3070 | Ga0495610_0112226 | |||
| 3071 | Ga0495610_0151459 | |||
| 3072 | Ga0495610_0237895 | |||
| 3073 | Ga0495618_0690362 | |||
| 3074 | Ga0495620_0013339 | |||
| 3075 | Ga0495620_0048024 | |||
| 3076 | Ga0495620_0092085 | |||
| 3077 | Ga0495620_0300239 | |||
| 3078 | Ga0495628_0245793 | |||
| 3079 | Ga0495631_0048144 | |||
| 3080 | Ga0495632_0004573 | |||
| 3081 | Ga0495632_0005877 | |||
| 3082 | Ga0495632_0019284 | |||
| 3083 | Ga0495632_0055251 | |||
| 3084 | Ga0495632_0067376 | |||
| 3085 | Ga0495632_0146319 | |||
| 3086 | Ga0495643_0004561 | |||
| 3087 | Ga0495643_0277504 | |||
| 3088 | Ga0495644_0040888 | |||
| 3089 | Ga0495644_0187454 | |||
| 3090 | Ga0495642_0010968 | |||
| 3091 | Ga0495642_0126278 | |||
| 3092 | Ga0495652_0474867 | |||
| 3093 | Ga0495654_0091204 | |||
| 3094 | Ga0495640_0152833 | |||
| 3095 | Ga0495586_0199579 | |||
| 3096 | Ga0495598_0126453 | |||
| 3097 | Ga0495598_0273086 | |||
| 3098 | Ga0495598_0363899 | |||
| 3099 | Ga0495609_0124522 | |||
| 3100 | Ga0495621_0064902 | |||
| 3101 | Ga0495597_0092634 | |||
| 3102 | Ga0495597_0278207 | |||
| 3103 | Ga0495645_0074164 | |||
| 3104 | Ga0495645_0245104 | |||
| 3105 | Ga0495622_0027086 | |||
| 3106 | Ga0495656_0124763 | |||
| 3107 | Ga0495668_0026531 | |||
| 3108 | Ga0495668_0273037 | |||
| 3109 | Ga0495668_0291160 | |||
| 3110 | Ga0495668_0603867 | |||
| 3111 | Ga0495611_0001249 | |||
| 3112 | Ga0495611_0063900 | |||
| 3113 | Ga0495611_0088526 | |||
| 3114 | Ga0495611_0270890 | |||
| 3115 | Ga0495625_0010777 | |||
| 3116 | Ga0495625_0128312 | |||
| 3117 | Ga0495625_0180493 | |||
| 3118 | Ga0495625_0609068 | |||
| 3119 | Ga0495635_0074733 | |||
| 3120 | Ga0495635_0115894 | |||
| 3121 | Ga0495659_0338654 | |||
| 3122 | Ga0495661_0025068 | |||
| 3123 | Ga0495661_0226445 | |||
| 3124 | Ga0495657_0082973 | |||
| 3125 | Ga0495599_0161085 | |||
| 3126 | Ga0495646_0073389 | |||
| 3127 | Ga0495647_0021435 | |||
| 3128 | Ga0495647_0021548 | |||
| 3129 | Ga0495658_0018582 | |||
| 3130 | Ga0495658_0032930 | |||
| 3131 | Ga0495658_0254946 | |||
| 3132 | Ga0495658_0263091 | |||
| 3133 | Ga0495669_0015535 | |||
| 3134 | Ga0495613_0339900 | |||
| 3135 | Ga0495613_0420755 | |||
| 3136 | Ga0495670_0007900 | |||
| 3137 | Ga0495671_0020895 | |||
| 3138 | Ga0495671_0053956 | |||
| 3139 | Ga0495671_0397257 | |||
| 3140 | Ga0495649_0003794 | |||
| 3141 | Ga0495649_0222559 | |||
| 3142 | Ga0495589_0017714 | |||
| 3143 | Ga0495589_0272469 | |||
| 3144 | Ga0495600_0286469 | |||
| 3145 | Ga0495660_0025217 | |||
| 3146 | Ga0495660_0394460 | |||
| 3147 | Ga0495604_0192249 | |||
| 3148 | Ga0495636_0060240 | |||
| 3149 | Ga0495674_0111820 | |||
| 3150 | Ga0495672_0009983 | |||
| 3151 | Ga0495680_0255245 | |||
| 3152 | Ga0495687_000912 | |||
| 3153 | Ga0495687_011633 | |||
| 3154 | Ga0495677_0019763 | |||
| 3155 | Ga0495679_066707 | |||
| 3156 | Ga0495673_0010730 | |||
| 3157 | Ga0495673_0021951 | |||
| 3158 | Ga0495681_0145242 | |||
| 3159 | Ga0495684_0163503 | |||
| 3160 | Ga0495686_0337769 | |||
| 3161 | Ga0495686_0549571 | |||
| 3162 | Ga0495614_0242387 | |||
| 3163 | Ga0495626_0111959 | |||
| 3164 | Ga0495626_0124367 | |||
| 3165 | Ga0496100_0832195 | |||
| 3166 | Ga0496101_0024961 | |||
| 3167 | Ga0496101_0297444 | |||
| 3168 | Ga0496101_0364831 | |||
| 3169 | Ga0496102_0021149 | |||
| 3170 | Ga0496102_0039318 | |||
| 3171 | Ga0496102_0079561 | |||
| 3172 | Ga0496102_0136772 | |||
| 3173 | Ga0496102_0439587 | |||
| 3174 | Ga0496102_1093602 | |||
| 3175 | Ga0496104_0013206 | |||
| 3176 | Ga0496104_0085647 | |||
| 3177 | Ga0496104_0124767 | |||
| 3178 | Ga0496105_0745533 | |||
| 3179 | Ga0496106_0057379 | |||
| 3180 | Ga0496106_0084887 | |||
| 3181 | Ga0496106_0185495 | |||
| 3182 | Ga0496106_0299452 | |||
| 3183 | Ga0496107_0088189 | |||
| 3184 | Ga0496108_0543160 | |||
| 3185 | Ga0496108_1625881 | |||
| 3186 | Ga0496108_1737401 | |||
| 3187 | Ga0496109_0125768 | |||
| 3188 | Ga0496109_0520052 | |||
| 3189 | Ga0496109_0592397 | |||
| 3190 | Ga0496109_0940342 | |||
| 3191 | Ga0496110_0069135 | |||
| 3192 | Ga0496110_0132413 | |||
| 3193 | Ga0496110_0218016 | |||
| 3194 | Ga0496110_0262072 | |||
| 3195 | Ga0496110_0546433 | |||
| 3196 | Ga0496110_1333805 | |||
| 3197 | Ga0496112_0005059 | |||
| 3198 | Ga0496113_0007024 | |||
| 3199 | Ga0496114_0001047 | |||
| 3200 | Ga0496114_0008159 | |||
| 3201 | Ga0496114_0028612 | |||
| 3202 | Ga0496114_0061024 | |||
| 3203 | Ga0496114_0352539 | |||
| 3204 | Ga0496115_0204471 | |||
| 3205 | Ga0496115_0375720 | |||
| 3206 | Ga0496116_0020148 | |||
| 3207 | Ga0496117_0056774 | |||
| 3208 | Ga0496118_0142551 | |||
| 3209 | Ga0496119_0000834 | |||
| 3210 | Ga0496120_0000718 | |||
| 3211 | Ga0496121_0026934 | |||
| 3212 | Ga0496122_0000592 | |||
| 3213 | Ga0496122_0016985 | |||
| 3214 | Ga0496123_0000656 | |||
| 3215 | Ga0496123_0030819 | |||
| 3216 | Ga0496124_0003362 | |||
| 3217 | Ga0496124_0010223 | |||
| 3218 | Ga0496124_0022120 | |||
| 3219 | Ga0496124_0078596 | |||
| 3220 | Ga0496124_0079168 | |||
| 3221 | Ga0496124_0091501 | |||
| 3222 | Ga0496124_0437474 | |||
| 3223 | Ga0496125_0022697 | |||
| 3224 | Ga0496125_0062565 | |||
| 3225 | Ga0496125_0137894 | |||
| 3226 | Ga0496126_0011307 | |||
| 3227 | Ga0496126_0047047 | |||
| 3228 | Ga0496126_0293202 | |||
| 3229 | Ga0501309_010432 | |||
| 3230 | Ga0495678_023711 | |||
| 3231 | Ga0495678_036235 | |||
| 3232 | Ga0495678_119543 | |||
| 3233 | Ga0495682_0002074 | |||
| 3234 | Ga0495682_0340000 | |||
| 3235 | Ga0501299_012430 | |||
| 3236 | Ga0501299_040320 | |||
| 3237 | Ga0501314_003354 | |||
| 3238 | Ga0501031_0001649 | |||
| 3239 | Ga0501031_1003052 | |||
| 3240 | Ga0501032_0125464 | |||
| 3241 | Ga0501032_0142264 | |||
| 3242 | Ga0501032_0750232 | |||
| 3243 | Ga0501033_0082237 | |||
| 3244 | Ga0501034_0130008 | |||
| 3245 | Ga0501034_0172250 | |||
| 3246 | Ga0501034_0199961 | |||
| 3247 | Ga0501034_0364902 | |||
| 3248 | Ga0501036_0245252 | |||
| 3249 | Ga0501036_0640592 | |||
| 3250 | Ga0501036_0820355 | |||
| 3251 | Ga0501037_0013659 | |||
| 3252 | Ga0501038_0120063 | |||
| 3253 | Ga0501038_0348001 | |||
| 3254 | Ga0501038_0891020 | |||
| 3255 | Ga0501039_0032761 | |||
| 3256 | Ga0501039_0052269 | |||
| 3257 | Ga0501039_0188149 | |||
| 3258 | Ga0501040_0103737 | |||
| 3259 | Ga0501040_0165251 | |||
| 3260 | Ga0501040_0675638 | |||
| 3261 | Ga0501040_0735400 | |||
| 3262 | Ga0501042_1075571 | |||
| 3263 | Ga0501043_0000004 | |||
| 3264 | Ga0501043_0088959 | |||
| 3265 | Ga0501046_0000016 | |||
| 3266 | Ga0501046_0201970 | |||
| 3267 | Ga0501046_0218551 | |||
| 3268 | Ga0501047_0000012 | |||
| 3269 | Ga0501047_0002537 | |||
| 3270 | Ga0501047_0122948 | |||
| 3271 | Ga0501047_0287570 | |||
| 3272 | Ga0501047_0293404 | |||
| 3273 | Ga0501047_0335198 | |||
| 3274 | Ga0501047_0335504 | |||
| 3275 | Ga0501047_0625024 | |||
| 3276 | Ga0501047_1051994 | |||
| 3277 | Ga0501048_0010438 | |||
| 3278 | Ga0501068_0275027 | |||
| 3279 | Ga0501069_0011816 | |||
| 3280 | Ga0501070_0013166 | |||
| 3281 | Ga0501070_0050947 | |||
| 3282 | Ga0501070_0734822 | |||
| 3283 | Ga0501071_0008835 | |||
| 3284 | Ga0501071_0410886 | |||
| 3285 | Ga0501073_0025636 | |||
| 3286 | Ga0501074_0002091 | |||
| 3287 | Ga0501076_0373427 | |||
| 3288 | Ga0501199_005273 | |||
| 3289 | Ga0501202_013977 | |||
| 3290 | Ga0501211_000722 | |||
| 3291 | Ga0501222_001247 | |||
| 3292 | Ga0501249_087284 | |||
| 3293 | Ga0501253_028874 | |||
| 3294 | Ga0501080_0033654 | |||
| 3295 | Ga0501080_0047008 | |||
| 3296 | Ga0501080_0175561 | |||
| 3297 | Ga0501080_0527557 | |||
| 3298 | Ga0501080_1094767 | |||
| 3299 | Ga0501081_0217634 | |||
| 3300 | Ga0501083_0014526 | |||
| 3301 | Ga0501264_006472 | |||
| 3302 | Ga0501266_008842 | |||
| 3303 | Ga0501267_006197 | |||
| 3304 | Ga0501272_005513 | |||
| 3305 | Ga0501278_010212 | |||
| 3306 | Ga0501279_003394 | |||
| 3307 | Ga0501035_0016682 | |||
| 3308 | Ga0501035_0068118 | |||
| 3309 | Ga0501035_0103549 | |||
| 3310 | Ga0501044_0007417 | |||
| 3311 | Ga0501044_0064676 | |||
| 3312 | Ga0501044_0139113 | |||
| 3313 | Ga0501044_0191635 | |||
| 3314 | Ga0501044_0247169 | |||
| 3315 | Ga0501045_0009097 | |||
| 3316 | Ga0501045_0434923 | |||
| 3317 | Ga0501226_004955 | |||
| 3318 | Ga0501226_006472 | |||
| 3319 | nmdc:mga03683_102014_c1 | |||
| 3320 | nmdc:mga03683_115789_c1 | |||
| 3321 | nmdc:mga03683_307019_c1 | |||
| 3322 | nmdc:mga03683_313614_c1 | |||
| 3323 | nmdc:mga03683_54553_c1 | |||
| 3324 | nmdc:mga03n38_41237_c1 | |||
| 3325 | nmdc:mga03n38_827733_c1 | |||
| 3326 | nmdc:mga00v17_127984_c1 | |||
| 3327 | nmdc:mga00v17_143688_c1 | |||
| 3328 | nmdc:mga00v17_186953_c1 | |||
| 3329 | nmdc:mga00v17_828904_c1 | |||
| 3330 | nmdc:mga0yw44_30213_c1 | |||
| 3331 | nmdc:mga0yw44_459892_c1 | |||
| 3332 | nmdc:mga0k408_109179_c1 | |||
| 3333 | nmdc:mga0k408_11211_c1 | |||
| 3334 | nmdc:mga0k408_114833_c1 | |||
| 3335 | nmdc:mga0k408_136285_c1 | |||
| 3336 | nmdc:mga0k408_14639_c1 | |||
| 3337 | nmdc:mga0k408_152829_c1 | |||
| 3338 | nmdc:mga0k408_15620_c1 | |||
| 3339 | nmdc:mga0k408_263616_c1 | |||
| 3340 | nmdc:mga0k408_2673_c1 | |||
| 3341 | nmdc:mga0k408_47503_c1 | |||
| 3342 | nmdc:mga0k408_60046_c1 | |||
| 3343 | nmdc:mga0k408_607146_c1 | |||
| 3344 | nmdc:mga0k408_63531_c1 | |||
| 3345 | nmdc:mga0k408_92973_c1 | |||
| 3346 | nmdc:mga0k408_96201_c1 | |||
| 3347 | nmdc:mga06z11_23782_c1 | |||
| 3348 | nmdc:mga06z11_27127_c1 | |||
| 3349 | nmdc:mga06z11_51754_c1 | |||
| 3350 | nmdc:mga06z11_551408_c1 | |||
| 3351 | nmdc:mga06z11_65667_c1 | |||
| 3352 | nmdc:mga07m45_1019_c1 | |||
| 3353 | nmdc:mga07m45_103975_c1 | |||
| 3354 | nmdc:mga07m45_1241_c1 | |||
| 3355 | nmdc:mga07m45_144604_c1 | |||
| 3356 | nmdc:mga07m45_215893_c1 | |||
| 3357 | nmdc:mga07m45_22037_c1 | |||
| 3358 | nmdc:mga07m45_4444_c1 | |||
| 3359 | nmdc:mga07m45_46325_c1 | |||
| 3360 | nmdc:mga07m45_650_c1 | |||
| 3361 | nmdc:mga07m45_687772_c1 | |||
| 3362 | nmdc:mga05p37_1697299_c1 | |||
| 3363 | nmdc:mga05p37_566117_c1 | |||
| 3364 | nmdc:mga09592_349395_c1 | |||
| 3365 | nmdc:mga09592_522300_c1 | |||
| 3366 | nmdc:mga0qj67_453007_c1 | |||
| 3367 | nmdc:mga0qj67_639730_c1 | |||
| 3368 | nmdc:mga06r32_352_c1 | |||
| 3369 | nmdc:mga06r32_77840_c1 | |||
| 3370 | nmdc:mga08y16_304961_c1 | |||
| 3371 | nmdc:mga08y16_465913_c1 | |||
| 3372 | nmdc:mga08y16_674920_c1 | |||
| 3373 | nmdc:mga0sz30_45120_c1 | |||
| 3374 | Ga0495601_0057819 | |||
| 3375 | Ga0495601_0448656 | |||
| 3376 | Ga0495612_0038847 | |||
| 3377 | Ga0495612_0040355 | |||
| 3378 | Ga0495619_0119836 | |||
| 3379 | Ga0495619_0734208 | |||
| 3380 | Ga0500578_0000049 | |||
| 3381 | Ga0500644_0032189 | |||
| 3382 | Ga0500644_0099111 | |||
| 3383 | Ga0500646_0003195 | |||
| 3384 | Ga0500647_0132189 | |||
| 3385 | Ga0500583_0389368 | |||
| 3386 | Ga0500583_0532016 | |||
| 3387 | Ga0500651_0097062 | |||
| 3388 | Ga0500651_0114859 | |||
| 3389 | Ga0500651_0406196 | |||
| 3390 | Ga0500650_0057076 | |||
| 3391 | Ga0500650_0183909 | |||
| 3392 | Ga0500660_124303 | |||
| 3393 | Ga0500555_089260 | |||
| 3394 | Ga0500562_007913 | |||
| 3395 | Ga0500569_105324 | |||
| 3396 | Ga0500591_075673 | |||
| 3397 | Ga0500593_000729 | |||
| 3398 | Ga0500593_030750 | |||
| 3399 | Ga0500594_0054739 | |||
| 3400 | Ga0500594_0058307 | |||
| 3401 | Ga0500628_000439 | |||
| 3402 | Ga0500642_0006244 | |||
| 3403 | Ga0500652_000044 | |||
| 3404 | Ga0500652_023494 | |||
| 3405 | Ga0500655_029979 | |||
| 3406 | Ga0500658_0002543 | |||
| 3407 | Ga0500658_0015441 | |||
| 3408 | Ga0500658_0074183 | |||
| 3409 | Ga0500658_0128090 | |||
| 3410 | Ga0500559_0006184 | |||
| 3411 | Ga0500559_0327048 | |||
| 3412 | Ga0500561_0058022 | |||
| 3413 | Ga0500568_0001263 | |||
| 3414 | Ga0500568_0016548 | |||
| 3415 | Ga0500568_0027522 | |||
| 3416 | Ga0500568_0038336 | |||
| 3417 | Ga0500577_0003546 | |||
| 3418 | Ga0500577_0347215 | |||
| 3419 | Ga0500588_0033202 | |||
| 3420 | Ga0500604_0012951 | |||
| 3421 | Ga0500604_0112477 | |||
| 3422 | Ga0500619_000120 | |||
| 3423 | Ga0500622_0000002 | |||
| 3424 | Ga0500622_0000128 | |||
| 3425 | Ga0500622_0001173 | |||
| 3426 | Ga0500622_0001549 | |||
| 3427 | Ga0500622_0007550 | |||
| 3428 | Ga0500622_0071964 | |||
| 3429 | Ga0500622_0170851 | |||
| 3430 | Ga0500645_000413 | |||
| 3431 | Ga0500645_014269 | |||
| 3432 | Ga0500565_014417 | |||
| 3433 | Ga0500587_005732 | |||
| 3434 | Ga0500587_011776 | |||
| 3435 | Ga0501084_0054143 | |||
| 3436 | Ga0590071_001980 | |||
| 3437 | Ga0501082_0821023 | |||
| 3438 | 2599971989 | |||
| 3439 | 2644363260 | |||
| 3440 | 2765586689 | |||
| 3441 | 2855021425 | |||
| 3442 | 2861695613 | |||
| 3443 | 2919156000 | |||
| 3444 | 2928516354 | |||
| 3445 | 2952254092 | |||
| 3446 | 3003670766 | |||
| 3447 | 8056163744 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4lhr-assembly1.cif.gz_A | crystal structure of a deoxyuridine 5'-triphosphate nucleotidohydrolase from burkholderia thailandensis | 0.9693 | 2 | 135 |
| 4lhr-assembly1.cif.gz_A | crystal structure of a deoxyuridine 5'-triphosphate nucleotidohydrolase from burkholderia thailandensis | 0.9623 | 2 | 135 |
| 1dup-assembly1.cif.gz_A | deoxyuridine 5'-triphosphate nucleotido hydrolase (d-utpase) | 0.9611 | 2 | 135 |
| 1rnj-assembly1.cif.gz_A | crystal structure of inactive mutant dutpase complexed with substrate analogue imido-dutp | 0.9586 | 2 | 135 |
| 6mai-assembly1.cif.gz_A | crystal structure of deoxyuridine 5'-triphosphate nucleotidohydrolase from legionella pneumophila philadelphia 1 | 0.9553 | 3 | 137 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3tqzA00 | Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) | 0.9468 | 3 | 137 | 2.70.40.10 |
| 1snfC00 | Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) | 0.9402 | 3 | 135 | 2.70.40.10 |
| 3tqzA00 | Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) | 0.9334 | 3 | 137 | 2.70.40.10 |
| 1snfC00 | Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) | 0.9332 | 3 | 135 | 2.70.40.10 |
| 3mbqA00 | Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) | 0.9118 | 3 | 136 | 2.70.40.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A259EVG0-F1-model_v4 | dUTP diphosphatase (EC 3.6.1.23) | 0.9941 | 5 | 118 |
GO:0000287
GO:0004170 GO:0006226 GO:0046081 |
| AF-A0A534E2N6-F1-model_v4 | deleted | 0.9899 | 19 | 118 |
|
| AF-A0A661CKF5-F1-model_v4 | dUTP diphosphatase (EC 3.6.1.23) | 0.9846 | 3 | 126 |
GO:0000287
GO:0004170 GO:0006226 GO:0046081 |
| AF-A0A356SLM4-F1-model_v4 | deleted | 0.9808 | 2 | 135 |
|
| AF-A0A447QL67-F1-model_v4 | dUTP diphosphatase (EC 3.6.1.23) | 0.9788 | 2 | 122 |
GO:0000287
GO:0004170 GO:0006226 GO:0046081 |