F495494

General Info

Members Datasets Scaffolds Average Seq Length
1727 955 3452 175

Family's Representative Sequence

Representative Sequence 3300049569|Ga0501032_0018503|Ga0501032_0018503_663_1262
Length 199
Sequence METSMTPDGSATGSDVPGTGRSTGAGRSLVVVEDDATFARTLKRSFEKRGYQVVLCPDGDELVAALETVAPDYAVVDLKLGTGSGLECVKLLAARDPDMRIVVLTGFASIATAVEAIKLGACHYLAKPANTDDIETAFGRAEGDVSVPLSSRPTSIKNLEWERIHETLVETGFNISETARRLGLHRRTLARKLEKRVVK

Samples

Sample ID Description Type Environment
1 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
8 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
9 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
10 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
11 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
12 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
13 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
14 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
15 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
16 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
17 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
18 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
19 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
20 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
21 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
22 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
23 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
24 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
25 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
26 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
27 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
28 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
29 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
30 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
31 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
32 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
33 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
34 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
35 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
36 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
37 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
38 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
39 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
40 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
41 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
42 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
43 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
44 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
45 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
46 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
47 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
48 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
49 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
50 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
51 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
52 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
53 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
54 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
55 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
56 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
57 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
58 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
59 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
60 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
61 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
62 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
63 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
64 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
65 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
66 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
67 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
68 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
69 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
70 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
71 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
72 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
73 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
74 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
75 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
76 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
77 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
78 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
79 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
80 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
81 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
82 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
83 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
84 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
85 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
86 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
87 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
88 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
89 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
90 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
91 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
92 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
93 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
94 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
95 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
96 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
97 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
98 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
99 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
100 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
101 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
102 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
103 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
104 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
105 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
106 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
107 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
108 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
109 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
110 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
111 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
112 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
113 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
114 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
115 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
116 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
117 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
118 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
119 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
120 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
121 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
122 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
123 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
124 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
125 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
126 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
127 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
128 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
129 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
130 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
131 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
132 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
133 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
134 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
139 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
140 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
143 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
144 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
145 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
146 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
148 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
149 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
150 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
152 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
153 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
154 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
156 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
157 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
159 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
207 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
208 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
209 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
210 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
211 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
212 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
213 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
214 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
218 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
219 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
220 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
221 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
222 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
223 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
224 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
225 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
226 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
227 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
228 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
229 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
230 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
231 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
232 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
233 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
234 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
235 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
236 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
237 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
238 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
239 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
240 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
241 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
242 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
243 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
244 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
245 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
246 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
247 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
248 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
249 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
250 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
251 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
252 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
253 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
254 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
255 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
256 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
257 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
258 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
259 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
260 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
261 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
262 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
263 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
264 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
265 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
266 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
267 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
268 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
269 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
270 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
271 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
272 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
273 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
274 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
275 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
276 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
277 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
278 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
279 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
280 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
281 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
282 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
283 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
284 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
285 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
286 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
287 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
288 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
289 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
290 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
291 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
292 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
293 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
294 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
295 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
296 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
297 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
298 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
299 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
300 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
301 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
302 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
303 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
304 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
305 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
306 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
307 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
308 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
309 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
310 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
311 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
312 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
313 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
314 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
315 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
316 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
317 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
318 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
319 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
320 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
321 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
322 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
323 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
324 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
325 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
326 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
327 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
328 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
329 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
330 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
331 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
332 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
333 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
334 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
335 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
336 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
337 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
338 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
339 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
340 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
341 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
342 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
343 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
344 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
345 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
346 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
347 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
348 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
349 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
350 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
351 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
352 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
353 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
354 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
355 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
356 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
357 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
358 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
359 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
360 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
361 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
362 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
363 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
364 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
365 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
366 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
367 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
368 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
369 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
370 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
371 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
372 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
373 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
374 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
375 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
376 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
377 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
378 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
379 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
380 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
381 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
382 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
383 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
384 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
385 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
386 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
387 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
388 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
389 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
390 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
391 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
392 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
393 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
394 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
395 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
396 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
397 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
398 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
399 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
400 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
401 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
402 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
403 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
404 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
405 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
406 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
407 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
408 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
409 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
410 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
411 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
412 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
413 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
414 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
415 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
416 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
417 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
418 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
419 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
420 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
421 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
422 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
423 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
424 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
425 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
426 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
427 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
428 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
429 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
430 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
431 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
432 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
433 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
434 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
435 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
436 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
437 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
438 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
439 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
440 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
441 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
442 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
443 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
444 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
445 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
446 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
447 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
448 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
449 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
450 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
451 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
452 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
453 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
454 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
455 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
456 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
457 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
458 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
459 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
460 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
461 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
462 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
463 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
464 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
465 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
466 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
467 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
468 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
469 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
470 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
471 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
472 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
473 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
474 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
475 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
476 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
477 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
478 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
479 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
480 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
481 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
482 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
483 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
484 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
485 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
486 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
487 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
488 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
489 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
490 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
491 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
492 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
493 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
494 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
495 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
496 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
497 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
498 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
499 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
500 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
501 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
502 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
503 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
504 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
505 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
506 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
507 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
508 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
509 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
510 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
511 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
512 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
513 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
514 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
515 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
516 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
517 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
518 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
519 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
520 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
521 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
522 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
523 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
524 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
525 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
526 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
527 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
528 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
529 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
530 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
531 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
532 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
533 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
534 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
535 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
536 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
537 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
538 2512875024
539 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
540 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
541 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
542 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
543 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
544 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
545 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
546 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
547 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
548 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
549 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
550 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
551 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
552 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
553 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
554 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
555 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
556 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
557 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
558 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
559 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
560 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
561 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
562 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
563 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
564 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
565 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
566 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
567 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
568 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
569 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
570 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
571 2643221658 Variovorax sp. Root411 Isolate Unclassified
572 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
573 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
574 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
575 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
576 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
577 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
578 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
579 2738543013 Variovorax sp. BT01 Isolate Unclassified
580 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
581 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
582 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
583 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
584 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
585 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
586 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
587 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
588 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
589 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
590 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
591 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
592 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
593 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
594 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
595 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
596 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
597 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
598 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
599 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
600 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
601 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
602 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
603 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
604 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
605 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
606 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
607 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
608 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
609 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
610 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
611 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
612 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
613 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
614 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
615 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
616 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
617 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
618 2842694124 Methylopila sp. R-72369 Isolate Unclassified
619 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
620 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
621 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
622 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
623 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
624 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
625 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
626 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
627 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
628 2849560528 Caulobacter zeae 410 Isolate Unclassified
629 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
630 2851153111 Caulobacter radicis 736 Isolate Unclassified
631 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
632 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
633 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
634 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
635 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
636 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
637 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
638 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
639 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
640 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
641 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
642 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
643 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
644 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
645 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
646 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
647 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
648 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
649 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
650 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
651 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
652 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
653 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
654 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
655 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
656 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
657 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
658 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
659 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
660 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
661 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
662 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
663 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
664 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
665 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
666 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
667 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
668 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
669 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
670 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
671 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
672 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
673 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
674 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
675 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
676 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
677 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
678 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
679 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
680 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
681 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
682 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
683 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
684 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
685 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
686 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
687 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
688 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
689 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
690 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
691 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
692 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
693 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
694 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
695 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
696 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
697 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
698 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
699 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
700 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
701 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
702 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
703 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
704 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
705 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
706 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
707 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
708 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
709 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
710 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
711 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
712 2904699407
713 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
714 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
715 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
716 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
717 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
718 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
719 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
720 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
721 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
722 2906610324
723 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
724 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
725 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
726 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
727 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
728 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
729 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
730 2909042592 Labrys sp. LIt4 Isolate Nodule
731 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
732 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
733 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
734 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
735 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
736 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
737 2922425934
738 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
739 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
740 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
741 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
742 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
743 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
744 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
745 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
746 2928972540 Brevundimonas sp. 1080 Isolate Rhizosphere
747 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
748 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
749 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
750 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
751 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
752 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
753 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
754 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
755 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
756 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
757 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
758 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
759 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
760 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
761 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
762 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
763 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
764 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
765 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
766 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
767 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
768 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
769 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
770 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
771 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
772 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
773 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
774 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
775 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
776 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
777 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
778 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
779 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
780 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
781 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
782 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
783 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
784 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
785 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
786 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
787 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
788 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
789 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
790 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
791 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
792 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
793 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
794 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
795 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
796 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
797 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
798 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
799 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
800 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
801 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
802 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
803 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
804 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
805 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
806 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
807 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
808 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
809 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
810 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
811 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
812 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
813 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
814 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
815 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
816 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
817 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
818 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
819 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
820 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
821 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
822 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
823 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
824 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
825 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
826 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
827 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
828 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
829 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
830 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
831 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
832 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
833 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
834 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
835 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
836 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
837 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
838 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
839 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
840 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
841 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
842 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
843 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
844 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
845 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
846 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
847 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
848 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
849 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
850 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
851 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
852 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
853 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
854 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
855 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
856 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
857 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
858 2977240413 Brevundimonas vesicularis SORGH_AS 431 Isolate Unclassified
859 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
860 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
861 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
862 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
863 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
864 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
865 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
866 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
867 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
868 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
869 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
870 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
871 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
872 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
873 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
874 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
875 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
876 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
877 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
878 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
879 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
880 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
881 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
882 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
883 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
884 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
885 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
886 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
887 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
888 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
889 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
890 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
891 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
892 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
893 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
894 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
895 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
896 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
897 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
898 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
899 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
900 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
901 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
902 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
903 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
904 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
905 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
906 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
907 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere
908 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
909 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
910 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
911 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
912 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
913 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
914 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
915 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
916 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
917 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
918 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
919 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
920 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
921 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
922 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
923 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
924 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
925 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
926 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
927 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
928 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
929 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
930 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
931 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
932 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
933 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
934 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
935 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
936 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
937 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
938 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
939 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
940 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
941 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
942 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
943 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
944 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
945 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
946 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
947 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
948 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
949 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
950 8054002106 Azospirillum lipoferum 59b Isolate Unclassified
951 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified
952 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
953 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified
954 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
955 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 75
Metatranscriptomes 0.17
Isolates 24.83

Biome Distribution

Category Percentage (%)
Aerial Root 0.17
Bulb 0
Endosphere 18.99
Nodule 19.22
Rhizoplane 3.01
Rhizosphere 47.08
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501032_0018503 3300049569 Bacteria 4879
2 JGI24739J22299_10011391 3300001989 Bacteria 3284
3 JGI24739J22299_10096872 3300001989 Bacteria 893
4 JGI24735J21928_10015613 3300002067 Bacteria 2367
5 JGI25156J39149_1004519 3300002705 Bacteria 4221
6 JGI25156J39149_1007573 3300002705 Bacteria 2831
7 JGI25158J39367_1025012 3300002739 Bacteria 704
8 JGI25157J39369_1003669 3300002741 Bacteria 3041
9 JGI25152J39213_1003099 3300002773 Bacteria 5813
10 JGI25150J39212_1001285 3300002774 Bacteria 7177
11 JGI25159J45721_1010897 3300002987 Bacteria 2272
12 JGI25151J46595_10038236 3300003187 Bacteria 1789
13 JGI25151J46595_10112289 3300003187 Bacteria 710
14 JGI25165J46597_1000037 3300003214 Bacteria 285722
15 JGI25153J46596_10008033 3300003215 Bacteria 5101
16 JGI25153J46596_10010518 3300003215 Bacteria 4178
17 JGI25153J46596_10021879 3300003215 Bacteria 2373
18 JGI25153J46596_10023921 3300003215 Bacteria 2213
19 rootH1_10006378 3300003316 Bacteria 14178
20 rootH2_10033453 3300003320 Bacteria 3898
21 rootL2_10024654 3300003322 Bacteria 13699
22 rootL2_10077388 3300003322 Bacteria 2144
23 rootH1_10220232 3300003323 Bacteria 1255
24 JGI25160J50197_1001756 3300003354 Bacteria 10513
25 JGI25160J50197_1008048 3300003354 Bacteria 4053
26 JGI25160J50197_1012962 3300003354 Bacteria 2863
27 JGI25160J50197_1017478 3300003354 Bacteria 2269
28 JGI25161J50226_1009749 3300003374 Bacteria 1338
29 JGI25161J50226_1010515 3300003374 Bacteria 1229
30 JGI25161J50226_1015223 3300003374 Bacteria 843
31 Ga0006562J51391_1106834 3300003578 Bacteria 2180
32 Ga0006562J51391_1106835 3300003578 Bacteria 1610
33 Ga0055532_1007168 3300003758 Bacteria 1450
34 Ga0055535_1000128 3300003761 Bacteria 80324
35 Ga0055542_1000062 3300003762 Bacteria 161494
36 Ga0055542_1001515 3300003762 Bacteria 11273
37 Ga0055529_1009081 3300003763 Bacteria 1312
38 Ga0055526_1016624 3300003771 Bacteria 2863
39 Ga0055526_1016625 3300003771 Bacteria 2863
40 Ga0055537_1000217 3300003773 Bacteria 42589
41 Ga0055537_1001276 3300003773 Bacteria 10463
42 Ga0055537_1004956 3300003773 Bacteria 3672
43 Ga0055537_1010392 3300003773 Bacteria 1966
44 Ga0055524_1000276 3300003775 Bacteria 50977
45 Ga0055524_1014879 3300003775 Bacteria 2863
46 Ga0055524_1016708 3300003775 Bacteria 2617
47 Ga0055536_1000385 3300003781 Bacteria 32350
48 Ga0055536_1000743 3300003781 Bacteria 21817
49 Ga0055536_1006377 3300003781 Bacteria 5527
50 Ga0055536_1009998 3300003781 Bacteria 3834
51 Ga0055536_1038275 3300003781 Bacteria 1164
52 Ga0055534_1000106 3300003784 Bacteria 63996
53 Ga0055534_1002390 3300003784 Bacteria 6534
54 Ga0055528_1010834 3300003790 Bacteria 3672
55 Ga0055528_1022442 3300003790 Bacteria 1966
56 Ga0055530_10000521 3300003791 Bacteria 33319
57 Ga0055530_10000573 3300003791 Bacteria 31894
58 Ga0055530_10001653 3300003791 Bacteria 15894
59 Ga0055530_10005644 3300003791 Bacteria 5862
60 Ga0055530_10007241 3300003791 Bacteria 4722
61 Ga0055530_10014165 3300003791 Bacteria 2673
62 Ga0055540_1002206 3300003792 Bacteria 10581
63 Ga0055540_1002275 3300003792 Bacteria 10354
64 Ga0055540_1005142 3300003792 Bacteria 5619
65 Ga0055540_1009867 3300003792 Bacteria 3237
66 Ga0055540_1014818 3300003792 Bacteria 2303
67 Ga0055531_10000203 3300003794 Bacteria 65490
68 Ga0055531_10001002 3300003794 Bacteria 22441
69 Ga0055531_10001633 3300003794 Bacteria 16244
70 Ga0055531_10002103 3300003794 Bacteria 13685
71 Ga0055531_10002282 3300003794 Bacteria 12970
72 Ga0055531_10019259 3300003794 Bacteria 2772
73 Ga0055543_1003281 3300004625 Bacteria 4867
74 Ga0055543_1004625 3300004625 Bacteria 3692
75 Ga0055543_1014782 3300004625 Bacteria 1514
76 Ga0065165_1003236 3300005262 Bacteria 11810
77 Ga0065165_1005102 3300005262 Bacteria 7628
78 Ga0065165_1006193 3300005262 Bacteria 6383
79 Ga0065165_1006686 3300005262 Bacteria 5939
80 Ga0065165_1012578 3300005262 Bacteria 3434
81 Ga0065165_1013310 3300005262 Bacteria 3281
82 Ga0065165_1019354 3300005262 Bacteria 2434
83 Ga0065165_1020392 3300005262 Bacteria 2332
84 Ga0065165_1079924 3300005262 Bacteria 850
85 Ga0065714_10015844 3300005288 Bacteria 3068
86 Ga0065704_10008951 3300005289 Bacteria 2501
87 Ga0065704_10087958 3300005289 Bacteria 2980
88 Ga0065707_10314962 3300005295 Bacteria 977
89 Ga0070658_10000618 3300005327 Bacteria 30678
90 Ga0070658_10018985 3300005327 Bacteria 5508
91 Ga0070658_10338307 3300005327 Bacteria 1287
92 Ga0070676_10752436 3300005328 Bacteria 715
93 Ga0070683_100734186 3300005329 Bacteria 946
94 Ga0070670_100000001 3300005331 Bacteria 728788
95 Ga0070670_100067774 3300005331 Bacteria 3062
96 Ga0070670_100349677 3300005331 Bacteria 1298
97 Ga0070670_100400983 3300005331 Bacteria 1211
98 Ga0068869_100002440 3300005334 Bacteria 11212
99 Ga0070666_10070267 3300005335 Bacteria 2382
100 Ga0070666_10131930 3300005335 Bacteria 1736
101 Ga0070666_10693550 3300005335 Bacteria 746
102 Ga0070682_100043030 3300005337 Bacteria 2791
103 Ga0068868_100057235 3300005338 Bacteria 3080
104 Ga0070660_100390345 3300005339 Bacteria 1150
105 Ga0070661_100153859 3300005344 Bacteria 1739
106 Ga0070692_10594814 3300005345 Bacteria 731
107 Ga0070668_100009520 3300005347 Bacteria 7208
108 Ga0070668_100027781 3300005347 Bacteria 4295
109 Ga0070669_100001723 3300005353 Bacteria 15839
110 Ga0070669_100030628 3300005353 Bacteria 3884
111 Ga0070669_100117833 3300005353 Bacteria 2022
112 Ga0070671_100000033 3300005355 Bacteria 105788
113 Ga0070673_100009989 3300005364 Bacteria 6401
114 Ga0070688_100013740 3300005365 Bacteria 4575
115 Ga0070659_100782192 3300005366 Bacteria 829
116 Ga0070667_100000405 3300005367 Bacteria 46253
117 Ga0070667_100005545 3300005367 Bacteria 10529
118 Ga0070667_100031542 3300005367 Bacteria 4418
119 Ga0070705_100151872 3300005440 Bacteria 1537
120 Ga0070663_100013652 3300005455 Bacteria 5188
121 Ga0070663_100244213 3300005455 Bacteria 1418
122 Ga0070662_100264302 3300005457 Bacteria 1387
123 Ga0070681_10932245 3300005458 Bacteria 787
124 Ga0068867_100146911 3300005459 Bacteria 1849
125 Ga0068867_100239521 3300005459 Bacteria 1471
126 Ga0070685_10000008 3300005466 Bacteria 166350
127 Ga0070706_100471230 3300005467 Bacteria 1168
128 Ga0070679_100196348 3300005530 Bacteria 1985
129 Ga0070679_100581460 3300005530 Bacteria 1063
130 Ga0070684_100848522 3300005535 Bacteria 855
131 Ga0070697_101542758 3300005536 Bacteria 594
132 Ga0068853_100014261 3300005539 Bacteria 6504
133 Ga0068853_100024199 3300005539 Bacteria 5090
134 Ga0068853_100069849 3300005539 Bacteria 3056
135 Ga0070672_100230040 3300005543 Bacteria 1557
136 Ga0070695_100835981 3300005545 Bacteria 740
137 Ga0070665_100040876 3300005548 Bacteria 4660
138 Ga0070665_100056363 3300005548 Bacteria 3940
139 Ga0070665_100058254 3300005548 Bacteria 3873
140 Ga0070665_100067417 3300005548 Bacteria 3588
141 Ga0070665_100116127 3300005548 Bacteria 2679
142 Ga0070665_100426378 3300005548 Bacteria 1335
143 Ga0070665_100732490 3300005548 Bacteria 1002
144 Ga0068855_100091195 3300005563 Bacteria 3516
145 Ga0068855_100122687 3300005563 Bacteria 2973
146 Ga0068855_100259174 3300005563 Bacteria 1938
147 Ga0068855_100282223 3300005563 Bacteria 1844
148 Ga0068857_100085660 3300005577 Bacteria 2816
149 Ga0068857_100102866 3300005577 Bacteria 2564
150 Ga0068857_100208233 3300005577 Bacteria 1784
151 Ga0068854_100167009 3300005578 Bacteria 1709
152 Ga0068856_100150515 3300005614 Bacteria 2336
153 Ga0068856_100319909 3300005614 Bacteria 1569
154 Ga0068856_100424811 3300005614 Bacteria 1349
155 Ga0068856_100798145 3300005614 Bacteria 964
156 Ga0068856_100829430 3300005614 Bacteria 944
157 Ga0068852_100014597 3300005616 Bacteria 6054
158 Ga0068852_100398478 3300005616 Bacteria 1353
159 Ga0068852_100446051 3300005616 Bacteria 1280
160 Ga0068852_100754264 3300005616 Bacteria 985
161 Ga0068852_100829153 3300005616 Bacteria 940
162 Ga0068859_100017687 3300005617 Bacteria 7165
163 Ga0068859_100082831 3300005617 Bacteria 3250
164 Ga0068859_100283618 3300005617 Bacteria 1749
165 Ga0068859_101164148 3300005617 Bacteria 849
166 Ga0068864_100000006 3300005618 Bacteria 393838
167 Ga0068864_100000115 3300005618 Bacteria 79542
168 Ga0068864_100006669 3300005618 Bacteria 9451
169 Ga0068864_100088879 3300005618 Bacteria 2722
170 Ga0068861_100003645 3300005719 Bacteria 10263
171 Ga0068863_100000007 3300005841 Bacteria 257578
172 Ga0068863_100003567 3300005841 Bacteria 15359
173 Ga0068863_100335206 3300005841 Bacteria 1471
174 Ga0068863_100875803 3300005841 Bacteria 898
175 Ga0068858_100000031 3300005842 Bacteria 143397
176 Ga0068858_100051365 3300005842 Bacteria 3814
177 Ga0068858_100100561 3300005842 Bacteria 2696
178 Ga0068858_100496491 3300005842 Bacteria 1179
179 Ga0068858_100589477 3300005842 Bacteria 1078
180 Ga0068860_100011998 3300005843 Bacteria 8534
181 Ga0068860_100059791 3300005843 Bacteria 3622
182 Ga0068862_100001252 3300005844 Bacteria 23865
183 Ga0068862_100548232 3300005844 Bacteria 1104
184 Ga0068862_101392111 3300005844 Bacteria 704
185 Ga0081455_10000120 3300005937 Bacteria 89920
186 Ga0075365_10029726 3300006038 Bacteria 3495
187 Ga0075365_10147570 3300006038 Bacteria 1635
188 Ga0075365_10402541 3300006038 Bacteria 966
189 Ga0075365_10464033 3300006038 Bacteria 894
190 Ga0075365_10555219 3300006038 Bacteria 812
191 Ga0075365_10605116 3300006038 Bacteria 775
192 Ga0075368_10095363 3300006042 Bacteria 1219
193 Ga0075363_100113746 3300006048 Bacteria 1506
194 Ga0075363_100124324 3300006048 Bacteria 1443
195 Ga0075363_100141318 3300006048 Bacteria 1356
196 Ga0075364_10009471 3300006051 Bacteria 5846
197 Ga0075364_10012251 3300006051 Bacteria 5242
198 Ga0075364_10020653 3300006051 Bacteria 4143
199 Ga0075364_10023413 3300006051 Bacteria 3910
200 Ga0075364_10073663 3300006051 Bacteria 2251
201 Ga0075364_10091396 3300006051 Bacteria 2019
202 Ga0075364_10122659 3300006051 Bacteria 1740
203 Ga0075364_10243189 3300006051 Bacteria 1222
204 Ga0075432_10041150 3300006058 Bacteria 1614
205 Ga0075432_10049939 3300006058 Bacteria 1474
206 Ga0070712_100231585 3300006175 Bacteria 1467
207 Ga0070712_100662200 3300006175 Bacteria 888
208 Ga0075362_10001023 3300006177 Bacteria 8611
209 Ga0075362_10064819 3300006177 Bacteria 1658
210 Ga0075362_10073816 3300006177 Bacteria 1562
211 Ga0075362_10209178 3300006177 Bacteria 951
212 Ga0075367_10044775 3300006178 Bacteria 2595
213 Ga0075367_10231261 3300006178 Bacteria 1158
214 Ga0075369_10005453 3300006186 Bacteria 4754
215 Ga0075369_10065285 3300006186 Bacteria 1595
216 Ga0075369_10145066 3300006186 Bacteria 1084
217 Ga0075369_10213722 3300006186 Bacteria 892
218 Ga0075369_10249194 3300006186 Bacteria 825
219 Ga0075369_10295610 3300006186 Bacteria 756
220 Ga0075366_10029145 3300006195 Bacteria 3242
221 Ga0075366_10058452 3300006195 Bacteria 2290
222 Ga0075366_10068117 3300006195 Bacteria 2118
223 Ga0075366_10151086 3300006195 Bacteria 1406
224 Ga0075366_10246500 3300006195 Bacteria 1089
225 Ga0075366_10282382 3300006195 Bacteria 1015
226 Ga0075370_10001207 3300006353 Bacteria 10914
227 Ga0075370_10002536 3300006353 Bacteria 8488
228 Ga0075370_10012763 3300006353 Bacteria 4449
229 Ga0075370_10080333 3300006353 Bacteria 1873
230 Ga0075370_10102645 3300006353 Bacteria 1656
231 Ga0068865_101321182 3300006881 Bacteria 642
232 Ga0075436_100027626 3300006914 Bacteria 3905
233 Ga0097620_100017687 3300006931 Bacteria 7165
234 Ga0097620_100082833 3300006931 Bacteria 3250
235 Ga0097620_100283611 3300006931 Bacteria 1749
236 Ga0097620_101164280 3300006931 Bacteria 849
237 Ga0099825_1026372 3300006941 Bacteria 3103
238 Ga0099824_1005117 3300006942 Bacteria 18601
239 Ga0099824_1018892 3300006942 Bacteria 5529
240 Ga0079104_1019522 3300006946 Bacteria 1891
241 Ga0079104_1043432 3300006946 Bacteria 1036
242 Ga0099826_10006923 3300006948 Bacteria 8307
243 Ga0105250_10082977 3300009092 Bacteria 1300
244 Ga0105240_10005838 3300009093 Bacteria 18251
245 Ga0105240_10015532 3300009093 Bacteria 10350
246 Ga0105240_10077393 3300009093 Bacteria 4098
247 Ga0105240_10182224 3300009093 Bacteria 2477
248 Ga0105240_10240781 3300009093 Bacteria 2097
249 Ga0105240_10935711 3300009093 Bacteria 930
250 Ga0105245_10032999 3300009098 Bacteria 4585
251 Ga0105245_10113604 3300009098 Bacteria 2522
252 Ga0105245_10463523 3300009098 Bacteria 1278
253 Ga0105245_10568395 3300009098 Bacteria 1157
254 Ga0105247_10015539 3300009101 Bacteria 4559
255 Ga0105247_10041761 3300009101 Bacteria 2807
256 Ga0105247_10061905 3300009101 Bacteria 2321
257 Ga0105247_10274072 3300009101 Bacteria 1162
258 Ga0105243_10002474 3300009148 Bacteria 15420
259 Ga0105243_10132992 3300009148 Bacteria 2113
260 Ga0105243_10203573 3300009148 Bacteria 1738
261 Ga0105243_10784734 3300009148 Bacteria 937
262 Ga0105241_10025725 3300009174 Bacteria 4375
263 Ga0105241_10129757 3300009174 Bacteria 2039
264 Ga0105241_10385178 3300009174 Bacteria 1226
265 Ga0105241_10487817 3300009174 Bacteria 1096
266 Ga0105241_11691295 3300009174 Bacteria 615
267 Ga0105242_11231846 3300009176 Bacteria 769
268 Ga0105248_10004030 3300009177 Bacteria 16246
269 Ga0105248_10094337 3300009177 Bacteria 3370
270 Ga0105248_10251283 3300009177 Bacteria 1990
271 Ga0105248_10807932 3300009177 Bacteria 1058
272 Ga0105248_10829931 3300009177 Bacteria 1043
273 Ga0105237_10000209 3300009545 Bacteria 83491
274 Ga0105237_10018789 3300009545 Bacteria 7148
275 Ga0105237_10020513 3300009545 Bacteria 6810
276 Ga0105237_10087966 3300009545 Bacteria 3096
277 Ga0105237_10199366 3300009545 Bacteria 2001
278 Ga0105237_10224458 3300009545 Bacteria 1879
279 Ga0105237_10331261 3300009545 Bacteria 1526
280 Ga0105237_10487792 3300009545 Bacteria 1238
281 Ga0105237_10720675 3300009545 Bacteria 1004
282 Ga0105237_10993961 3300009545 Bacteria 846
283 Ga0105238_10004686 3300009551 Bacteria 13524
284 Ga0105238_10106327 3300009551 Bacteria 2788
285 Ga0105238_10208506 3300009551 Bacteria 1930
286 Ga0105238_10812979 3300009551 Bacteria 951
287 Ga0105238_11269759 3300009551 Bacteria 762
288 Ga0105238_11335831 3300009551 Bacteria 743
289 Ga0105238_11746841 3300009551 Bacteria 654
290 Ga0105249_10016332 3300009553 Bacteria 6585
291 Ga0105249_10691972 3300009553 Bacteria 1079
292 Ga0105239_10019083 3300010375 Bacteria 7578
293 Ga0105239_10071618 3300010375 Bacteria 3808
294 Ga0105239_10073276 3300010375 Bacteria 3765
295 Ga0105239_10111109 3300010375 Bacteria 3038
296 Ga0105239_10197116 3300010375 Bacteria 2255
297 Ga0105239_10201886 3300010375 Bacteria 2227
298 Ga0105239_10483651 3300010375 Bacteria 1407
299 Ga0105239_10618586 3300010375 Bacteria 1236
300 Ga0105239_10919522 3300010375 Bacteria 1004
301 Ga0105239_11681549 3300010375 Bacteria 734
302 Ga0105246_10007753 3300011119 Bacteria 6590
303 Ga0105246_10368789 3300011119 Bacteria 1182
304 Ga0105246_10371451 3300011119 Bacteria 1179
305 Ga0157371_10095472 3300013102 Bacteria 2107
306 Ga0157370_10020928 3300013104 Bacteria 6525
307 Ga0157370_10029446 3300013104 Bacteria 5388
308 Ga0157369_10015433 3300013105 Bacteria 8609
309 Ga0157369_10148621 3300013105 Bacteria 2477
310 Ga0157369_10297102 3300013105 Bacteria 1681
311 Ga0157369_10576202 3300013105 Bacteria 1162
312 Ga0157369_10683195 3300013105 Bacteria 1058
313 Ga0157374_10221425 3300013296 Bacteria 1857
314 Ga0157374_11150605 3300013296 Bacteria 797
315 Ga0157374_12145005 3300013296 Bacteria 586
316 Ga0157378_10192239 3300013297 Bacteria 1926
317 Ga0157378_10429305 3300013297 Bacteria 1308
318 Ga0157372_10114193 3300013307 Bacteria 3096
319 Ga0157372_10149239 3300013307 Bacteria 2697
320 Ga0157375_10047270 3300013308 Bacteria 4202
321 Ga0163163_10000926 3300014325 Bacteria 24867
322 Ga0163163_10082749 3300014325 Bacteria 3214
323 Ga0163163_10115692 3300014325 Bacteria 2713
324 Ga0157380_10949288 3300014326 Bacteria 890
325 Ga0182008_10012461 3300014497 Bacteria 4488
326 Ga0182008_10074251 3300014497 Bacteria 1673
327 Ga0182008_10185854 3300014497 Bacteria 1053
328 Ga0157377_10265760 3300014745 Bacteria 1118
329 Ga0157379_10017367 3300014968 Bacteria 6339
330 Ga0157379_10397451 3300014968 Bacteria 1266
331 Ga0157379_10641515 3300014968 Bacteria 994
332 Ga0157379_10895684 3300014968 Bacteria 841
333 Ga0163161_10002178 3300017792 Bacteria 14129
334 Ga0163161_10090314 3300017792 Bacteria 2266
335 Ga0163161_10244232 3300017792 Bacteria 1397
336 Ga0214544_1000003 3300021320 Bacteria 643752
337 Ga0214542_1000003 3300021321 Bacteria 435700
338 Ga0214545_1000004 3300021324 Bacteria 453352
339 Ga0214543_1000007 3300021327 Bacteria 414744
340 Ga0213872_10000678 3300021361 Bacteria 25758
341 Ga0213872_10003050 3300021361 Bacteria 9445
342 Ga0213872_10004783 3300021361 Bacteria 7078
343 Ga0213872_10006716 3300021361 Bacteria 5733
344 Ga0213872_10008898 3300021361 Bacteria 4834
345 Ga0213872_10032482 3300021361 Bacteria 2391
346 Ga0213872_10089556 3300021361 Bacteria 1377
347 Ga0213872_10091688 3300021361 Bacteria 1359
348 Ga0213872_10154141 3300021361 Bacteria 1002
349 Ga0213874_10315183 3300021377 Bacteria 592
350 Ga0213876_10014677 3300021384 Bacteria 4151
351 Ga0213876_10116727 3300021384 Bacteria 1417
352 Ga0209672_100326 3300025228 Bacteria 31060
353 Ga0209147_101453 3300025229 Bacteria 8533
354 Ga0209563_104203 3300025230 Bacteria 2793
355 Ga0209258_100154 3300025242 Bacteria 158235
356 Ga0207425_1009030 3300025245 Bacteria 2507
357 Ga0207425_1027585 3300025245 Bacteria 1158
358 Ga0209026_1000013 3300025250 Bacteria 415633
359 Ga0209026_1012883 3300025250 Bacteria 1442
360 Ga0209677_101412 3300025253 Bacteria 10402
361 Ga0209677_118621 3300025253 Bacteria 843
362 Ga0209148_1000078 3300025254 Bacteria 296101
363 Ga0209148_1000145 3300025254 Bacteria 161352
364 Ga0209148_1000761 3300025254 Bacteria 24569
365 Ga0209148_1007279 3300025254 Bacteria 2314
366 Ga0209759_1000149 3300025256 Bacteria 120932
367 Ga0209129_1000054 3300025258 Bacteria 261997
368 Ga0209129_1002251 3300025258 Bacteria 9636
369 Ga0209129_1006857 3300025258 Bacteria 3551
370 Ga0209233_1000102 3300025261 Bacteria 285774
371 Ga0209233_1000947 3300025261 Bacteria 12594
372 Ga0209233_1017503 3300025261 Bacteria 1950
373 Ga0209565_1000008 3300025263 Bacteria 774179
374 Ga0209565_1000067 3300025263 Bacteria 171247
375 Ga0209565_1000185 3300025263 Bacteria 76451
376 Ga0209565_1005666 3300025263 Bacteria 3606
377 Ga0209455_1000194 3300025272 Bacteria 89837
378 Ga0209455_1001577 3300025272 Bacteria 10047
379 Ga0209455_1004890 3300025272 Bacteria 4263
380 Ga0209673_1000097 3300025273 Bacteria 193482
381 Ga0209673_1000548 3300025273 Bacteria 60849
382 Ga0209673_1002045 3300025273 Bacteria 15283
383 Ga0209673_1002338 3300025273 Bacteria 13412
384 Ga0209673_1002470 3300025273 Bacteria 12782
385 Ga0209130_1000260 3300025284 Bacteria 66399
386 Ga0209130_1000441 3300025284 Bacteria 43985
387 Ga0209130_1003421 3300025284 Bacteria 6775
388 Ga0209675_1000038 3300025291 Bacteria 250481
389 Ga0209675_1001284 3300025291 Bacteria 14917
390 Ga0209675_1001491 3300025291 Bacteria 13425
391 Ga0209675_1013906 3300025291 Bacteria 2482
392 Ga0209676_1000103 3300025292 Bacteria 226908
393 Ga0209676_1000128 3300025292 Bacteria 188099
394 Ga0209676_1000243 3300025292 Bacteria 117113
395 Ga0209676_1000791 3300025292 Bacteria 41820
396 Ga0209676_1001349 3300025292 Bacteria 24416
397 Ga0209676_1042983 3300025292 Bacteria 1250
398 Ga0209025_1000185 3300025294 Bacteria 155366
399 Ga0209025_1000474 3300025294 Bacteria 78060
400 Ga0209025_1016842 3300025294 Bacteria 4270
401 Ga0209025_1017217 3300025294 Bacteria 4192
402 Ga0209564_1000301 3300025295 Bacteria 97869
403 Ga0209564_1000383 3300025295 Bacteria 81061
404 Ga0209564_1000629 3300025295 Bacteria 53834
405 Ga0209564_1005181 3300025295 Bacteria 7558
406 Ga0209564_1021261 3300025295 Bacteria 2340
407 Ga0209564_1035300 3300025295 Bacteria 1450
408 Ga0209564_1054528 3300025295 Bacteria 943
409 Ga0209758_1000030 3300025297 Bacteria 509217
410 Ga0209758_1000034 3300025297 Bacteria 467637
411 Ga0209758_1005701 3300025297 Bacteria 9402
412 Ga0209758_1011492 3300025297 Bacteria 5117
413 Ga0209758_1020188 3300025297 Bacteria 3168
414 Ga0209758_1033122 3300025297 Bacteria 2083
415 Ga0209758_1033265 3300025297 Bacteria 2075
416 Ga0209758_1037103 3300025297 Bacteria 1889
417 Ga0209050_1000010 3300025298 Bacteria 980454
418 Ga0209050_1000012 3300025298 Bacteria 813717
419 Ga0209050_1000244 3300025298 Bacteria 117105
420 Ga0209050_1001118 3300025298 Bacteria 32421
421 Ga0209050_1001465 3300025298 Bacteria 25256
422 Ga0209256_1000009 3300025299 Bacteria 922071
423 Ga0209256_1000010 3300025299 Bacteria 912110
424 Ga0209256_1000103 3300025299 Bacteria 193900
425 Ga0209256_1000165 3300025299 Bacteria 135104
426 Ga0209256_1010538 3300025299 Bacteria 3851
427 Ga0209256_1014683 3300025299 Bacteria 2795
428 Ga0209256_1023169 3300025299 Bacteria 1859
429 Ga0207426_1000058 3300025302 Bacteria 363857
430 Ga0207426_1000067 3300025302 Bacteria 342108
431 Ga0207426_1000867 3300025302 Bacteria 31615
432 Ga0207426_1004113 3300025302 Bacteria 7313
433 Ga0207426_1011500 3300025302 Bacteria 3368
434 Ga0207426_1013645 3300025302 Bacteria 3002
435 Ga0207426_1065474 3300025302 Bacteria 1030
436 Ga0209051_1000019 3300025303 Bacteria 511268
437 Ga0209051_1000603 3300025303 Bacteria 42060
438 Ga0209051_1000638 3300025303 Bacteria 40261
439 Ga0209051_1001110 3300025303 Bacteria 24653
440 Ga0209051_1002726 3300025303 Bacteria 12255
441 Ga0209051_1018263 3300025303 Bacteria 3107
442 Ga0209051_1044966 3300025303 Bacteria 1533
443 Ga0209051_1066054 3300025303 Bacteria 1112
444 Ga0209257_1000009 3300025304 Bacteria 1205047
445 Ga0209257_1000024 3300025304 Bacteria 726068
446 Ga0209257_1000057 3300025304 Bacteria 396985
447 Ga0209257_1000140 3300025304 Bacteria 201515
448 Ga0209257_1003185 3300025304 Bacteria 14585
449 Ga0209257_1007671 3300025304 Bacteria 6449
450 Ga0209257_1021545 3300025304 Bacteria 2336
451 Ga0209257_1042799 3300025304 Bacteria 1333
452 Ga0207697_10064476 3300025315 Bacteria 1528
453 Ga0207656_10002594 3300025321 Bacteria 6115
454 Ga0207656_10223788 3300025321 Bacteria 915
455 Ga0207710_10041186 3300025900 Bacteria 2048
456 Ga0207710_10108518 3300025900 Bacteria 1316
457 Ga0207710_10128491 3300025900 Bacteria 1216
458 Ga0207688_10035473 3300025901 Bacteria 2763
459 Ga0207680_10091257 3300025903 Bacteria 1938
460 Ga0207680_10386632 3300025903 Bacteria 987
461 Ga0207680_10535179 3300025903 Bacteria 836
462 Ga0207647_10007551 3300025904 Bacteria 7843
463 Ga0207647_10008829 3300025904 Bacteria 7192
464 Ga0207647_10028609 3300025904 Bacteria 3617
465 Ga0207647_10129393 3300025904 Bacteria 1484
466 Ga0207643_10042028 3300025908 Bacteria 2576
467 Ga0207705_10047855 3300025909 Bacteria 3076
468 Ga0207705_10331023 3300025909 Bacteria 1171
469 Ga0207705_11096885 3300025909 Bacteria 613
470 Ga0207684_10398643 3300025910 Bacteria 1183
471 Ga0207654_10419337 3300025911 Bacteria 934
472 Ga0207695_10000065 3300025913 Bacteria 336949
473 Ga0207695_10042830 3300025913 Bacteria 4829
474 Ga0207695_10411294 3300025913 Bacteria 1237
475 Ga0207671_10000072 3300025914 Bacteria 159539
476 Ga0207671_10024760 3300025914 Bacteria 4509
477 Ga0207671_10439069 3300025914 Bacteria 1039
478 Ga0207671_10872388 3300025914 Bacteria 712
479 Ga0207693_10316976 3300025915 Bacteria 1221
480 Ga0207693_10491064 3300025915 Bacteria 959
481 Ga0207663_10502918 3300025916 Bacteria 942
482 Ga0207663_11146613 3300025916 Bacteria 625
483 Ga0207660_10007226 3300025917 Bacteria 7189
484 Ga0207649_10261967 3300025920 Bacteria 1249
485 Ga0207652_10001316 3300025921 Bacteria 22069
486 Ga0207652_10004184 3300025921 Bacteria 11769
487 Ga0207652_11368554 3300025921 Bacteria 611
488 Ga0207681_10005483 3300025923 Bacteria 7793
489 Ga0207681_10035167 3300025923 Bacteria 3300
490 Ga0207694_10043700 3300025924 Bacteria 3458
491 Ga0207694_10062913 3300025924 Bacteria 2890
492 Ga0207694_10177439 3300025924 Bacteria 1726
493 Ga0207694_10341442 3300025924 Bacteria 1238
494 Ga0207650_10000002 3300025925 Bacteria 1439222
495 Ga0207650_10040555 3300025925 Bacteria 3408
496 Ga0207650_10216887 3300025925 Bacteria 1539
497 Ga0207650_10439127 3300025925 Bacteria 1085
498 Ga0207687_10032239 3300025927 Bacteria 3548
499 Ga0207687_10095641 3300025927 Bacteria 2176
500 Ga0207644_10000176 3300025931 Bacteria 45641
501 Ga0207644_11091068 3300025931 Bacteria 671
502 Ga0207706_10275029 3300025933 Bacteria 1469
503 Ga0207709_10000491 3300025935 Bacteria 35713
504 Ga0207709_10555413 3300025935 Bacteria 904
505 Ga0207709_10812133 3300025935 Bacteria 755
506 Ga0207709_11358718 3300025935 Bacteria 588
507 Ga0207704_10163116 3300025938 Bacteria 1588
508 Ga0207665_10072406 3300025939 Bacteria 2354
509 Ga0207665_10284959 3300025939 Bacteria 1231
510 Ga0207691_10101219 3300025940 Bacteria 2571
511 Ga0207691_10256780 3300025940 Bacteria 1507
512 Ga0207711_10000366 3300025941 Bacteria 47938
513 Ga0207711_10011017 3300025941 Bacteria 7513
514 Ga0207711_10100192 3300025941 Bacteria 2562
515 Ga0207711_11045822 3300025941 Bacteria 757
516 Ga0207689_10017565 3300025942 Bacteria 6048
517 Ga0207689_10133025 3300025942 Bacteria 2047
518 Ga0207689_10592096 3300025942 Bacteria 933
519 Ga0207689_10772287 3300025942 Bacteria 811
520 Ga0207661_10984183 3300025944 Bacteria 777
521 Ga0207667_10083293 3300025949 Bacteria 3312
522 Ga0207667_10664612 3300025949 Bacteria 1046
523 Ga0207667_10815640 3300025949 Bacteria 929
524 Ga0207667_10921850 3300025949 Bacteria 864
525 Ga0207667_11335861 3300025949 Bacteria 692
526 Ga0207651_10175144 3300025960 Bacteria 1696
527 Ga0207712_10058704 3300025961 Bacteria 2719
528 Ga0207668_11093724 3300025972 Bacteria 714
529 Ga0207640_10027904 3300025981 Bacteria 3444
530 Ga0207640_10155381 3300025981 Bacteria 1686
531 Ga0207658_10000001 3300025986 Bacteria 1439333
532 Ga0207658_10018437 3300025986 Bacteria 4819
533 Ga0207658_10030655 3300025986 Bacteria 3811
534 Ga0207677_10037938 3300026023 Bacteria 3153
535 Ga0207703_10000038 3300026035 Bacteria 175917
536 Ga0207703_10006584 3300026035 Bacteria 9270
537 Ga0207703_10265985 3300026035 Bacteria 1552
538 Ga0207703_10311432 3300026035 Bacteria 1439
539 Ga0207703_10692361 3300026035 Bacteria 969
540 Ga0207639_10002789 3300026041 Bacteria 11724
541 Ga0207639_10042208 3300026041 Bacteria 3417
542 Ga0207639_10064609 3300026041 Bacteria 2838
543 Ga0207639_10144270 3300026041 Bacteria 1987
544 Ga0207639_10252120 3300026041 Bacteria 1539
545 Ga0207639_11052625 3300026041 Bacteria 763
546 Ga0207678_10006072 3300026067 Bacteria 10743
547 Ga0207678_10075970 3300026067 Bacteria 2877
548 Ga0207678_10182977 3300026067 Bacteria 1789
549 Ga0207678_10269338 3300026067 Bacteria 1460
550 Ga0207702_10273241 3300026078 Bacteria 1595
551 Ga0207702_10294050 3300026078 Bacteria 1539
552 Ga0207702_10382947 3300026078 Bacteria 1353
553 Ga0207702_10591423 3300026078 Bacteria 1088
554 Ga0207702_10890844 3300026078 Bacteria 882
555 Ga0207702_11056332 3300026078 Bacteria 806
556 Ga0207641_10000012 3300026088 Bacteria 375486
557 Ga0207641_10038578 3300026088 Bacteria 3993
558 Ga0207641_10094862 3300026088 Bacteria 2617
559 Ga0207641_10295626 3300026088 Bacteria 1528
560 Ga0207648_10003010 3300026089 Bacteria 17798
561 Ga0207648_10092771 3300026089 Bacteria 2640
562 Ga0207676_10000001 3300026095 Bacteria 1439222
563 Ga0207676_10000610 3300026095 Bacteria 29371
564 Ga0207676_10050809 3300026095 Bacteria 3234
565 Ga0207674_10001341 3300026116 Bacteria 31867
566 Ga0207674_10050312 3300026116 Bacteria 4258
567 Ga0207674_10092422 3300026116 Bacteria 3015
568 Ga0207674_10152361 3300026116 Bacteria 2268
569 Ga0207675_100008719 3300026118 Bacteria 9527
570 Ga0207675_100856501 3300026118 Bacteria 924
571 Ga0207675_100922904 3300026118 Bacteria 890
572 Ga0207698_10052977 3300026142 Bacteria 3111
573 Ga0207698_10375188 3300026142 Bacteria 1351
574 Ga0207698_10575526 3300026142 Bacteria 1107
575 Ga0209281_1029587 3300027111 Bacteria 988
576 Ga0209389_1000015 3300027296 Bacteria 188311
577 Ga0209389_1000035 3300027296 Bacteria 127089
578 Ga0209589_1000039 3300027357 Bacteria 127084
579 Ga0209589_1001702 3300027357 Bacteria 36938
580 Ga0209489_100084 3300027361 Bacteria 127094
581 Ga0209489_102545 3300027361 Bacteria 36938
582 Ga0209489_102940 3300027361 Bacteria 33921
583 Ga0209700_100034 3300027363 Bacteria 197276
584 Ga0209700_102508 3300027363 Bacteria 36938
585 Ga0209282_1000929 3300027666 Bacteria 15308
586 Ga0209813_10203577 3300027866 Bacteria 734
587 Ga0207428_10348473 3300027907 Bacteria 1090
588 Ga0268266_10003368 3300028379 Bacteria 16011
589 Ga0268266_10201553 3300028379 Bacteria 1821
590 Ga0268266_10252783 3300028379 Bacteria 1631
591 Ga0268266_10271585 3300028379 Bacteria 1574
592 Ga0268266_10857013 3300028379 Bacteria 878
593 Ga0268266_10878814 3300028379 Bacteria 867
594 Ga0268266_10983406 3300028379 Bacteria 816
595 Ga0268266_11346816 3300028379 Bacteria 689
596 Ga0268265_10000639 3300028380 Bacteria 34871
597 Ga0268265_10063708 3300028380 Bacteria 2837
598 Ga0268265_10223249 3300028380 Bacteria 1650
599 Ga0268265_10868378 3300028380 Bacteria 884
600 Ga0268264_10000004 3300028381 Bacteria 1116842
601 Ga0268264_10030875 3300028381 Bacteria 4393
602 Ga0268264_10263950 3300028381 Bacteria 1606
603 Ga0265337_1004460 3300028556 Bacteria 5803
604 Ga0265326_10008660 3300028558 Bacteria 3060
605 Ga0265319_1002535 3300028563 Bacteria 9887
606 Ga0265319_1114219 3300028563 Bacteria 843
607 Ga0265334_10000692 3300028573 Bacteria 16893
608 Ga0265318_10005512 3300028577 Bacteria 5939
609 Ga0265323_10000487 3300028653 Bacteria 22352
610 Ga0265336_10000116 3300028666 Bacteria 59582
611 Ga0307517_10242884 3300028786 Bacteria 1066
612 Ga0307515_10000306 3300028794 Bacteria 121448
613 Ga0307515_10073133 3300028794 Bacteria 4613
614 Ga0307515_10091389 3300028794 Bacteria 3804
615 Ga0265338_10000094 3300028800 Bacteria 168366
616 Ga0265324_10001770 3300029957 Bacteria 11823
617 Ga0307512_10077299 3300030522 Bacteria 2420
618 Ga0316177_1218212 3300030731 Bacteria 4818
619 Ga0316176_1077164 3300030732 Bacteria 1043
620 Ga0314311_1119909 3300030733 Bacteria 2249
621 Ga0316178_1021912 3300030735 Bacteria 2704
622 Ga0316180_1096038 3300030736 Bacteria 1525
623 Ga0316183_1023532 3300030742 Bacteria 3105
624 Ga0316181_1045265 3300030744 Bacteria 2692
625 Ga0316182_1432467 3300030745 Bacteria 1938
626 Ga0265330_10070025 3300031235 Bacteria 1518
627 Ga0265340_10009477 3300031247 Bacteria 5223
628 Ga0265339_10001522 3300031249 Bacteria 17112
629 Ga0265339_10202618 3300031249 Bacteria 978
630 Ga0265316_10006562 3300031344 Bacteria 11097
631 Ga0307513_10027606 3300031456 Bacteria 6512
632 Ga0307513_10112484 3300031456 Bacteria 2712
633 Ga0307513_10317575 3300031456 Bacteria 1317
634 Ga0307513_10374244 3300031456 Bacteria 1166
635 Ga0307509_10156210 3300031507 Bacteria 2187
636 Ga0307408_100000030 3300031548 Bacteria 223389
637 Ga0307408_100135180 3300031548 Bacteria 1928
638 Ga0307408_100247478 3300031548 Bacteria 1468
639 Ga0265313_10000181 3300031595 Bacteria 67263
640 Ga0265313_10009198 3300031595 Bacteria 6443
641 Ga0265313_10014374 3300031595 Bacteria 4681
642 Ga0307514_10003152 3300031649 Bacteria 16186
643 Ga0265314_10306564 3300031711 Bacteria 889
644 Ga0265342_10100640 3300031712 Bacteria 1646
645 Ga0307405_10604158 3300031731 Bacteria 895
646 Ga0307413_10695691 3300031824 Bacteria 844
647 Ga0307406_10498753 3300031901 Bacteria 987
648 Ga0307407_10126408 3300031903 Bacteria 1629
649 Ga0307412_10020383 3300031911 Bacteria 4034
650 Ga0307412_10031555 3300031911 Bacteria 3347
651 Ga0307412_10144525 3300031911 Bacteria 1746
652 Ga0307412_10223632 3300031911 Bacteria 1444
653 Ga0307412_10265449 3300031911 Bacteria 1340
654 Ga0307412_10360592 3300031911 Bacteria 1170
655 Ga0307416_100138604 3300032002 Bacteria 2206
656 Ga0307416_101393900 3300032002 Bacteria 807
657 Ga0307414_10039618 3300032004 Bacteria 3175
658 Ga0307414_10272243 3300032004 Bacteria 1419
659 Ga0307414_11074879 3300032004 Bacteria 742
660 Ga0307411_10002074 3300032005 Bacteria 8623
661 Ga0307411_10191162 3300032005 Bacteria 1563
662 Ga0307411_10744465 3300032005 Bacteria 858
663 Ga0307411_11267663 3300032005 Bacteria 670
664 Ga0307510_10081070 3300033180 Bacteria 3149
665 Ga0307510_10123919 3300033180 Bacteria 2280
666 Ga0315911_1000042 3300033442 Bacteria 49262
667 Ga0373954_0224454 3300035118 Bacteria 924
668 Ga0373955_0442203 3300035172 Bacteria 792
669 Ga0373947_0630710 3300035725 Bacteria 731
670 Ga0373937_1080809 3300036401 Bacteria 751
671 Ga0395899_0000107 3300037312 Bacteria 144087
672 Ga0395899_0000264 3300037312 Bacteria 68569
673 Ga0395899_0000589 3300037312 Bacteria 38294
674 Ga0395899_0000854 3300037312 Bacteria 29169
675 Ga0395899_0033456 3300037312 Bacteria 3860
676 Ga0395899_0184442 3300037312 Bacteria 1463
677 Ga0395899_0267838 3300037312 Bacteria 1166
678 Ga0395899_0491720 3300037312 Bacteria 797
679 Ga0395899_0837568 3300037312 Bacteria 565
680 Ga0395900_0000072 3300037418 Bacteria 187428
681 Ga0395900_0000101 3300037418 Bacteria 153550
682 Ga0395900_0000375 3300037418 Bacteria 64534
683 Ga0395900_0000924 3300037418 Bacteria 38604
684 Ga0395900_0007118 3300037418 Bacteria 11591
685 Ga0395900_0023664 3300037418 Bacteria 6284
686 Ga0395900_0038244 3300037418 Bacteria 4946
687 Ga0395900_0227712 3300037418 Bacteria 1876
688 Ga0395900_0702299 3300037418 Bacteria 945
689 Ga0395900_0835755 3300037418 Bacteria 847
690 Ga0395900_0924838 3300037418 Bacteria 794
691 Ga0395900_1023328 3300037418 Bacteria 745
692 Ga0395900_1378096 3300037418 Bacteria 618
693 Ga0395898_0000043 3300037466 Bacteria 301783
694 Ga0395898_0000629 3300037466 Bacteria 64534
695 Ga0395898_0027961 3300037466 Bacteria 5655
696 Ga0395898_0030665 3300037466 Bacteria 5379
697 Ga0395898_0046845 3300037466 Bacteria 4246
698 Ga0395898_0093907 3300037466 Bacteria 2882
699 Ga0395898_0474518 3300037466 Bacteria 1190
700 Ga0395898_0502156 3300037466 Bacteria 1153
701 Ga0395898_0585479 3300037466 Bacteria 1058
702 Ga0395905_0000101 3300037471 Bacteria 144115
703 Ga0395905_0000361 3300037471 Bacteria 64517
704 Ga0395905_0000678 3300037471 Bacteria 45181
705 Ga0395905_0020944 3300037471 Bacteria 6192
706 Ga0395905_0038381 3300037471 Bacteria 4494
707 Ga0395905_0048180 3300037471 Bacteria 3994
708 Ga0395905_0052161 3300037471 Bacteria 3830
709 Ga0395905_0054838 3300037471 Bacteria 3730
710 Ga0395905_0066764 3300037471 Bacteria 3369
711 Ga0395905_0139686 3300037471 Bacteria 2279
712 Ga0395905_0173407 3300037471 Bacteria 2025
713 Ga0395905_0521152 3300037471 Bacteria 1089
714 Ga0395901_0000052 3300038443 Bacteria 165888
715 Ga0395901_0000068 3300038443 Bacteria 144095
716 Ga0395901_0000273 3300038443 Bacteria 64425
717 Ga0395901_0057959 3300038443 Bacteria 4028
718 Ga0395901_0111619 3300038443 Bacteria 2871
719 Ga0395901_0264643 3300038443 Bacteria 1789
720 Ga0395901_0370830 3300038443 Bacteria 1475
721 Ga0395901_0425360 3300038443 Bacteria 1361
722 Ga0395901_0460995 3300038443 Bacteria 1299
723 Ga0395901_0951562 3300038443 Bacteria 837
724 Ga0436365_0367404 3300039437 Bacteria 1204
725 Ga0436365_1284605 3300039437 Bacteria 1381
726 Ga0436365_1811392 3300039437 Bacteria 9704
727 Ga0436360_0885706 3300039438 Bacteria 2035
728 Ga0436361_0092690 3300039447 Bacteria 3325
729 Ga0436361_0105866 3300039447 Bacteria 6883
730 Ga0436361_0320757 3300039447 Bacteria 82248
731 Ga0436361_0325425 3300039447 Bacteria 2296
732 Ga0436361_0347304 3300039447 Bacteria 1876
733 Ga0436361_0347340 3300039447 Bacteria 2300
734 Ga0436361_0428897 3300039447 Bacteria 1083
735 Ga0436361_0444413 3300039447 Bacteria 4154
736 Ga0436361_0558784 3300039447 Bacteria 1785
737 Ga0436361_0585531 3300039447 Bacteria 936
738 Ga0436361_0689358 3300039447 Bacteria 1476
739 Ga0436361_0795199 3300039447 Bacteria 71391
740 Ga0436361_0871756 3300039447 Bacteria 2077
741 Ga0436361_0975940 3300039447 Bacteria 771
742 Ga0436363_0436704 3300039450 Bacteria 829
743 Ga0439436_0005797 3300041404 Bacteria 3784
744 Ga0439436_0018111 3300041404 Bacteria 2106
745 Ga0439439_0001395 3300041406 Bacteria 4789
746 Ga0439439_0078268 3300041406 Bacteria 891
747 Ga0439447_009190 3300041407 Bacteria 3012
748 Ga0439461_0000338 3300041410 Bacteria 6676
749 Ga0439461_0012958 3300041410 Bacteria 1567
750 Ga0439466_0008919 3300041411 Bacteria 3771
751 Ga0439466_0054384 3300041411 Bacteria 1304
752 Ga0439465_0001362 3300041413 Bacteria 7874
753 Ga0439465_0013022 3300041413 Bacteria 2599
754 Ga0451793_0484513 3300041452 Bacteria 712
755 Ga0451798_0229046 3300041458 Bacteria 2973
756 Ga0451800_0517189 3300041459 Bacteria 1242
757 Ga0451802_1574410 3300041460 Bacteria 998
758 Ga0451806_090485 3300041462 Bacteria 756
759 Ga0451806_223475 3300041462 Bacteria 3770
760 Ga0451807_1439184 3300041486 Bacteria 1043
761 Ga0451833_0019008 3300041491 Bacteria 1450
762 Ga0451839_1344540 3300041496 Bacteria 745
763 Ga0451845_0447342 3300041501 Bacteria 1088
764 Ga0451843_1695995 3300041509 Bacteria 759
765 Ga0451853_2497818 3300041512 Bacteria 1322
766 Ga0451853_3703070 3300041512 Bacteria 1415
767 Ga0439431_0001989 3300041997 Bacteria 4533
768 Ga0439431_0011302 3300041997 Bacteria 2038
769 Ga0439442_002682 3300042002 Bacteria 3494
770 Ga0439442_013875 3300042002 Bacteria 1655
771 Ga0439445_0000584 3300042004 Bacteria 7463
772 Ga0439445_0011308 3300042004 Bacteria 2126
773 Ga0439432_000736 3300042006 Bacteria 12263
774 Ga0439449_0032811 3300042007 Bacteria 1935
775 Ga0439449_0188187 3300042007 Bacteria 772
776 Ga0439452_015478 3300042010 Bacteria 2092
777 Ga0439452_016405 3300042010 Bacteria 2012
778 Ga0439452_021212 3300042010 Bacteria 1696
779 Ga0439457_002395 3300042014 Bacteria 5363
780 Ga0439462_0001500 3300042015 Bacteria 5213
781 Ga0439462_0004148 3300042015 Bacteria 3522
782 Ga0439462_0066352 3300042015 Bacteria 978
783 Ga0450911_000134 3300042115 Bacteria 29664
784 Ga0450919_010575 3300042121 Bacteria 1052
785 Ga0450921_001010 3300042123 Bacteria 1580
786 Ga0450922_011408 3300042124 Bacteria 856
787 Ga0450923_021486 3300042125 Bacteria 1259
788 Ga0450888_000272 3300042126 Bacteria 4804
789 Ga0450890_003629 3300042127 Bacteria 2042
790 Ga0450890_015300 3300042127 Bacteria 1009
791 Ga0450891_001401 3300042129 Bacteria 2497
792 Ga0450892_000472 3300042130 Bacteria 4663
793 Ga0450894_028707 3300042131 Bacteria 770
794 Ga0450898_006086 3300042134 Bacteria 1844
795 Ga0450898_007877 3300042134 Bacteria 1668
796 Ga0450900_033784 3300042136 Bacteria 750
797 Ga0450889_009467 3300042144 Bacteria 999
798 Ga0450906_008220 3300042145 Bacteria 2027
799 Ga0450906_017028 3300042145 Bacteria 1313
800 Ga0450910_004640 3300042147 Bacteria 1859
801 Ga0439446_0014107 3300042156 Bacteria 2201
802 Ga0439446_0031700 3300042156 Bacteria 1531
803 Ga0439434_0000210 3300042435 Bacteria 16132
804 Ga0439434_0002390 3300042435 Bacteria 5452
805 Ga0439434_0013492 3300042435 Bacteria 2426
806 Ga0439459_0052398 3300042438 Bacteria 900
807 Ga0450918_000761 3300042531 Bacteria 6832
808 Ga0450893_0001075 3300042532 Bacteria 4105
809 Ga0450893_0018034 3300042532 Bacteria 1201
810 Ga0451577_0003919 3300042876 Bacteria 16077
811 Ga0451577_0004095 3300042876 Bacteria 15657
812 Ga0466969_0056066 3300044656 Bacteria 1925
813 Ga0466972_0006287 3300044658 Bacteria 5965
814 Ga0466972_0092644 3300044658 Bacteria 1432
815 Ga0466972_0097997 3300044658 Bacteria 1388
816 Ga0466972_0124065 3300044658 Bacteria 1217
817 Ga0466972_0128525 3300044658 Bacteria 1193
818 Ga0466965_0156740 3300044683 Bacteria 1192
819 Ga0466966_0009251 3300044684 Bacteria 6523
820 Ga0466966_0051238 3300044684 Bacteria 2624
821 Ga0466961_0001449 3300044693 Bacteria 14742
822 Ga0466961_0629790 3300044693 Bacteria 644
823 Ga0466964_0115308 3300044706 Bacteria 1203
824 Ga0466964_0143971 3300044706 Bacteria 1098
825 Ga0453684_0178300 3300044712 Bacteria 2497
826 Ga0453684_0944967 3300044712 Bacteria 920
827 Ga0466971_0135585 3300044719 Bacteria 1145
828 Ga0466968_0003118 3300044735 Bacteria 6115
829 Ga0466970_0257622 3300044765 Bacteria 978
830 Ga0466957_0526156 3300044842 Bacteria 822
831 Ga0466957_1052621 3300044842 Bacteria 586
832 Ga0466960_0007309 3300044901 Bacteria 4478
833 Ga0466960_0079605 3300044901 Bacteria 1648
834 Ga0466960_0119690 3300044901 Bacteria 1378
835 Ga0466959_0003192 3300045049 Bacteria 10651
836 Ga0466959_0044627 3300045049 Bacteria 3266
837 Ga0466958_0008129 3300045836 Bacteria 5807
838 Ga0466958_0112405 3300045836 Bacteria 1701
839 Ga0466967_0085388 3300045976 Bacteria 2858
840 Ga0466967_0553630 3300045976 Bacteria 1132
841 Ga0495627_013446 3300046453 Bacteria 2879
842 Ga0495592_0054735 3300046454 Bacteria 2954
843 Ga0495592_0678325 3300046454 Bacteria 622
844 Ga0495590_0019400 3300046457 Bacteria 2424
845 Ga0495629_0008209 3300046459 Bacteria 7678
846 Ga0495638_0007506 3300046460 Bacteria 7806
847 Ga0495638_0238952 3300046460 Bacteria 1007
848 Ga0495651_0017763 3300046462 Bacteria 5507
849 Ga0495651_0034392 3300046462 Bacteria 3949
850 Ga0495653_0055208 3300046463 Bacteria 3032
851 Ga0495605_0057631 3300046474 Bacteria 1869
852 Ga0495639_0146697 3300046475 Bacteria 1137
853 Ga0495664_0013389 3300046477 Bacteria 4651
854 Ga0495664_0038578 3300046477 Bacteria 2820
855 Ga0495585_0329478 3300046492 Bacteria 745
856 Ga0495607_0108397 3300046501 Bacteria 1476
857 Ga0495583_0000024 3300046506 Bacteria 274122
858 Ga0495583_0060284 3300046506 Bacteria 1697
859 Ga0495583_0119066 3300046506 Bacteria 1113
860 Ga0495606_0056889 3300046507 Bacteria 2521
861 Ga0495606_0302832 3300046507 Bacteria 865
862 Ga0495608_0095065 3300046511 Bacteria 1925
863 Ga0495616_0077637 3300046513 Bacteria 1594
864 Ga0495620_0030296 3300046515 Bacteria 2493
865 Ga0495620_0108092 3300046515 Bacteria 1104
866 Ga0495628_0037903 3300046516 Bacteria 3862
867 Ga0495628_0568165 3300046516 Bacteria 813
868 Ga0495630_0433509 3300046517 Bacteria 1007
869 Ga0495630_0707507 3300046517 Bacteria 771
870 Ga0495631_0160163 3300046518 Bacteria 966
871 Ga0495632_0030226 3300046519 Bacteria 2814
872 Ga0495632_0272332 3300046519 Bacteria 755
873 Ga0495632_0284786 3300046519 Bacteria 735
874 Ga0495637_0008735 3300046520 Bacteria 4965
875 Ga0495637_0100302 3300046520 Bacteria 1132
876 Ga0495643_0005950 3300046522 Bacteria 8139
877 Ga0495643_0043864 3300046522 Bacteria 2431
878 Ga0495643_0110535 3300046522 Bacteria 1398
879 Ga0495643_0161471 3300046522 Bacteria 1102
880 Ga0495643_0246945 3300046522 Bacteria 835
881 Ga0495648_0001207 3300046524 Bacteria 25895
882 Ga0495663_0167630 3300046525 Bacteria 756
883 Ga0495642_0012335 3300046528 Bacteria 3294
884 Ga0495652_0030167 3300046529 Bacteria 4758
885 Ga0495652_0103323 3300046529 Bacteria 2307
886 Ga0495640_0015972 3300046533 Bacteria 5632
887 Ga0495640_0027981 3300046533 Bacteria 4061
888 Ga0495587_0006868 3300046536 Bacteria 7396
889 Ga0495597_0001605 3300046542 Bacteria 15862
890 Ga0495597_0012409 3300046542 Bacteria 4111
891 Ga0495622_0008216 3300046557 Bacteria 4836
892 Ga0495622_0021100 3300046557 Bacteria 3035
893 Ga0495633_0000871 3300046558 Bacteria 26182
894 Ga0495633_0014709 3300046558 Bacteria 4080
895 Ga0495667_0042387 3300046559 Bacteria 3018
896 Ga0495668_0024509 3300046616 Bacteria 3431
897 Ga0495668_0047976 3300046616 Bacteria 2370
898 Ga0495668_0158108 3300046616 Bacteria 1241
899 Ga0495668_0283565 3300046616 Bacteria 908
900 Ga0495611_0165996 3300046648 Bacteria 1032
901 Ga0495625_0000661 3300046660 Bacteria 49248
902 Ga0495625_0051113 3300046660 Bacteria 2964
903 Ga0495625_0214547 3300046660 Bacteria 1264
904 Ga0495625_0450965 3300046660 Bacteria 795
905 Ga0495635_0010642 3300046663 Bacteria 6439
906 Ga0495661_0017236 3300046665 Bacteria 4770
907 Ga0495661_0219511 3300046665 Bacteria 986
908 Ga0495588_0015869 3300046674 Bacteria 3633
909 Ga0495657_0010266 3300046675 Bacteria 7048
910 Ga0495657_0029366 3300046675 Bacteria 3857
911 Ga0495599_0031929 3300046678 Bacteria 3305
912 Ga0495623_0053661 3300046679 Bacteria 2544
913 Ga0495646_0082543 3300046680 Bacteria 1870
914 Ga0495669_0256037 3300046684 Bacteria 841
915 Ga0495613_0013192 3300046689 Bacteria 6140
916 Ga0495624_0306664 3300046690 Bacteria 957
917 Ga0495670_0000034 3300046691 Bacteria 80461
918 Ga0495670_0088845 3300046691 Bacteria 1580
919 Ga0495671_0005640 3300046692 Bacteria 7300
920 Ga0495671_0035828 3300046692 Bacteria 2518
921 Ga0495671_0385169 3300046692 Bacteria 672
922 Ga0495649_0015662 3300046694 Bacteria 4311
923 Ga0495649_0038349 3300046694 Bacteria 2629
924 Ga0495589_0090942 3300046794 Bacteria 1482
925 Ga0495600_0009990 3300046809 Bacteria 5882
926 Ga0495660_0037841 3300046810 Bacteria 2686
927 Ga0495660_0065627 3300046810 Bacteria 1937
928 Ga0495660_0274839 3300046810 Bacteria 773
929 Ga0495581_0094671 3300047315 Bacteria 1734
930 Ga0495604_0040795 3300047317 Bacteria 3642
931 Ga0495604_0050432 3300047317 Bacteria 3231
932 Ga0495674_0022726 3300047319 Bacteria 5781
933 Ga0495672_0046228 3300047320 Bacteria 2597
934 Ga0495672_0046400 3300047320 Bacteria 2591
935 Ga0495676_0037455 3300047321 Bacteria 4036
936 Ga0495680_0007641 3300047322 Bacteria 9871
937 Ga0495683_0039430 3300047323 Bacteria 2388
938 Ga0495683_0049204 3300047323 Bacteria 2112
939 Ga0495687_011306 3300047443 Bacteria 4812
940 Ga0495687_055523 3300047443 Bacteria 1655
941 Ga0495687_084996 3300047443 Bacteria 1228
942 Ga0495675_0010586 3300047444 Bacteria 5764
943 Ga0495677_0060603 3300047445 Bacteria 1403
944 Ga0495673_0047410 3300047469 Bacteria 1899
945 Ga0495681_0021947 3300047470 Bacteria 3427
946 Ga0495684_0146922 3300047471 Bacteria 1765
947 Ga0495686_0027203 3300047472 Bacteria 3736
948 Ga0495686_0066061 3300047472 Bacteria 2236
949 Ga0495686_0075449 3300047472 Bacteria 2067
950 Ga0495686_0205830 3300047472 Bacteria 1127
951 Ga0495686_0205984 3300047472 Bacteria 1126
952 Ga0495686_0483967 3300047472 Bacteria 654
953 Ga0495593_0027633 3300047673 Bacteria 3122
954 Ga0495593_0205615 3300047673 Bacteria 989
955 Ga0495602_0013736 3300048088 Bacteria 8258
956 Ga0495614_0085393 3300048089 Bacteria 1370
957 Ga0496100_0126311 3300048903 Bacteria 1795
958 Ga0496100_0441055 3300048903 Bacteria 997
959 Ga0496101_0005794 3300048904 Bacteria 7898
960 Ga0496101_0182361 3300048904 Bacteria 1617
961 Ga0496101_0404276 3300048904 Bacteria 1075
962 Ga0496102_0040088 3300048905 Bacteria 4235
963 Ga0496102_0110237 3300048905 Bacteria 2565
964 Ga0496102_0170304 3300048905 Bacteria 2050
965 Ga0496102_0289399 3300048905 Bacteria 1544
966 Ga0496102_0583486 3300048905 Bacteria 1041
967 Ga0496102_0861378 3300048905 Bacteria 828
968 Ga0496102_1071204 3300048905 Bacteria 726
969 Ga0496103_0144459 3300048906 Bacteria 1522
970 Ga0496103_0224472 3300048906 Bacteria 1208
971 Ga0496104_0034944 3300048907 Bacteria 4690
972 Ga0496104_0061336 3300048907 Bacteria 3565
973 Ga0496104_0186575 3300048907 Bacteria 1984
974 Ga0496104_0492395 3300048907 Bacteria 1137
975 Ga0496105_0055861 3300048908 Bacteria 3259
976 Ga0496105_0068847 3300048908 Bacteria 2924
977 Ga0496106_0008009 3300048909 Bacteria 7808
978 Ga0496106_0117954 3300048909 Bacteria 2072
979 Ga0496107_0032954 3300048910 Bacteria 3705
980 Ga0496107_0033498 3300048910 Bacteria 3676
981 Ga0496107_0056811 3300048910 Bacteria 2828
982 Ga0496107_0154085 3300048910 Bacteria 1701
983 Ga0496108_0446804 3300048911 Bacteria 1129
984 Ga0496109_0020128 3300048912 Bacteria 5895
985 Ga0496109_0035717 3300048912 Bacteria 4485
986 Ga0496109_0079304 3300048912 Bacteria 3025
987 Ga0496109_0338989 3300048912 Bacteria 1420
988 Ga0496110_0059452 3300048913 Bacteria 3369
989 Ga0496111_0138168 3300048914 Bacteria 1806
990 Ga0496112_0132215 3300048915 Bacteria 2466
991 Ga0496112_0344962 3300048915 Bacteria 1432
992 Ga0496113_0076453 3300048916 Bacteria 2558
993 Ga0496113_0709227 3300048916 Bacteria 802
994 Ga0496113_0711314 3300048916 Bacteria 801
995 Ga0496114_0026528 3300048917 Bacteria 4743
996 Ga0496114_0314262 3300048917 Bacteria 1384
997 Ga0496115_0179355 3300048918 Bacteria 1751
998 Ga0496115_0182219 3300048918 Bacteria 1736
999 Ga0496115_0223528 3300048918 Bacteria 1554
1000 Ga0496116_0149126 3300048919 Bacteria 1302
1001 Ga0496117_0051694 3300048920 Bacteria 2902
1002 Ga0496118_0010190 3300048921 Bacteria 9334
1003 Ga0496118_0041072 3300048921 Bacteria 3668
1004 Ga0496118_0154618 3300048921 Bacteria 1429
1005 Ga0496118_0306668 3300048921 Bacteria 869
1006 Ga0496119_0012917 3300048922 Bacteria 6722
1007 Ga0496119_0078747 3300048922 Bacteria 1905
1008 Ga0496119_0083482 3300048922 Bacteria 1834
1009 Ga0496119_0099360 3300048922 Bacteria 1637
1010 Ga0496119_0154960 3300048922 Bacteria 1224
1011 Ga0496120_0000435 3300048923 Bacteria 66035
1012 Ga0496120_0021764 3300048923 Bacteria 4044
1013 Ga0496120_0033527 3300048923 Bacteria 3084
1014 Ga0496120_0044804 3300048923 Bacteria 2568
1015 Ga0496120_0069714 3300048923 Bacteria 1936
1016 Ga0496120_0217169 3300048923 Bacteria 916
1017 Ga0496121_0000091 3300048924 Bacteria 216685
1018 Ga0496121_0006917 3300048924 Bacteria 13831
1019 Ga0496121_0015919 3300048924 Bacteria 7811
1020 Ga0496121_0044637 3300048924 Bacteria 3820
1021 Ga0496121_0045073 3300048924 Bacteria 3794
1022 Ga0496121_0113744 3300048924 Bacteria 2059
1023 Ga0496121_0184812 3300048924 Bacteria 1500
1024 Ga0496121_0212339 3300048924 Bacteria 1370
1025 Ga0496121_0297836 3300048924 Bacteria 1096
1026 Ga0496121_0573820 3300048924 Bacteria 701
1027 Ga0496121_0668779 3300048924 Bacteria 630
1028 Ga0496122_0035517 3300048925 Bacteria 4052
1029 Ga0496122_0039013 3300048925 Bacteria 3794
1030 Ga0496122_0074747 3300048925 Bacteria 2395
1031 Ga0496122_0142567 3300048925 Bacteria 1496
1032 Ga0496123_0004305 3300048926 Bacteria 15121
1033 Ga0496123_0048893 3300048926 Bacteria 2841
1034 Ga0496124_0028741 3300048927 Bacteria 4967
1035 Ga0496124_0049080 3300048927 Bacteria 3602
1036 Ga0496124_0058454 3300048927 Bacteria 3243
1037 Ga0496124_0191405 3300048927 Bacteria 1565
1038 Ga0496124_0278167 3300048927 Bacteria 1222
1039 Ga0496124_0344703 3300048927 Bacteria 1056
1040 Ga0496124_0365434 3300048927 Bacteria 1015
1041 Ga0496124_0483987 3300048927 Bacteria 835
1042 Ga0496124_0841026 3300048927 Bacteria 564
1043 Ga0496125_0000352 3300048928 Bacteria 87143
1044 Ga0496125_0016745 3300048928 Bacteria 7030
1045 Ga0496125_0016750 3300048928 Bacteria 7027
1046 Ga0496125_0044128 3300048928 Bacteria 3775
1047 Ga0496125_0212638 3300048928 Bacteria 1254
1048 Ga0496125_0236479 3300048928 Bacteria 1163
1049 Ga0496126_0007394 3300048929 Bacteria 12047
1050 Ga0496126_0023157 3300048929 Bacteria 6021
1051 Ga0496126_0027931 3300048929 Bacteria 5381
1052 Ga0496126_0059973 3300048929 Bacteria 3424
1053 Ga0496126_0061639 3300048929 Bacteria 3369
1054 Ga0496126_0077591 3300048929 Bacteria 2945
1055 Ga0496126_0107156 3300048929 Bacteria 2437
1056 Ga0496126_0129166 3300048929 Bacteria 2185
1057 Ga0496126_0237816 3300048929 Bacteria 1523
1058 Ga0496126_0266800 3300048929 Bacteria 1422
1059 Ga0496126_0547400 3300048929 Bacteria 919
1060 Ga0496126_0569428 3300048929 Bacteria 896
1061 Ga0501310_029544 3300049130 Bacteria 723
1062 Ga0501294_007359 3300049517 Bacteria 1062
1063 Ga0501300_005430 3300049523 Bacteria 1877
1064 Ga0501031_0129954 3300049568 Bacteria 1645
1065 Ga0501031_0411918 3300049568 Bacteria 874
1066 Ga0501032_0006968 3300049569 Bacteria 8287
1067 Ga0501032_0023507 3300049569 Bacteria 4257
1068 Ga0501032_0111332 3300049569 Bacteria 1811
1069 Ga0501033_0007935 3300049570 Bacteria 8221
1070 Ga0501033_0048490 3300049570 Bacteria 3154
1071 Ga0501033_0073442 3300049570 Bacteria 2511
1072 Ga0501033_0117411 3300049570 Bacteria 1933
1073 Ga0501033_0170694 3300049570 Bacteria 1562
1074 Ga0501033_0205263 3300049570 Bacteria 1406
1075 Ga0501033_0369248 3300049570 Bacteria 1003
1076 Ga0501033_0578043 3300049570 Bacteria 772
1077 Ga0501034_0006155 3300049571 Bacteria 12940
1078 Ga0501034_0009755 3300049571 Bacteria 10040
1079 Ga0501034_0025344 3300049571 Bacteria 6037
1080 Ga0501034_0025864 3300049571 Bacteria 5977
1081 Ga0501034_0029777 3300049571 Bacteria 5549
1082 Ga0501034_0076321 3300049571 Bacteria 3358
1083 Ga0501034_0414000 3300049571 Bacteria 1270
1084 Ga0501034_0529334 3300049571 Bacteria 1090
1085 Ga0501034_0690326 3300049571 Bacteria 920
1086 Ga0501036_0001698 3300049572 Bacteria 17103
1087 Ga0501036_0152991 3300049572 Bacteria 1945
1088 Ga0501036_0188319 3300049572 Bacteria 1737
1089 Ga0501036_0285367 3300049572 Bacteria 1381
1090 Ga0501036_0356885 3300049572 Bacteria 1220
1091 Ga0501037_0021179 3300049573 Bacteria 4803
1092 Ga0501037_0031114 3300049573 Bacteria 3941
1093 Ga0501037_0035110 3300049573 Bacteria 3698
1094 Ga0501037_0115841 3300049573 Bacteria 1929
1095 Ga0501037_0312295 3300049573 Bacteria 1089
1096 Ga0501038_0016637 3300049574 Bacteria 6666
1097 Ga0501038_0018939 3300049574 Bacteria 6213
1098 Ga0501038_0020329 3300049574 Bacteria 5970
1099 Ga0501038_0206876 3300049574 Bacteria 1572
1100 Ga0501038_0317014 3300049574 Bacteria 1220
1101 Ga0501038_0461937 3300049574 Bacteria 975
1102 Ga0501038_0633520 3300049574 Bacteria 806
1103 Ga0501039_0152154 3300049575 Bacteria 1817
1104 Ga0501039_0181004 3300049575 Bacteria 1657
1105 Ga0501040_0106110 3300049576 Bacteria 1963
1106 Ga0501042_0061964 3300049578 Bacteria 2672
1107 Ga0501043_0014288 3300049579 Bacteria 6213
1108 Ga0501043_0014731 3300049579 Bacteria 6122
1109 Ga0501043_0146383 3300049579 Bacteria 1849
1110 Ga0501043_0178804 3300049579 Bacteria 1653
1111 Ga0501046_0008710 3300049580 Bacteria 8817
1112 Ga0501046_0840601 3300049580 Bacteria 642
1113 Ga0501047_0018727 3300049581 Bacteria 6638
1114 Ga0501047_0025481 3300049581 Bacteria 5686
1115 Ga0501047_0062178 3300049581 Bacteria 3602
1116 Ga0501047_0088364 3300049581 Bacteria 2976
1117 Ga0501047_0198864 3300049581 Bacteria 1865
1118 Ga0501047_0199795 3300049581 Bacteria 1860
1119 Ga0501047_0314389 3300049581 Bacteria 1406
1120 Ga0501047_0314395 3300049581 Bacteria 1406
1121 Ga0501047_0376744 3300049581 Bacteria 1254
1122 Ga0501048_0072858 3300049582 Bacteria 2424
1123 Ga0501048_0166654 3300049582 Bacteria 1560
1124 Ga0501048_0376103 3300049582 Bacteria 1014
1125 Ga0501067_0104061 3300049583 Bacteria 1577
1126 Ga0501068_0078871 3300049584 Bacteria 2019
1127 Ga0501068_0255419 3300049584 Bacteria 1118
1128 Ga0501070_0159115 3300049586 Bacteria 1862
1129 Ga0501070_0182568 3300049586 Bacteria 1726
1130 Ga0501070_0233999 3300049586 Bacteria 1505
1131 Ga0501070_0512275 3300049586 Bacteria 963
1132 Ga0501073_0011914 3300049589 Bacteria 6347
1133 Ga0501073_0042668 3300049589 Bacteria 3200
1134 Ga0501073_0090090 3300049589 Bacteria 2132
1135 Ga0501074_0172343 3300049590 Bacteria 1544
1136 Ga0501074_0187422 3300049590 Bacteria 1475
1137 Ga0501211_001650 3300049658 Bacteria 2389
1138 Ga0501217_022639 3300049661 Bacteria 1492
1139 Ga0501222_012228 3300049662 Bacteria 1130
1140 Ga0501235_046995 3300049669 Bacteria 994
1141 Ga0501249_002521 3300049679 Bacteria 3699
1142 Ga0501257_000883 3300049686 Bacteria 6052
1143 Ga0501258_000994 3300049687 Bacteria 2180
1144 Ga0501259_066400 3300049688 Bacteria 765
1145 Ga0501229_002101 3300049706 Bacteria 2336
1146 Ga0501080_0000625 3300049742 Bacteria 28031
1147 Ga0501080_0085300 3300049742 Bacteria 2934
1148 Ga0501080_0110133 3300049742 Bacteria 2552
1149 Ga0501080_0122796 3300049742 Bacteria 2406
1150 Ga0501080_0688588 3300049742 Bacteria 902
1151 Ga0501083_0023237 3300049744 Bacteria 4301
1152 Ga0501083_0267834 3300049744 Bacteria 1111
1153 Ga0501241_031036 3300049758 Bacteria 1010
1154 Ga0501262_000489 3300049759 Bacteria 4715
1155 Ga0501267_010271 3300049764 Bacteria 943
1156 Ga0501035_0011712 3300049822 Bacteria 8124
1157 Ga0501035_0077553 3300049822 Bacteria 2936
1158 Ga0501035_0082194 3300049822 Bacteria 2843
1159 Ga0501035_0107220 3300049822 Bacteria 2449
1160 Ga0501035_0130654 3300049822 Bacteria 2189
1161 Ga0501035_0156326 3300049822 Bacteria 1976
1162 Ga0501035_0281105 3300049822 Bacteria 1406
1163 Ga0501035_0319959 3300049822 Bacteria 1303
1164 Ga0501044_0024139 3300049823 Bacteria 6459
1165 Ga0501044_0035800 3300049823 Bacteria 5196
1166 Ga0501044_0037635 3300049823 Bacteria 5055
1167 Ga0501044_0043203 3300049823 Bacteria 4683
1168 Ga0501044_0107275 3300049823 Bacteria 2804
1169 Ga0501044_0183152 3300049823 Bacteria 2060
1170 Ga0501044_0215536 3300049823 Bacteria 1872
1171 Ga0501044_0273502 3300049823 Bacteria 1624
1172 Ga0501044_1092902 3300049823 Bacteria 667
1173 Ga0501045_0039912 3300049824 Bacteria 3415
1174 nmdc:mga03683_11473_c1 3300050489 Bacteria 3210
1175 nmdc:mga03683_174394_c1 3300050489 Bacteria 978
1176 nmdc:mga03683_32994_c1 3300050489 Bacteria 2086
1177 nmdc:mga03683_65825_c1 3300050489 Bacteria 1540
1178 nmdc:mga03683_87305_c1 3300050489 Bacteria 1355
1179 nmdc:mga03n38_11305_c1 3300050490 Bacteria 3320
1180 nmdc:mga00v17_16100_c1 3300050491 Bacteria 4210
1181 nmdc:mga00v17_29018_c1 3300050491 Bacteria 3244
1182 nmdc:mga00v17_37311_c1 3300050491 Bacteria 2901
1183 nmdc:mga00v17_69892_c1 3300050491 Bacteria 2174
1184 nmdc:mga00v17_86082_c1 3300050491 Bacteria 1969
1185 nmdc:mga0yw44_17340_c1 3300050492 Bacteria 3917
1186 nmdc:mga0yw44_19198_c1 3300050492 Bacteria 3764
1187 nmdc:mga0yw44_34925_c1 3300050492 Bacteria 2950
1188 nmdc:mga0yw44_452584_c1 3300050492 Bacteria 870
1189 nmdc:mga0k408_10077_c1 3300050493 Bacteria 5105
1190 nmdc:mga0k408_13160_c3 3300050493 Bacteria 2518
1191 nmdc:mga0k408_379440_c1 3300050493 Bacteria 842
1192 nmdc:mga0k408_41720_c1 3300050493 Bacteria 2642
1193 nmdc:mga0k408_53718_c2 3300050493 Bacteria 1644
1194 nmdc:mga06z11_189016_c1 3300050494 Bacteria 1191
1195 nmdc:mga06z11_88562_c1 3300050494 Bacteria 1676
1196 nmdc:mga04h51_31440_c1 3300050495 Bacteria 1677
1197 nmdc:mga07m45_12486_c1 3300050496 Bacteria 4491
1198 nmdc:mga07m45_1970_c1 3300050496 Bacteria 9504
1199 nmdc:mga07m45_2447_c1 3300050496 Bacteria 8719
1200 nmdc:mga07m45_26459_c1 3300050496 Bacteria 3189
1201 nmdc:mga07m45_36002_c1 3300050496 Bacteria 2755
1202 nmdc:mga07m45_88246_c1 3300050496 Bacteria 1775
1203 nmdc:mga08x19_252343_c1 3300050514 Bacteria 1218
1204 nmdc:mga0sz30_143250_c1 3300050516 Bacteria 1056
1205 nmdc:mga0sz30_279959_c1 3300050516 Bacteria 743
1206 nmdc:mga0sz30_290396_c1 3300050516 Bacteria 729
1207 nmdc:mga0sz30_359214_c1 3300050516 Bacteria 651
1208 nmdc:mga0sz30_55009_c1 3300050516 Bacteria 1693
1209 Ga0500610_0097753 3300053079 Bacteria 1521
1210 Ga0500578_0017074 3300053086 Bacteria 4664
1211 Ga0500643_000117 3300053087 Bacteria 82982
1212 Ga0500643_013466 3300053087 Bacteria 2886
1213 Ga0500643_025299 3300053087 Bacteria 1874
1214 Ga0500644_0318434 3300053088 Bacteria 668
1215 Ga0500646_0081632 3300053090 Bacteria 987
1216 Ga0500647_0043082 3300053091 Bacteria 2167
1217 Ga0500583_0008979 3300053092 Bacteria 3625
1218 Ga0500583_0013885 3300053092 Bacteria 3133
1219 Ga0500583_0114636 3300053092 Bacteria 1330
1220 Ga0500651_0029989 3300053093 Bacteria 3421
1221 Ga0500566_0000089 3300053094 Bacteria 45622
1222 Ga0500566_0007716 3300053094 Bacteria 6381
1223 Ga0500566_0284604 3300053094 Bacteria 786
1224 Ga0500566_0365025 3300053094 Bacteria 657
1225 Ga0500641_0016651 3300053096 Bacteria 2740
1226 Ga0500650_0043101 3300053098 Bacteria 2086
1227 Ga0500650_0121583 3300053098 Bacteria 1217
1228 Ga0500555_022776 3300053103 Bacteria 1797
1229 Ga0500556_0110918 3300053104 Bacteria 1063
1230 Ga0500556_0165983 3300053104 Bacteria 872
1231 Ga0500557_000089 3300053105 Bacteria 31156
1232 Ga0500562_001563 3300053108 Bacteria 5679
1233 Ga0500562_008747 3300053108 Bacteria 2558
1234 Ga0500569_001966 3300053109 Bacteria 3986
1235 Ga0500593_001529 3300053117 Bacteria 8308
1236 Ga0500594_0023917 3300053118 Bacteria 1553
1237 Ga0500595_105080 3300053119 Bacteria 806
1238 Ga0500597_009365 3300053120 Bacteria 3441
1239 Ga0500597_087200 3300053120 Bacteria 1355
1240 Ga0500607_000992 3300053121 Bacteria 27011
1241 Ga0500607_084049 3300053121 Bacteria 1617
1242 Ga0500608_000056 3300053122 Bacteria 48877
1243 Ga0500608_065252 3300053122 Bacteria 1737
1244 Ga0500617_141819 3300053124 Bacteria 963
1245 Ga0500642_0002259 3300053130 Bacteria 5623
1246 Ga0500642_0010858 3300053130 Bacteria 3232
1247 Ga0500652_007545 3300053131 Bacteria 3567
1248 Ga0500652_221352 3300053131 Bacteria 761
1249 Ga0500658_0002356 3300053134 Bacteria 7321
1250 Ga0500658_0023945 3300053134 Bacteria 2336
1251 Ga0500658_0042641 3300053134 Bacteria 1824
1252 Ga0500658_0273580 3300053134 Bacteria 776
1253 Ga0500559_0000251 3300053136 Bacteria 42552
1254 Ga0500559_0003661 3300053136 Bacteria 7515
1255 Ga0500559_0022448 3300053136 Bacteria 2676
1256 Ga0500559_0025312 3300053136 Bacteria 2525
1257 Ga0500559_0097098 3300053136 Bacteria 1354
1258 Ga0500559_0295541 3300053136 Bacteria 761
1259 Ga0500564_106654 3300053138 Bacteria 1233
1260 Ga0500568_0006855 3300053139 Bacteria 5670
1261 Ga0500568_0010336 3300053139 Bacteria 4377
1262 Ga0500568_0013851 3300053139 Bacteria 3662
1263 Ga0500568_0087030 3300053139 Bacteria 1181
1264 Ga0500568_0131743 3300053139 Bacteria 929
1265 Ga0500568_0146741 3300053139 Bacteria 874
1266 Ga0500573_0000021 3300053140 Bacteria 159093
1267 Ga0500577_0002096 3300053142 Bacteria 5095
1268 Ga0500577_0008824 3300053142 Bacteria 2895
1269 Ga0500577_0036812 3300053142 Bacteria 1755
1270 Ga0500604_0128541 3300053151 Bacteria 851
1271 Ga0500616_0000011 3300053153 Bacteria 732880
1272 Ga0500616_0005790 3300053153 Bacteria 8296
1273 Ga0500616_0034153 3300053153 Bacteria 2772
1274 Ga0500616_0047942 3300053153 Bacteria 2267
1275 Ga0500619_036863 3300053154 Bacteria 1524
1276 Ga0500620_002504 3300053155 Bacteria 3721
1277 Ga0500622_0006962 3300053156 Bacteria 6475
1278 Ga0500622_0012884 3300053156 Bacteria 4518
1279 Ga0500624_000020 3300053157 Bacteria 118392
1280 Ga0500627_0006872 3300053158 Bacteria 3913
1281 Ga0500627_0039756 3300053158 Bacteria 2015
1282 Ga0500633_0192256 3300053160 Bacteria 764
1283 Ga0500634_0007272 3300053161 Bacteria 5443
1284 Ga0500636_0000526 3300053177 Bacteria 20787
1285 Ga0500637_0000074 3300053178 Bacteria 35683
1286 Ga0500637_0297756 3300053178 Bacteria 881
1287 Ga0500625_027984 3300053729 Bacteria 2673
1288 Ga0500625_089535 3300053729 Bacteria 1321
1289 Ga0500645_009627 3300053730 Bacteria 3237
1290 Ga0500599_007459 3300053736 Bacteria 1408
1291 Ga0500601_000577 3300053737 Bacteria 5267
1292 Ga0501084_0777206 3300054114 Bacteria 807
1293 Ga0500661_012337 3300055283 Bacteria 1543
1294 Ga0501082_0012479 3300060353 Bacteria 7300
1295 Ga0466962_0090141 3300061719 Bacteria 1469
1296 2507505660 2507262055 Bacteria 8048963
1297 2508539551 2508501009 Bacteria 7784016
1298 2508695918 2508501042 Bacteria 8719808
1299 2509116914 2508501123 Bacteria 6283661
1300 2509146792 2508501128 Bacteria 8613869
1301 2509373192 2509276018 Bacteria 6910194
1302 2509395536 2509276022 Bacteria 6200534
1303 2510317153 2510065059 Bacteria 6847884
1304 2511388512 2511231027 Bacteria 5013807
1305 2511398991 2511231028 Bacteria 8046582
1306 2512035794 2511231221 Bacteria 6846400
1307 2512929030 2512875016 Bacteria 6529530
1308 2512963594 2512875024 Bacteria 7195110
1309 2513589890 2513237087 Bacteria 5817514
1310 2513612450 2513237090 Bacteria 7096802
1311 2513625025 2513237092 Bacteria 8341956
1312 2513640820 2513237094 Bacteria 8789602
1313 2513651805 2513237095 Bacteria 8976980
1314 2513659395 2513237096 Bacteria 8722461
1315 2513673974 2513237098 Bacteria 9902361
1316 2513699782 2513237102 Bacteria 7703324
1317 2513722035 2513237104 Bacteria 10034502
1318 2513860662 2513237137 Bacteria 9558895
1319 2513876888 2513237139 Bacteria 8737671
1320 2513889954 2513237141 Bacteria 8496279
1321 2513919070 2513237145 Bacteria 8979722
1322 2514010297 2513237161 Bacteria 8871253
1323 2514038147 2513237164 Bacteria 7563725
1324 2514423412 2513237305 Bacteria 7293571
1325 2515624057 2515154112 Bacteria 8294334
1326 2517106584 2517093001 Bacteria 9002274
1327 2517888393 2517572143 Bacteria 9484767
1328 2524440101 2524023205 Bacteria 8918781
1329 2524470037 2524023210 Bacteria 9029266
1330 2524535304 2524023228 Bacteria 10118060
1331 2528854419 2528768022 Bacteria 10457665
1332 2588514563 2588253730 Bacteria 6881675
1333 2599104042 2597490356 Bacteria 7030811
1334 2599935920 2599185301 Bacteria 6161860
1335 2617350063 2617270735 Bacteria 9163226
1336 2617374131 2617270741 Bacteria 8201522
1337 2643745642 2643221544 Bacteria 5886209
1338 2643757465 2643221547 Bacteria 4740017
1339 2644126219 2643221622 Bacteria 4212502
1340 2644257709 2643221646 Bacteria 6433402
1341 2644325470 2643221658 Bacteria 6064537
1342 2671124216 2667528175 Bacteria 7532676
1343 2671694043 2671180139 Bacteria 4196045
1344 2688599156 2687453392 Bacteria 6880454
1345 2694633523 2693429783 Bacteria 7019804
1346 2694635227 2693429784 Bacteria 7241525
1347 2723578230 2721755686 Bacteria 7343952
1348 2728747924 2728368998 Bacteria 8720350
1349 2739252154 2738543013 Bacteria 5618633
1350 2745077791 2744054633 Bacteria 8678936
1351 2792460705 2791355048 Bacteria 5832535
1352 2793065960 2791355196 Bacteria 7323613
1353 2793067207 2791355197 Bacteria 8420563
1354 2805922215 2802429603 Bacteria 8777136
1355 2818239289 2816332527 Bacteria 8933356
1356 2824606262 2824600985 Bacteria 8488197
1357 2824616118 2824609381 Bacteria 8672835
1358 2824625514 2824617872 Bacteria 8814715
1359 2824634378 2824626560 Bacteria 8813858
1360 2824641655 2824635225 Bacteria 8785348
1361 2824648940 2824644064 Bacteria 8743947
1362 2824658283 2824653114 Bacteria 8493680
1363 2824669721 2824661429 Bacteria 9877870
1364 2824677072 2824671348 Bacteria 8369588
1365 2824684858 2824679649 Bacteria 8248951
1366 2824693561 2824687955 Bacteria 8360029
1367 2824701794 2824696289 Bacteria 8335049
1368 2824711972 2824704595 Bacteria 9667483
1369 2824718977 2824714736 Bacteria 8717648
1370 2824729180 2824723954 Bacteria 8758240
1371 2824734867 2824732956 Bacteria 7810675
1372 2824748126 2824746037 Bacteria 7911610
1373 2824762575 2824753945 Bacteria 9787441
1374 2824772749 2824763712 Bacteria 9792355
1375 2824780039 2824773399 Bacteria 8360218
1376 2828306905 2828305725 Bacteria 4916900
1377 2838125786 2838122688 Bacteria 8803140
1378 2841913612 2841911363 Bacteria 6173697
1379 2841919359 2841917233 Bacteria 6173500
1380 2841948380 2841941048 Bacteria 8688029
1381 2841952827 2841949485 Bacteria 8680857
1382 2841965657 2841957949 Bacteria 8652217
1383 2841972824 2841966195 Bacteria 8673214
1384 2841977599 2841974524 Bacteria 8931498
1385 2841984840 2841983080 Bacteria 8395090
1386 2842041408 2842038055 Bacteria 8002051
1387 2842049450 2842045827 Bacteria 8006841
1388 2842697195 2842694124 Bacteria 4063419
1389 2842875377 2842871566 Bacteria 4827117
1390 2843747987 2843744320 Bacteria 5659202
1391 2844014334 2844009547 Bacteria 6728125
1392 2844315890 2844315083 Bacteria 8138177
1393 2846957082 2846952575 Bacteria 6587527
1394 2847939884 2847930680 Bacteria 9342022
1395 2847942720 2847939898 Bacteria 8606328
1396 2848863089 2848858292 Bacteria 7391279
1397 2849076714 2849076700 Bacteria 7039503
1398 2849561426 2849560528 Bacteria 5393480
1399 2849574673 2849573788 Bacteria 5421256
1400 2851153574 2851153111 Bacteria 5542585
1401 2856328122 2856320880 Bacteria 7263508
1402 2856329105 2856328259 Bacteria 6528202
1403 2856341982 2856334872 Bacteria 7037011
1404 2856367275 2856364286 Bacteria 6939991
1405 2857354165 2857349434 Bacteria 7926032
1406 2857372330 2857367948 Bacteria 6965560
1407 2857506512 2857504554 Bacteria 5369913
1408 2857515669 2857509624 Bacteria 7472071
1409 2857577080 2857576091 Bacteria 5465855
1410 2869175361 2869169390 Bacteria 6659796
1411 2869238856 2869234852 Bacteria 6654993
1412 2869252227 2869249662 Bacteria 6868783
1413 2869263523 2869256925 Bacteria 6981691
1414 2869268166 2869264136 Bacteria 6880765
1415 2869278022 2869271264 Bacteria 6908218
1416 2869284343 2869278585 Bacteria 7077053
1417 2869287558 2869285874 Bacteria 6901219
1418 2871431082 2871429161 Bacteria 6547891
1419 2871439012 2871435913 Bacteria 6880295
1420 2871452002 2871451962 Bacteria 7336357
1421 2871460132 2871459585 Bacteria 6866887
1422 2871487416 2871481445 Bacteria 6700002
1423 2874110949 2874109183 Bacteria 6517025
1424 2874120890 2874116593 Bacteria 6674494
1425 2874134171 2874131515 Bacteria 6820270
1426 2874139194 2874139085 Bacteria 7021506
1427 2874150354 2874146452 Bacteria 7533118
1428 2874157409 2874155637 Bacteria 6724144
1429 2874164154 2874162495 Bacteria 6174670
1430 2874593220 2874590934 Bacteria 8299676
1431 2874617178 2874612657 Bacteria 8252029
1432 2874621405 2874620515 Bacteria 8290088
1433 2874629207 2874628541 Bacteria 8630250
1434 2874647803 2874645413 Bacteria 8214782
1435 2876369496 2876363079 Bacteria 6544991
1436 2876386004 2876377896 Bacteria 6565995
1437 2876386569 2876386047 Bacteria 6698674
1438 2876403341 2876399893 Bacteria 6927900
1439 2876410088 2876406927 Bacteria 6191900
1440 2876416505 2876413966 Bacteria 6831344
1441 2876422225 2876420981 Bacteria 6687741
1442 2876762869 2876761206 Bacteria 10111113
1443 2876773260 2876771140 Bacteria 8287509
1444 2876820567 2876818435 Bacteria 8274608
1445 2878738329 2878730984 Bacteria 6380721
1446 2878740041 2878738818 Bacteria 7136951
1447 2878747695 2878745973 Bacteria 6867388
1448 2878777805 2878774303 Bacteria 6108671
1449 2878781088 2878781027 Bacteria 6834456
1450 2879076794 2879074833 Bacteria 8279565
1451 2879083557 2879083081 Bacteria 8587928
1452 2879101211 2879099564 Bacteria 10442239
1453 2879128747 2879127579 Bacteria 8294491
1454 2879145534 2879142872 Bacteria 8267021
1455 2881367167 2881364244 Bacteria 7710352
1456 2881668454 2881665667 Bacteria 8175609
1457 2882637507 2882632389 Bacteria 8154593
1458 2885368973 2885366525 Bacteria 8326213
1459 2885380443 2885374607 Bacteria 8927485
1460 2885386348 2885383462 Bacteria 9473874
1461 2885414250 2885409591 Bacteria 9235467
1462 2885431821 2885429604 Bacteria 3642894
1463 2888342394 2888337043 Bacteria 6629336
1464 2888352100 2888350351 Bacteria 7372807
1465 2888379078 2888378607 Bacteria 9652610
1466 2888390253 2888388044 Bacteria 7304136
1467 2888427482 2888419890 Bacteria 7857137
1468 2889014087 2889010040 Bacteria 6749192
1469 2889021204 2889016732 Bacteria 6700763
1470 2894822197 2894817345 Bacteria 4892941
1471 2898329880 2898329390 Bacteria 5168154
1472 2903453084 2903448605 Bacteria 7357801
1473 2903498811 2903492973 Bacteria 13473544
1474 2903515917 2903513507 Bacteria 6344008
1475 2903526902 2903521522 Bacteria 6525694
1476 2903530235 2903528002 Bacteria 6586099
1477 2903731840 2903727486 Bacteria 8281579
1478 2903753289 2903748898 Bacteria 9972761
1479 2903771414 2903768456 Bacteria 9749579
1480 2904668075 2904666416 Bacteria 8226587
1481 2904692277 2904690495 Bacteria 9412302
1482 2904707783
1483 2904718215 2904711408 Bacteria 9771557
1484 2906310096 2906308376 Bacteria 6841989
1485 2906322968 2906321335 Bacteria 6579571
1486 2906361143 2906354277 Bacteria 6991324
1487 2906376926 2906370794 Bacteria 6881062
1488 2906402112 2906401398 Bacteria 6693206
1489 2906414353 2906408224 Bacteria 6162342
1490 2906432697 2906427513 Bacteria 6375796
1491 2906603633 2906602504 Bacteria 8295279
1492 2906614253
1493 2906631759 2906626472 Bacteria 8826946
1494 2906640750 2906635258 Bacteria 8601019
1495 2906646267 2906643746 Bacteria 8722424
1496 2906660868 2906660503 Bacteria 8595048
1497 2908746919 2908739725 Bacteria 8628932
1498 2908758915 2908756301 Bacteria 8864324
1499 2908776605 2908775508 Bacteria 8092255
1500 2909048404 2909042592 Bacteria 6499737
1501 2919454171 2919450847 Bacteria 5631160
1502 2922137046 2922130491 Bacteria 7173936
1503 2922153766 2922151315 Bacteria 6902399
1504 2922173096 2922172374 Bacteria 6167644
1505 2922187442 2922185730 Bacteria 7113964
1506 2922400369 2922393267 Bacteria 8285685
1507 2922426076
1508 2924714882 2924710171 Bacteria 6752351
1509 2924723335 2924718760 Bacteria 6331356
1510 2924734661 2924733363 Bacteria 7574837
1511 2924743177 2924741084 Bacteria 6661321
1512 2924752112 2924748358 Bacteria 6154725
1513 2924777640 2924776078 Bacteria 7492003
1514 2928027414 2928027323 Bacteria 4382488
1515 2928525836 2928521798 Bacteria 4960112
1516 2928974752 2928972540 Bacteria 3058286
1517 2929205260 2929199973 Bacteria 7260745
1518 2929619039 2929615660 Bacteria 9193770
1519 2929631116 2929624759 Bacteria 9339455
1520 2932789081 2932784394 Bacteria 9704911
1521 2932800186 2932794094 Bacteria 7915132
1522 2932808231 2932801729 Bacteria 7987968
1523 2932814282 2932809354 Bacteria 9135765
1524 2932820408 2932818245 Bacteria 9955613
1525 2932834330 2932828146 Bacteria 9745859
1526 2933580251 2933577622 Bacteria 9116884
1527 2935614714 2935608549 Bacteria 8203142
1528 2935620015 2935616580 Bacteria 9032984
1529 2935632488 2935630451 Bacteria 8169952
1530 2935640334 2935638405 Bacteria 10015038
1531 2935649101 2935648319 Bacteria 8801166
1532 2935658127 2935656913 Bacteria 8965014
1533 2935673379 2935665750 Bacteria 9571747
1534 2935683860 2935675223 Bacteria 9928132
1535 2935686829 2935684952 Bacteria 9590419
1536 2935702125 2935694250 Bacteria 9291695
1537 2935710535 2935703347 Bacteria 10242284
1538 2935716517 2935713505 Bacteria 9608509
1539 2935723358 2935722832 Bacteria 9608746
1540 2935734914 2935732158 Bacteria 9706831
1541 2935744295 2935741537 Bacteria 9707219
1542 2935752795 2935750917 Bacteria 9590372
1543 2935764657 2935760218 Bacteria 9817913
1544 2935774707 2935769743 Bacteria 7878163
1545 2935785071 2935777560 Bacteria 8077691
1546 2935789778 2935785616 Bacteria 7962367
1547 2935797854 2935793552 Bacteria 8012592
1548 2935806232 2935801545 Bacteria 9301974
1549 2935818088 2935810662 Bacteria 9401221
1550 2935826246 2935819856 Bacteria 8261050
1551 2935837149 2935827899 Bacteria 10038562
1552 2935841330 2935837841 Bacteria 9454360
1553 2935853742 2935847175 Bacteria 8228321
1554 2935858901 2935855204 Bacteria 9035059
1555 2935864082 2935864058 Bacteria 9784707
1556 2935875604 2935873716 Bacteria 9632195
1557 2935883335 2935883170 Bacteria 7964738
1558 2935910964 2935908558 Bacteria 8568796
1559 2935924125 2935916978 Bacteria 9113783
1560 2935932822 2935926038 Bacteria 8601059
1561 2935937385 2935934488 Bacteria 8602579
1562 2935949414 2935942939 Bacteria 8599779
1563 2935958187 2935951376 Bacteria 8602333
1564 2935964115 2935959822 Bacteria 7869783
1565 2935971158 2935967501 Bacteria 8603075
1566 2935982250 2935975950 Bacteria 8347125
1567 2935985385 2935984226 Bacteria 8302647
1568 2935995452 2935992306 Bacteria 9802711
1569 2936007875 2936002035 Bacteria 9362176
1570 2936012346 2936011229 Bacteria 8801034
1571 2936020573 2936019824 Bacteria 8804134
1572 2936029639 2936028420 Bacteria 8965941
1573 2936044698 2936037263 Bacteria 9446081
1574 2936051896 2936046547 Bacteria 8903709
1575 2936056848 2936055302 Bacteria 8785755
1576 2937815382 2937813078 Bacteria 7783518
1577 2937851435 2937848649 Bacteria 6983481
1578 2937864224 2937861824 Bacteria 6660327
1579 2937873166 2937868953 Bacteria 6639878
1580 2937883859 2937877337 Bacteria 7246526
1581 2937976609 2937972304 Bacteria 7532020
1582 2937988302 2937980651 Bacteria 6517427
1583 2938021085 2938014810 Bacteria 6700592
1584 2939634624 2939631187 Bacteria 6118131
1585 2940558708 2940556831 Bacteria 9590747
1586 2941508848 2941507105 Bacteria 8166816
1587 2941516678 2941515067 Bacteria 8166720
1588 2941524306 2941523033 Bacteria 8169134
1589 2941535738 2941531003 Bacteria 7653939
1590 2941543557 2941538514 Bacteria 9402094
1591 2945910195 2945909444 Bacteria 7065066
1592 2945987779 2945984333 Bacteria 7358892
1593 2954012075 2954011201 Bacteria 4762601
1594 2958038440 2958034702 Bacteria 6989922
1595 2958044405 2958041894 Bacteria 13082850
1596 2958056051 2958041894 Bacteria 13082850
1597 2958069727 2958064165 Bacteria 7158582
1598 2958091137 2958084443 Bacteria 7312792
1599 2958096218 2958092219 Bacteria 6861151
1600 2958101107 2958100919 Bacteria 6800575
1601 2958108939 2958108152 Bacteria 6681128
1602 2958128360 2958122699 Bacteria 7280457
1603 2958131960 2958130278 Bacteria 6897202
1604 2958140723 2958137437 Bacteria 6050276
1605 2958147463 2958144490 Bacteria 6677056
1606 2958164571 2958158011 Bacteria 6058449
1607 2958176565 2958172287 Bacteria 6716688
1608 2958181763 2958179912 Bacteria 6874908
1609 2961079607 2961077736 Bacteria 7079850
1610 2961186779 2961183825 Bacteria 6688536
1611 2963650204 2963644680 Bacteria 6530403
1612 2965029258 2965025482 Bacteria 6532201
1613 2965045694 2965040258 Bacteria 6855979
1614 2965049861 2965047637 Bacteria 6623551
1615 2965091103 2965089291 Bacteria 6866420
1616 2965120743 2965119406 Bacteria 6956431
1617 2968021255 2968016561 Bacteria 7022047
1618 2968086450 2968083720 Bacteria 7351627
1619 2968120278 2968117919 Bacteria 6536078
1620 2968142146 2968138860 Bacteria 6605449
1621 2970476360 2970469710 Bacteria 6969209
1622 2970489805 2970489779 Bacteria 6517260
1623 2970517928 2970510686 Bacteria 7006402
1624 2970535661 2970532167 Bacteria 6553173
1625 2970551916 2970547951 Bacteria 6931819
1626 2970598958 2970593180 Bacteria 7073582
1627 2970626861 2970619444 Bacteria 6986144
1628 2970629714 2970627176 Bacteria 6680862
1629 2977242208 2977240413 Bacteria 3191065
1630 2977846610 2977843712 Bacteria 6753583
1631 2977853988 2977851361 Bacteria 6694324
1632 2977879525 2977872689 Bacteria 7270173
1633 2977905473 2977898635 Bacteria 6675551
1634 2977909957 2977907340 Bacteria 6577984
1635 2977923266 2977922695 Bacteria 6956781
1636 2977937541 2977935797 Bacteria 6252826
1637 2977949683 2977942078 Bacteria 7570577
1638 2977953996 2977950692 Bacteria 6893264
1639 2977961982 2977957713 Bacteria 6877875
1640 2977976353 2977971508 Bacteria 7472917
1641 2977986694 2977986579 Bacteria 6581278
1642 2979711000 2979710463 Bacteria 6785254
1643 2979748443 2979742915 Bacteria 7301278
1644 2979771851 2979764755 Bacteria 6610066
1645 2979776784 2979772303 Bacteria 6618277
1646 2979798507 2979793036 Bacteria 6808957
1647 2984558284 2984555340 Bacteria 4247089
1648 2984567336 2984564862 Bacteria 4339992
1649 2987642425 2987636660 Bacteria 8088555
1650 2987647290 2987645492 Bacteria 6117018
1651 2987657142 2987652177 Bacteria 6969023
1652 2987677044 2987673487 Bacteria 6884027
1653 2993358402 2993356040 Bacteria 4247105
1654 2995951874 2995948881 Bacteria 6358104
1655 2996356438 2996348954 Bacteria 7239054
1656 2996388306 2996386984 Bacteria 6978667
1657 3002145572 3002141150 Bacteria 5254435
1658 3003666512 3003665799 Bacteria 7279786
1659 3004196980 3004195979 Bacteria 6776956
1660 3004210507 3004203850 Bacteria 7307914
1661 3004213443 3004211236 Bacteria 7417683
1662 3004221270 3004218560 Bacteria 7421728
1663 3004238468 3004232784 Bacteria 6662140
1664 3004253002 3004248173 Bacteria 6563236
1665 3004269813 3004268573 Bacteria 7043476
1666 3004282743 3004275668 Bacteria 7114440
1667 3004338463 3004334049 Bacteria 8449246
1668 3005483464 3005474847 Bacteria 9259049
1669 3005488914 3005483717 Bacteria 7877331
1670 3005506327 3005506211 Bacteria 6943378
1671 3005592698 3005587118 Bacteria 7794411
1672 3005595477 3005594810 Bacteria 8716512
1673 3005711443 3005710791 Bacteria 7622528
1674 3005718705 3005718088 Bacteria 8283608
1675 637078749 637000159 Bacteria 7596297
1676 649873586 649633066 Bacteria 6690028
1677 8001846245 8001845381 Bacteria 5804942
1678 8003405184 8003400568 Bacteria 5535898
1679 8004302192 8004300914 Bacteria 6132239
1680 8004367523 8004361976 Bacteria 6858373
1681 8004390294 8004387939 Bacteria 7049250
1682 8004642299 8004640170 Bacteria 6723001
1683 8004699137 8004695233 Bacteria 6731676
1684 8004716358 8004714634 Bacteria 6776161
1685 8004732201 8004727605 Bacteria 6643904
1686 8006932029 8006926726 Bacteria 6749210
1687 8006936774 8006933436 Bacteria 10410654
1688 8006976745 8006973647 Bacteria 10679141
1689 8016517719 8016511872 Bacteria 9921665
1690 8016525772 8016522445 Bacteria 8156687
1691 8016539372 8016530956 Bacteria 8155261
1692 8016543662 8016539877 Bacteria 8155419
1693 8016549634 8016548790 Bacteria 8155074
1694 8016558052 8016557553 Bacteria 8154380
1695 8016569067 8016566248 Bacteria 8158151
1696 8016581701 8016575299 Bacteria 8154085
1697 8016585876 8016583857 Bacteria 10421953
1698 8016596063 8016595262 Bacteria 8149947
1699 8016606949 8016603502 Bacteria 8731218
1700 8016618855 8016613128 Bacteria 8794220
1701 8016622688 8016622563 Bacteria 7999408
1702 8016635186 8016630954 Bacteria 9217207
1703 8017058909 8017057580 Bacteria 10023680
1704 8019530651 8019530166 Bacteria 8155624
1705 8019540935 8019538911 Bacteria 7872763
1706 8019549684 8019547302 Bacteria 7996444
1707 8019561914 8019555841 Bacteria 9642137
1708 8019571987 8019565922 Bacteria 9639779
1709 8019576741 8019576017 Bacteria 10049540
1710 8019594794 8019586578 Bacteria 10212056
1711 8019606943 8019597564 Bacteria 10041141
1712 8019611564 8019608314 Bacteria 10042931
1713 8019623407 8019619141 Bacteria 9218857
1714 8019638733 8019629233 Bacteria 8687553
1715 8019640932 8019638758 Bacteria 9062356
1716 8019653021 8019648815 Bacteria 10014479
1717 8019666534 8019659431 Bacteria 8577854
1718 8019676232 8019668869 Bacteria 8791617
1719 8019679753 8019678201 Bacteria 8863603
1720 8019695748 8019687851 Bacteria 8712826
1721 8054007968 8054002106 Bacteria 7987183
1722 8054568787 8054563764 Bacteria 5592885
1723 8055742888 8055742211 Bacteria 9226248
1724 8055913433 8055909800 Bacteria 7278581
1725 8056683150 8056681323 Bacteria 8472857
1726 8056970808 8056967851 Bacteria 9038162
1727 Ga0501032_0018503
1728 JGI24739J22299_10011391
1729 JGI24739J22299_10096872
1730 JGI24735J21928_10015613
1731 JGI25156J39149_1004519
1732 JGI25156J39149_1007573
1733 JGI25158J39367_1025012
1734 JGI25157J39369_1003669
1735 JGI25152J39213_1003099
1736 JGI25150J39212_1001285
1737 JGI25159J45721_1010897
1738 JGI25151J46595_10038236
1739 JGI25151J46595_10112289
1740 JGI25165J46597_1000037
1741 JGI25153J46596_10008033
1742 JGI25153J46596_10010518
1743 JGI25153J46596_10021879
1744 JGI25153J46596_10023921
1745 rootH1_10006378
1746 rootH2_10033453
1747 rootL2_10024654
1748 rootL2_10077388
1749 rootH1_10220232
1750 JGI25160J50197_1001756
1751 JGI25160J50197_1008048
1752 JGI25160J50197_1012962
1753 JGI25160J50197_1017478
1754 JGI25161J50226_1009749
1755 JGI25161J50226_1010515
1756 JGI25161J50226_1015223
1757 Ga0006562J51391_1106834
1758 Ga0006562J51391_1106835
1759 Ga0055532_1007168
1760 Ga0055535_1000128
1761 Ga0055542_1000062
1762 Ga0055542_1001515
1763 Ga0055529_1009081
1764 Ga0055526_1016624
1765 Ga0055526_1016625
1766 Ga0055537_1000217
1767 Ga0055537_1001276
1768 Ga0055537_1004956
1769 Ga0055537_1010392
1770 Ga0055524_1000276
1771 Ga0055524_1014879
1772 Ga0055524_1016708
1773 Ga0055536_1000385
1774 Ga0055536_1000743
1775 Ga0055536_1006377
1776 Ga0055536_1009998
1777 Ga0055536_1038275
1778 Ga0055534_1000106
1779 Ga0055534_1002390
1780 Ga0055528_1010834
1781 Ga0055528_1022442
1782 Ga0055530_10000521
1783 Ga0055530_10000573
1784 Ga0055530_10001653
1785 Ga0055530_10005644
1786 Ga0055530_10007241
1787 Ga0055530_10014165
1788 Ga0055540_1002206
1789 Ga0055540_1002275
1790 Ga0055540_1005142
1791 Ga0055540_1009867
1792 Ga0055540_1014818
1793 Ga0055531_10000203
1794 Ga0055531_10001002
1795 Ga0055531_10001633
1796 Ga0055531_10002103
1797 Ga0055531_10002282
1798 Ga0055531_10019259
1799 Ga0055543_1003281
1800 Ga0055543_1004625
1801 Ga0055543_1014782
1802 Ga0065165_1003236
1803 Ga0065165_1005102
1804 Ga0065165_1006193
1805 Ga0065165_1006686
1806 Ga0065165_1012578
1807 Ga0065165_1013310
1808 Ga0065165_1019354
1809 Ga0065165_1020392
1810 Ga0065165_1079924
1811 Ga0065714_10015844
1812 Ga0065704_10008951
1813 Ga0065704_10087958
1814 Ga0065707_10314962
1815 Ga0070658_10000618
1816 Ga0070658_10018985
1817 Ga0070658_10338307
1818 Ga0070676_10752436
1819 Ga0070683_100734186
1820 Ga0070670_100000001
1821 Ga0070670_100067774
1822 Ga0070670_100349677
1823 Ga0070670_100400983
1824 Ga0068869_100002440
1825 Ga0070666_10070267
1826 Ga0070666_10131930
1827 Ga0070666_10693550
1828 Ga0070682_100043030
1829 Ga0068868_100057235
1830 Ga0070660_100390345
1831 Ga0070661_100153859
1832 Ga0070692_10594814
1833 Ga0070668_100009520
1834 Ga0070668_100027781
1835 Ga0070669_100001723
1836 Ga0070669_100030628
1837 Ga0070669_100117833
1838 Ga0070671_100000033
1839 Ga0070673_100009989
1840 Ga0070688_100013740
1841 Ga0070659_100782192
1842 Ga0070667_100000405
1843 Ga0070667_100005545
1844 Ga0070667_100031542
1845 Ga0070705_100151872
1846 Ga0070663_100013652
1847 Ga0070663_100244213
1848 Ga0070662_100264302
1849 Ga0070681_10932245
1850 Ga0068867_100146911
1851 Ga0068867_100239521
1852 Ga0070685_10000008
1853 Ga0070706_100471230
1854 Ga0070679_100196348
1855 Ga0070679_100581460
1856 Ga0070684_100848522
1857 Ga0070697_101542758
1858 Ga0068853_100014261
1859 Ga0068853_100024199
1860 Ga0068853_100069849
1861 Ga0070672_100230040
1862 Ga0070695_100835981
1863 Ga0070665_100040876
1864 Ga0070665_100056363
1865 Ga0070665_100058254
1866 Ga0070665_100067417
1867 Ga0070665_100116127
1868 Ga0070665_100426378
1869 Ga0070665_100732490
1870 Ga0068855_100091195
1871 Ga0068855_100122687
1872 Ga0068855_100259174
1873 Ga0068855_100282223
1874 Ga0068857_100085660
1875 Ga0068857_100102866
1876 Ga0068857_100208233
1877 Ga0068854_100167009
1878 Ga0068856_100150515
1879 Ga0068856_100319909
1880 Ga0068856_100424811
1881 Ga0068856_100798145
1882 Ga0068856_100829430
1883 Ga0068852_100014597
1884 Ga0068852_100398478
1885 Ga0068852_100446051
1886 Ga0068852_100754264
1887 Ga0068852_100829153
1888 Ga0068859_100017687
1889 Ga0068859_100082831
1890 Ga0068859_100283618
1891 Ga0068859_101164148
1892 Ga0068864_100000006
1893 Ga0068864_100000115
1894 Ga0068864_100006669
1895 Ga0068864_100088879
1896 Ga0068861_100003645
1897 Ga0068863_100000007
1898 Ga0068863_100003567
1899 Ga0068863_100335206
1900 Ga0068863_100875803
1901 Ga0068858_100000031
1902 Ga0068858_100051365
1903 Ga0068858_100100561
1904 Ga0068858_100496491
1905 Ga0068858_100589477
1906 Ga0068860_100011998
1907 Ga0068860_100059791
1908 Ga0068862_100001252
1909 Ga0068862_100548232
1910 Ga0068862_101392111
1911 Ga0081455_10000120
1912 Ga0075365_10029726
1913 Ga0075365_10147570
1914 Ga0075365_10402541
1915 Ga0075365_10464033
1916 Ga0075365_10555219
1917 Ga0075365_10605116
1918 Ga0075368_10095363
1919 Ga0075363_100113746
1920 Ga0075363_100124324
1921 Ga0075363_100141318
1922 Ga0075364_10009471
1923 Ga0075364_10012251
1924 Ga0075364_10020653
1925 Ga0075364_10023413
1926 Ga0075364_10073663
1927 Ga0075364_10091396
1928 Ga0075364_10122659
1929 Ga0075364_10243189
1930 Ga0075432_10041150
1931 Ga0075432_10049939
1932 Ga0070712_100231585
1933 Ga0070712_100662200
1934 Ga0075362_10001023
1935 Ga0075362_10064819
1936 Ga0075362_10073816
1937 Ga0075362_10209178
1938 Ga0075367_10044775
1939 Ga0075367_10231261
1940 Ga0075369_10005453
1941 Ga0075369_10065285
1942 Ga0075369_10145066
1943 Ga0075369_10213722
1944 Ga0075369_10249194
1945 Ga0075369_10295610
1946 Ga0075366_10029145
1947 Ga0075366_10058452
1948 Ga0075366_10068117
1949 Ga0075366_10151086
1950 Ga0075366_10246500
1951 Ga0075366_10282382
1952 Ga0075370_10001207
1953 Ga0075370_10002536
1954 Ga0075370_10012763
1955 Ga0075370_10080333
1956 Ga0075370_10102645
1957 Ga0068865_101321182
1958 Ga0075436_100027626
1959 Ga0097620_100017687
1960 Ga0097620_100082833
1961 Ga0097620_100283611
1962 Ga0097620_101164280
1963 Ga0099825_1026372
1964 Ga0099824_1005117
1965 Ga0099824_1018892
1966 Ga0079104_1019522
1967 Ga0079104_1043432
1968 Ga0099826_10006923
1969 Ga0105250_10082977
1970 Ga0105240_10005838
1971 Ga0105240_10015532
1972 Ga0105240_10077393
1973 Ga0105240_10182224
1974 Ga0105240_10240781
1975 Ga0105240_10935711
1976 Ga0105245_10032999
1977 Ga0105245_10113604
1978 Ga0105245_10463523
1979 Ga0105245_10568395
1980 Ga0105247_10015539
1981 Ga0105247_10041761
1982 Ga0105247_10061905
1983 Ga0105247_10274072
1984 Ga0105243_10002474
1985 Ga0105243_10132992
1986 Ga0105243_10203573
1987 Ga0105243_10784734
1988 Ga0105241_10025725
1989 Ga0105241_10129757
1990 Ga0105241_10385178
1991 Ga0105241_10487817
1992 Ga0105241_11691295
1993 Ga0105242_11231846
1994 Ga0105248_10004030
1995 Ga0105248_10094337
1996 Ga0105248_10251283
1997 Ga0105248_10807932
1998 Ga0105248_10829931
1999 Ga0105237_10000209
2000 Ga0105237_10018789
2001 Ga0105237_10020513
2002 Ga0105237_10087966
2003 Ga0105237_10199366
2004 Ga0105237_10224458
2005 Ga0105237_10331261
2006 Ga0105237_10487792
2007 Ga0105237_10720675
2008 Ga0105237_10993961
2009 Ga0105238_10004686
2010 Ga0105238_10106327
2011 Ga0105238_10208506
2012 Ga0105238_10812979
2013 Ga0105238_11269759
2014 Ga0105238_11335831
2015 Ga0105238_11746841
2016 Ga0105249_10016332
2017 Ga0105249_10691972
2018 Ga0105239_10019083
2019 Ga0105239_10071618
2020 Ga0105239_10073276
2021 Ga0105239_10111109
2022 Ga0105239_10197116
2023 Ga0105239_10201886
2024 Ga0105239_10483651
2025 Ga0105239_10618586
2026 Ga0105239_10919522
2027 Ga0105239_11681549
2028 Ga0105246_10007753
2029 Ga0105246_10368789
2030 Ga0105246_10371451
2031 Ga0157371_10095472
2032 Ga0157370_10020928
2033 Ga0157370_10029446
2034 Ga0157369_10015433
2035 Ga0157369_10148621
2036 Ga0157369_10297102
2037 Ga0157369_10576202
2038 Ga0157369_10683195
2039 Ga0157374_10221425
2040 Ga0157374_11150605
2041 Ga0157374_12145005
2042 Ga0157378_10192239
2043 Ga0157378_10429305
2044 Ga0157372_10114193
2045 Ga0157372_10149239
2046 Ga0157375_10047270
2047 Ga0163163_10000926
2048 Ga0163163_10082749
2049 Ga0163163_10115692
2050 Ga0157380_10949288
2051 Ga0182008_10012461
2052 Ga0182008_10074251
2053 Ga0182008_10185854
2054 Ga0157377_10265760
2055 Ga0157379_10017367
2056 Ga0157379_10397451
2057 Ga0157379_10641515
2058 Ga0157379_10895684
2059 Ga0163161_10002178
2060 Ga0163161_10090314
2061 Ga0163161_10244232
2062 Ga0214544_1000003
2063 Ga0214542_1000003
2064 Ga0214545_1000004
2065 Ga0214543_1000007
2066 Ga0213872_10000678
2067 Ga0213872_10003050
2068 Ga0213872_10004783
2069 Ga0213872_10006716
2070 Ga0213872_10008898
2071 Ga0213872_10032482
2072 Ga0213872_10089556
2073 Ga0213872_10091688
2074 Ga0213872_10154141
2075 Ga0213874_10315183
2076 Ga0213876_10014677
2077 Ga0213876_10116727
2078 Ga0209672_100326
2079 Ga0209147_101453
2080 Ga0209563_104203
2081 Ga0209258_100154
2082 Ga0207425_1009030
2083 Ga0207425_1027585
2084 Ga0209026_1000013
2085 Ga0209026_1012883
2086 Ga0209677_101412
2087 Ga0209677_118621
2088 Ga0209148_1000078
2089 Ga0209148_1000145
2090 Ga0209148_1000761
2091 Ga0209148_1007279
2092 Ga0209759_1000149
2093 Ga0209129_1000054
2094 Ga0209129_1002251
2095 Ga0209129_1006857
2096 Ga0209233_1000102
2097 Ga0209233_1000947
2098 Ga0209233_1017503
2099 Ga0209565_1000008
2100 Ga0209565_1000067
2101 Ga0209565_1000185
2102 Ga0209565_1005666
2103 Ga0209455_1000194
2104 Ga0209455_1001577
2105 Ga0209455_1004890
2106 Ga0209673_1000097
2107 Ga0209673_1000548
2108 Ga0209673_1002045
2109 Ga0209673_1002338
2110 Ga0209673_1002470
2111 Ga0209130_1000260
2112 Ga0209130_1000441
2113 Ga0209130_1003421
2114 Ga0209675_1000038
2115 Ga0209675_1001284
2116 Ga0209675_1001491
2117 Ga0209675_1013906
2118 Ga0209676_1000103
2119 Ga0209676_1000128
2120 Ga0209676_1000243
2121 Ga0209676_1000791
2122 Ga0209676_1001349
2123 Ga0209676_1042983
2124 Ga0209025_1000185
2125 Ga0209025_1000474
2126 Ga0209025_1016842
2127 Ga0209025_1017217
2128 Ga0209564_1000301
2129 Ga0209564_1000383
2130 Ga0209564_1000629
2131 Ga0209564_1005181
2132 Ga0209564_1021261
2133 Ga0209564_1035300
2134 Ga0209564_1054528
2135 Ga0209758_1000030
2136 Ga0209758_1000034
2137 Ga0209758_1005701
2138 Ga0209758_1011492
2139 Ga0209758_1020188
2140 Ga0209758_1033122
2141 Ga0209758_1033265
2142 Ga0209758_1037103
2143 Ga0209050_1000010
2144 Ga0209050_1000012
2145 Ga0209050_1000244
2146 Ga0209050_1001118
2147 Ga0209050_1001465
2148 Ga0209256_1000009
2149 Ga0209256_1000010
2150 Ga0209256_1000103
2151 Ga0209256_1000165
2152 Ga0209256_1010538
2153 Ga0209256_1014683
2154 Ga0209256_1023169
2155 Ga0207426_1000058
2156 Ga0207426_1000067
2157 Ga0207426_1000867
2158 Ga0207426_1004113
2159 Ga0207426_1011500
2160 Ga0207426_1013645
2161 Ga0207426_1065474
2162 Ga0209051_1000019
2163 Ga0209051_1000603
2164 Ga0209051_1000638
2165 Ga0209051_1001110
2166 Ga0209051_1002726
2167 Ga0209051_1018263
2168 Ga0209051_1044966
2169 Ga0209051_1066054
2170 Ga0209257_1000009
2171 Ga0209257_1000024
2172 Ga0209257_1000057
2173 Ga0209257_1000140
2174 Ga0209257_1003185
2175 Ga0209257_1007671
2176 Ga0209257_1021545
2177 Ga0209257_1042799
2178 Ga0207697_10064476
2179 Ga0207656_10002594
2180 Ga0207656_10223788
2181 Ga0207710_10041186
2182 Ga0207710_10108518
2183 Ga0207710_10128491
2184 Ga0207688_10035473
2185 Ga0207680_10091257
2186 Ga0207680_10386632
2187 Ga0207680_10535179
2188 Ga0207647_10007551
2189 Ga0207647_10008829
2190 Ga0207647_10028609
2191 Ga0207647_10129393
2192 Ga0207643_10042028
2193 Ga0207705_10047855
2194 Ga0207705_10331023
2195 Ga0207705_11096885
2196 Ga0207684_10398643
2197 Ga0207654_10419337
2198 Ga0207695_10000065
2199 Ga0207695_10042830
2200 Ga0207695_10411294
2201 Ga0207671_10000072
2202 Ga0207671_10024760
2203 Ga0207671_10439069
2204 Ga0207671_10872388
2205 Ga0207693_10316976
2206 Ga0207693_10491064
2207 Ga0207663_10502918
2208 Ga0207663_11146613
2209 Ga0207660_10007226
2210 Ga0207649_10261967
2211 Ga0207652_10001316
2212 Ga0207652_10004184
2213 Ga0207652_11368554
2214 Ga0207681_10005483
2215 Ga0207681_10035167
2216 Ga0207694_10043700
2217 Ga0207694_10062913
2218 Ga0207694_10177439
2219 Ga0207694_10341442
2220 Ga0207650_10000002
2221 Ga0207650_10040555
2222 Ga0207650_10216887
2223 Ga0207650_10439127
2224 Ga0207687_10032239
2225 Ga0207687_10095641
2226 Ga0207644_10000176
2227 Ga0207644_11091068
2228 Ga0207706_10275029
2229 Ga0207709_10000491
2230 Ga0207709_10555413
2231 Ga0207709_10812133
2232 Ga0207709_11358718
2233 Ga0207704_10163116
2234 Ga0207665_10072406
2235 Ga0207665_10284959
2236 Ga0207691_10101219
2237 Ga0207691_10256780
2238 Ga0207711_10000366
2239 Ga0207711_10011017
2240 Ga0207711_10100192
2241 Ga0207711_11045822
2242 Ga0207689_10017565
2243 Ga0207689_10133025
2244 Ga0207689_10592096
2245 Ga0207689_10772287
2246 Ga0207661_10984183
2247 Ga0207667_10083293
2248 Ga0207667_10664612
2249 Ga0207667_10815640
2250 Ga0207667_10921850
2251 Ga0207667_11335861
2252 Ga0207651_10175144
2253 Ga0207712_10058704
2254 Ga0207668_11093724
2255 Ga0207640_10027904
2256 Ga0207640_10155381
2257 Ga0207658_10000001
2258 Ga0207658_10018437
2259 Ga0207658_10030655
2260 Ga0207677_10037938
2261 Ga0207703_10000038
2262 Ga0207703_10006584
2263 Ga0207703_10265985
2264 Ga0207703_10311432
2265 Ga0207703_10692361
2266 Ga0207639_10002789
2267 Ga0207639_10042208
2268 Ga0207639_10064609
2269 Ga0207639_10144270
2270 Ga0207639_10252120
2271 Ga0207639_11052625
2272 Ga0207678_10006072
2273 Ga0207678_10075970
2274 Ga0207678_10182977
2275 Ga0207678_10269338
2276 Ga0207702_10273241
2277 Ga0207702_10294050
2278 Ga0207702_10382947
2279 Ga0207702_10591423
2280 Ga0207702_10890844
2281 Ga0207702_11056332
2282 Ga0207641_10000012
2283 Ga0207641_10038578
2284 Ga0207641_10094862
2285 Ga0207641_10295626
2286 Ga0207648_10003010
2287 Ga0207648_10092771
2288 Ga0207676_10000001
2289 Ga0207676_10000610
2290 Ga0207676_10050809
2291 Ga0207674_10001341
2292 Ga0207674_10050312
2293 Ga0207674_10092422
2294 Ga0207674_10152361
2295 Ga0207675_100008719
2296 Ga0207675_100856501
2297 Ga0207675_100922904
2298 Ga0207698_10052977
2299 Ga0207698_10375188
2300 Ga0207698_10575526
2301 Ga0209281_1029587
2302 Ga0209389_1000015
2303 Ga0209389_1000035
2304 Ga0209589_1000039
2305 Ga0209589_1001702
2306 Ga0209489_100084
2307 Ga0209489_102545
2308 Ga0209489_102940
2309 Ga0209700_100034
2310 Ga0209700_102508
2311 Ga0209282_1000929
2312 Ga0209813_10203577
2313 Ga0207428_10348473
2314 Ga0268266_10003368
2315 Ga0268266_10201553
2316 Ga0268266_10252783
2317 Ga0268266_10271585
2318 Ga0268266_10857013
2319 Ga0268266_10878814
2320 Ga0268266_10983406
2321 Ga0268266_11346816
2322 Ga0268265_10000639
2323 Ga0268265_10063708
2324 Ga0268265_10223249
2325 Ga0268265_10868378
2326 Ga0268264_10000004
2327 Ga0268264_10030875
2328 Ga0268264_10263950
2329 Ga0265337_1004460
2330 Ga0265326_10008660
2331 Ga0265319_1002535
2332 Ga0265319_1114219
2333 Ga0265334_10000692
2334 Ga0265318_10005512
2335 Ga0265323_10000487
2336 Ga0265336_10000116
2337 Ga0307517_10242884
2338 Ga0307515_10000306
2339 Ga0307515_10073133
2340 Ga0307515_10091389
2341 Ga0265338_10000094
2342 Ga0265324_10001770
2343 Ga0307512_10077299
2344 Ga0316177_1218212
2345 Ga0316176_1077164
2346 Ga0314311_1119909
2347 Ga0316178_1021912
2348 Ga0316180_1096038
2349 Ga0316183_1023532
2350 Ga0316181_1045265
2351 Ga0316182_1432467
2352 Ga0265330_10070025
2353 Ga0265340_10009477
2354 Ga0265339_10001522
2355 Ga0265339_10202618
2356 Ga0265316_10006562
2357 Ga0307513_10027606
2358 Ga0307513_10112484
2359 Ga0307513_10317575
2360 Ga0307513_10374244
2361 Ga0307509_10156210
2362 Ga0307408_100000030
2363 Ga0307408_100135180
2364 Ga0307408_100247478
2365 Ga0265313_10000181
2366 Ga0265313_10009198
2367 Ga0265313_10014374
2368 Ga0307514_10003152
2369 Ga0265314_10306564
2370 Ga0265342_10100640
2371 Ga0307405_10604158
2372 Ga0307413_10695691
2373 Ga0307406_10498753
2374 Ga0307407_10126408
2375 Ga0307412_10020383
2376 Ga0307412_10031555
2377 Ga0307412_10144525
2378 Ga0307412_10223632
2379 Ga0307412_10265449
2380 Ga0307412_10360592
2381 Ga0307416_100138604
2382 Ga0307416_101393900
2383 Ga0307414_10039618
2384 Ga0307414_10272243
2385 Ga0307414_11074879
2386 Ga0307411_10002074
2387 Ga0307411_10191162
2388 Ga0307411_10744465
2389 Ga0307411_11267663
2390 Ga0307510_10081070
2391 Ga0307510_10123919
2392 Ga0315911_1000042
2393 Ga0373954_0224454
2394 Ga0373955_0442203
2395 Ga0373947_0630710
2396 Ga0373937_1080809
2397 Ga0395899_0000107
2398 Ga0395899_0000264
2399 Ga0395899_0000589
2400 Ga0395899_0000854
2401 Ga0395899_0033456
2402 Ga0395899_0184442
2403 Ga0395899_0267838
2404 Ga0395899_0491720
2405 Ga0395899_0837568
2406 Ga0395900_0000072
2407 Ga0395900_0000101
2408 Ga0395900_0000375
2409 Ga0395900_0000924
2410 Ga0395900_0007118
2411 Ga0395900_0023664
2412 Ga0395900_0038244
2413 Ga0395900_0227712
2414 Ga0395900_0702299
2415 Ga0395900_0835755
2416 Ga0395900_0924838
2417 Ga0395900_1023328
2418 Ga0395900_1378096
2419 Ga0395898_0000043
2420 Ga0395898_0000629
2421 Ga0395898_0027961
2422 Ga0395898_0030665
2423 Ga0395898_0046845
2424 Ga0395898_0093907
2425 Ga0395898_0474518
2426 Ga0395898_0502156
2427 Ga0395898_0585479
2428 Ga0395905_0000101
2429 Ga0395905_0000361
2430 Ga0395905_0000678
2431 Ga0395905_0020944
2432 Ga0395905_0038381
2433 Ga0395905_0048180
2434 Ga0395905_0052161
2435 Ga0395905_0054838
2436 Ga0395905_0066764
2437 Ga0395905_0139686
2438 Ga0395905_0173407
2439 Ga0395905_0521152
2440 Ga0395901_0000052
2441 Ga0395901_0000068
2442 Ga0395901_0000273
2443 Ga0395901_0057959
2444 Ga0395901_0111619
2445 Ga0395901_0264643
2446 Ga0395901_0370830
2447 Ga0395901_0425360
2448 Ga0395901_0460995
2449 Ga0395901_0951562
2450 Ga0436365_0367404
2451 Ga0436365_1284605
2452 Ga0436365_1811392
2453 Ga0436360_0885706
2454 Ga0436361_0092690
2455 Ga0436361_0105866
2456 Ga0436361_0320757
2457 Ga0436361_0325425
2458 Ga0436361_0347304
2459 Ga0436361_0347340
2460 Ga0436361_0428897
2461 Ga0436361_0444413
2462 Ga0436361_0558784
2463 Ga0436361_0585531
2464 Ga0436361_0689358
2465 Ga0436361_0795199
2466 Ga0436361_0871756
2467 Ga0436361_0975940
2468 Ga0436363_0436704
2469 Ga0439436_0005797
2470 Ga0439436_0018111
2471 Ga0439439_0001395
2472 Ga0439439_0078268
2473 Ga0439447_009190
2474 Ga0439461_0000338
2475 Ga0439461_0012958
2476 Ga0439466_0008919
2477 Ga0439466_0054384
2478 Ga0439465_0001362
2479 Ga0439465_0013022
2480 Ga0451793_0484513
2481 Ga0451798_0229046
2482 Ga0451800_0517189
2483 Ga0451802_1574410
2484 Ga0451806_090485
2485 Ga0451806_223475
2486 Ga0451807_1439184
2487 Ga0451833_0019008
2488 Ga0451839_1344540
2489 Ga0451845_0447342
2490 Ga0451843_1695995
2491 Ga0451853_2497818
2492 Ga0451853_3703070
2493 Ga0439431_0001989
2494 Ga0439431_0011302
2495 Ga0439442_002682
2496 Ga0439442_013875
2497 Ga0439445_0000584
2498 Ga0439445_0011308
2499 Ga0439432_000736
2500 Ga0439449_0032811
2501 Ga0439449_0188187
2502 Ga0439452_015478
2503 Ga0439452_016405
2504 Ga0439452_021212
2505 Ga0439457_002395
2506 Ga0439462_0001500
2507 Ga0439462_0004148
2508 Ga0439462_0066352
2509 Ga0450911_000134
2510 Ga0450919_010575
2511 Ga0450921_001010
2512 Ga0450922_011408
2513 Ga0450923_021486
2514 Ga0450888_000272
2515 Ga0450890_003629
2516 Ga0450890_015300
2517 Ga0450891_001401
2518 Ga0450892_000472
2519 Ga0450894_028707
2520 Ga0450898_006086
2521 Ga0450898_007877
2522 Ga0450900_033784
2523 Ga0450889_009467
2524 Ga0450906_008220
2525 Ga0450906_017028
2526 Ga0450910_004640
2527 Ga0439446_0014107
2528 Ga0439446_0031700
2529 Ga0439434_0000210
2530 Ga0439434_0002390
2531 Ga0439434_0013492
2532 Ga0439459_0052398
2533 Ga0450918_000761
2534 Ga0450893_0001075
2535 Ga0450893_0018034
2536 Ga0451577_0003919
2537 Ga0451577_0004095
2538 Ga0466969_0056066
2539 Ga0466972_0006287
2540 Ga0466972_0092644
2541 Ga0466972_0097997
2542 Ga0466972_0124065
2543 Ga0466972_0128525
2544 Ga0466965_0156740
2545 Ga0466966_0009251
2546 Ga0466966_0051238
2547 Ga0466961_0001449
2548 Ga0466961_0629790
2549 Ga0466964_0115308
2550 Ga0466964_0143971
2551 Ga0453684_0178300
2552 Ga0453684_0944967
2553 Ga0466971_0135585
2554 Ga0466968_0003118
2555 Ga0466970_0257622
2556 Ga0466957_0526156
2557 Ga0466957_1052621
2558 Ga0466960_0007309
2559 Ga0466960_0079605
2560 Ga0466960_0119690
2561 Ga0466959_0003192
2562 Ga0466959_0044627
2563 Ga0466958_0008129
2564 Ga0466958_0112405
2565 Ga0466967_0085388
2566 Ga0466967_0553630
2567 Ga0495627_013446
2568 Ga0495592_0054735
2569 Ga0495592_0678325
2570 Ga0495590_0019400
2571 Ga0495629_0008209
2572 Ga0495638_0007506
2573 Ga0495638_0238952
2574 Ga0495651_0017763
2575 Ga0495651_0034392
2576 Ga0495653_0055208
2577 Ga0495605_0057631
2578 Ga0495639_0146697
2579 Ga0495664_0013389
2580 Ga0495664_0038578
2581 Ga0495585_0329478
2582 Ga0495607_0108397
2583 Ga0495583_0000024
2584 Ga0495583_0060284
2585 Ga0495583_0119066
2586 Ga0495606_0056889
2587 Ga0495606_0302832
2588 Ga0495608_0095065
2589 Ga0495616_0077637
2590 Ga0495620_0030296
2591 Ga0495620_0108092
2592 Ga0495628_0037903
2593 Ga0495628_0568165
2594 Ga0495630_0433509
2595 Ga0495630_0707507
2596 Ga0495631_0160163
2597 Ga0495632_0030226
2598 Ga0495632_0272332
2599 Ga0495632_0284786
2600 Ga0495637_0008735
2601 Ga0495637_0100302
2602 Ga0495643_0005950
2603 Ga0495643_0043864
2604 Ga0495643_0110535
2605 Ga0495643_0161471
2606 Ga0495643_0246945
2607 Ga0495648_0001207
2608 Ga0495663_0167630
2609 Ga0495642_0012335
2610 Ga0495652_0030167
2611 Ga0495652_0103323
2612 Ga0495640_0015972
2613 Ga0495640_0027981
2614 Ga0495587_0006868
2615 Ga0495597_0001605
2616 Ga0495597_0012409
2617 Ga0495622_0008216
2618 Ga0495622_0021100
2619 Ga0495633_0000871
2620 Ga0495633_0014709
2621 Ga0495667_0042387
2622 Ga0495668_0024509
2623 Ga0495668_0047976
2624 Ga0495668_0158108
2625 Ga0495668_0283565
2626 Ga0495611_0165996
2627 Ga0495625_0000661
2628 Ga0495625_0051113
2629 Ga0495625_0214547
2630 Ga0495625_0450965
2631 Ga0495635_0010642
2632 Ga0495661_0017236
2633 Ga0495661_0219511
2634 Ga0495588_0015869
2635 Ga0495657_0010266
2636 Ga0495657_0029366
2637 Ga0495599_0031929
2638 Ga0495623_0053661
2639 Ga0495646_0082543
2640 Ga0495669_0256037
2641 Ga0495613_0013192
2642 Ga0495624_0306664
2643 Ga0495670_0000034
2644 Ga0495670_0088845
2645 Ga0495671_0005640
2646 Ga0495671_0035828
2647 Ga0495671_0385169
2648 Ga0495649_0015662
2649 Ga0495649_0038349
2650 Ga0495589_0090942
2651 Ga0495600_0009990
2652 Ga0495660_0037841
2653 Ga0495660_0065627
2654 Ga0495660_0274839
2655 Ga0495581_0094671
2656 Ga0495604_0040795
2657 Ga0495604_0050432
2658 Ga0495674_0022726
2659 Ga0495672_0046228
2660 Ga0495672_0046400
2661 Ga0495676_0037455
2662 Ga0495680_0007641
2663 Ga0495683_0039430
2664 Ga0495683_0049204
2665 Ga0495687_011306
2666 Ga0495687_055523
2667 Ga0495687_084996
2668 Ga0495675_0010586
2669 Ga0495677_0060603
2670 Ga0495673_0047410
2671 Ga0495681_0021947
2672 Ga0495684_0146922
2673 Ga0495686_0027203
2674 Ga0495686_0066061
2675 Ga0495686_0075449
2676 Ga0495686_0205830
2677 Ga0495686_0205984
2678 Ga0495686_0483967
2679 Ga0495593_0027633
2680 Ga0495593_0205615
2681 Ga0495602_0013736
2682 Ga0495614_0085393
2683 Ga0496100_0126311
2684 Ga0496100_0441055
2685 Ga0496101_0005794
2686 Ga0496101_0182361
2687 Ga0496101_0404276
2688 Ga0496102_0040088
2689 Ga0496102_0110237
2690 Ga0496102_0170304
2691 Ga0496102_0289399
2692 Ga0496102_0583486
2693 Ga0496102_0861378
2694 Ga0496102_1071204
2695 Ga0496103_0144459
2696 Ga0496103_0224472
2697 Ga0496104_0034944
2698 Ga0496104_0061336
2699 Ga0496104_0186575
2700 Ga0496104_0492395
2701 Ga0496105_0055861
2702 Ga0496105_0068847
2703 Ga0496106_0008009
2704 Ga0496106_0117954
2705 Ga0496107_0032954
2706 Ga0496107_0033498
2707 Ga0496107_0056811
2708 Ga0496107_0154085
2709 Ga0496108_0446804
2710 Ga0496109_0020128
2711 Ga0496109_0035717
2712 Ga0496109_0079304
2713 Ga0496109_0338989
2714 Ga0496110_0059452
2715 Ga0496111_0138168
2716 Ga0496112_0132215
2717 Ga0496112_0344962
2718 Ga0496113_0076453
2719 Ga0496113_0709227
2720 Ga0496113_0711314
2721 Ga0496114_0026528
2722 Ga0496114_0314262
2723 Ga0496115_0179355
2724 Ga0496115_0182219
2725 Ga0496115_0223528
2726 Ga0496116_0149126
2727 Ga0496117_0051694
2728 Ga0496118_0010190
2729 Ga0496118_0041072
2730 Ga0496118_0154618
2731 Ga0496118_0306668
2732 Ga0496119_0012917
2733 Ga0496119_0078747
2734 Ga0496119_0083482
2735 Ga0496119_0099360
2736 Ga0496119_0154960
2737 Ga0496120_0000435
2738 Ga0496120_0021764
2739 Ga0496120_0033527
2740 Ga0496120_0044804
2741 Ga0496120_0069714
2742 Ga0496120_0217169
2743 Ga0496121_0000091
2744 Ga0496121_0006917
2745 Ga0496121_0015919
2746 Ga0496121_0044637
2747 Ga0496121_0045073
2748 Ga0496121_0113744
2749 Ga0496121_0184812
2750 Ga0496121_0212339
2751 Ga0496121_0297836
2752 Ga0496121_0573820
2753 Ga0496121_0668779
2754 Ga0496122_0035517
2755 Ga0496122_0039013
2756 Ga0496122_0074747
2757 Ga0496122_0142567
2758 Ga0496123_0004305
2759 Ga0496123_0048893
2760 Ga0496124_0028741
2761 Ga0496124_0049080
2762 Ga0496124_0058454
2763 Ga0496124_0191405
2764 Ga0496124_0278167
2765 Ga0496124_0344703
2766 Ga0496124_0365434
2767 Ga0496124_0483987
2768 Ga0496124_0841026
2769 Ga0496125_0000352
2770 Ga0496125_0016745
2771 Ga0496125_0016750
2772 Ga0496125_0044128
2773 Ga0496125_0212638
2774 Ga0496125_0236479
2775 Ga0496126_0007394
2776 Ga0496126_0023157
2777 Ga0496126_0027931
2778 Ga0496126_0059973
2779 Ga0496126_0061639
2780 Ga0496126_0077591
2781 Ga0496126_0107156
2782 Ga0496126_0129166
2783 Ga0496126_0237816
2784 Ga0496126_0266800
2785 Ga0496126_0547400
2786 Ga0496126_0569428
2787 Ga0501310_029544
2788 Ga0501294_007359
2789 Ga0501300_005430
2790 Ga0501031_0129954
2791 Ga0501031_0411918
2792 Ga0501032_0006968
2793 Ga0501032_0023507
2794 Ga0501032_0111332
2795 Ga0501033_0007935
2796 Ga0501033_0048490
2797 Ga0501033_0073442
2798 Ga0501033_0117411
2799 Ga0501033_0170694
2800 Ga0501033_0205263
2801 Ga0501033_0369248
2802 Ga0501033_0578043
2803 Ga0501034_0006155
2804 Ga0501034_0009755
2805 Ga0501034_0025344
2806 Ga0501034_0025864
2807 Ga0501034_0029777
2808 Ga0501034_0076321
2809 Ga0501034_0414000
2810 Ga0501034_0529334
2811 Ga0501034_0690326
2812 Ga0501036_0001698
2813 Ga0501036_0152991
2814 Ga0501036_0188319
2815 Ga0501036_0285367
2816 Ga0501036_0356885
2817 Ga0501037_0021179
2818 Ga0501037_0031114
2819 Ga0501037_0035110
2820 Ga0501037_0115841
2821 Ga0501037_0312295
2822 Ga0501038_0016637
2823 Ga0501038_0018939
2824 Ga0501038_0020329
2825 Ga0501038_0206876
2826 Ga0501038_0317014
2827 Ga0501038_0461937
2828 Ga0501038_0633520
2829 Ga0501039_0152154
2830 Ga0501039_0181004
2831 Ga0501040_0106110
2832 Ga0501042_0061964
2833 Ga0501043_0014288
2834 Ga0501043_0014731
2835 Ga0501043_0146383
2836 Ga0501043_0178804
2837 Ga0501046_0008710
2838 Ga0501046_0840601
2839 Ga0501047_0018727
2840 Ga0501047_0025481
2841 Ga0501047_0062178
2842 Ga0501047_0088364
2843 Ga0501047_0198864
2844 Ga0501047_0199795
2845 Ga0501047_0314389
2846 Ga0501047_0314395
2847 Ga0501047_0376744
2848 Ga0501048_0072858
2849 Ga0501048_0166654
2850 Ga0501048_0376103
2851 Ga0501067_0104061
2852 Ga0501068_0078871
2853 Ga0501068_0255419
2854 Ga0501070_0159115
2855 Ga0501070_0182568
2856 Ga0501070_0233999
2857 Ga0501070_0512275
2858 Ga0501073_0011914
2859 Ga0501073_0042668
2860 Ga0501073_0090090
2861 Ga0501074_0172343
2862 Ga0501074_0187422
2863 Ga0501211_001650
2864 Ga0501217_022639
2865 Ga0501222_012228
2866 Ga0501235_046995
2867 Ga0501249_002521
2868 Ga0501257_000883
2869 Ga0501258_000994
2870 Ga0501259_066400
2871 Ga0501229_002101
2872 Ga0501080_0000625
2873 Ga0501080_0085300
2874 Ga0501080_0110133
2875 Ga0501080_0122796
2876 Ga0501080_0688588
2877 Ga0501083_0023237
2878 Ga0501083_0267834
2879 Ga0501241_031036
2880 Ga0501262_000489
2881 Ga0501267_010271
2882 Ga0501035_0011712
2883 Ga0501035_0077553
2884 Ga0501035_0082194
2885 Ga0501035_0107220
2886 Ga0501035_0130654
2887 Ga0501035_0156326
2888 Ga0501035_0281105
2889 Ga0501035_0319959
2890 Ga0501044_0024139
2891 Ga0501044_0035800
2892 Ga0501044_0037635
2893 Ga0501044_0043203
2894 Ga0501044_0107275
2895 Ga0501044_0183152
2896 Ga0501044_0215536
2897 Ga0501044_0273502
2898 Ga0501044_1092902
2899 Ga0501045_0039912
2900 nmdc:mga03683_11473_c1
2901 nmdc:mga03683_174394_c1
2902 nmdc:mga03683_32994_c1
2903 nmdc:mga03683_65825_c1
2904 nmdc:mga03683_87305_c1
2905 nmdc:mga03n38_11305_c1
2906 nmdc:mga00v17_16100_c1
2907 nmdc:mga00v17_29018_c1
2908 nmdc:mga00v17_37311_c1
2909 nmdc:mga00v17_69892_c1
2910 nmdc:mga00v17_86082_c1
2911 nmdc:mga0yw44_17340_c1
2912 nmdc:mga0yw44_19198_c1
2913 nmdc:mga0yw44_34925_c1
2914 nmdc:mga0yw44_452584_c1
2915 nmdc:mga0k408_10077_c1
2916 nmdc:mga0k408_13160_c3
2917 nmdc:mga0k408_379440_c1
2918 nmdc:mga0k408_41720_c1
2919 nmdc:mga0k408_53718_c2
2920 nmdc:mga06z11_189016_c1
2921 nmdc:mga06z11_88562_c1
2922 nmdc:mga04h51_31440_c1
2923 nmdc:mga07m45_12486_c1
2924 nmdc:mga07m45_1970_c1
2925 nmdc:mga07m45_2447_c1
2926 nmdc:mga07m45_26459_c1
2927 nmdc:mga07m45_36002_c1
2928 nmdc:mga07m45_88246_c1
2929 nmdc:mga08x19_252343_c1
2930 nmdc:mga0sz30_143250_c1
2931 nmdc:mga0sz30_279959_c1
2932 nmdc:mga0sz30_290396_c1
2933 nmdc:mga0sz30_359214_c1
2934 nmdc:mga0sz30_55009_c1
2935 Ga0500610_0097753
2936 Ga0500578_0017074
2937 Ga0500643_000117
2938 Ga0500643_013466
2939 Ga0500643_025299
2940 Ga0500644_0318434
2941 Ga0500646_0081632
2942 Ga0500647_0043082
2943 Ga0500583_0008979
2944 Ga0500583_0013885
2945 Ga0500583_0114636
2946 Ga0500651_0029989
2947 Ga0500566_0000089
2948 Ga0500566_0007716
2949 Ga0500566_0284604
2950 Ga0500566_0365025
2951 Ga0500641_0016651
2952 Ga0500650_0043101
2953 Ga0500650_0121583
2954 Ga0500555_022776
2955 Ga0500556_0110918
2956 Ga0500556_0165983
2957 Ga0500557_000089
2958 Ga0500562_001563
2959 Ga0500562_008747
2960 Ga0500569_001966
2961 Ga0500593_001529
2962 Ga0500594_0023917
2963 Ga0500595_105080
2964 Ga0500597_009365
2965 Ga0500597_087200
2966 Ga0500607_000992
2967 Ga0500607_084049
2968 Ga0500608_000056
2969 Ga0500608_065252
2970 Ga0500617_141819
2971 Ga0500642_0002259
2972 Ga0500642_0010858
2973 Ga0500652_007545
2974 Ga0500652_221352
2975 Ga0500658_0002356
2976 Ga0500658_0023945
2977 Ga0500658_0042641
2978 Ga0500658_0273580
2979 Ga0500559_0000251
2980 Ga0500559_0003661
2981 Ga0500559_0022448
2982 Ga0500559_0025312
2983 Ga0500559_0097098
2984 Ga0500559_0295541
2985 Ga0500564_106654
2986 Ga0500568_0006855
2987 Ga0500568_0010336
2988 Ga0500568_0013851
2989 Ga0500568_0087030
2990 Ga0500568_0131743
2991 Ga0500568_0146741
2992 Ga0500573_0000021
2993 Ga0500577_0002096
2994 Ga0500577_0008824
2995 Ga0500577_0036812
2996 Ga0500604_0128541
2997 Ga0500616_0000011
2998 Ga0500616_0005790
2999 Ga0500616_0034153
3000 Ga0500616_0047942
3001 Ga0500619_036863
3002 Ga0500620_002504
3003 Ga0500622_0006962
3004 Ga0500622_0012884
3005 Ga0500624_000020
3006 Ga0500627_0006872
3007 Ga0500627_0039756
3008 Ga0500633_0192256
3009 Ga0500634_0007272
3010 Ga0500636_0000526
3011 Ga0500637_0000074
3012 Ga0500637_0297756
3013 Ga0500625_027984
3014 Ga0500625_089535
3015 Ga0500645_009627
3016 Ga0500599_007459
3017 Ga0500601_000577
3018 Ga0501084_0777206
3019 Ga0500661_012337
3020 Ga0501082_0012479
3021 Ga0466962_0090141
3022 2507505660
3023 2508539551
3024 2508695918
3025 2509116914
3026 2509146792
3027 2509373192
3028 2509395536
3029 2510317153
3030 2511388512
3031 2511398991
3032 2512035794
3033 2512929030
3034 2512963594
3035 2513589890
3036 2513612450
3037 2513625025
3038 2513640820
3039 2513651805
3040 2513659395
3041 2513673974
3042 2513699782
3043 2513722035
3044 2513860662
3045 2513876888
3046 2513889954
3047 2513919070
3048 2514010297
3049 2514038147
3050 2514423412
3051 2515624057
3052 2517106584
3053 2517888393
3054 2524440101
3055 2524470037
3056 2524535304
3057 2528854419
3058 2588514563
3059 2599104042
3060 2599935920
3061 2617350063
3062 2617374131
3063 2643745642
3064 2643757465
3065 2644126219
3066 2644257709
3067 2644325470
3068 2671124216
3069 2671694043
3070 2688599156
3071 2694633523
3072 2694635227
3073 2723578230
3074 2728747924
3075 2739252154
3076 2745077791
3077 2792460705
3078 2793065960
3079 2793067207
3080 2805922215
3081 2818239289
3082 2824606262
3083 2824616118
3084 2824625514
3085 2824634378
3086 2824641655
3087 2824648940
3088 2824658283
3089 2824669721
3090 2824677072
3091 2824684858
3092 2824693561
3093 2824701794
3094 2824711972
3095 2824718977
3096 2824729180
3097 2824734867
3098 2824748126
3099 2824762575
3100 2824772749
3101 2824780039
3102 2828306905
3103 2838125786
3104 2841913612
3105 2841919359
3106 2841948380
3107 2841952827
3108 2841965657
3109 2841972824
3110 2841977599
3111 2841984840
3112 2842041408
3113 2842049450
3114 2842697195
3115 2842875377
3116 2843747987
3117 2844014334
3118 2844315890
3119 2846957082
3120 2847939884
3121 2847942720
3122 2848863089
3123 2849076714
3124 2849561426
3125 2849574673
3126 2851153574
3127 2856328122
3128 2856329105
3129 2856341982
3130 2856367275
3131 2857354165
3132 2857372330
3133 2857506512
3134 2857515669
3135 2857577080
3136 2869175361
3137 2869238856
3138 2869252227
3139 2869263523
3140 2869268166
3141 2869278022
3142 2869284343
3143 2869287558
3144 2871431082
3145 2871439012
3146 2871452002
3147 2871460132
3148 2871487416
3149 2874110949
3150 2874120890
3151 2874134171
3152 2874139194
3153 2874150354
3154 2874157409
3155 2874164154
3156 2874593220
3157 2874617178
3158 2874621405
3159 2874629207
3160 2874647803
3161 2876369496
3162 2876386004
3163 2876386569
3164 2876403341
3165 2876410088
3166 2876416505
3167 2876422225
3168 2876762869
3169 2876773260
3170 2876820567
3171 2878738329
3172 2878740041
3173 2878747695
3174 2878777805
3175 2878781088
3176 2879076794
3177 2879083557
3178 2879101211
3179 2879128747
3180 2879145534
3181 2881367167
3182 2881668454
3183 2882637507
3184 2885368973
3185 2885380443
3186 2885386348
3187 2885414250
3188 2885431821
3189 2888342394
3190 2888352100
3191 2888379078
3192 2888390253
3193 2888427482
3194 2889014087
3195 2889021204
3196 2894822197
3197 2898329880
3198 2903453084
3199 2903498811
3200 2903515917
3201 2903526902
3202 2903530235
3203 2903731840
3204 2903753289
3205 2903771414
3206 2904668075
3207 2904692277
3208 2904707783
3209 2904718215
3210 2906310096
3211 2906322968
3212 2906361143
3213 2906376926
3214 2906402112
3215 2906414353
3216 2906432697
3217 2906603633
3218 2906614253
3219 2906631759
3220 2906640750
3221 2906646267
3222 2906660868
3223 2908746919
3224 2908758915
3225 2908776605
3226 2909048404
3227 2919454171
3228 2922137046
3229 2922153766
3230 2922173096
3231 2922187442
3232 2922400369
3233 2922426076
3234 2924714882
3235 2924723335
3236 2924734661
3237 2924743177
3238 2924752112
3239 2924777640
3240 2928027414
3241 2928525836
3242 2928974752
3243 2929205260
3244 2929619039
3245 2929631116
3246 2932789081
3247 2932800186
3248 2932808231
3249 2932814282
3250 2932820408
3251 2932834330
3252 2933580251
3253 2935614714
3254 2935620015
3255 2935632488
3256 2935640334
3257 2935649101
3258 2935658127
3259 2935673379
3260 2935683860
3261 2935686829
3262 2935702125
3263 2935710535
3264 2935716517
3265 2935723358
3266 2935734914
3267 2935744295
3268 2935752795
3269 2935764657
3270 2935774707
3271 2935785071
3272 2935789778
3273 2935797854
3274 2935806232
3275 2935818088
3276 2935826246
3277 2935837149
3278 2935841330
3279 2935853742
3280 2935858901
3281 2935864082
3282 2935875604
3283 2935883335
3284 2935910964
3285 2935924125
3286 2935932822
3287 2935937385
3288 2935949414
3289 2935958187
3290 2935964115
3291 2935971158
3292 2935982250
3293 2935985385
3294 2935995452
3295 2936007875
3296 2936012346
3297 2936020573
3298 2936029639
3299 2936044698
3300 2936051896
3301 2936056848
3302 2937815382
3303 2937851435
3304 2937864224
3305 2937873166
3306 2937883859
3307 2937976609
3308 2937988302
3309 2938021085
3310 2939634624
3311 2940558708
3312 2941508848
3313 2941516678
3314 2941524306
3315 2941535738
3316 2941543557
3317 2945910195
3318 2945987779
3319 2954012075
3320 2958038440
3321 2958044405
3322 2958056051
3323 2958069727
3324 2958091137
3325 2958096218
3326 2958101107
3327 2958108939
3328 2958128360
3329 2958131960
3330 2958140723
3331 2958147463
3332 2958164571
3333 2958176565
3334 2958181763
3335 2961079607
3336 2961186779
3337 2963650204
3338 2965029258
3339 2965045694
3340 2965049861
3341 2965091103
3342 2965120743
3343 2968021255
3344 2968086450
3345 2968120278
3346 2968142146
3347 2970476360
3348 2970489805
3349 2970517928
3350 2970535661
3351 2970551916
3352 2970598958
3353 2970626861
3354 2970629714
3355 2977242208
3356 2977846610
3357 2977853988
3358 2977879525
3359 2977905473
3360 2977909957
3361 2977923266
3362 2977937541
3363 2977949683
3364 2977953996
3365 2977961982
3366 2977976353
3367 2977986694
3368 2979711000
3369 2979748443
3370 2979771851
3371 2979776784
3372 2979798507
3373 2984558284
3374 2984567336
3375 2987642425
3376 2987647290
3377 2987657142
3378 2987677044
3379 2993358402
3380 2995951874
3381 2996356438
3382 2996388306
3383 3002145572
3384 3003666512
3385 3004196980
3386 3004210507
3387 3004213443
3388 3004221270
3389 3004238468
3390 3004253002
3391 3004269813
3392 3004282743
3393 3004338463
3394 3005483464
3395 3005488914
3396 3005506327
3397 3005592698
3398 3005595477
3399 3005711443
3400 3005718705
3401 637078749
3402 649873586
3403 8001846245
3404 8003405184
3405 8004302192
3406 8004367523
3407 8004390294
3408 8004642299
3409 8004699137
3410 8004716358
3411 8004732201
3412 8006932029
3413 8006936774
3414 8006976745
3415 8016517719
3416 8016525772
3417 8016539372
3418 8016543662
3419 8016549634
3420 8016558052
3421 8016569067
3422 8016581701
3423 8016585876
3424 8016596063
3425 8016606949
3426 8016618855
3427 8016622688
3428 8016635186
3429 8017058909
3430 8019530651
3431 8019540935
3432 8019549684
3433 8019561914
3434 8019571987
3435 8019576741
3436 8019594794
3437 8019606943
3438 8019611564
3439 8019623407
3440 8019638733
3441 8019640932
3442 8019653021
3443 8019666534
3444 8019676232
3445 8019679753
3446 8019695748
3447 8054007968
3448 8054568787
3449 8055742888
3450 8055913433
3451 8056683150
3452 8056970808

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

29

138

0.98

PF02954

HTH_8

Bacterial regulatory protein, Fis family

155

195

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4l5e-assembly1.cif.gz_A-2 crystal structure of a. aeolicus ntrc1 dna binding domain 0.9773 137 180
5ds9-assembly1.cif.gz_A crystal structure of fis bound to 27bp dna f1-8a (aaattagtttgaattttgagctaattt) 0.9435 141 177
2qzj-assembly5.cif.gz_E crystal structure of a two-component response regulator from clostridium difficile 0.9305 9 118
1f36-assembly1.cif.gz_B the crystal structure of fis mutant k36e reveals that the transactivation region of the fis protein contains extended mobile beta-hairpin arms 0.9302 139 177
1etq-assembly2.cif.gz_D the crystal structure of e. coli fis mutant r71y 0.9281 139 177
ID Description Score Start End Superfamily
4l5eA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9772 137 180 1.10.10.60
3rqiA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.952 8 122 3.40.50.2300
3jriB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.935 139 177 1.10.10.60
5e3oA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9315 139 177 1.10.10.60
1f36B00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9302 139 177 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A519L8J2-F1-model_v4 Response regulator 0.9778 9 124 GO:0000160
AF-A0A1G0NHW1-F1-model_v4 Two-component system response regulator 0.9634 10 122 GO:0000160
AF-A0A7C3E8B7-F1-model_v4 Response regulator 0.9598 9 122 GO:0000160
AF-A0A2H0LHK0-F1-model_v4 Type II secretion system protein GspE 0.9463 9 119 GO:0000160
GO:0005524
GO:0005886
GO:0016887
AF-A0A0F9BAK8-F1-model_v4 Response regulatory domain-containing protein 0.9462 9 118 GO:0000160

Map