F495494
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1727 | 955 | 3452 | 175 |
Family's Representative Sequence
| Representative Sequence | 3300049569|Ga0501032_0018503|Ga0501032_0018503_663_1262 |
| Length | 199 |
| Sequence | METSMTPDGSATGSDVPGTGRSTGAGRSLVVVEDDATFARTLKRSFEKRGYQVVLCPDGDELVAALETVAPDYAVVDLKLGTGSGLECVKLLAARDPDMRIVVLTGFASIATAVEAIKLGACHYLAKPANTDDIETAFGRAEGDVSVPLSSRPTSIKNLEWERIHETLVETGFNISETARRLGLHRRTLARKLEKRVVK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 2 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 3 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 4 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 5 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 6 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 7 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 8 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 9 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 10 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 11 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 12 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 13 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 14 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 15 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 16 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 17 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 18 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 19 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 20 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 21 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 22 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 23 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 24 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 25 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 26 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 27 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 28 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 29 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 30 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 31 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 32 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 33 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 34 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 35 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 36 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 37 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 38 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 43 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 46 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 54 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 60 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 61 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 64 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 67 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 71 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 72 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 73 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 74 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 75 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 76 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 77 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 78 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 79 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 80 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 81 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 82 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 83 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 84 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 85 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 86 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 87 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 88 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 89 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 90 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 91 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 92 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 93 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 94 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 95 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 96 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 98 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 99 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 100 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 101 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 124 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 128 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 129 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 130 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 131 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 132 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 133 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 134 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 139 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 140 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 143 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 144 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 146 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 148 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 150 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 153 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 156 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 207 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 208 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 209 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 210 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 211 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 212 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 213 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 214 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 218 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 219 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 220 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 221 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 222 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 223 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 224 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 225 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 226 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 227 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 228 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 229 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 230 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 231 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 232 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 233 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 234 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 235 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 236 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 237 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 238 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 239 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 240 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 241 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 242 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 243 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 244 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 245 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 246 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 247 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 248 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 249 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 250 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 251 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 252 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 253 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 254 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 255 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 256 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 257 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 258 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 259 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 260 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 261 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 262 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 263 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 264 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 265 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 266 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 267 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 268 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 269 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 270 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 271 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 272 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 273 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 274 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 275 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 276 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 277 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 278 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 279 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 280 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 281 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 282 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 283 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 284 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 285 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 286 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 287 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 288 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 289 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 290 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 291 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 292 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 293 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 294 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 295 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 296 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 297 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 298 | 3300042123 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 | Metagenome | Rhizosphere |
| 299 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 300 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 301 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 302 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 303 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 304 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 305 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 306 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 307 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 308 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 309 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 310 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 311 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 312 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 313 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 314 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 315 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 316 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 317 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 318 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 319 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 320 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 321 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 322 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 323 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 324 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 325 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 326 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 327 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 328 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 329 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 330 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 331 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 332 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 402 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 403 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 404 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 405 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 406 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 407 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 408 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 409 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 410 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 411 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 412 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 413 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 414 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 415 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 416 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 417 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 418 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 419 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 420 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 421 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 422 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 423 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 424 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 425 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 426 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 427 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 428 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 429 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 430 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 431 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 432 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 433 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 434 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 435 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 436 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 437 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 438 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 439 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 440 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 441 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 442 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 443 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 444 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 445 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 446 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 447 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 448 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 449 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 450 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 451 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 452 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 453 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 454 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 455 | 3300049687 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought | Metagenome | Rhizosphere |
| 456 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 457 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 458 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 459 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 460 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 461 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 462 | 3300049764 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control | Metagenome | Rhizosphere |
| 463 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 464 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 465 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 466 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 467 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 468 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 469 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 470 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 471 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 472 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 473 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 474 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 475 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 476 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 477 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 478 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 479 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 480 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 481 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 482 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 483 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 484 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 485 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 486 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 487 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 488 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 489 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 490 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 491 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 492 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 493 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 494 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 495 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 496 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 497 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 498 | 3300053124 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere | Metagenome | Endosphere |
| 499 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 500 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 501 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 502 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 503 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 504 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 505 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 506 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 507 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 508 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 509 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 510 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 511 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 512 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 513 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 514 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 515 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 516 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 517 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 518 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 519 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 520 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 521 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 522 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 523 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 524 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 525 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 526 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 527 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 528 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 529 | 2508501123 | Mesorhizobium sp. WSM3626 | Isolate | Nodule |
| 530 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 531 | 2509276018 | Mesorhizobium ciceri CMG6 | Isolate | Nodule |
| 532 | 2509276022 | Mesorhizobium australicum WSM2073 | Isolate | Nodule |
| 533 | 2510065059 | Mesorhizobium ciceri WSM4083 | Isolate | Nodule |
| 534 | 2511231027 | Phyllobacterium sp. YR531 | Isolate | Rhizosphere |
| 535 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 536 | 2511231221 | Azospirillum lipoferum 4B | Isolate | Rhizosphere |
| 537 | 2512875016 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 538 | 2512875024 | |||
| 539 | 2513237087 | Azorhizobium doebereinerae UFLA1-100 | Isolate | Nodule |
| 540 | 2513237090 | Mesorhizobium sp. WSM3224 | Isolate | Nodule |
| 541 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 542 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 543 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 544 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 545 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 546 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 547 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 548 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 549 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 550 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 551 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 552 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 553 | 2513237164 | Mesorhizobium loti CJ3sym | Isolate | Nodule |
| 554 | 2513237305 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 555 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 556 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 557 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 558 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 559 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 560 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 561 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 562 | 2588253730 | Mesorhizobium huakuii 7653R | Isolate | Rhizosphere |
| 563 | 2597490356 | Azospirillum brasilense sp7 | Isolate | Unclassified |
| 564 | 2599185301 | Mesorhizobium sp. NFR06 | Isolate | Rhizoplane |
| 565 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 566 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 567 | 2643221544 | Pelomonas sp. Root1444 | Isolate | Unclassified |
| 568 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 569 | 2643221622 | Sphingomonas sp. Root241 | Isolate | Unclassified |
| 570 | 2643221646 | Pelomonas sp. Root1237 | Isolate | Unclassified |
| 571 | 2643221658 | Variovorax sp. Root411 | Isolate | Unclassified |
| 572 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 573 | 2671180139 | Chelativorans sp. A52C2 | Isolate | Unclassified |
| 574 | 2687453392 | Mesorhizobium ciceri biserrulae WSM1284 | Isolate | Unclassified |
| 575 | 2693429783 | Mesorhizobium sp. LCM 4577 | Isolate | Rhizosphere |
| 576 | 2693429784 | Mesorhizobium sp. LCM 4576 | Isolate | Rhizosphere |
| 577 | 2721755686 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 578 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 579 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 580 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 581 | 2791355048 | Caulobacter flavus CGMCC1 15093 | Isolate | Rhizosphere |
| 582 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 583 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 584 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 585 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 586 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 587 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 588 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 589 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 590 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 591 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 592 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 593 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 594 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 595 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 596 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 597 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 598 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 599 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 600 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 601 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 602 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 603 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 604 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 605 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 606 | 2828305725 | Xanthobacter tagetidis DSM 11105 | Isolate | Unclassified |
| 607 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 608 | 2841911363 | Bosea caraganae RCAM04685 | Isolate | Nodule |
| 609 | 2841917233 | Bosea caraganae RCAM04680 | Isolate | Nodule |
| 610 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 611 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 612 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 613 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 614 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 615 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 616 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 617 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 618 | 2842694124 | Methylopila sp. R-72369 | Isolate | Unclassified |
| 619 | 2842871566 | Phyllobacterium sp. R-73111 | Isolate | Unclassified |
| 620 | 2843744320 | Caulobacter flavus RHGG3 | Isolate | Unclassified |
| 621 | 2844009547 | Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 | Isolate | Nodule |
| 622 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 623 | 2846952575 | Azospirillum brasilense sp7 | Isolate | Unclassified |
| 624 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 625 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 626 | 2848858292 | Azospirillum brasilense Az39 | Isolate | Unclassified |
| 627 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 628 | 2849560528 | Caulobacter zeae 410 | Isolate | Unclassified |
| 629 | 2849573788 | Caulobacter endophyticus 774 | Isolate | Unclassified |
| 630 | 2851153111 | Caulobacter radicis 736 | Isolate | Unclassified |
| 631 | 2856320880 | Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 | Isolate | Nodule |
| 632 | 2856328259 | Mesorhizobium sp. Primo-B | Isolate | Nodule |
| 633 | 2856334872 | Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 | Isolate | Nodule |
| 634 | 2856364286 | Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 | Isolate | Nodule |
| 635 | 2857349434 | Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 | Isolate | Nodule |
| 636 | 2857367948 | Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 | Isolate | Nodule |
| 637 | 2857504554 | Caulobacter sp. R-72291 | Isolate | Unclassified |
| 638 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 639 | 2857576091 | Pigmentiphaga sp. R-72090 | Isolate | Unclassified |
| 640 | 2869169390 | Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 | Isolate | Nodule |
| 641 | 2869234852 | Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 | Isolate | Nodule |
| 642 | 2869249662 | Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 | Isolate | Nodule |
| 643 | 2869256925 | Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 | Isolate | Nodule |
| 644 | 2869264136 | Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 | Isolate | Nodule |
| 645 | 2869271264 | Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 | Isolate | Nodule |
| 646 | 2869278585 | Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 | Isolate | Nodule |
| 647 | 2869285874 | Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 | Isolate | Nodule |
| 648 | 2871429161 | Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 | Isolate | Nodule |
| 649 | 2871435913 | Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 | Isolate | Nodule |
| 650 | 2871451962 | Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 | Isolate | Nodule |
| 651 | 2871459585 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 | Isolate | Nodule |
| 652 | 2871481445 | Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 | Isolate | Nodule |
| 653 | 2874109183 | Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 | Isolate | Nodule |
| 654 | 2874116593 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 | Isolate | Nodule |
| 655 | 2874131515 | Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 | Isolate | Nodule |
| 656 | 2874139085 | Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 | Isolate | Nodule |
| 657 | 2874146452 | Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 | Isolate | Nodule |
| 658 | 2874155637 | Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 | Isolate | Nodule |
| 659 | 2874162495 | Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 | Isolate | Nodule |
| 660 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 661 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 662 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 663 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 664 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 665 | 2876363079 | Mesorhizobium loti R7ANS::ICEMlSym2042 | Isolate | Nodule |
| 666 | 2876377896 | Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 | Isolate | Nodule |
| 667 | 2876386047 | Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 | Isolate | Nodule |
| 668 | 2876399893 | Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 | Isolate | Nodule |
| 669 | 2876406927 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 | Isolate | Nodule |
| 670 | 2876413966 | Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 | Isolate | Nodule |
| 671 | 2876420981 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 | Isolate | Nodule |
| 672 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 673 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 674 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 675 | 2878730984 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 | Isolate | Nodule |
| 676 | 2878738818 | Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 | Isolate | Nodule |
| 677 | 2878745973 | Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 | Isolate | Nodule |
| 678 | 2878774303 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 | Isolate | Nodule |
| 679 | 2878781027 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 | Isolate | Nodule |
| 680 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 681 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 682 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 683 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 684 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 685 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 686 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 687 | 2882632389 | Mesorhizobium waimense ICMP19557 | Isolate | Unclassified |
| 688 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 689 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 690 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 691 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 692 | 2885429604 | Sphingomonas sp. WZY 27 | Isolate | Rhizosphere |
| 693 | 2888337043 | Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 | Isolate | Nodule |
| 694 | 2888350351 | Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 | Isolate | Nodule |
| 695 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 696 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 697 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 698 | 2889010040 | Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 | Isolate | Nodule |
| 699 | 2889016732 | Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 | Isolate | Nodule |
| 700 | 2894817345 | Aureimonas psammosilenae YIM DR1026 | Isolate | Unclassified |
| 701 | 2898329390 | Caulobacter sp. 602-2 | Isolate | Rhizosphere |
| 702 | 2903448605 | Mesorhizobium japonicum Opo-235 | Isolate | Nodule |
| 703 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 704 | 2903513507 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 | Isolate | Nodule |
| 705 | 2903521522 | Mesorhizobium loti R7ANS::ICEMlSym2014 | Isolate | Nodule |
| 706 | 2903528002 | Mesorhizobium loti R7ANS::ICEMlSym2037 | Isolate | Nodule |
| 707 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 708 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 709 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 710 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 711 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 712 | 2904699407 | |||
| 713 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 714 | 2906308376 | Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 | Isolate | Nodule |
| 715 | 2906321335 | Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 | Isolate | Nodule |
| 716 | 2906354277 | Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 | Isolate | Nodule |
| 717 | 2906370794 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 | Isolate | Nodule |
| 718 | 2906401398 | Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 | Isolate | Nodule |
| 719 | 2906408224 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 | Isolate | Nodule |
| 720 | 2906427513 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 | Isolate | Nodule |
| 721 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 722 | 2906610324 | |||
| 723 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 724 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 725 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 726 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 727 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 728 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 729 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 730 | 2909042592 | Labrys sp. LIt4 | Isolate | Nodule |
| 731 | 2919450847 | Ancylobacter sp. 3268 | Isolate | Rhizosphere |
| 732 | 2922130491 | Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 | Isolate | Nodule |
| 733 | 2922151315 | Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 | Isolate | Nodule |
| 734 | 2922172374 | Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 | Isolate | Nodule |
| 735 | 2922185730 | Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 | Isolate | Nodule |
| 736 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 737 | 2922425934 | |||
| 738 | 2924710171 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 | Isolate | Nodule |
| 739 | 2924718760 | Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 | Isolate | Nodule |
| 740 | 2924733363 | Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 | Isolate | Nodule |
| 741 | 2924741084 | Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 | Isolate | Nodule |
| 742 | 2924748358 | Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 | Isolate | Nodule |
| 743 | 2924776078 | Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 | Isolate | Nodule |
| 744 | 2928027323 | Sphingomonas sp. 1185 | Isolate | Unclassified |
| 745 | 2928521798 | Phyllobacterium ifriqiyense 1451 | Isolate | Rhizosphere |
| 746 | 2928972540 | Brevundimonas sp. 1080 | Isolate | Rhizosphere |
| 747 | 2929199973 | Roseomonas sp. R-73070 Hybrid assembly | Isolate | Unclassified |
| 748 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 749 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 750 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 751 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 752 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 753 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 754 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 755 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 756 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 757 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 758 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 759 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 760 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 761 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 762 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 763 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 764 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 765 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 766 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 767 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 768 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 769 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 770 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 771 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 772 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 773 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 774 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 775 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 776 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 777 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 778 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 779 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 780 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 781 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 782 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 783 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 784 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 785 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 786 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 787 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 788 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 789 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 790 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 791 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 792 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 793 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 794 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 795 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 796 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 797 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 798 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 799 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 800 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 801 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 802 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 803 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 804 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 805 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 806 | 2937813078 | Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 | Isolate | Nodule |
| 807 | 2937848649 | Mesorhizobium sp. WSM4310 | Isolate | Unclassified |
| 808 | 2937861824 | Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 | Isolate | Nodule |
| 809 | 2937868953 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 | Isolate | Nodule |
| 810 | 2937877337 | Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 | Isolate | Nodule |
| 811 | 2937972304 | Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 | Isolate | Nodule |
| 812 | 2937980651 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 | Isolate | Nodule |
| 813 | 2938014810 | Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 | Isolate | Nodule |
| 814 | 2939631187 | Ottowia thiooxydans 2709 | Isolate | Rhizosphere |
| 815 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 816 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 817 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 818 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 819 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 820 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 821 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 822 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 823 | 2954011201 | Phyllobacterium ifrigiyense W4I11 | Isolate | Rhizosphere |
| 824 | 2958034702 | Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 | Isolate | Nodule |
| 825 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 826 | 2958064165 | Mesorhizobium sp. SARCC-RB16n | Isolate | Unclassified |
| 827 | 2958084443 | Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 | Isolate | Nodule |
| 828 | 2958092219 | Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 | Isolate | Nodule |
| 829 | 2958100919 | Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 | Isolate | Nodule |
| 830 | 2958108152 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 | Isolate | Nodule |
| 831 | 2958122699 | Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 | Isolate | Nodule |
| 832 | 2958130278 | Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 | Isolate | Nodule |
| 833 | 2958137437 | Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 | Isolate | Nodule |
| 834 | 2958144490 | Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 | Isolate | Nodule |
| 835 | 2958158011 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 | Isolate | Nodule |
| 836 | 2958172287 | Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 | Isolate | Nodule |
| 837 | 2958179912 | Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 | Isolate | Nodule |
| 838 | 2961077736 | Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 | Isolate | Nodule |
| 839 | 2961183825 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 | Isolate | Nodule |
| 840 | 2963644680 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 841 | 2965025482 | Mesorhizobium sp. Primo-A | Isolate | Nodule |
| 842 | 2965040258 | Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 | Isolate | Nodule |
| 843 | 2965047637 | Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 | Isolate | Nodule |
| 844 | 2965089291 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 | Isolate | Nodule |
| 845 | 2965119406 | Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 | Isolate | Nodule |
| 846 | 2968016561 | Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 | Isolate | Nodule |
| 847 | 2968083720 | Mesorhizobium erdmanii Opo-242 | Isolate | Unclassified |
| 848 | 2968117919 | Mesorhizobium atlanticum CNPSo 3140 | Isolate | Unclassified |
| 849 | 2968138860 | Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 | Isolate | Nodule |
| 850 | 2970469710 | Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 | Isolate | Nodule |
| 851 | 2970489779 | Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 | Isolate | Nodule |
| 852 | 2970510686 | Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 | Isolate | Nodule |
| 853 | 2970532167 | Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 | Isolate | Nodule |
| 854 | 2970547951 | Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 | Isolate | Nodule |
| 855 | 2970593180 | Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 | Isolate | Nodule |
| 856 | 2970619444 | Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 | Isolate | Nodule |
| 857 | 2970627176 | Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 | Isolate | Nodule |
| 858 | 2977240413 | Brevundimonas vesicularis SORGH_AS 431 | Isolate | Unclassified |
| 859 | 2977843712 | Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 | Isolate | Nodule |
| 860 | 2977851361 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 | Isolate | Nodule |
| 861 | 2977872689 | Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 | Isolate | Nodule |
| 862 | 2977898635 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 | Isolate | Nodule |
| 863 | 2977907340 | Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 | Isolate | Nodule |
| 864 | 2977922695 | Mesorhizobium sp. WSM4305 | Isolate | Unclassified |
| 865 | 2977935797 | Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 | Isolate | Nodule |
| 866 | 2977942078 | Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 | Isolate | Nodule |
| 867 | 2977950692 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 | Isolate | Nodule |
| 868 | 2977957713 | Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 | Isolate | Nodule |
| 869 | 2977971508 | Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 | Isolate | Nodule |
| 870 | 2977986579 | Mesorhizobium intechi BD68 | Isolate | Unclassified |
| 871 | 2979710463 | Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 | Isolate | Nodule |
| 872 | 2979742915 | Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 | Isolate | Nodule |
| 873 | 2979764755 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 | Isolate | Nodule |
| 874 | 2979772303 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 | Isolate | Nodule |
| 875 | 2979793036 | Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 | Isolate | Nodule |
| 876 | 2984555340 | Sphingomonas sp. SORGH_AS789 | Isolate | Aerial Root |
| 877 | 2984564862 | Sphingomonas sp. SORGH_AS870 | Isolate | Aerial Root |
| 878 | 2987636660 | Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 | Isolate | Nodule |
| 879 | 2987645492 | Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 | Isolate | Nodule |
| 880 | 2987652177 | Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 | Isolate | Nodule |
| 881 | 2987673487 | Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 | Isolate | Nodule |
| 882 | 2993356040 | Sphingomonas sp. SORGH_AS742 | Isolate | Aerial Root |
| 883 | 2995948881 | Lysobacter enzymogenes B25 | Isolate | Unclassified |
| 884 | 2996348954 | Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 | Isolate | Nodule |
| 885 | 2996386984 | Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 | Isolate | Nodule |
| 886 | 3002141150 | Phyllobacterium sp. 628 | Isolate | Unclassified |
| 887 | 3003665799 | Methylobacterium aquaticum BG2 | Isolate | Unclassified |
| 888 | 3004195979 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 | Isolate | Nodule |
| 889 | 3004203850 | Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 | Isolate | Nodule |
| 890 | 3004211236 | Mesorhizobium sp. WSM4307 | Isolate | Unclassified |
| 891 | 3004218560 | Mesorhizobium sp. WSM4315 | Isolate | Unclassified |
| 892 | 3004232784 | Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 | Isolate | Nodule |
| 893 | 3004248173 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 | Isolate | Nodule |
| 894 | 3004268573 | Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 | Isolate | Nodule |
| 895 | 3004275668 | Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 | Isolate | Nodule |
| 896 | 3004334049 | Mesorhizobium huakuii 583 | Isolate | Unclassified |
| 897 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 898 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 899 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 900 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 901 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 902 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 903 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 904 | 637000159 | Mesorhizobium japonicum MAFF 303099 | Isolate | Unclassified |
| 905 | 649633066 | Mesorhizobium ciceri bv. biserrulae WSM1271 | Isolate | Nodule |
| 906 | 8001845381 | Ancylobacter sonchi VKM B-3145 | Isolate | Unclassified |
| 907 | 8003400568 | Cupriavidus gilardii USM5 | Isolate | Rhizosphere |
| 908 | 8004300914 | Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 | Isolate | Nodule |
| 909 | 8004361976 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 | Isolate | Nodule |
| 910 | 8004387939 | Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 | Isolate | Nodule |
| 911 | 8004640170 | Mesorhizobium sp. GbtcB19 | Isolate | Unclassified |
| 912 | 8004695233 | Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 | Isolate | Nodule |
| 913 | 8004714634 | Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 | Isolate | Nodule |
| 914 | 8004727605 | Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 | Isolate | Nodule |
| 915 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 916 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 917 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 918 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 919 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 920 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 921 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 922 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 923 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 924 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 925 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 926 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 927 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 928 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 929 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 930 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 931 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 932 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 933 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 934 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 935 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 936 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 937 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 938 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 939 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 940 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 941 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 942 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 943 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 944 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 945 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 946 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 947 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 948 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 949 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 950 | 8054002106 | Azospirillum lipoferum 59b | Isolate | Unclassified |
| 951 | 8054563764 | Acuticoccus kalidii M5D2P5 | Isolate | Unclassified |
| 952 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 953 | 8055909800 | Plastoroseomonas hellenica LMG 31523 | Isolate | Unclassified |
| 954 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 955 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 75 |
| Metatranscriptomes | 0.17 |
| Isolates | 24.83 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.17 |
| Bulb | 0 |
| Endosphere | 18.99 |
| Nodule | 19.22 |
| Rhizoplane | 3.01 |
| Rhizosphere | 47.08 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501032_0018503 | 3300049569 | Bacteria | 4879 |
| 2 | JGI24739J22299_10011391 | 3300001989 | Bacteria | 3284 |
| 3 | JGI24739J22299_10096872 | 3300001989 | Bacteria | 893 |
| 4 | JGI24735J21928_10015613 | 3300002067 | Bacteria | 2367 |
| 5 | JGI25156J39149_1004519 | 3300002705 | Bacteria | 4221 |
| 6 | JGI25156J39149_1007573 | 3300002705 | Bacteria | 2831 |
| 7 | JGI25158J39367_1025012 | 3300002739 | Bacteria | 704 |
| 8 | JGI25157J39369_1003669 | 3300002741 | Bacteria | 3041 |
| 9 | JGI25152J39213_1003099 | 3300002773 | Bacteria | 5813 |
| 10 | JGI25150J39212_1001285 | 3300002774 | Bacteria | 7177 |
| 11 | JGI25159J45721_1010897 | 3300002987 | Bacteria | 2272 |
| 12 | JGI25151J46595_10038236 | 3300003187 | Bacteria | 1789 |
| 13 | JGI25151J46595_10112289 | 3300003187 | Bacteria | 710 |
| 14 | JGI25165J46597_1000037 | 3300003214 | Bacteria | 285722 |
| 15 | JGI25153J46596_10008033 | 3300003215 | Bacteria | 5101 |
| 16 | JGI25153J46596_10010518 | 3300003215 | Bacteria | 4178 |
| 17 | JGI25153J46596_10021879 | 3300003215 | Bacteria | 2373 |
| 18 | JGI25153J46596_10023921 | 3300003215 | Bacteria | 2213 |
| 19 | rootH1_10006378 | 3300003316 | Bacteria | 14178 |
| 20 | rootH2_10033453 | 3300003320 | Bacteria | 3898 |
| 21 | rootL2_10024654 | 3300003322 | Bacteria | 13699 |
| 22 | rootL2_10077388 | 3300003322 | Bacteria | 2144 |
| 23 | rootH1_10220232 | 3300003323 | Bacteria | 1255 |
| 24 | JGI25160J50197_1001756 | 3300003354 | Bacteria | 10513 |
| 25 | JGI25160J50197_1008048 | 3300003354 | Bacteria | 4053 |
| 26 | JGI25160J50197_1012962 | 3300003354 | Bacteria | 2863 |
| 27 | JGI25160J50197_1017478 | 3300003354 | Bacteria | 2269 |
| 28 | JGI25161J50226_1009749 | 3300003374 | Bacteria | 1338 |
| 29 | JGI25161J50226_1010515 | 3300003374 | Bacteria | 1229 |
| 30 | JGI25161J50226_1015223 | 3300003374 | Bacteria | 843 |
| 31 | Ga0006562J51391_1106834 | 3300003578 | Bacteria | 2180 |
| 32 | Ga0006562J51391_1106835 | 3300003578 | Bacteria | 1610 |
| 33 | Ga0055532_1007168 | 3300003758 | Bacteria | 1450 |
| 34 | Ga0055535_1000128 | 3300003761 | Bacteria | 80324 |
| 35 | Ga0055542_1000062 | 3300003762 | Bacteria | 161494 |
| 36 | Ga0055542_1001515 | 3300003762 | Bacteria | 11273 |
| 37 | Ga0055529_1009081 | 3300003763 | Bacteria | 1312 |
| 38 | Ga0055526_1016624 | 3300003771 | Bacteria | 2863 |
| 39 | Ga0055526_1016625 | 3300003771 | Bacteria | 2863 |
| 40 | Ga0055537_1000217 | 3300003773 | Bacteria | 42589 |
| 41 | Ga0055537_1001276 | 3300003773 | Bacteria | 10463 |
| 42 | Ga0055537_1004956 | 3300003773 | Bacteria | 3672 |
| 43 | Ga0055537_1010392 | 3300003773 | Bacteria | 1966 |
| 44 | Ga0055524_1000276 | 3300003775 | Bacteria | 50977 |
| 45 | Ga0055524_1014879 | 3300003775 | Bacteria | 2863 |
| 46 | Ga0055524_1016708 | 3300003775 | Bacteria | 2617 |
| 47 | Ga0055536_1000385 | 3300003781 | Bacteria | 32350 |
| 48 | Ga0055536_1000743 | 3300003781 | Bacteria | 21817 |
| 49 | Ga0055536_1006377 | 3300003781 | Bacteria | 5527 |
| 50 | Ga0055536_1009998 | 3300003781 | Bacteria | 3834 |
| 51 | Ga0055536_1038275 | 3300003781 | Bacteria | 1164 |
| 52 | Ga0055534_1000106 | 3300003784 | Bacteria | 63996 |
| 53 | Ga0055534_1002390 | 3300003784 | Bacteria | 6534 |
| 54 | Ga0055528_1010834 | 3300003790 | Bacteria | 3672 |
| 55 | Ga0055528_1022442 | 3300003790 | Bacteria | 1966 |
| 56 | Ga0055530_10000521 | 3300003791 | Bacteria | 33319 |
| 57 | Ga0055530_10000573 | 3300003791 | Bacteria | 31894 |
| 58 | Ga0055530_10001653 | 3300003791 | Bacteria | 15894 |
| 59 | Ga0055530_10005644 | 3300003791 | Bacteria | 5862 |
| 60 | Ga0055530_10007241 | 3300003791 | Bacteria | 4722 |
| 61 | Ga0055530_10014165 | 3300003791 | Bacteria | 2673 |
| 62 | Ga0055540_1002206 | 3300003792 | Bacteria | 10581 |
| 63 | Ga0055540_1002275 | 3300003792 | Bacteria | 10354 |
| 64 | Ga0055540_1005142 | 3300003792 | Bacteria | 5619 |
| 65 | Ga0055540_1009867 | 3300003792 | Bacteria | 3237 |
| 66 | Ga0055540_1014818 | 3300003792 | Bacteria | 2303 |
| 67 | Ga0055531_10000203 | 3300003794 | Bacteria | 65490 |
| 68 | Ga0055531_10001002 | 3300003794 | Bacteria | 22441 |
| 69 | Ga0055531_10001633 | 3300003794 | Bacteria | 16244 |
| 70 | Ga0055531_10002103 | 3300003794 | Bacteria | 13685 |
| 71 | Ga0055531_10002282 | 3300003794 | Bacteria | 12970 |
| 72 | Ga0055531_10019259 | 3300003794 | Bacteria | 2772 |
| 73 | Ga0055543_1003281 | 3300004625 | Bacteria | 4867 |
| 74 | Ga0055543_1004625 | 3300004625 | Bacteria | 3692 |
| 75 | Ga0055543_1014782 | 3300004625 | Bacteria | 1514 |
| 76 | Ga0065165_1003236 | 3300005262 | Bacteria | 11810 |
| 77 | Ga0065165_1005102 | 3300005262 | Bacteria | 7628 |
| 78 | Ga0065165_1006193 | 3300005262 | Bacteria | 6383 |
| 79 | Ga0065165_1006686 | 3300005262 | Bacteria | 5939 |
| 80 | Ga0065165_1012578 | 3300005262 | Bacteria | 3434 |
| 81 | Ga0065165_1013310 | 3300005262 | Bacteria | 3281 |
| 82 | Ga0065165_1019354 | 3300005262 | Bacteria | 2434 |
| 83 | Ga0065165_1020392 | 3300005262 | Bacteria | 2332 |
| 84 | Ga0065165_1079924 | 3300005262 | Bacteria | 850 |
| 85 | Ga0065714_10015844 | 3300005288 | Bacteria | 3068 |
| 86 | Ga0065704_10008951 | 3300005289 | Bacteria | 2501 |
| 87 | Ga0065704_10087958 | 3300005289 | Bacteria | 2980 |
| 88 | Ga0065707_10314962 | 3300005295 | Bacteria | 977 |
| 89 | Ga0070658_10000618 | 3300005327 | Bacteria | 30678 |
| 90 | Ga0070658_10018985 | 3300005327 | Bacteria | 5508 |
| 91 | Ga0070658_10338307 | 3300005327 | Bacteria | 1287 |
| 92 | Ga0070676_10752436 | 3300005328 | Bacteria | 715 |
| 93 | Ga0070683_100734186 | 3300005329 | Bacteria | 946 |
| 94 | Ga0070670_100000001 | 3300005331 | Bacteria | 728788 |
| 95 | Ga0070670_100067774 | 3300005331 | Bacteria | 3062 |
| 96 | Ga0070670_100349677 | 3300005331 | Bacteria | 1298 |
| 97 | Ga0070670_100400983 | 3300005331 | Bacteria | 1211 |
| 98 | Ga0068869_100002440 | 3300005334 | Bacteria | 11212 |
| 99 | Ga0070666_10070267 | 3300005335 | Bacteria | 2382 |
| 100 | Ga0070666_10131930 | 3300005335 | Bacteria | 1736 |
| 101 | Ga0070666_10693550 | 3300005335 | Bacteria | 746 |
| 102 | Ga0070682_100043030 | 3300005337 | Bacteria | 2791 |
| 103 | Ga0068868_100057235 | 3300005338 | Bacteria | 3080 |
| 104 | Ga0070660_100390345 | 3300005339 | Bacteria | 1150 |
| 105 | Ga0070661_100153859 | 3300005344 | Bacteria | 1739 |
| 106 | Ga0070692_10594814 | 3300005345 | Bacteria | 731 |
| 107 | Ga0070668_100009520 | 3300005347 | Bacteria | 7208 |
| 108 | Ga0070668_100027781 | 3300005347 | Bacteria | 4295 |
| 109 | Ga0070669_100001723 | 3300005353 | Bacteria | 15839 |
| 110 | Ga0070669_100030628 | 3300005353 | Bacteria | 3884 |
| 111 | Ga0070669_100117833 | 3300005353 | Bacteria | 2022 |
| 112 | Ga0070671_100000033 | 3300005355 | Bacteria | 105788 |
| 113 | Ga0070673_100009989 | 3300005364 | Bacteria | 6401 |
| 114 | Ga0070688_100013740 | 3300005365 | Bacteria | 4575 |
| 115 | Ga0070659_100782192 | 3300005366 | Bacteria | 829 |
| 116 | Ga0070667_100000405 | 3300005367 | Bacteria | 46253 |
| 117 | Ga0070667_100005545 | 3300005367 | Bacteria | 10529 |
| 118 | Ga0070667_100031542 | 3300005367 | Bacteria | 4418 |
| 119 | Ga0070705_100151872 | 3300005440 | Bacteria | 1537 |
| 120 | Ga0070663_100013652 | 3300005455 | Bacteria | 5188 |
| 121 | Ga0070663_100244213 | 3300005455 | Bacteria | 1418 |
| 122 | Ga0070662_100264302 | 3300005457 | Bacteria | 1387 |
| 123 | Ga0070681_10932245 | 3300005458 | Bacteria | 787 |
| 124 | Ga0068867_100146911 | 3300005459 | Bacteria | 1849 |
| 125 | Ga0068867_100239521 | 3300005459 | Bacteria | 1471 |
| 126 | Ga0070685_10000008 | 3300005466 | Bacteria | 166350 |
| 127 | Ga0070706_100471230 | 3300005467 | Bacteria | 1168 |
| 128 | Ga0070679_100196348 | 3300005530 | Bacteria | 1985 |
| 129 | Ga0070679_100581460 | 3300005530 | Bacteria | 1063 |
| 130 | Ga0070684_100848522 | 3300005535 | Bacteria | 855 |
| 131 | Ga0070697_101542758 | 3300005536 | Bacteria | 594 |
| 132 | Ga0068853_100014261 | 3300005539 | Bacteria | 6504 |
| 133 | Ga0068853_100024199 | 3300005539 | Bacteria | 5090 |
| 134 | Ga0068853_100069849 | 3300005539 | Bacteria | 3056 |
| 135 | Ga0070672_100230040 | 3300005543 | Bacteria | 1557 |
| 136 | Ga0070695_100835981 | 3300005545 | Bacteria | 740 |
| 137 | Ga0070665_100040876 | 3300005548 | Bacteria | 4660 |
| 138 | Ga0070665_100056363 | 3300005548 | Bacteria | 3940 |
| 139 | Ga0070665_100058254 | 3300005548 | Bacteria | 3873 |
| 140 | Ga0070665_100067417 | 3300005548 | Bacteria | 3588 |
| 141 | Ga0070665_100116127 | 3300005548 | Bacteria | 2679 |
| 142 | Ga0070665_100426378 | 3300005548 | Bacteria | 1335 |
| 143 | Ga0070665_100732490 | 3300005548 | Bacteria | 1002 |
| 144 | Ga0068855_100091195 | 3300005563 | Bacteria | 3516 |
| 145 | Ga0068855_100122687 | 3300005563 | Bacteria | 2973 |
| 146 | Ga0068855_100259174 | 3300005563 | Bacteria | 1938 |
| 147 | Ga0068855_100282223 | 3300005563 | Bacteria | 1844 |
| 148 | Ga0068857_100085660 | 3300005577 | Bacteria | 2816 |
| 149 | Ga0068857_100102866 | 3300005577 | Bacteria | 2564 |
| 150 | Ga0068857_100208233 | 3300005577 | Bacteria | 1784 |
| 151 | Ga0068854_100167009 | 3300005578 | Bacteria | 1709 |
| 152 | Ga0068856_100150515 | 3300005614 | Bacteria | 2336 |
| 153 | Ga0068856_100319909 | 3300005614 | Bacteria | 1569 |
| 154 | Ga0068856_100424811 | 3300005614 | Bacteria | 1349 |
| 155 | Ga0068856_100798145 | 3300005614 | Bacteria | 964 |
| 156 | Ga0068856_100829430 | 3300005614 | Bacteria | 944 |
| 157 | Ga0068852_100014597 | 3300005616 | Bacteria | 6054 |
| 158 | Ga0068852_100398478 | 3300005616 | Bacteria | 1353 |
| 159 | Ga0068852_100446051 | 3300005616 | Bacteria | 1280 |
| 160 | Ga0068852_100754264 | 3300005616 | Bacteria | 985 |
| 161 | Ga0068852_100829153 | 3300005616 | Bacteria | 940 |
| 162 | Ga0068859_100017687 | 3300005617 | Bacteria | 7165 |
| 163 | Ga0068859_100082831 | 3300005617 | Bacteria | 3250 |
| 164 | Ga0068859_100283618 | 3300005617 | Bacteria | 1749 |
| 165 | Ga0068859_101164148 | 3300005617 | Bacteria | 849 |
| 166 | Ga0068864_100000006 | 3300005618 | Bacteria | 393838 |
| 167 | Ga0068864_100000115 | 3300005618 | Bacteria | 79542 |
| 168 | Ga0068864_100006669 | 3300005618 | Bacteria | 9451 |
| 169 | Ga0068864_100088879 | 3300005618 | Bacteria | 2722 |
| 170 | Ga0068861_100003645 | 3300005719 | Bacteria | 10263 |
| 171 | Ga0068863_100000007 | 3300005841 | Bacteria | 257578 |
| 172 | Ga0068863_100003567 | 3300005841 | Bacteria | 15359 |
| 173 | Ga0068863_100335206 | 3300005841 | Bacteria | 1471 |
| 174 | Ga0068863_100875803 | 3300005841 | Bacteria | 898 |
| 175 | Ga0068858_100000031 | 3300005842 | Bacteria | 143397 |
| 176 | Ga0068858_100051365 | 3300005842 | Bacteria | 3814 |
| 177 | Ga0068858_100100561 | 3300005842 | Bacteria | 2696 |
| 178 | Ga0068858_100496491 | 3300005842 | Bacteria | 1179 |
| 179 | Ga0068858_100589477 | 3300005842 | Bacteria | 1078 |
| 180 | Ga0068860_100011998 | 3300005843 | Bacteria | 8534 |
| 181 | Ga0068860_100059791 | 3300005843 | Bacteria | 3622 |
| 182 | Ga0068862_100001252 | 3300005844 | Bacteria | 23865 |
| 183 | Ga0068862_100548232 | 3300005844 | Bacteria | 1104 |
| 184 | Ga0068862_101392111 | 3300005844 | Bacteria | 704 |
| 185 | Ga0081455_10000120 | 3300005937 | Bacteria | 89920 |
| 186 | Ga0075365_10029726 | 3300006038 | Bacteria | 3495 |
| 187 | Ga0075365_10147570 | 3300006038 | Bacteria | 1635 |
| 188 | Ga0075365_10402541 | 3300006038 | Bacteria | 966 |
| 189 | Ga0075365_10464033 | 3300006038 | Bacteria | 894 |
| 190 | Ga0075365_10555219 | 3300006038 | Bacteria | 812 |
| 191 | Ga0075365_10605116 | 3300006038 | Bacteria | 775 |
| 192 | Ga0075368_10095363 | 3300006042 | Bacteria | 1219 |
| 193 | Ga0075363_100113746 | 3300006048 | Bacteria | 1506 |
| 194 | Ga0075363_100124324 | 3300006048 | Bacteria | 1443 |
| 195 | Ga0075363_100141318 | 3300006048 | Bacteria | 1356 |
| 196 | Ga0075364_10009471 | 3300006051 | Bacteria | 5846 |
| 197 | Ga0075364_10012251 | 3300006051 | Bacteria | 5242 |
| 198 | Ga0075364_10020653 | 3300006051 | Bacteria | 4143 |
| 199 | Ga0075364_10023413 | 3300006051 | Bacteria | 3910 |
| 200 | Ga0075364_10073663 | 3300006051 | Bacteria | 2251 |
| 201 | Ga0075364_10091396 | 3300006051 | Bacteria | 2019 |
| 202 | Ga0075364_10122659 | 3300006051 | Bacteria | 1740 |
| 203 | Ga0075364_10243189 | 3300006051 | Bacteria | 1222 |
| 204 | Ga0075432_10041150 | 3300006058 | Bacteria | 1614 |
| 205 | Ga0075432_10049939 | 3300006058 | Bacteria | 1474 |
| 206 | Ga0070712_100231585 | 3300006175 | Bacteria | 1467 |
| 207 | Ga0070712_100662200 | 3300006175 | Bacteria | 888 |
| 208 | Ga0075362_10001023 | 3300006177 | Bacteria | 8611 |
| 209 | Ga0075362_10064819 | 3300006177 | Bacteria | 1658 |
| 210 | Ga0075362_10073816 | 3300006177 | Bacteria | 1562 |
| 211 | Ga0075362_10209178 | 3300006177 | Bacteria | 951 |
| 212 | Ga0075367_10044775 | 3300006178 | Bacteria | 2595 |
| 213 | Ga0075367_10231261 | 3300006178 | Bacteria | 1158 |
| 214 | Ga0075369_10005453 | 3300006186 | Bacteria | 4754 |
| 215 | Ga0075369_10065285 | 3300006186 | Bacteria | 1595 |
| 216 | Ga0075369_10145066 | 3300006186 | Bacteria | 1084 |
| 217 | Ga0075369_10213722 | 3300006186 | Bacteria | 892 |
| 218 | Ga0075369_10249194 | 3300006186 | Bacteria | 825 |
| 219 | Ga0075369_10295610 | 3300006186 | Bacteria | 756 |
| 220 | Ga0075366_10029145 | 3300006195 | Bacteria | 3242 |
| 221 | Ga0075366_10058452 | 3300006195 | Bacteria | 2290 |
| 222 | Ga0075366_10068117 | 3300006195 | Bacteria | 2118 |
| 223 | Ga0075366_10151086 | 3300006195 | Bacteria | 1406 |
| 224 | Ga0075366_10246500 | 3300006195 | Bacteria | 1089 |
| 225 | Ga0075366_10282382 | 3300006195 | Bacteria | 1015 |
| 226 | Ga0075370_10001207 | 3300006353 | Bacteria | 10914 |
| 227 | Ga0075370_10002536 | 3300006353 | Bacteria | 8488 |
| 228 | Ga0075370_10012763 | 3300006353 | Bacteria | 4449 |
| 229 | Ga0075370_10080333 | 3300006353 | Bacteria | 1873 |
| 230 | Ga0075370_10102645 | 3300006353 | Bacteria | 1656 |
| 231 | Ga0068865_101321182 | 3300006881 | Bacteria | 642 |
| 232 | Ga0075436_100027626 | 3300006914 | Bacteria | 3905 |
| 233 | Ga0097620_100017687 | 3300006931 | Bacteria | 7165 |
| 234 | Ga0097620_100082833 | 3300006931 | Bacteria | 3250 |
| 235 | Ga0097620_100283611 | 3300006931 | Bacteria | 1749 |
| 236 | Ga0097620_101164280 | 3300006931 | Bacteria | 849 |
| 237 | Ga0099825_1026372 | 3300006941 | Bacteria | 3103 |
| 238 | Ga0099824_1005117 | 3300006942 | Bacteria | 18601 |
| 239 | Ga0099824_1018892 | 3300006942 | Bacteria | 5529 |
| 240 | Ga0079104_1019522 | 3300006946 | Bacteria | 1891 |
| 241 | Ga0079104_1043432 | 3300006946 | Bacteria | 1036 |
| 242 | Ga0099826_10006923 | 3300006948 | Bacteria | 8307 |
| 243 | Ga0105250_10082977 | 3300009092 | Bacteria | 1300 |
| 244 | Ga0105240_10005838 | 3300009093 | Bacteria | 18251 |
| 245 | Ga0105240_10015532 | 3300009093 | Bacteria | 10350 |
| 246 | Ga0105240_10077393 | 3300009093 | Bacteria | 4098 |
| 247 | Ga0105240_10182224 | 3300009093 | Bacteria | 2477 |
| 248 | Ga0105240_10240781 | 3300009093 | Bacteria | 2097 |
| 249 | Ga0105240_10935711 | 3300009093 | Bacteria | 930 |
| 250 | Ga0105245_10032999 | 3300009098 | Bacteria | 4585 |
| 251 | Ga0105245_10113604 | 3300009098 | Bacteria | 2522 |
| 252 | Ga0105245_10463523 | 3300009098 | Bacteria | 1278 |
| 253 | Ga0105245_10568395 | 3300009098 | Bacteria | 1157 |
| 254 | Ga0105247_10015539 | 3300009101 | Bacteria | 4559 |
| 255 | Ga0105247_10041761 | 3300009101 | Bacteria | 2807 |
| 256 | Ga0105247_10061905 | 3300009101 | Bacteria | 2321 |
| 257 | Ga0105247_10274072 | 3300009101 | Bacteria | 1162 |
| 258 | Ga0105243_10002474 | 3300009148 | Bacteria | 15420 |
| 259 | Ga0105243_10132992 | 3300009148 | Bacteria | 2113 |
| 260 | Ga0105243_10203573 | 3300009148 | Bacteria | 1738 |
| 261 | Ga0105243_10784734 | 3300009148 | Bacteria | 937 |
| 262 | Ga0105241_10025725 | 3300009174 | Bacteria | 4375 |
| 263 | Ga0105241_10129757 | 3300009174 | Bacteria | 2039 |
| 264 | Ga0105241_10385178 | 3300009174 | Bacteria | 1226 |
| 265 | Ga0105241_10487817 | 3300009174 | Bacteria | 1096 |
| 266 | Ga0105241_11691295 | 3300009174 | Bacteria | 615 |
| 267 | Ga0105242_11231846 | 3300009176 | Bacteria | 769 |
| 268 | Ga0105248_10004030 | 3300009177 | Bacteria | 16246 |
| 269 | Ga0105248_10094337 | 3300009177 | Bacteria | 3370 |
| 270 | Ga0105248_10251283 | 3300009177 | Bacteria | 1990 |
| 271 | Ga0105248_10807932 | 3300009177 | Bacteria | 1058 |
| 272 | Ga0105248_10829931 | 3300009177 | Bacteria | 1043 |
| 273 | Ga0105237_10000209 | 3300009545 | Bacteria | 83491 |
| 274 | Ga0105237_10018789 | 3300009545 | Bacteria | 7148 |
| 275 | Ga0105237_10020513 | 3300009545 | Bacteria | 6810 |
| 276 | Ga0105237_10087966 | 3300009545 | Bacteria | 3096 |
| 277 | Ga0105237_10199366 | 3300009545 | Bacteria | 2001 |
| 278 | Ga0105237_10224458 | 3300009545 | Bacteria | 1879 |
| 279 | Ga0105237_10331261 | 3300009545 | Bacteria | 1526 |
| 280 | Ga0105237_10487792 | 3300009545 | Bacteria | 1238 |
| 281 | Ga0105237_10720675 | 3300009545 | Bacteria | 1004 |
| 282 | Ga0105237_10993961 | 3300009545 | Bacteria | 846 |
| 283 | Ga0105238_10004686 | 3300009551 | Bacteria | 13524 |
| 284 | Ga0105238_10106327 | 3300009551 | Bacteria | 2788 |
| 285 | Ga0105238_10208506 | 3300009551 | Bacteria | 1930 |
| 286 | Ga0105238_10812979 | 3300009551 | Bacteria | 951 |
| 287 | Ga0105238_11269759 | 3300009551 | Bacteria | 762 |
| 288 | Ga0105238_11335831 | 3300009551 | Bacteria | 743 |
| 289 | Ga0105238_11746841 | 3300009551 | Bacteria | 654 |
| 290 | Ga0105249_10016332 | 3300009553 | Bacteria | 6585 |
| 291 | Ga0105249_10691972 | 3300009553 | Bacteria | 1079 |
| 292 | Ga0105239_10019083 | 3300010375 | Bacteria | 7578 |
| 293 | Ga0105239_10071618 | 3300010375 | Bacteria | 3808 |
| 294 | Ga0105239_10073276 | 3300010375 | Bacteria | 3765 |
| 295 | Ga0105239_10111109 | 3300010375 | Bacteria | 3038 |
| 296 | Ga0105239_10197116 | 3300010375 | Bacteria | 2255 |
| 297 | Ga0105239_10201886 | 3300010375 | Bacteria | 2227 |
| 298 | Ga0105239_10483651 | 3300010375 | Bacteria | 1407 |
| 299 | Ga0105239_10618586 | 3300010375 | Bacteria | 1236 |
| 300 | Ga0105239_10919522 | 3300010375 | Bacteria | 1004 |
| 301 | Ga0105239_11681549 | 3300010375 | Bacteria | 734 |
| 302 | Ga0105246_10007753 | 3300011119 | Bacteria | 6590 |
| 303 | Ga0105246_10368789 | 3300011119 | Bacteria | 1182 |
| 304 | Ga0105246_10371451 | 3300011119 | Bacteria | 1179 |
| 305 | Ga0157371_10095472 | 3300013102 | Bacteria | 2107 |
| 306 | Ga0157370_10020928 | 3300013104 | Bacteria | 6525 |
| 307 | Ga0157370_10029446 | 3300013104 | Bacteria | 5388 |
| 308 | Ga0157369_10015433 | 3300013105 | Bacteria | 8609 |
| 309 | Ga0157369_10148621 | 3300013105 | Bacteria | 2477 |
| 310 | Ga0157369_10297102 | 3300013105 | Bacteria | 1681 |
| 311 | Ga0157369_10576202 | 3300013105 | Bacteria | 1162 |
| 312 | Ga0157369_10683195 | 3300013105 | Bacteria | 1058 |
| 313 | Ga0157374_10221425 | 3300013296 | Bacteria | 1857 |
| 314 | Ga0157374_11150605 | 3300013296 | Bacteria | 797 |
| 315 | Ga0157374_12145005 | 3300013296 | Bacteria | 586 |
| 316 | Ga0157378_10192239 | 3300013297 | Bacteria | 1926 |
| 317 | Ga0157378_10429305 | 3300013297 | Bacteria | 1308 |
| 318 | Ga0157372_10114193 | 3300013307 | Bacteria | 3096 |
| 319 | Ga0157372_10149239 | 3300013307 | Bacteria | 2697 |
| 320 | Ga0157375_10047270 | 3300013308 | Bacteria | 4202 |
| 321 | Ga0163163_10000926 | 3300014325 | Bacteria | 24867 |
| 322 | Ga0163163_10082749 | 3300014325 | Bacteria | 3214 |
| 323 | Ga0163163_10115692 | 3300014325 | Bacteria | 2713 |
| 324 | Ga0157380_10949288 | 3300014326 | Bacteria | 890 |
| 325 | Ga0182008_10012461 | 3300014497 | Bacteria | 4488 |
| 326 | Ga0182008_10074251 | 3300014497 | Bacteria | 1673 |
| 327 | Ga0182008_10185854 | 3300014497 | Bacteria | 1053 |
| 328 | Ga0157377_10265760 | 3300014745 | Bacteria | 1118 |
| 329 | Ga0157379_10017367 | 3300014968 | Bacteria | 6339 |
| 330 | Ga0157379_10397451 | 3300014968 | Bacteria | 1266 |
| 331 | Ga0157379_10641515 | 3300014968 | Bacteria | 994 |
| 332 | Ga0157379_10895684 | 3300014968 | Bacteria | 841 |
| 333 | Ga0163161_10002178 | 3300017792 | Bacteria | 14129 |
| 334 | Ga0163161_10090314 | 3300017792 | Bacteria | 2266 |
| 335 | Ga0163161_10244232 | 3300017792 | Bacteria | 1397 |
| 336 | Ga0214544_1000003 | 3300021320 | Bacteria | 643752 |
| 337 | Ga0214542_1000003 | 3300021321 | Bacteria | 435700 |
| 338 | Ga0214545_1000004 | 3300021324 | Bacteria | 453352 |
| 339 | Ga0214543_1000007 | 3300021327 | Bacteria | 414744 |
| 340 | Ga0213872_10000678 | 3300021361 | Bacteria | 25758 |
| 341 | Ga0213872_10003050 | 3300021361 | Bacteria | 9445 |
| 342 | Ga0213872_10004783 | 3300021361 | Bacteria | 7078 |
| 343 | Ga0213872_10006716 | 3300021361 | Bacteria | 5733 |
| 344 | Ga0213872_10008898 | 3300021361 | Bacteria | 4834 |
| 345 | Ga0213872_10032482 | 3300021361 | Bacteria | 2391 |
| 346 | Ga0213872_10089556 | 3300021361 | Bacteria | 1377 |
| 347 | Ga0213872_10091688 | 3300021361 | Bacteria | 1359 |
| 348 | Ga0213872_10154141 | 3300021361 | Bacteria | 1002 |
| 349 | Ga0213874_10315183 | 3300021377 | Bacteria | 592 |
| 350 | Ga0213876_10014677 | 3300021384 | Bacteria | 4151 |
| 351 | Ga0213876_10116727 | 3300021384 | Bacteria | 1417 |
| 352 | Ga0209672_100326 | 3300025228 | Bacteria | 31060 |
| 353 | Ga0209147_101453 | 3300025229 | Bacteria | 8533 |
| 354 | Ga0209563_104203 | 3300025230 | Bacteria | 2793 |
| 355 | Ga0209258_100154 | 3300025242 | Bacteria | 158235 |
| 356 | Ga0207425_1009030 | 3300025245 | Bacteria | 2507 |
| 357 | Ga0207425_1027585 | 3300025245 | Bacteria | 1158 |
| 358 | Ga0209026_1000013 | 3300025250 | Bacteria | 415633 |
| 359 | Ga0209026_1012883 | 3300025250 | Bacteria | 1442 |
| 360 | Ga0209677_101412 | 3300025253 | Bacteria | 10402 |
| 361 | Ga0209677_118621 | 3300025253 | Bacteria | 843 |
| 362 | Ga0209148_1000078 | 3300025254 | Bacteria | 296101 |
| 363 | Ga0209148_1000145 | 3300025254 | Bacteria | 161352 |
| 364 | Ga0209148_1000761 | 3300025254 | Bacteria | 24569 |
| 365 | Ga0209148_1007279 | 3300025254 | Bacteria | 2314 |
| 366 | Ga0209759_1000149 | 3300025256 | Bacteria | 120932 |
| 367 | Ga0209129_1000054 | 3300025258 | Bacteria | 261997 |
| 368 | Ga0209129_1002251 | 3300025258 | Bacteria | 9636 |
| 369 | Ga0209129_1006857 | 3300025258 | Bacteria | 3551 |
| 370 | Ga0209233_1000102 | 3300025261 | Bacteria | 285774 |
| 371 | Ga0209233_1000947 | 3300025261 | Bacteria | 12594 |
| 372 | Ga0209233_1017503 | 3300025261 | Bacteria | 1950 |
| 373 | Ga0209565_1000008 | 3300025263 | Bacteria | 774179 |
| 374 | Ga0209565_1000067 | 3300025263 | Bacteria | 171247 |
| 375 | Ga0209565_1000185 | 3300025263 | Bacteria | 76451 |
| 376 | Ga0209565_1005666 | 3300025263 | Bacteria | 3606 |
| 377 | Ga0209455_1000194 | 3300025272 | Bacteria | 89837 |
| 378 | Ga0209455_1001577 | 3300025272 | Bacteria | 10047 |
| 379 | Ga0209455_1004890 | 3300025272 | Bacteria | 4263 |
| 380 | Ga0209673_1000097 | 3300025273 | Bacteria | 193482 |
| 381 | Ga0209673_1000548 | 3300025273 | Bacteria | 60849 |
| 382 | Ga0209673_1002045 | 3300025273 | Bacteria | 15283 |
| 383 | Ga0209673_1002338 | 3300025273 | Bacteria | 13412 |
| 384 | Ga0209673_1002470 | 3300025273 | Bacteria | 12782 |
| 385 | Ga0209130_1000260 | 3300025284 | Bacteria | 66399 |
| 386 | Ga0209130_1000441 | 3300025284 | Bacteria | 43985 |
| 387 | Ga0209130_1003421 | 3300025284 | Bacteria | 6775 |
| 388 | Ga0209675_1000038 | 3300025291 | Bacteria | 250481 |
| 389 | Ga0209675_1001284 | 3300025291 | Bacteria | 14917 |
| 390 | Ga0209675_1001491 | 3300025291 | Bacteria | 13425 |
| 391 | Ga0209675_1013906 | 3300025291 | Bacteria | 2482 |
| 392 | Ga0209676_1000103 | 3300025292 | Bacteria | 226908 |
| 393 | Ga0209676_1000128 | 3300025292 | Bacteria | 188099 |
| 394 | Ga0209676_1000243 | 3300025292 | Bacteria | 117113 |
| 395 | Ga0209676_1000791 | 3300025292 | Bacteria | 41820 |
| 396 | Ga0209676_1001349 | 3300025292 | Bacteria | 24416 |
| 397 | Ga0209676_1042983 | 3300025292 | Bacteria | 1250 |
| 398 | Ga0209025_1000185 | 3300025294 | Bacteria | 155366 |
| 399 | Ga0209025_1000474 | 3300025294 | Bacteria | 78060 |
| 400 | Ga0209025_1016842 | 3300025294 | Bacteria | 4270 |
| 401 | Ga0209025_1017217 | 3300025294 | Bacteria | 4192 |
| 402 | Ga0209564_1000301 | 3300025295 | Bacteria | 97869 |
| 403 | Ga0209564_1000383 | 3300025295 | Bacteria | 81061 |
| 404 | Ga0209564_1000629 | 3300025295 | Bacteria | 53834 |
| 405 | Ga0209564_1005181 | 3300025295 | Bacteria | 7558 |
| 406 | Ga0209564_1021261 | 3300025295 | Bacteria | 2340 |
| 407 | Ga0209564_1035300 | 3300025295 | Bacteria | 1450 |
| 408 | Ga0209564_1054528 | 3300025295 | Bacteria | 943 |
| 409 | Ga0209758_1000030 | 3300025297 | Bacteria | 509217 |
| 410 | Ga0209758_1000034 | 3300025297 | Bacteria | 467637 |
| 411 | Ga0209758_1005701 | 3300025297 | Bacteria | 9402 |
| 412 | Ga0209758_1011492 | 3300025297 | Bacteria | 5117 |
| 413 | Ga0209758_1020188 | 3300025297 | Bacteria | 3168 |
| 414 | Ga0209758_1033122 | 3300025297 | Bacteria | 2083 |
| 415 | Ga0209758_1033265 | 3300025297 | Bacteria | 2075 |
| 416 | Ga0209758_1037103 | 3300025297 | Bacteria | 1889 |
| 417 | Ga0209050_1000010 | 3300025298 | Bacteria | 980454 |
| 418 | Ga0209050_1000012 | 3300025298 | Bacteria | 813717 |
| 419 | Ga0209050_1000244 | 3300025298 | Bacteria | 117105 |
| 420 | Ga0209050_1001118 | 3300025298 | Bacteria | 32421 |
| 421 | Ga0209050_1001465 | 3300025298 | Bacteria | 25256 |
| 422 | Ga0209256_1000009 | 3300025299 | Bacteria | 922071 |
| 423 | Ga0209256_1000010 | 3300025299 | Bacteria | 912110 |
| 424 | Ga0209256_1000103 | 3300025299 | Bacteria | 193900 |
| 425 | Ga0209256_1000165 | 3300025299 | Bacteria | 135104 |
| 426 | Ga0209256_1010538 | 3300025299 | Bacteria | 3851 |
| 427 | Ga0209256_1014683 | 3300025299 | Bacteria | 2795 |
| 428 | Ga0209256_1023169 | 3300025299 | Bacteria | 1859 |
| 429 | Ga0207426_1000058 | 3300025302 | Bacteria | 363857 |
| 430 | Ga0207426_1000067 | 3300025302 | Bacteria | 342108 |
| 431 | Ga0207426_1000867 | 3300025302 | Bacteria | 31615 |
| 432 | Ga0207426_1004113 | 3300025302 | Bacteria | 7313 |
| 433 | Ga0207426_1011500 | 3300025302 | Bacteria | 3368 |
| 434 | Ga0207426_1013645 | 3300025302 | Bacteria | 3002 |
| 435 | Ga0207426_1065474 | 3300025302 | Bacteria | 1030 |
| 436 | Ga0209051_1000019 | 3300025303 | Bacteria | 511268 |
| 437 | Ga0209051_1000603 | 3300025303 | Bacteria | 42060 |
| 438 | Ga0209051_1000638 | 3300025303 | Bacteria | 40261 |
| 439 | Ga0209051_1001110 | 3300025303 | Bacteria | 24653 |
| 440 | Ga0209051_1002726 | 3300025303 | Bacteria | 12255 |
| 441 | Ga0209051_1018263 | 3300025303 | Bacteria | 3107 |
| 442 | Ga0209051_1044966 | 3300025303 | Bacteria | 1533 |
| 443 | Ga0209051_1066054 | 3300025303 | Bacteria | 1112 |
| 444 | Ga0209257_1000009 | 3300025304 | Bacteria | 1205047 |
| 445 | Ga0209257_1000024 | 3300025304 | Bacteria | 726068 |
| 446 | Ga0209257_1000057 | 3300025304 | Bacteria | 396985 |
| 447 | Ga0209257_1000140 | 3300025304 | Bacteria | 201515 |
| 448 | Ga0209257_1003185 | 3300025304 | Bacteria | 14585 |
| 449 | Ga0209257_1007671 | 3300025304 | Bacteria | 6449 |
| 450 | Ga0209257_1021545 | 3300025304 | Bacteria | 2336 |
| 451 | Ga0209257_1042799 | 3300025304 | Bacteria | 1333 |
| 452 | Ga0207697_10064476 | 3300025315 | Bacteria | 1528 |
| 453 | Ga0207656_10002594 | 3300025321 | Bacteria | 6115 |
| 454 | Ga0207656_10223788 | 3300025321 | Bacteria | 915 |
| 455 | Ga0207710_10041186 | 3300025900 | Bacteria | 2048 |
| 456 | Ga0207710_10108518 | 3300025900 | Bacteria | 1316 |
| 457 | Ga0207710_10128491 | 3300025900 | Bacteria | 1216 |
| 458 | Ga0207688_10035473 | 3300025901 | Bacteria | 2763 |
| 459 | Ga0207680_10091257 | 3300025903 | Bacteria | 1938 |
| 460 | Ga0207680_10386632 | 3300025903 | Bacteria | 987 |
| 461 | Ga0207680_10535179 | 3300025903 | Bacteria | 836 |
| 462 | Ga0207647_10007551 | 3300025904 | Bacteria | 7843 |
| 463 | Ga0207647_10008829 | 3300025904 | Bacteria | 7192 |
| 464 | Ga0207647_10028609 | 3300025904 | Bacteria | 3617 |
| 465 | Ga0207647_10129393 | 3300025904 | Bacteria | 1484 |
| 466 | Ga0207643_10042028 | 3300025908 | Bacteria | 2576 |
| 467 | Ga0207705_10047855 | 3300025909 | Bacteria | 3076 |
| 468 | Ga0207705_10331023 | 3300025909 | Bacteria | 1171 |
| 469 | Ga0207705_11096885 | 3300025909 | Bacteria | 613 |
| 470 | Ga0207684_10398643 | 3300025910 | Bacteria | 1183 |
| 471 | Ga0207654_10419337 | 3300025911 | Bacteria | 934 |
| 472 | Ga0207695_10000065 | 3300025913 | Bacteria | 336949 |
| 473 | Ga0207695_10042830 | 3300025913 | Bacteria | 4829 |
| 474 | Ga0207695_10411294 | 3300025913 | Bacteria | 1237 |
| 475 | Ga0207671_10000072 | 3300025914 | Bacteria | 159539 |
| 476 | Ga0207671_10024760 | 3300025914 | Bacteria | 4509 |
| 477 | Ga0207671_10439069 | 3300025914 | Bacteria | 1039 |
| 478 | Ga0207671_10872388 | 3300025914 | Bacteria | 712 |
| 479 | Ga0207693_10316976 | 3300025915 | Bacteria | 1221 |
| 480 | Ga0207693_10491064 | 3300025915 | Bacteria | 959 |
| 481 | Ga0207663_10502918 | 3300025916 | Bacteria | 942 |
| 482 | Ga0207663_11146613 | 3300025916 | Bacteria | 625 |
| 483 | Ga0207660_10007226 | 3300025917 | Bacteria | 7189 |
| 484 | Ga0207649_10261967 | 3300025920 | Bacteria | 1249 |
| 485 | Ga0207652_10001316 | 3300025921 | Bacteria | 22069 |
| 486 | Ga0207652_10004184 | 3300025921 | Bacteria | 11769 |
| 487 | Ga0207652_11368554 | 3300025921 | Bacteria | 611 |
| 488 | Ga0207681_10005483 | 3300025923 | Bacteria | 7793 |
| 489 | Ga0207681_10035167 | 3300025923 | Bacteria | 3300 |
| 490 | Ga0207694_10043700 | 3300025924 | Bacteria | 3458 |
| 491 | Ga0207694_10062913 | 3300025924 | Bacteria | 2890 |
| 492 | Ga0207694_10177439 | 3300025924 | Bacteria | 1726 |
| 493 | Ga0207694_10341442 | 3300025924 | Bacteria | 1238 |
| 494 | Ga0207650_10000002 | 3300025925 | Bacteria | 1439222 |
| 495 | Ga0207650_10040555 | 3300025925 | Bacteria | 3408 |
| 496 | Ga0207650_10216887 | 3300025925 | Bacteria | 1539 |
| 497 | Ga0207650_10439127 | 3300025925 | Bacteria | 1085 |
| 498 | Ga0207687_10032239 | 3300025927 | Bacteria | 3548 |
| 499 | Ga0207687_10095641 | 3300025927 | Bacteria | 2176 |
| 500 | Ga0207644_10000176 | 3300025931 | Bacteria | 45641 |
| 501 | Ga0207644_11091068 | 3300025931 | Bacteria | 671 |
| 502 | Ga0207706_10275029 | 3300025933 | Bacteria | 1469 |
| 503 | Ga0207709_10000491 | 3300025935 | Bacteria | 35713 |
| 504 | Ga0207709_10555413 | 3300025935 | Bacteria | 904 |
| 505 | Ga0207709_10812133 | 3300025935 | Bacteria | 755 |
| 506 | Ga0207709_11358718 | 3300025935 | Bacteria | 588 |
| 507 | Ga0207704_10163116 | 3300025938 | Bacteria | 1588 |
| 508 | Ga0207665_10072406 | 3300025939 | Bacteria | 2354 |
| 509 | Ga0207665_10284959 | 3300025939 | Bacteria | 1231 |
| 510 | Ga0207691_10101219 | 3300025940 | Bacteria | 2571 |
| 511 | Ga0207691_10256780 | 3300025940 | Bacteria | 1507 |
| 512 | Ga0207711_10000366 | 3300025941 | Bacteria | 47938 |
| 513 | Ga0207711_10011017 | 3300025941 | Bacteria | 7513 |
| 514 | Ga0207711_10100192 | 3300025941 | Bacteria | 2562 |
| 515 | Ga0207711_11045822 | 3300025941 | Bacteria | 757 |
| 516 | Ga0207689_10017565 | 3300025942 | Bacteria | 6048 |
| 517 | Ga0207689_10133025 | 3300025942 | Bacteria | 2047 |
| 518 | Ga0207689_10592096 | 3300025942 | Bacteria | 933 |
| 519 | Ga0207689_10772287 | 3300025942 | Bacteria | 811 |
| 520 | Ga0207661_10984183 | 3300025944 | Bacteria | 777 |
| 521 | Ga0207667_10083293 | 3300025949 | Bacteria | 3312 |
| 522 | Ga0207667_10664612 | 3300025949 | Bacteria | 1046 |
| 523 | Ga0207667_10815640 | 3300025949 | Bacteria | 929 |
| 524 | Ga0207667_10921850 | 3300025949 | Bacteria | 864 |
| 525 | Ga0207667_11335861 | 3300025949 | Bacteria | 692 |
| 526 | Ga0207651_10175144 | 3300025960 | Bacteria | 1696 |
| 527 | Ga0207712_10058704 | 3300025961 | Bacteria | 2719 |
| 528 | Ga0207668_11093724 | 3300025972 | Bacteria | 714 |
| 529 | Ga0207640_10027904 | 3300025981 | Bacteria | 3444 |
| 530 | Ga0207640_10155381 | 3300025981 | Bacteria | 1686 |
| 531 | Ga0207658_10000001 | 3300025986 | Bacteria | 1439333 |
| 532 | Ga0207658_10018437 | 3300025986 | Bacteria | 4819 |
| 533 | Ga0207658_10030655 | 3300025986 | Bacteria | 3811 |
| 534 | Ga0207677_10037938 | 3300026023 | Bacteria | 3153 |
| 535 | Ga0207703_10000038 | 3300026035 | Bacteria | 175917 |
| 536 | Ga0207703_10006584 | 3300026035 | Bacteria | 9270 |
| 537 | Ga0207703_10265985 | 3300026035 | Bacteria | 1552 |
| 538 | Ga0207703_10311432 | 3300026035 | Bacteria | 1439 |
| 539 | Ga0207703_10692361 | 3300026035 | Bacteria | 969 |
| 540 | Ga0207639_10002789 | 3300026041 | Bacteria | 11724 |
| 541 | Ga0207639_10042208 | 3300026041 | Bacteria | 3417 |
| 542 | Ga0207639_10064609 | 3300026041 | Bacteria | 2838 |
| 543 | Ga0207639_10144270 | 3300026041 | Bacteria | 1987 |
| 544 | Ga0207639_10252120 | 3300026041 | Bacteria | 1539 |
| 545 | Ga0207639_11052625 | 3300026041 | Bacteria | 763 |
| 546 | Ga0207678_10006072 | 3300026067 | Bacteria | 10743 |
| 547 | Ga0207678_10075970 | 3300026067 | Bacteria | 2877 |
| 548 | Ga0207678_10182977 | 3300026067 | Bacteria | 1789 |
| 549 | Ga0207678_10269338 | 3300026067 | Bacteria | 1460 |
| 550 | Ga0207702_10273241 | 3300026078 | Bacteria | 1595 |
| 551 | Ga0207702_10294050 | 3300026078 | Bacteria | 1539 |
| 552 | Ga0207702_10382947 | 3300026078 | Bacteria | 1353 |
| 553 | Ga0207702_10591423 | 3300026078 | Bacteria | 1088 |
| 554 | Ga0207702_10890844 | 3300026078 | Bacteria | 882 |
| 555 | Ga0207702_11056332 | 3300026078 | Bacteria | 806 |
| 556 | Ga0207641_10000012 | 3300026088 | Bacteria | 375486 |
| 557 | Ga0207641_10038578 | 3300026088 | Bacteria | 3993 |
| 558 | Ga0207641_10094862 | 3300026088 | Bacteria | 2617 |
| 559 | Ga0207641_10295626 | 3300026088 | Bacteria | 1528 |
| 560 | Ga0207648_10003010 | 3300026089 | Bacteria | 17798 |
| 561 | Ga0207648_10092771 | 3300026089 | Bacteria | 2640 |
| 562 | Ga0207676_10000001 | 3300026095 | Bacteria | 1439222 |
| 563 | Ga0207676_10000610 | 3300026095 | Bacteria | 29371 |
| 564 | Ga0207676_10050809 | 3300026095 | Bacteria | 3234 |
| 565 | Ga0207674_10001341 | 3300026116 | Bacteria | 31867 |
| 566 | Ga0207674_10050312 | 3300026116 | Bacteria | 4258 |
| 567 | Ga0207674_10092422 | 3300026116 | Bacteria | 3015 |
| 568 | Ga0207674_10152361 | 3300026116 | Bacteria | 2268 |
| 569 | Ga0207675_100008719 | 3300026118 | Bacteria | 9527 |
| 570 | Ga0207675_100856501 | 3300026118 | Bacteria | 924 |
| 571 | Ga0207675_100922904 | 3300026118 | Bacteria | 890 |
| 572 | Ga0207698_10052977 | 3300026142 | Bacteria | 3111 |
| 573 | Ga0207698_10375188 | 3300026142 | Bacteria | 1351 |
| 574 | Ga0207698_10575526 | 3300026142 | Bacteria | 1107 |
| 575 | Ga0209281_1029587 | 3300027111 | Bacteria | 988 |
| 576 | Ga0209389_1000015 | 3300027296 | Bacteria | 188311 |
| 577 | Ga0209389_1000035 | 3300027296 | Bacteria | 127089 |
| 578 | Ga0209589_1000039 | 3300027357 | Bacteria | 127084 |
| 579 | Ga0209589_1001702 | 3300027357 | Bacteria | 36938 |
| 580 | Ga0209489_100084 | 3300027361 | Bacteria | 127094 |
| 581 | Ga0209489_102545 | 3300027361 | Bacteria | 36938 |
| 582 | Ga0209489_102940 | 3300027361 | Bacteria | 33921 |
| 583 | Ga0209700_100034 | 3300027363 | Bacteria | 197276 |
| 584 | Ga0209700_102508 | 3300027363 | Bacteria | 36938 |
| 585 | Ga0209282_1000929 | 3300027666 | Bacteria | 15308 |
| 586 | Ga0209813_10203577 | 3300027866 | Bacteria | 734 |
| 587 | Ga0207428_10348473 | 3300027907 | Bacteria | 1090 |
| 588 | Ga0268266_10003368 | 3300028379 | Bacteria | 16011 |
| 589 | Ga0268266_10201553 | 3300028379 | Bacteria | 1821 |
| 590 | Ga0268266_10252783 | 3300028379 | Bacteria | 1631 |
| 591 | Ga0268266_10271585 | 3300028379 | Bacteria | 1574 |
| 592 | Ga0268266_10857013 | 3300028379 | Bacteria | 878 |
| 593 | Ga0268266_10878814 | 3300028379 | Bacteria | 867 |
| 594 | Ga0268266_10983406 | 3300028379 | Bacteria | 816 |
| 595 | Ga0268266_11346816 | 3300028379 | Bacteria | 689 |
| 596 | Ga0268265_10000639 | 3300028380 | Bacteria | 34871 |
| 597 | Ga0268265_10063708 | 3300028380 | Bacteria | 2837 |
| 598 | Ga0268265_10223249 | 3300028380 | Bacteria | 1650 |
| 599 | Ga0268265_10868378 | 3300028380 | Bacteria | 884 |
| 600 | Ga0268264_10000004 | 3300028381 | Bacteria | 1116842 |
| 601 | Ga0268264_10030875 | 3300028381 | Bacteria | 4393 |
| 602 | Ga0268264_10263950 | 3300028381 | Bacteria | 1606 |
| 603 | Ga0265337_1004460 | 3300028556 | Bacteria | 5803 |
| 604 | Ga0265326_10008660 | 3300028558 | Bacteria | 3060 |
| 605 | Ga0265319_1002535 | 3300028563 | Bacteria | 9887 |
| 606 | Ga0265319_1114219 | 3300028563 | Bacteria | 843 |
| 607 | Ga0265334_10000692 | 3300028573 | Bacteria | 16893 |
| 608 | Ga0265318_10005512 | 3300028577 | Bacteria | 5939 |
| 609 | Ga0265323_10000487 | 3300028653 | Bacteria | 22352 |
| 610 | Ga0265336_10000116 | 3300028666 | Bacteria | 59582 |
| 611 | Ga0307517_10242884 | 3300028786 | Bacteria | 1066 |
| 612 | Ga0307515_10000306 | 3300028794 | Bacteria | 121448 |
| 613 | Ga0307515_10073133 | 3300028794 | Bacteria | 4613 |
| 614 | Ga0307515_10091389 | 3300028794 | Bacteria | 3804 |
| 615 | Ga0265338_10000094 | 3300028800 | Bacteria | 168366 |
| 616 | Ga0265324_10001770 | 3300029957 | Bacteria | 11823 |
| 617 | Ga0307512_10077299 | 3300030522 | Bacteria | 2420 |
| 618 | Ga0316177_1218212 | 3300030731 | Bacteria | 4818 |
| 619 | Ga0316176_1077164 | 3300030732 | Bacteria | 1043 |
| 620 | Ga0314311_1119909 | 3300030733 | Bacteria | 2249 |
| 621 | Ga0316178_1021912 | 3300030735 | Bacteria | 2704 |
| 622 | Ga0316180_1096038 | 3300030736 | Bacteria | 1525 |
| 623 | Ga0316183_1023532 | 3300030742 | Bacteria | 3105 |
| 624 | Ga0316181_1045265 | 3300030744 | Bacteria | 2692 |
| 625 | Ga0316182_1432467 | 3300030745 | Bacteria | 1938 |
| 626 | Ga0265330_10070025 | 3300031235 | Bacteria | 1518 |
| 627 | Ga0265340_10009477 | 3300031247 | Bacteria | 5223 |
| 628 | Ga0265339_10001522 | 3300031249 | Bacteria | 17112 |
| 629 | Ga0265339_10202618 | 3300031249 | Bacteria | 978 |
| 630 | Ga0265316_10006562 | 3300031344 | Bacteria | 11097 |
| 631 | Ga0307513_10027606 | 3300031456 | Bacteria | 6512 |
| 632 | Ga0307513_10112484 | 3300031456 | Bacteria | 2712 |
| 633 | Ga0307513_10317575 | 3300031456 | Bacteria | 1317 |
| 634 | Ga0307513_10374244 | 3300031456 | Bacteria | 1166 |
| 635 | Ga0307509_10156210 | 3300031507 | Bacteria | 2187 |
| 636 | Ga0307408_100000030 | 3300031548 | Bacteria | 223389 |
| 637 | Ga0307408_100135180 | 3300031548 | Bacteria | 1928 |
| 638 | Ga0307408_100247478 | 3300031548 | Bacteria | 1468 |
| 639 | Ga0265313_10000181 | 3300031595 | Bacteria | 67263 |
| 640 | Ga0265313_10009198 | 3300031595 | Bacteria | 6443 |
| 641 | Ga0265313_10014374 | 3300031595 | Bacteria | 4681 |
| 642 | Ga0307514_10003152 | 3300031649 | Bacteria | 16186 |
| 643 | Ga0265314_10306564 | 3300031711 | Bacteria | 889 |
| 644 | Ga0265342_10100640 | 3300031712 | Bacteria | 1646 |
| 645 | Ga0307405_10604158 | 3300031731 | Bacteria | 895 |
| 646 | Ga0307413_10695691 | 3300031824 | Bacteria | 844 |
| 647 | Ga0307406_10498753 | 3300031901 | Bacteria | 987 |
| 648 | Ga0307407_10126408 | 3300031903 | Bacteria | 1629 |
| 649 | Ga0307412_10020383 | 3300031911 | Bacteria | 4034 |
| 650 | Ga0307412_10031555 | 3300031911 | Bacteria | 3347 |
| 651 | Ga0307412_10144525 | 3300031911 | Bacteria | 1746 |
| 652 | Ga0307412_10223632 | 3300031911 | Bacteria | 1444 |
| 653 | Ga0307412_10265449 | 3300031911 | Bacteria | 1340 |
| 654 | Ga0307412_10360592 | 3300031911 | Bacteria | 1170 |
| 655 | Ga0307416_100138604 | 3300032002 | Bacteria | 2206 |
| 656 | Ga0307416_101393900 | 3300032002 | Bacteria | 807 |
| 657 | Ga0307414_10039618 | 3300032004 | Bacteria | 3175 |
| 658 | Ga0307414_10272243 | 3300032004 | Bacteria | 1419 |
| 659 | Ga0307414_11074879 | 3300032004 | Bacteria | 742 |
| 660 | Ga0307411_10002074 | 3300032005 | Bacteria | 8623 |
| 661 | Ga0307411_10191162 | 3300032005 | Bacteria | 1563 |
| 662 | Ga0307411_10744465 | 3300032005 | Bacteria | 858 |
| 663 | Ga0307411_11267663 | 3300032005 | Bacteria | 670 |
| 664 | Ga0307510_10081070 | 3300033180 | Bacteria | 3149 |
| 665 | Ga0307510_10123919 | 3300033180 | Bacteria | 2280 |
| 666 | Ga0315911_1000042 | 3300033442 | Bacteria | 49262 |
| 667 | Ga0373954_0224454 | 3300035118 | Bacteria | 924 |
| 668 | Ga0373955_0442203 | 3300035172 | Bacteria | 792 |
| 669 | Ga0373947_0630710 | 3300035725 | Bacteria | 731 |
| 670 | Ga0373937_1080809 | 3300036401 | Bacteria | 751 |
| 671 | Ga0395899_0000107 | 3300037312 | Bacteria | 144087 |
| 672 | Ga0395899_0000264 | 3300037312 | Bacteria | 68569 |
| 673 | Ga0395899_0000589 | 3300037312 | Bacteria | 38294 |
| 674 | Ga0395899_0000854 | 3300037312 | Bacteria | 29169 |
| 675 | Ga0395899_0033456 | 3300037312 | Bacteria | 3860 |
| 676 | Ga0395899_0184442 | 3300037312 | Bacteria | 1463 |
| 677 | Ga0395899_0267838 | 3300037312 | Bacteria | 1166 |
| 678 | Ga0395899_0491720 | 3300037312 | Bacteria | 797 |
| 679 | Ga0395899_0837568 | 3300037312 | Bacteria | 565 |
| 680 | Ga0395900_0000072 | 3300037418 | Bacteria | 187428 |
| 681 | Ga0395900_0000101 | 3300037418 | Bacteria | 153550 |
| 682 | Ga0395900_0000375 | 3300037418 | Bacteria | 64534 |
| 683 | Ga0395900_0000924 | 3300037418 | Bacteria | 38604 |
| 684 | Ga0395900_0007118 | 3300037418 | Bacteria | 11591 |
| 685 | Ga0395900_0023664 | 3300037418 | Bacteria | 6284 |
| 686 | Ga0395900_0038244 | 3300037418 | Bacteria | 4946 |
| 687 | Ga0395900_0227712 | 3300037418 | Bacteria | 1876 |
| 688 | Ga0395900_0702299 | 3300037418 | Bacteria | 945 |
| 689 | Ga0395900_0835755 | 3300037418 | Bacteria | 847 |
| 690 | Ga0395900_0924838 | 3300037418 | Bacteria | 794 |
| 691 | Ga0395900_1023328 | 3300037418 | Bacteria | 745 |
| 692 | Ga0395900_1378096 | 3300037418 | Bacteria | 618 |
| 693 | Ga0395898_0000043 | 3300037466 | Bacteria | 301783 |
| 694 | Ga0395898_0000629 | 3300037466 | Bacteria | 64534 |
| 695 | Ga0395898_0027961 | 3300037466 | Bacteria | 5655 |
| 696 | Ga0395898_0030665 | 3300037466 | Bacteria | 5379 |
| 697 | Ga0395898_0046845 | 3300037466 | Bacteria | 4246 |
| 698 | Ga0395898_0093907 | 3300037466 | Bacteria | 2882 |
| 699 | Ga0395898_0474518 | 3300037466 | Bacteria | 1190 |
| 700 | Ga0395898_0502156 | 3300037466 | Bacteria | 1153 |
| 701 | Ga0395898_0585479 | 3300037466 | Bacteria | 1058 |
| 702 | Ga0395905_0000101 | 3300037471 | Bacteria | 144115 |
| 703 | Ga0395905_0000361 | 3300037471 | Bacteria | 64517 |
| 704 | Ga0395905_0000678 | 3300037471 | Bacteria | 45181 |
| 705 | Ga0395905_0020944 | 3300037471 | Bacteria | 6192 |
| 706 | Ga0395905_0038381 | 3300037471 | Bacteria | 4494 |
| 707 | Ga0395905_0048180 | 3300037471 | Bacteria | 3994 |
| 708 | Ga0395905_0052161 | 3300037471 | Bacteria | 3830 |
| 709 | Ga0395905_0054838 | 3300037471 | Bacteria | 3730 |
| 710 | Ga0395905_0066764 | 3300037471 | Bacteria | 3369 |
| 711 | Ga0395905_0139686 | 3300037471 | Bacteria | 2279 |
| 712 | Ga0395905_0173407 | 3300037471 | Bacteria | 2025 |
| 713 | Ga0395905_0521152 | 3300037471 | Bacteria | 1089 |
| 714 | Ga0395901_0000052 | 3300038443 | Bacteria | 165888 |
| 715 | Ga0395901_0000068 | 3300038443 | Bacteria | 144095 |
| 716 | Ga0395901_0000273 | 3300038443 | Bacteria | 64425 |
| 717 | Ga0395901_0057959 | 3300038443 | Bacteria | 4028 |
| 718 | Ga0395901_0111619 | 3300038443 | Bacteria | 2871 |
| 719 | Ga0395901_0264643 | 3300038443 | Bacteria | 1789 |
| 720 | Ga0395901_0370830 | 3300038443 | Bacteria | 1475 |
| 721 | Ga0395901_0425360 | 3300038443 | Bacteria | 1361 |
| 722 | Ga0395901_0460995 | 3300038443 | Bacteria | 1299 |
| 723 | Ga0395901_0951562 | 3300038443 | Bacteria | 837 |
| 724 | Ga0436365_0367404 | 3300039437 | Bacteria | 1204 |
| 725 | Ga0436365_1284605 | 3300039437 | Bacteria | 1381 |
| 726 | Ga0436365_1811392 | 3300039437 | Bacteria | 9704 |
| 727 | Ga0436360_0885706 | 3300039438 | Bacteria | 2035 |
| 728 | Ga0436361_0092690 | 3300039447 | Bacteria | 3325 |
| 729 | Ga0436361_0105866 | 3300039447 | Bacteria | 6883 |
| 730 | Ga0436361_0320757 | 3300039447 | Bacteria | 82248 |
| 731 | Ga0436361_0325425 | 3300039447 | Bacteria | 2296 |
| 732 | Ga0436361_0347304 | 3300039447 | Bacteria | 1876 |
| 733 | Ga0436361_0347340 | 3300039447 | Bacteria | 2300 |
| 734 | Ga0436361_0428897 | 3300039447 | Bacteria | 1083 |
| 735 | Ga0436361_0444413 | 3300039447 | Bacteria | 4154 |
| 736 | Ga0436361_0558784 | 3300039447 | Bacteria | 1785 |
| 737 | Ga0436361_0585531 | 3300039447 | Bacteria | 936 |
| 738 | Ga0436361_0689358 | 3300039447 | Bacteria | 1476 |
| 739 | Ga0436361_0795199 | 3300039447 | Bacteria | 71391 |
| 740 | Ga0436361_0871756 | 3300039447 | Bacteria | 2077 |
| 741 | Ga0436361_0975940 | 3300039447 | Bacteria | 771 |
| 742 | Ga0436363_0436704 | 3300039450 | Bacteria | 829 |
| 743 | Ga0439436_0005797 | 3300041404 | Bacteria | 3784 |
| 744 | Ga0439436_0018111 | 3300041404 | Bacteria | 2106 |
| 745 | Ga0439439_0001395 | 3300041406 | Bacteria | 4789 |
| 746 | Ga0439439_0078268 | 3300041406 | Bacteria | 891 |
| 747 | Ga0439447_009190 | 3300041407 | Bacteria | 3012 |
| 748 | Ga0439461_0000338 | 3300041410 | Bacteria | 6676 |
| 749 | Ga0439461_0012958 | 3300041410 | Bacteria | 1567 |
| 750 | Ga0439466_0008919 | 3300041411 | Bacteria | 3771 |
| 751 | Ga0439466_0054384 | 3300041411 | Bacteria | 1304 |
| 752 | Ga0439465_0001362 | 3300041413 | Bacteria | 7874 |
| 753 | Ga0439465_0013022 | 3300041413 | Bacteria | 2599 |
| 754 | Ga0451793_0484513 | 3300041452 | Bacteria | 712 |
| 755 | Ga0451798_0229046 | 3300041458 | Bacteria | 2973 |
| 756 | Ga0451800_0517189 | 3300041459 | Bacteria | 1242 |
| 757 | Ga0451802_1574410 | 3300041460 | Bacteria | 998 |
| 758 | Ga0451806_090485 | 3300041462 | Bacteria | 756 |
| 759 | Ga0451806_223475 | 3300041462 | Bacteria | 3770 |
| 760 | Ga0451807_1439184 | 3300041486 | Bacteria | 1043 |
| 761 | Ga0451833_0019008 | 3300041491 | Bacteria | 1450 |
| 762 | Ga0451839_1344540 | 3300041496 | Bacteria | 745 |
| 763 | Ga0451845_0447342 | 3300041501 | Bacteria | 1088 |
| 764 | Ga0451843_1695995 | 3300041509 | Bacteria | 759 |
| 765 | Ga0451853_2497818 | 3300041512 | Bacteria | 1322 |
| 766 | Ga0451853_3703070 | 3300041512 | Bacteria | 1415 |
| 767 | Ga0439431_0001989 | 3300041997 | Bacteria | 4533 |
| 768 | Ga0439431_0011302 | 3300041997 | Bacteria | 2038 |
| 769 | Ga0439442_002682 | 3300042002 | Bacteria | 3494 |
| 770 | Ga0439442_013875 | 3300042002 | Bacteria | 1655 |
| 771 | Ga0439445_0000584 | 3300042004 | Bacteria | 7463 |
| 772 | Ga0439445_0011308 | 3300042004 | Bacteria | 2126 |
| 773 | Ga0439432_000736 | 3300042006 | Bacteria | 12263 |
| 774 | Ga0439449_0032811 | 3300042007 | Bacteria | 1935 |
| 775 | Ga0439449_0188187 | 3300042007 | Bacteria | 772 |
| 776 | Ga0439452_015478 | 3300042010 | Bacteria | 2092 |
| 777 | Ga0439452_016405 | 3300042010 | Bacteria | 2012 |
| 778 | Ga0439452_021212 | 3300042010 | Bacteria | 1696 |
| 779 | Ga0439457_002395 | 3300042014 | Bacteria | 5363 |
| 780 | Ga0439462_0001500 | 3300042015 | Bacteria | 5213 |
| 781 | Ga0439462_0004148 | 3300042015 | Bacteria | 3522 |
| 782 | Ga0439462_0066352 | 3300042015 | Bacteria | 978 |
| 783 | Ga0450911_000134 | 3300042115 | Bacteria | 29664 |
| 784 | Ga0450919_010575 | 3300042121 | Bacteria | 1052 |
| 785 | Ga0450921_001010 | 3300042123 | Bacteria | 1580 |
| 786 | Ga0450922_011408 | 3300042124 | Bacteria | 856 |
| 787 | Ga0450923_021486 | 3300042125 | Bacteria | 1259 |
| 788 | Ga0450888_000272 | 3300042126 | Bacteria | 4804 |
| 789 | Ga0450890_003629 | 3300042127 | Bacteria | 2042 |
| 790 | Ga0450890_015300 | 3300042127 | Bacteria | 1009 |
| 791 | Ga0450891_001401 | 3300042129 | Bacteria | 2497 |
| 792 | Ga0450892_000472 | 3300042130 | Bacteria | 4663 |
| 793 | Ga0450894_028707 | 3300042131 | Bacteria | 770 |
| 794 | Ga0450898_006086 | 3300042134 | Bacteria | 1844 |
| 795 | Ga0450898_007877 | 3300042134 | Bacteria | 1668 |
| 796 | Ga0450900_033784 | 3300042136 | Bacteria | 750 |
| 797 | Ga0450889_009467 | 3300042144 | Bacteria | 999 |
| 798 | Ga0450906_008220 | 3300042145 | Bacteria | 2027 |
| 799 | Ga0450906_017028 | 3300042145 | Bacteria | 1313 |
| 800 | Ga0450910_004640 | 3300042147 | Bacteria | 1859 |
| 801 | Ga0439446_0014107 | 3300042156 | Bacteria | 2201 |
| 802 | Ga0439446_0031700 | 3300042156 | Bacteria | 1531 |
| 803 | Ga0439434_0000210 | 3300042435 | Bacteria | 16132 |
| 804 | Ga0439434_0002390 | 3300042435 | Bacteria | 5452 |
| 805 | Ga0439434_0013492 | 3300042435 | Bacteria | 2426 |
| 806 | Ga0439459_0052398 | 3300042438 | Bacteria | 900 |
| 807 | Ga0450918_000761 | 3300042531 | Bacteria | 6832 |
| 808 | Ga0450893_0001075 | 3300042532 | Bacteria | 4105 |
| 809 | Ga0450893_0018034 | 3300042532 | Bacteria | 1201 |
| 810 | Ga0451577_0003919 | 3300042876 | Bacteria | 16077 |
| 811 | Ga0451577_0004095 | 3300042876 | Bacteria | 15657 |
| 812 | Ga0466969_0056066 | 3300044656 | Bacteria | 1925 |
| 813 | Ga0466972_0006287 | 3300044658 | Bacteria | 5965 |
| 814 | Ga0466972_0092644 | 3300044658 | Bacteria | 1432 |
| 815 | Ga0466972_0097997 | 3300044658 | Bacteria | 1388 |
| 816 | Ga0466972_0124065 | 3300044658 | Bacteria | 1217 |
| 817 | Ga0466972_0128525 | 3300044658 | Bacteria | 1193 |
| 818 | Ga0466965_0156740 | 3300044683 | Bacteria | 1192 |
| 819 | Ga0466966_0009251 | 3300044684 | Bacteria | 6523 |
| 820 | Ga0466966_0051238 | 3300044684 | Bacteria | 2624 |
| 821 | Ga0466961_0001449 | 3300044693 | Bacteria | 14742 |
| 822 | Ga0466961_0629790 | 3300044693 | Bacteria | 644 |
| 823 | Ga0466964_0115308 | 3300044706 | Bacteria | 1203 |
| 824 | Ga0466964_0143971 | 3300044706 | Bacteria | 1098 |
| 825 | Ga0453684_0178300 | 3300044712 | Bacteria | 2497 |
| 826 | Ga0453684_0944967 | 3300044712 | Bacteria | 920 |
| 827 | Ga0466971_0135585 | 3300044719 | Bacteria | 1145 |
| 828 | Ga0466968_0003118 | 3300044735 | Bacteria | 6115 |
| 829 | Ga0466970_0257622 | 3300044765 | Bacteria | 978 |
| 830 | Ga0466957_0526156 | 3300044842 | Bacteria | 822 |
| 831 | Ga0466957_1052621 | 3300044842 | Bacteria | 586 |
| 832 | Ga0466960_0007309 | 3300044901 | Bacteria | 4478 |
| 833 | Ga0466960_0079605 | 3300044901 | Bacteria | 1648 |
| 834 | Ga0466960_0119690 | 3300044901 | Bacteria | 1378 |
| 835 | Ga0466959_0003192 | 3300045049 | Bacteria | 10651 |
| 836 | Ga0466959_0044627 | 3300045049 | Bacteria | 3266 |
| 837 | Ga0466958_0008129 | 3300045836 | Bacteria | 5807 |
| 838 | Ga0466958_0112405 | 3300045836 | Bacteria | 1701 |
| 839 | Ga0466967_0085388 | 3300045976 | Bacteria | 2858 |
| 840 | Ga0466967_0553630 | 3300045976 | Bacteria | 1132 |
| 841 | Ga0495627_013446 | 3300046453 | Bacteria | 2879 |
| 842 | Ga0495592_0054735 | 3300046454 | Bacteria | 2954 |
| 843 | Ga0495592_0678325 | 3300046454 | Bacteria | 622 |
| 844 | Ga0495590_0019400 | 3300046457 | Bacteria | 2424 |
| 845 | Ga0495629_0008209 | 3300046459 | Bacteria | 7678 |
| 846 | Ga0495638_0007506 | 3300046460 | Bacteria | 7806 |
| 847 | Ga0495638_0238952 | 3300046460 | Bacteria | 1007 |
| 848 | Ga0495651_0017763 | 3300046462 | Bacteria | 5507 |
| 849 | Ga0495651_0034392 | 3300046462 | Bacteria | 3949 |
| 850 | Ga0495653_0055208 | 3300046463 | Bacteria | 3032 |
| 851 | Ga0495605_0057631 | 3300046474 | Bacteria | 1869 |
| 852 | Ga0495639_0146697 | 3300046475 | Bacteria | 1137 |
| 853 | Ga0495664_0013389 | 3300046477 | Bacteria | 4651 |
| 854 | Ga0495664_0038578 | 3300046477 | Bacteria | 2820 |
| 855 | Ga0495585_0329478 | 3300046492 | Bacteria | 745 |
| 856 | Ga0495607_0108397 | 3300046501 | Bacteria | 1476 |
| 857 | Ga0495583_0000024 | 3300046506 | Bacteria | 274122 |
| 858 | Ga0495583_0060284 | 3300046506 | Bacteria | 1697 |
| 859 | Ga0495583_0119066 | 3300046506 | Bacteria | 1113 |
| 860 | Ga0495606_0056889 | 3300046507 | Bacteria | 2521 |
| 861 | Ga0495606_0302832 | 3300046507 | Bacteria | 865 |
| 862 | Ga0495608_0095065 | 3300046511 | Bacteria | 1925 |
| 863 | Ga0495616_0077637 | 3300046513 | Bacteria | 1594 |
| 864 | Ga0495620_0030296 | 3300046515 | Bacteria | 2493 |
| 865 | Ga0495620_0108092 | 3300046515 | Bacteria | 1104 |
| 866 | Ga0495628_0037903 | 3300046516 | Bacteria | 3862 |
| 867 | Ga0495628_0568165 | 3300046516 | Bacteria | 813 |
| 868 | Ga0495630_0433509 | 3300046517 | Bacteria | 1007 |
| 869 | Ga0495630_0707507 | 3300046517 | Bacteria | 771 |
| 870 | Ga0495631_0160163 | 3300046518 | Bacteria | 966 |
| 871 | Ga0495632_0030226 | 3300046519 | Bacteria | 2814 |
| 872 | Ga0495632_0272332 | 3300046519 | Bacteria | 755 |
| 873 | Ga0495632_0284786 | 3300046519 | Bacteria | 735 |
| 874 | Ga0495637_0008735 | 3300046520 | Bacteria | 4965 |
| 875 | Ga0495637_0100302 | 3300046520 | Bacteria | 1132 |
| 876 | Ga0495643_0005950 | 3300046522 | Bacteria | 8139 |
| 877 | Ga0495643_0043864 | 3300046522 | Bacteria | 2431 |
| 878 | Ga0495643_0110535 | 3300046522 | Bacteria | 1398 |
| 879 | Ga0495643_0161471 | 3300046522 | Bacteria | 1102 |
| 880 | Ga0495643_0246945 | 3300046522 | Bacteria | 835 |
| 881 | Ga0495648_0001207 | 3300046524 | Bacteria | 25895 |
| 882 | Ga0495663_0167630 | 3300046525 | Bacteria | 756 |
| 883 | Ga0495642_0012335 | 3300046528 | Bacteria | 3294 |
| 884 | Ga0495652_0030167 | 3300046529 | Bacteria | 4758 |
| 885 | Ga0495652_0103323 | 3300046529 | Bacteria | 2307 |
| 886 | Ga0495640_0015972 | 3300046533 | Bacteria | 5632 |
| 887 | Ga0495640_0027981 | 3300046533 | Bacteria | 4061 |
| 888 | Ga0495587_0006868 | 3300046536 | Bacteria | 7396 |
| 889 | Ga0495597_0001605 | 3300046542 | Bacteria | 15862 |
| 890 | Ga0495597_0012409 | 3300046542 | Bacteria | 4111 |
| 891 | Ga0495622_0008216 | 3300046557 | Bacteria | 4836 |
| 892 | Ga0495622_0021100 | 3300046557 | Bacteria | 3035 |
| 893 | Ga0495633_0000871 | 3300046558 | Bacteria | 26182 |
| 894 | Ga0495633_0014709 | 3300046558 | Bacteria | 4080 |
| 895 | Ga0495667_0042387 | 3300046559 | Bacteria | 3018 |
| 896 | Ga0495668_0024509 | 3300046616 | Bacteria | 3431 |
| 897 | Ga0495668_0047976 | 3300046616 | Bacteria | 2370 |
| 898 | Ga0495668_0158108 | 3300046616 | Bacteria | 1241 |
| 899 | Ga0495668_0283565 | 3300046616 | Bacteria | 908 |
| 900 | Ga0495611_0165996 | 3300046648 | Bacteria | 1032 |
| 901 | Ga0495625_0000661 | 3300046660 | Bacteria | 49248 |
| 902 | Ga0495625_0051113 | 3300046660 | Bacteria | 2964 |
| 903 | Ga0495625_0214547 | 3300046660 | Bacteria | 1264 |
| 904 | Ga0495625_0450965 | 3300046660 | Bacteria | 795 |
| 905 | Ga0495635_0010642 | 3300046663 | Bacteria | 6439 |
| 906 | Ga0495661_0017236 | 3300046665 | Bacteria | 4770 |
| 907 | Ga0495661_0219511 | 3300046665 | Bacteria | 986 |
| 908 | Ga0495588_0015869 | 3300046674 | Bacteria | 3633 |
| 909 | Ga0495657_0010266 | 3300046675 | Bacteria | 7048 |
| 910 | Ga0495657_0029366 | 3300046675 | Bacteria | 3857 |
| 911 | Ga0495599_0031929 | 3300046678 | Bacteria | 3305 |
| 912 | Ga0495623_0053661 | 3300046679 | Bacteria | 2544 |
| 913 | Ga0495646_0082543 | 3300046680 | Bacteria | 1870 |
| 914 | Ga0495669_0256037 | 3300046684 | Bacteria | 841 |
| 915 | Ga0495613_0013192 | 3300046689 | Bacteria | 6140 |
| 916 | Ga0495624_0306664 | 3300046690 | Bacteria | 957 |
| 917 | Ga0495670_0000034 | 3300046691 | Bacteria | 80461 |
| 918 | Ga0495670_0088845 | 3300046691 | Bacteria | 1580 |
| 919 | Ga0495671_0005640 | 3300046692 | Bacteria | 7300 |
| 920 | Ga0495671_0035828 | 3300046692 | Bacteria | 2518 |
| 921 | Ga0495671_0385169 | 3300046692 | Bacteria | 672 |
| 922 | Ga0495649_0015662 | 3300046694 | Bacteria | 4311 |
| 923 | Ga0495649_0038349 | 3300046694 | Bacteria | 2629 |
| 924 | Ga0495589_0090942 | 3300046794 | Bacteria | 1482 |
| 925 | Ga0495600_0009990 | 3300046809 | Bacteria | 5882 |
| 926 | Ga0495660_0037841 | 3300046810 | Bacteria | 2686 |
| 927 | Ga0495660_0065627 | 3300046810 | Bacteria | 1937 |
| 928 | Ga0495660_0274839 | 3300046810 | Bacteria | 773 |
| 929 | Ga0495581_0094671 | 3300047315 | Bacteria | 1734 |
| 930 | Ga0495604_0040795 | 3300047317 | Bacteria | 3642 |
| 931 | Ga0495604_0050432 | 3300047317 | Bacteria | 3231 |
| 932 | Ga0495674_0022726 | 3300047319 | Bacteria | 5781 |
| 933 | Ga0495672_0046228 | 3300047320 | Bacteria | 2597 |
| 934 | Ga0495672_0046400 | 3300047320 | Bacteria | 2591 |
| 935 | Ga0495676_0037455 | 3300047321 | Bacteria | 4036 |
| 936 | Ga0495680_0007641 | 3300047322 | Bacteria | 9871 |
| 937 | Ga0495683_0039430 | 3300047323 | Bacteria | 2388 |
| 938 | Ga0495683_0049204 | 3300047323 | Bacteria | 2112 |
| 939 | Ga0495687_011306 | 3300047443 | Bacteria | 4812 |
| 940 | Ga0495687_055523 | 3300047443 | Bacteria | 1655 |
| 941 | Ga0495687_084996 | 3300047443 | Bacteria | 1228 |
| 942 | Ga0495675_0010586 | 3300047444 | Bacteria | 5764 |
| 943 | Ga0495677_0060603 | 3300047445 | Bacteria | 1403 |
| 944 | Ga0495673_0047410 | 3300047469 | Bacteria | 1899 |
| 945 | Ga0495681_0021947 | 3300047470 | Bacteria | 3427 |
| 946 | Ga0495684_0146922 | 3300047471 | Bacteria | 1765 |
| 947 | Ga0495686_0027203 | 3300047472 | Bacteria | 3736 |
| 948 | Ga0495686_0066061 | 3300047472 | Bacteria | 2236 |
| 949 | Ga0495686_0075449 | 3300047472 | Bacteria | 2067 |
| 950 | Ga0495686_0205830 | 3300047472 | Bacteria | 1127 |
| 951 | Ga0495686_0205984 | 3300047472 | Bacteria | 1126 |
| 952 | Ga0495686_0483967 | 3300047472 | Bacteria | 654 |
| 953 | Ga0495593_0027633 | 3300047673 | Bacteria | 3122 |
| 954 | Ga0495593_0205615 | 3300047673 | Bacteria | 989 |
| 955 | Ga0495602_0013736 | 3300048088 | Bacteria | 8258 |
| 956 | Ga0495614_0085393 | 3300048089 | Bacteria | 1370 |
| 957 | Ga0496100_0126311 | 3300048903 | Bacteria | 1795 |
| 958 | Ga0496100_0441055 | 3300048903 | Bacteria | 997 |
| 959 | Ga0496101_0005794 | 3300048904 | Bacteria | 7898 |
| 960 | Ga0496101_0182361 | 3300048904 | Bacteria | 1617 |
| 961 | Ga0496101_0404276 | 3300048904 | Bacteria | 1075 |
| 962 | Ga0496102_0040088 | 3300048905 | Bacteria | 4235 |
| 963 | Ga0496102_0110237 | 3300048905 | Bacteria | 2565 |
| 964 | Ga0496102_0170304 | 3300048905 | Bacteria | 2050 |
| 965 | Ga0496102_0289399 | 3300048905 | Bacteria | 1544 |
| 966 | Ga0496102_0583486 | 3300048905 | Bacteria | 1041 |
| 967 | Ga0496102_0861378 | 3300048905 | Bacteria | 828 |
| 968 | Ga0496102_1071204 | 3300048905 | Bacteria | 726 |
| 969 | Ga0496103_0144459 | 3300048906 | Bacteria | 1522 |
| 970 | Ga0496103_0224472 | 3300048906 | Bacteria | 1208 |
| 971 | Ga0496104_0034944 | 3300048907 | Bacteria | 4690 |
| 972 | Ga0496104_0061336 | 3300048907 | Bacteria | 3565 |
| 973 | Ga0496104_0186575 | 3300048907 | Bacteria | 1984 |
| 974 | Ga0496104_0492395 | 3300048907 | Bacteria | 1137 |
| 975 | Ga0496105_0055861 | 3300048908 | Bacteria | 3259 |
| 976 | Ga0496105_0068847 | 3300048908 | Bacteria | 2924 |
| 977 | Ga0496106_0008009 | 3300048909 | Bacteria | 7808 |
| 978 | Ga0496106_0117954 | 3300048909 | Bacteria | 2072 |
| 979 | Ga0496107_0032954 | 3300048910 | Bacteria | 3705 |
| 980 | Ga0496107_0033498 | 3300048910 | Bacteria | 3676 |
| 981 | Ga0496107_0056811 | 3300048910 | Bacteria | 2828 |
| 982 | Ga0496107_0154085 | 3300048910 | Bacteria | 1701 |
| 983 | Ga0496108_0446804 | 3300048911 | Bacteria | 1129 |
| 984 | Ga0496109_0020128 | 3300048912 | Bacteria | 5895 |
| 985 | Ga0496109_0035717 | 3300048912 | Bacteria | 4485 |
| 986 | Ga0496109_0079304 | 3300048912 | Bacteria | 3025 |
| 987 | Ga0496109_0338989 | 3300048912 | Bacteria | 1420 |
| 988 | Ga0496110_0059452 | 3300048913 | Bacteria | 3369 |
| 989 | Ga0496111_0138168 | 3300048914 | Bacteria | 1806 |
| 990 | Ga0496112_0132215 | 3300048915 | Bacteria | 2466 |
| 991 | Ga0496112_0344962 | 3300048915 | Bacteria | 1432 |
| 992 | Ga0496113_0076453 | 3300048916 | Bacteria | 2558 |
| 993 | Ga0496113_0709227 | 3300048916 | Bacteria | 802 |
| 994 | Ga0496113_0711314 | 3300048916 | Bacteria | 801 |
| 995 | Ga0496114_0026528 | 3300048917 | Bacteria | 4743 |
| 996 | Ga0496114_0314262 | 3300048917 | Bacteria | 1384 |
| 997 | Ga0496115_0179355 | 3300048918 | Bacteria | 1751 |
| 998 | Ga0496115_0182219 | 3300048918 | Bacteria | 1736 |
| 999 | Ga0496115_0223528 | 3300048918 | Bacteria | 1554 |
| 1000 | Ga0496116_0149126 | 3300048919 | Bacteria | 1302 |
| 1001 | Ga0496117_0051694 | 3300048920 | Bacteria | 2902 |
| 1002 | Ga0496118_0010190 | 3300048921 | Bacteria | 9334 |
| 1003 | Ga0496118_0041072 | 3300048921 | Bacteria | 3668 |
| 1004 | Ga0496118_0154618 | 3300048921 | Bacteria | 1429 |
| 1005 | Ga0496118_0306668 | 3300048921 | Bacteria | 869 |
| 1006 | Ga0496119_0012917 | 3300048922 | Bacteria | 6722 |
| 1007 | Ga0496119_0078747 | 3300048922 | Bacteria | 1905 |
| 1008 | Ga0496119_0083482 | 3300048922 | Bacteria | 1834 |
| 1009 | Ga0496119_0099360 | 3300048922 | Bacteria | 1637 |
| 1010 | Ga0496119_0154960 | 3300048922 | Bacteria | 1224 |
| 1011 | Ga0496120_0000435 | 3300048923 | Bacteria | 66035 |
| 1012 | Ga0496120_0021764 | 3300048923 | Bacteria | 4044 |
| 1013 | Ga0496120_0033527 | 3300048923 | Bacteria | 3084 |
| 1014 | Ga0496120_0044804 | 3300048923 | Bacteria | 2568 |
| 1015 | Ga0496120_0069714 | 3300048923 | Bacteria | 1936 |
| 1016 | Ga0496120_0217169 | 3300048923 | Bacteria | 916 |
| 1017 | Ga0496121_0000091 | 3300048924 | Bacteria | 216685 |
| 1018 | Ga0496121_0006917 | 3300048924 | Bacteria | 13831 |
| 1019 | Ga0496121_0015919 | 3300048924 | Bacteria | 7811 |
| 1020 | Ga0496121_0044637 | 3300048924 | Bacteria | 3820 |
| 1021 | Ga0496121_0045073 | 3300048924 | Bacteria | 3794 |
| 1022 | Ga0496121_0113744 | 3300048924 | Bacteria | 2059 |
| 1023 | Ga0496121_0184812 | 3300048924 | Bacteria | 1500 |
| 1024 | Ga0496121_0212339 | 3300048924 | Bacteria | 1370 |
| 1025 | Ga0496121_0297836 | 3300048924 | Bacteria | 1096 |
| 1026 | Ga0496121_0573820 | 3300048924 | Bacteria | 701 |
| 1027 | Ga0496121_0668779 | 3300048924 | Bacteria | 630 |
| 1028 | Ga0496122_0035517 | 3300048925 | Bacteria | 4052 |
| 1029 | Ga0496122_0039013 | 3300048925 | Bacteria | 3794 |
| 1030 | Ga0496122_0074747 | 3300048925 | Bacteria | 2395 |
| 1031 | Ga0496122_0142567 | 3300048925 | Bacteria | 1496 |
| 1032 | Ga0496123_0004305 | 3300048926 | Bacteria | 15121 |
| 1033 | Ga0496123_0048893 | 3300048926 | Bacteria | 2841 |
| 1034 | Ga0496124_0028741 | 3300048927 | Bacteria | 4967 |
| 1035 | Ga0496124_0049080 | 3300048927 | Bacteria | 3602 |
| 1036 | Ga0496124_0058454 | 3300048927 | Bacteria | 3243 |
| 1037 | Ga0496124_0191405 | 3300048927 | Bacteria | 1565 |
| 1038 | Ga0496124_0278167 | 3300048927 | Bacteria | 1222 |
| 1039 | Ga0496124_0344703 | 3300048927 | Bacteria | 1056 |
| 1040 | Ga0496124_0365434 | 3300048927 | Bacteria | 1015 |
| 1041 | Ga0496124_0483987 | 3300048927 | Bacteria | 835 |
| 1042 | Ga0496124_0841026 | 3300048927 | Bacteria | 564 |
| 1043 | Ga0496125_0000352 | 3300048928 | Bacteria | 87143 |
| 1044 | Ga0496125_0016745 | 3300048928 | Bacteria | 7030 |
| 1045 | Ga0496125_0016750 | 3300048928 | Bacteria | 7027 |
| 1046 | Ga0496125_0044128 | 3300048928 | Bacteria | 3775 |
| 1047 | Ga0496125_0212638 | 3300048928 | Bacteria | 1254 |
| 1048 | Ga0496125_0236479 | 3300048928 | Bacteria | 1163 |
| 1049 | Ga0496126_0007394 | 3300048929 | Bacteria | 12047 |
| 1050 | Ga0496126_0023157 | 3300048929 | Bacteria | 6021 |
| 1051 | Ga0496126_0027931 | 3300048929 | Bacteria | 5381 |
| 1052 | Ga0496126_0059973 | 3300048929 | Bacteria | 3424 |
| 1053 | Ga0496126_0061639 | 3300048929 | Bacteria | 3369 |
| 1054 | Ga0496126_0077591 | 3300048929 | Bacteria | 2945 |
| 1055 | Ga0496126_0107156 | 3300048929 | Bacteria | 2437 |
| 1056 | Ga0496126_0129166 | 3300048929 | Bacteria | 2185 |
| 1057 | Ga0496126_0237816 | 3300048929 | Bacteria | 1523 |
| 1058 | Ga0496126_0266800 | 3300048929 | Bacteria | 1422 |
| 1059 | Ga0496126_0547400 | 3300048929 | Bacteria | 919 |
| 1060 | Ga0496126_0569428 | 3300048929 | Bacteria | 896 |
| 1061 | Ga0501310_029544 | 3300049130 | Bacteria | 723 |
| 1062 | Ga0501294_007359 | 3300049517 | Bacteria | 1062 |
| 1063 | Ga0501300_005430 | 3300049523 | Bacteria | 1877 |
| 1064 | Ga0501031_0129954 | 3300049568 | Bacteria | 1645 |
| 1065 | Ga0501031_0411918 | 3300049568 | Bacteria | 874 |
| 1066 | Ga0501032_0006968 | 3300049569 | Bacteria | 8287 |
| 1067 | Ga0501032_0023507 | 3300049569 | Bacteria | 4257 |
| 1068 | Ga0501032_0111332 | 3300049569 | Bacteria | 1811 |
| 1069 | Ga0501033_0007935 | 3300049570 | Bacteria | 8221 |
| 1070 | Ga0501033_0048490 | 3300049570 | Bacteria | 3154 |
| 1071 | Ga0501033_0073442 | 3300049570 | Bacteria | 2511 |
| 1072 | Ga0501033_0117411 | 3300049570 | Bacteria | 1933 |
| 1073 | Ga0501033_0170694 | 3300049570 | Bacteria | 1562 |
| 1074 | Ga0501033_0205263 | 3300049570 | Bacteria | 1406 |
| 1075 | Ga0501033_0369248 | 3300049570 | Bacteria | 1003 |
| 1076 | Ga0501033_0578043 | 3300049570 | Bacteria | 772 |
| 1077 | Ga0501034_0006155 | 3300049571 | Bacteria | 12940 |
| 1078 | Ga0501034_0009755 | 3300049571 | Bacteria | 10040 |
| 1079 | Ga0501034_0025344 | 3300049571 | Bacteria | 6037 |
| 1080 | Ga0501034_0025864 | 3300049571 | Bacteria | 5977 |
| 1081 | Ga0501034_0029777 | 3300049571 | Bacteria | 5549 |
| 1082 | Ga0501034_0076321 | 3300049571 | Bacteria | 3358 |
| 1083 | Ga0501034_0414000 | 3300049571 | Bacteria | 1270 |
| 1084 | Ga0501034_0529334 | 3300049571 | Bacteria | 1090 |
| 1085 | Ga0501034_0690326 | 3300049571 | Bacteria | 920 |
| 1086 | Ga0501036_0001698 | 3300049572 | Bacteria | 17103 |
| 1087 | Ga0501036_0152991 | 3300049572 | Bacteria | 1945 |
| 1088 | Ga0501036_0188319 | 3300049572 | Bacteria | 1737 |
| 1089 | Ga0501036_0285367 | 3300049572 | Bacteria | 1381 |
| 1090 | Ga0501036_0356885 | 3300049572 | Bacteria | 1220 |
| 1091 | Ga0501037_0021179 | 3300049573 | Bacteria | 4803 |
| 1092 | Ga0501037_0031114 | 3300049573 | Bacteria | 3941 |
| 1093 | Ga0501037_0035110 | 3300049573 | Bacteria | 3698 |
| 1094 | Ga0501037_0115841 | 3300049573 | Bacteria | 1929 |
| 1095 | Ga0501037_0312295 | 3300049573 | Bacteria | 1089 |
| 1096 | Ga0501038_0016637 | 3300049574 | Bacteria | 6666 |
| 1097 | Ga0501038_0018939 | 3300049574 | Bacteria | 6213 |
| 1098 | Ga0501038_0020329 | 3300049574 | Bacteria | 5970 |
| 1099 | Ga0501038_0206876 | 3300049574 | Bacteria | 1572 |
| 1100 | Ga0501038_0317014 | 3300049574 | Bacteria | 1220 |
| 1101 | Ga0501038_0461937 | 3300049574 | Bacteria | 975 |
| 1102 | Ga0501038_0633520 | 3300049574 | Bacteria | 806 |
| 1103 | Ga0501039_0152154 | 3300049575 | Bacteria | 1817 |
| 1104 | Ga0501039_0181004 | 3300049575 | Bacteria | 1657 |
| 1105 | Ga0501040_0106110 | 3300049576 | Bacteria | 1963 |
| 1106 | Ga0501042_0061964 | 3300049578 | Bacteria | 2672 |
| 1107 | Ga0501043_0014288 | 3300049579 | Bacteria | 6213 |
| 1108 | Ga0501043_0014731 | 3300049579 | Bacteria | 6122 |
| 1109 | Ga0501043_0146383 | 3300049579 | Bacteria | 1849 |
| 1110 | Ga0501043_0178804 | 3300049579 | Bacteria | 1653 |
| 1111 | Ga0501046_0008710 | 3300049580 | Bacteria | 8817 |
| 1112 | Ga0501046_0840601 | 3300049580 | Bacteria | 642 |
| 1113 | Ga0501047_0018727 | 3300049581 | Bacteria | 6638 |
| 1114 | Ga0501047_0025481 | 3300049581 | Bacteria | 5686 |
| 1115 | Ga0501047_0062178 | 3300049581 | Bacteria | 3602 |
| 1116 | Ga0501047_0088364 | 3300049581 | Bacteria | 2976 |
| 1117 | Ga0501047_0198864 | 3300049581 | Bacteria | 1865 |
| 1118 | Ga0501047_0199795 | 3300049581 | Bacteria | 1860 |
| 1119 | Ga0501047_0314389 | 3300049581 | Bacteria | 1406 |
| 1120 | Ga0501047_0314395 | 3300049581 | Bacteria | 1406 |
| 1121 | Ga0501047_0376744 | 3300049581 | Bacteria | 1254 |
| 1122 | Ga0501048_0072858 | 3300049582 | Bacteria | 2424 |
| 1123 | Ga0501048_0166654 | 3300049582 | Bacteria | 1560 |
| 1124 | Ga0501048_0376103 | 3300049582 | Bacteria | 1014 |
| 1125 | Ga0501067_0104061 | 3300049583 | Bacteria | 1577 |
| 1126 | Ga0501068_0078871 | 3300049584 | Bacteria | 2019 |
| 1127 | Ga0501068_0255419 | 3300049584 | Bacteria | 1118 |
| 1128 | Ga0501070_0159115 | 3300049586 | Bacteria | 1862 |
| 1129 | Ga0501070_0182568 | 3300049586 | Bacteria | 1726 |
| 1130 | Ga0501070_0233999 | 3300049586 | Bacteria | 1505 |
| 1131 | Ga0501070_0512275 | 3300049586 | Bacteria | 963 |
| 1132 | Ga0501073_0011914 | 3300049589 | Bacteria | 6347 |
| 1133 | Ga0501073_0042668 | 3300049589 | Bacteria | 3200 |
| 1134 | Ga0501073_0090090 | 3300049589 | Bacteria | 2132 |
| 1135 | Ga0501074_0172343 | 3300049590 | Bacteria | 1544 |
| 1136 | Ga0501074_0187422 | 3300049590 | Bacteria | 1475 |
| 1137 | Ga0501211_001650 | 3300049658 | Bacteria | 2389 |
| 1138 | Ga0501217_022639 | 3300049661 | Bacteria | 1492 |
| 1139 | Ga0501222_012228 | 3300049662 | Bacteria | 1130 |
| 1140 | Ga0501235_046995 | 3300049669 | Bacteria | 994 |
| 1141 | Ga0501249_002521 | 3300049679 | Bacteria | 3699 |
| 1142 | Ga0501257_000883 | 3300049686 | Bacteria | 6052 |
| 1143 | Ga0501258_000994 | 3300049687 | Bacteria | 2180 |
| 1144 | Ga0501259_066400 | 3300049688 | Bacteria | 765 |
| 1145 | Ga0501229_002101 | 3300049706 | Bacteria | 2336 |
| 1146 | Ga0501080_0000625 | 3300049742 | Bacteria | 28031 |
| 1147 | Ga0501080_0085300 | 3300049742 | Bacteria | 2934 |
| 1148 | Ga0501080_0110133 | 3300049742 | Bacteria | 2552 |
| 1149 | Ga0501080_0122796 | 3300049742 | Bacteria | 2406 |
| 1150 | Ga0501080_0688588 | 3300049742 | Bacteria | 902 |
| 1151 | Ga0501083_0023237 | 3300049744 | Bacteria | 4301 |
| 1152 | Ga0501083_0267834 | 3300049744 | Bacteria | 1111 |
| 1153 | Ga0501241_031036 | 3300049758 | Bacteria | 1010 |
| 1154 | Ga0501262_000489 | 3300049759 | Bacteria | 4715 |
| 1155 | Ga0501267_010271 | 3300049764 | Bacteria | 943 |
| 1156 | Ga0501035_0011712 | 3300049822 | Bacteria | 8124 |
| 1157 | Ga0501035_0077553 | 3300049822 | Bacteria | 2936 |
| 1158 | Ga0501035_0082194 | 3300049822 | Bacteria | 2843 |
| 1159 | Ga0501035_0107220 | 3300049822 | Bacteria | 2449 |
| 1160 | Ga0501035_0130654 | 3300049822 | Bacteria | 2189 |
| 1161 | Ga0501035_0156326 | 3300049822 | Bacteria | 1976 |
| 1162 | Ga0501035_0281105 | 3300049822 | Bacteria | 1406 |
| 1163 | Ga0501035_0319959 | 3300049822 | Bacteria | 1303 |
| 1164 | Ga0501044_0024139 | 3300049823 | Bacteria | 6459 |
| 1165 | Ga0501044_0035800 | 3300049823 | Bacteria | 5196 |
| 1166 | Ga0501044_0037635 | 3300049823 | Bacteria | 5055 |
| 1167 | Ga0501044_0043203 | 3300049823 | Bacteria | 4683 |
| 1168 | Ga0501044_0107275 | 3300049823 | Bacteria | 2804 |
| 1169 | Ga0501044_0183152 | 3300049823 | Bacteria | 2060 |
| 1170 | Ga0501044_0215536 | 3300049823 | Bacteria | 1872 |
| 1171 | Ga0501044_0273502 | 3300049823 | Bacteria | 1624 |
| 1172 | Ga0501044_1092902 | 3300049823 | Bacteria | 667 |
| 1173 | Ga0501045_0039912 | 3300049824 | Bacteria | 3415 |
| 1174 | nmdc:mga03683_11473_c1 | 3300050489 | Bacteria | 3210 |
| 1175 | nmdc:mga03683_174394_c1 | 3300050489 | Bacteria | 978 |
| 1176 | nmdc:mga03683_32994_c1 | 3300050489 | Bacteria | 2086 |
| 1177 | nmdc:mga03683_65825_c1 | 3300050489 | Bacteria | 1540 |
| 1178 | nmdc:mga03683_87305_c1 | 3300050489 | Bacteria | 1355 |
| 1179 | nmdc:mga03n38_11305_c1 | 3300050490 | Bacteria | 3320 |
| 1180 | nmdc:mga00v17_16100_c1 | 3300050491 | Bacteria | 4210 |
| 1181 | nmdc:mga00v17_29018_c1 | 3300050491 | Bacteria | 3244 |
| 1182 | nmdc:mga00v17_37311_c1 | 3300050491 | Bacteria | 2901 |
| 1183 | nmdc:mga00v17_69892_c1 | 3300050491 | Bacteria | 2174 |
| 1184 | nmdc:mga00v17_86082_c1 | 3300050491 | Bacteria | 1969 |
| 1185 | nmdc:mga0yw44_17340_c1 | 3300050492 | Bacteria | 3917 |
| 1186 | nmdc:mga0yw44_19198_c1 | 3300050492 | Bacteria | 3764 |
| 1187 | nmdc:mga0yw44_34925_c1 | 3300050492 | Bacteria | 2950 |
| 1188 | nmdc:mga0yw44_452584_c1 | 3300050492 | Bacteria | 870 |
| 1189 | nmdc:mga0k408_10077_c1 | 3300050493 | Bacteria | 5105 |
| 1190 | nmdc:mga0k408_13160_c3 | 3300050493 | Bacteria | 2518 |
| 1191 | nmdc:mga0k408_379440_c1 | 3300050493 | Bacteria | 842 |
| 1192 | nmdc:mga0k408_41720_c1 | 3300050493 | Bacteria | 2642 |
| 1193 | nmdc:mga0k408_53718_c2 | 3300050493 | Bacteria | 1644 |
| 1194 | nmdc:mga06z11_189016_c1 | 3300050494 | Bacteria | 1191 |
| 1195 | nmdc:mga06z11_88562_c1 | 3300050494 | Bacteria | 1676 |
| 1196 | nmdc:mga04h51_31440_c1 | 3300050495 | Bacteria | 1677 |
| 1197 | nmdc:mga07m45_12486_c1 | 3300050496 | Bacteria | 4491 |
| 1198 | nmdc:mga07m45_1970_c1 | 3300050496 | Bacteria | 9504 |
| 1199 | nmdc:mga07m45_2447_c1 | 3300050496 | Bacteria | 8719 |
| 1200 | nmdc:mga07m45_26459_c1 | 3300050496 | Bacteria | 3189 |
| 1201 | nmdc:mga07m45_36002_c1 | 3300050496 | Bacteria | 2755 |
| 1202 | nmdc:mga07m45_88246_c1 | 3300050496 | Bacteria | 1775 |
| 1203 | nmdc:mga08x19_252343_c1 | 3300050514 | Bacteria | 1218 |
| 1204 | nmdc:mga0sz30_143250_c1 | 3300050516 | Bacteria | 1056 |
| 1205 | nmdc:mga0sz30_279959_c1 | 3300050516 | Bacteria | 743 |
| 1206 | nmdc:mga0sz30_290396_c1 | 3300050516 | Bacteria | 729 |
| 1207 | nmdc:mga0sz30_359214_c1 | 3300050516 | Bacteria | 651 |
| 1208 | nmdc:mga0sz30_55009_c1 | 3300050516 | Bacteria | 1693 |
| 1209 | Ga0500610_0097753 | 3300053079 | Bacteria | 1521 |
| 1210 | Ga0500578_0017074 | 3300053086 | Bacteria | 4664 |
| 1211 | Ga0500643_000117 | 3300053087 | Bacteria | 82982 |
| 1212 | Ga0500643_013466 | 3300053087 | Bacteria | 2886 |
| 1213 | Ga0500643_025299 | 3300053087 | Bacteria | 1874 |
| 1214 | Ga0500644_0318434 | 3300053088 | Bacteria | 668 |
| 1215 | Ga0500646_0081632 | 3300053090 | Bacteria | 987 |
| 1216 | Ga0500647_0043082 | 3300053091 | Bacteria | 2167 |
| 1217 | Ga0500583_0008979 | 3300053092 | Bacteria | 3625 |
| 1218 | Ga0500583_0013885 | 3300053092 | Bacteria | 3133 |
| 1219 | Ga0500583_0114636 | 3300053092 | Bacteria | 1330 |
| 1220 | Ga0500651_0029989 | 3300053093 | Bacteria | 3421 |
| 1221 | Ga0500566_0000089 | 3300053094 | Bacteria | 45622 |
| 1222 | Ga0500566_0007716 | 3300053094 | Bacteria | 6381 |
| 1223 | Ga0500566_0284604 | 3300053094 | Bacteria | 786 |
| 1224 | Ga0500566_0365025 | 3300053094 | Bacteria | 657 |
| 1225 | Ga0500641_0016651 | 3300053096 | Bacteria | 2740 |
| 1226 | Ga0500650_0043101 | 3300053098 | Bacteria | 2086 |
| 1227 | Ga0500650_0121583 | 3300053098 | Bacteria | 1217 |
| 1228 | Ga0500555_022776 | 3300053103 | Bacteria | 1797 |
| 1229 | Ga0500556_0110918 | 3300053104 | Bacteria | 1063 |
| 1230 | Ga0500556_0165983 | 3300053104 | Bacteria | 872 |
| 1231 | Ga0500557_000089 | 3300053105 | Bacteria | 31156 |
| 1232 | Ga0500562_001563 | 3300053108 | Bacteria | 5679 |
| 1233 | Ga0500562_008747 | 3300053108 | Bacteria | 2558 |
| 1234 | Ga0500569_001966 | 3300053109 | Bacteria | 3986 |
| 1235 | Ga0500593_001529 | 3300053117 | Bacteria | 8308 |
| 1236 | Ga0500594_0023917 | 3300053118 | Bacteria | 1553 |
| 1237 | Ga0500595_105080 | 3300053119 | Bacteria | 806 |
| 1238 | Ga0500597_009365 | 3300053120 | Bacteria | 3441 |
| 1239 | Ga0500597_087200 | 3300053120 | Bacteria | 1355 |
| 1240 | Ga0500607_000992 | 3300053121 | Bacteria | 27011 |
| 1241 | Ga0500607_084049 | 3300053121 | Bacteria | 1617 |
| 1242 | Ga0500608_000056 | 3300053122 | Bacteria | 48877 |
| 1243 | Ga0500608_065252 | 3300053122 | Bacteria | 1737 |
| 1244 | Ga0500617_141819 | 3300053124 | Bacteria | 963 |
| 1245 | Ga0500642_0002259 | 3300053130 | Bacteria | 5623 |
| 1246 | Ga0500642_0010858 | 3300053130 | Bacteria | 3232 |
| 1247 | Ga0500652_007545 | 3300053131 | Bacteria | 3567 |
| 1248 | Ga0500652_221352 | 3300053131 | Bacteria | 761 |
| 1249 | Ga0500658_0002356 | 3300053134 | Bacteria | 7321 |
| 1250 | Ga0500658_0023945 | 3300053134 | Bacteria | 2336 |
| 1251 | Ga0500658_0042641 | 3300053134 | Bacteria | 1824 |
| 1252 | Ga0500658_0273580 | 3300053134 | Bacteria | 776 |
| 1253 | Ga0500559_0000251 | 3300053136 | Bacteria | 42552 |
| 1254 | Ga0500559_0003661 | 3300053136 | Bacteria | 7515 |
| 1255 | Ga0500559_0022448 | 3300053136 | Bacteria | 2676 |
| 1256 | Ga0500559_0025312 | 3300053136 | Bacteria | 2525 |
| 1257 | Ga0500559_0097098 | 3300053136 | Bacteria | 1354 |
| 1258 | Ga0500559_0295541 | 3300053136 | Bacteria | 761 |
| 1259 | Ga0500564_106654 | 3300053138 | Bacteria | 1233 |
| 1260 | Ga0500568_0006855 | 3300053139 | Bacteria | 5670 |
| 1261 | Ga0500568_0010336 | 3300053139 | Bacteria | 4377 |
| 1262 | Ga0500568_0013851 | 3300053139 | Bacteria | 3662 |
| 1263 | Ga0500568_0087030 | 3300053139 | Bacteria | 1181 |
| 1264 | Ga0500568_0131743 | 3300053139 | Bacteria | 929 |
| 1265 | Ga0500568_0146741 | 3300053139 | Bacteria | 874 |
| 1266 | Ga0500573_0000021 | 3300053140 | Bacteria | 159093 |
| 1267 | Ga0500577_0002096 | 3300053142 | Bacteria | 5095 |
| 1268 | Ga0500577_0008824 | 3300053142 | Bacteria | 2895 |
| 1269 | Ga0500577_0036812 | 3300053142 | Bacteria | 1755 |
| 1270 | Ga0500604_0128541 | 3300053151 | Bacteria | 851 |
| 1271 | Ga0500616_0000011 | 3300053153 | Bacteria | 732880 |
| 1272 | Ga0500616_0005790 | 3300053153 | Bacteria | 8296 |
| 1273 | Ga0500616_0034153 | 3300053153 | Bacteria | 2772 |
| 1274 | Ga0500616_0047942 | 3300053153 | Bacteria | 2267 |
| 1275 | Ga0500619_036863 | 3300053154 | Bacteria | 1524 |
| 1276 | Ga0500620_002504 | 3300053155 | Bacteria | 3721 |
| 1277 | Ga0500622_0006962 | 3300053156 | Bacteria | 6475 |
| 1278 | Ga0500622_0012884 | 3300053156 | Bacteria | 4518 |
| 1279 | Ga0500624_000020 | 3300053157 | Bacteria | 118392 |
| 1280 | Ga0500627_0006872 | 3300053158 | Bacteria | 3913 |
| 1281 | Ga0500627_0039756 | 3300053158 | Bacteria | 2015 |
| 1282 | Ga0500633_0192256 | 3300053160 | Bacteria | 764 |
| 1283 | Ga0500634_0007272 | 3300053161 | Bacteria | 5443 |
| 1284 | Ga0500636_0000526 | 3300053177 | Bacteria | 20787 |
| 1285 | Ga0500637_0000074 | 3300053178 | Bacteria | 35683 |
| 1286 | Ga0500637_0297756 | 3300053178 | Bacteria | 881 |
| 1287 | Ga0500625_027984 | 3300053729 | Bacteria | 2673 |
| 1288 | Ga0500625_089535 | 3300053729 | Bacteria | 1321 |
| 1289 | Ga0500645_009627 | 3300053730 | Bacteria | 3237 |
| 1290 | Ga0500599_007459 | 3300053736 | Bacteria | 1408 |
| 1291 | Ga0500601_000577 | 3300053737 | Bacteria | 5267 |
| 1292 | Ga0501084_0777206 | 3300054114 | Bacteria | 807 |
| 1293 | Ga0500661_012337 | 3300055283 | Bacteria | 1543 |
| 1294 | Ga0501082_0012479 | 3300060353 | Bacteria | 7300 |
| 1295 | Ga0466962_0090141 | 3300061719 | Bacteria | 1469 |
| 1296 | 2507505660 | 2507262055 | Bacteria | 8048963 |
| 1297 | 2508539551 | 2508501009 | Bacteria | 7784016 |
| 1298 | 2508695918 | 2508501042 | Bacteria | 8719808 |
| 1299 | 2509116914 | 2508501123 | Bacteria | 6283661 |
| 1300 | 2509146792 | 2508501128 | Bacteria | 8613869 |
| 1301 | 2509373192 | 2509276018 | Bacteria | 6910194 |
| 1302 | 2509395536 | 2509276022 | Bacteria | 6200534 |
| 1303 | 2510317153 | 2510065059 | Bacteria | 6847884 |
| 1304 | 2511388512 | 2511231027 | Bacteria | 5013807 |
| 1305 | 2511398991 | 2511231028 | Bacteria | 8046582 |
| 1306 | 2512035794 | 2511231221 | Bacteria | 6846400 |
| 1307 | 2512929030 | 2512875016 | Bacteria | 6529530 |
| 1308 | 2512963594 | 2512875024 | Bacteria | 7195110 |
| 1309 | 2513589890 | 2513237087 | Bacteria | 5817514 |
| 1310 | 2513612450 | 2513237090 | Bacteria | 7096802 |
| 1311 | 2513625025 | 2513237092 | Bacteria | 8341956 |
| 1312 | 2513640820 | 2513237094 | Bacteria | 8789602 |
| 1313 | 2513651805 | 2513237095 | Bacteria | 8976980 |
| 1314 | 2513659395 | 2513237096 | Bacteria | 8722461 |
| 1315 | 2513673974 | 2513237098 | Bacteria | 9902361 |
| 1316 | 2513699782 | 2513237102 | Bacteria | 7703324 |
| 1317 | 2513722035 | 2513237104 | Bacteria | 10034502 |
| 1318 | 2513860662 | 2513237137 | Bacteria | 9558895 |
| 1319 | 2513876888 | 2513237139 | Bacteria | 8737671 |
| 1320 | 2513889954 | 2513237141 | Bacteria | 8496279 |
| 1321 | 2513919070 | 2513237145 | Bacteria | 8979722 |
| 1322 | 2514010297 | 2513237161 | Bacteria | 8871253 |
| 1323 | 2514038147 | 2513237164 | Bacteria | 7563725 |
| 1324 | 2514423412 | 2513237305 | Bacteria | 7293571 |
| 1325 | 2515624057 | 2515154112 | Bacteria | 8294334 |
| 1326 | 2517106584 | 2517093001 | Bacteria | 9002274 |
| 1327 | 2517888393 | 2517572143 | Bacteria | 9484767 |
| 1328 | 2524440101 | 2524023205 | Bacteria | 8918781 |
| 1329 | 2524470037 | 2524023210 | Bacteria | 9029266 |
| 1330 | 2524535304 | 2524023228 | Bacteria | 10118060 |
| 1331 | 2528854419 | 2528768022 | Bacteria | 10457665 |
| 1332 | 2588514563 | 2588253730 | Bacteria | 6881675 |
| 1333 | 2599104042 | 2597490356 | Bacteria | 7030811 |
| 1334 | 2599935920 | 2599185301 | Bacteria | 6161860 |
| 1335 | 2617350063 | 2617270735 | Bacteria | 9163226 |
| 1336 | 2617374131 | 2617270741 | Bacteria | 8201522 |
| 1337 | 2643745642 | 2643221544 | Bacteria | 5886209 |
| 1338 | 2643757465 | 2643221547 | Bacteria | 4740017 |
| 1339 | 2644126219 | 2643221622 | Bacteria | 4212502 |
| 1340 | 2644257709 | 2643221646 | Bacteria | 6433402 |
| 1341 | 2644325470 | 2643221658 | Bacteria | 6064537 |
| 1342 | 2671124216 | 2667528175 | Bacteria | 7532676 |
| 1343 | 2671694043 | 2671180139 | Bacteria | 4196045 |
| 1344 | 2688599156 | 2687453392 | Bacteria | 6880454 |
| 1345 | 2694633523 | 2693429783 | Bacteria | 7019804 |
| 1346 | 2694635227 | 2693429784 | Bacteria | 7241525 |
| 1347 | 2723578230 | 2721755686 | Bacteria | 7343952 |
| 1348 | 2728747924 | 2728368998 | Bacteria | 8720350 |
| 1349 | 2739252154 | 2738543013 | Bacteria | 5618633 |
| 1350 | 2745077791 | 2744054633 | Bacteria | 8678936 |
| 1351 | 2792460705 | 2791355048 | Bacteria | 5832535 |
| 1352 | 2793065960 | 2791355196 | Bacteria | 7323613 |
| 1353 | 2793067207 | 2791355197 | Bacteria | 8420563 |
| 1354 | 2805922215 | 2802429603 | Bacteria | 8777136 |
| 1355 | 2818239289 | 2816332527 | Bacteria | 8933356 |
| 1356 | 2824606262 | 2824600985 | Bacteria | 8488197 |
| 1357 | 2824616118 | 2824609381 | Bacteria | 8672835 |
| 1358 | 2824625514 | 2824617872 | Bacteria | 8814715 |
| 1359 | 2824634378 | 2824626560 | Bacteria | 8813858 |
| 1360 | 2824641655 | 2824635225 | Bacteria | 8785348 |
| 1361 | 2824648940 | 2824644064 | Bacteria | 8743947 |
| 1362 | 2824658283 | 2824653114 | Bacteria | 8493680 |
| 1363 | 2824669721 | 2824661429 | Bacteria | 9877870 |
| 1364 | 2824677072 | 2824671348 | Bacteria | 8369588 |
| 1365 | 2824684858 | 2824679649 | Bacteria | 8248951 |
| 1366 | 2824693561 | 2824687955 | Bacteria | 8360029 |
| 1367 | 2824701794 | 2824696289 | Bacteria | 8335049 |
| 1368 | 2824711972 | 2824704595 | Bacteria | 9667483 |
| 1369 | 2824718977 | 2824714736 | Bacteria | 8717648 |
| 1370 | 2824729180 | 2824723954 | Bacteria | 8758240 |
| 1371 | 2824734867 | 2824732956 | Bacteria | 7810675 |
| 1372 | 2824748126 | 2824746037 | Bacteria | 7911610 |
| 1373 | 2824762575 | 2824753945 | Bacteria | 9787441 |
| 1374 | 2824772749 | 2824763712 | Bacteria | 9792355 |
| 1375 | 2824780039 | 2824773399 | Bacteria | 8360218 |
| 1376 | 2828306905 | 2828305725 | Bacteria | 4916900 |
| 1377 | 2838125786 | 2838122688 | Bacteria | 8803140 |
| 1378 | 2841913612 | 2841911363 | Bacteria | 6173697 |
| 1379 | 2841919359 | 2841917233 | Bacteria | 6173500 |
| 1380 | 2841948380 | 2841941048 | Bacteria | 8688029 |
| 1381 | 2841952827 | 2841949485 | Bacteria | 8680857 |
| 1382 | 2841965657 | 2841957949 | Bacteria | 8652217 |
| 1383 | 2841972824 | 2841966195 | Bacteria | 8673214 |
| 1384 | 2841977599 | 2841974524 | Bacteria | 8931498 |
| 1385 | 2841984840 | 2841983080 | Bacteria | 8395090 |
| 1386 | 2842041408 | 2842038055 | Bacteria | 8002051 |
| 1387 | 2842049450 | 2842045827 | Bacteria | 8006841 |
| 1388 | 2842697195 | 2842694124 | Bacteria | 4063419 |
| 1389 | 2842875377 | 2842871566 | Bacteria | 4827117 |
| 1390 | 2843747987 | 2843744320 | Bacteria | 5659202 |
| 1391 | 2844014334 | 2844009547 | Bacteria | 6728125 |
| 1392 | 2844315890 | 2844315083 | Bacteria | 8138177 |
| 1393 | 2846957082 | 2846952575 | Bacteria | 6587527 |
| 1394 | 2847939884 | 2847930680 | Bacteria | 9342022 |
| 1395 | 2847942720 | 2847939898 | Bacteria | 8606328 |
| 1396 | 2848863089 | 2848858292 | Bacteria | 7391279 |
| 1397 | 2849076714 | 2849076700 | Bacteria | 7039503 |
| 1398 | 2849561426 | 2849560528 | Bacteria | 5393480 |
| 1399 | 2849574673 | 2849573788 | Bacteria | 5421256 |
| 1400 | 2851153574 | 2851153111 | Bacteria | 5542585 |
| 1401 | 2856328122 | 2856320880 | Bacteria | 7263508 |
| 1402 | 2856329105 | 2856328259 | Bacteria | 6528202 |
| 1403 | 2856341982 | 2856334872 | Bacteria | 7037011 |
| 1404 | 2856367275 | 2856364286 | Bacteria | 6939991 |
| 1405 | 2857354165 | 2857349434 | Bacteria | 7926032 |
| 1406 | 2857372330 | 2857367948 | Bacteria | 6965560 |
| 1407 | 2857506512 | 2857504554 | Bacteria | 5369913 |
| 1408 | 2857515669 | 2857509624 | Bacteria | 7472071 |
| 1409 | 2857577080 | 2857576091 | Bacteria | 5465855 |
| 1410 | 2869175361 | 2869169390 | Bacteria | 6659796 |
| 1411 | 2869238856 | 2869234852 | Bacteria | 6654993 |
| 1412 | 2869252227 | 2869249662 | Bacteria | 6868783 |
| 1413 | 2869263523 | 2869256925 | Bacteria | 6981691 |
| 1414 | 2869268166 | 2869264136 | Bacteria | 6880765 |
| 1415 | 2869278022 | 2869271264 | Bacteria | 6908218 |
| 1416 | 2869284343 | 2869278585 | Bacteria | 7077053 |
| 1417 | 2869287558 | 2869285874 | Bacteria | 6901219 |
| 1418 | 2871431082 | 2871429161 | Bacteria | 6547891 |
| 1419 | 2871439012 | 2871435913 | Bacteria | 6880295 |
| 1420 | 2871452002 | 2871451962 | Bacteria | 7336357 |
| 1421 | 2871460132 | 2871459585 | Bacteria | 6866887 |
| 1422 | 2871487416 | 2871481445 | Bacteria | 6700002 |
| 1423 | 2874110949 | 2874109183 | Bacteria | 6517025 |
| 1424 | 2874120890 | 2874116593 | Bacteria | 6674494 |
| 1425 | 2874134171 | 2874131515 | Bacteria | 6820270 |
| 1426 | 2874139194 | 2874139085 | Bacteria | 7021506 |
| 1427 | 2874150354 | 2874146452 | Bacteria | 7533118 |
| 1428 | 2874157409 | 2874155637 | Bacteria | 6724144 |
| 1429 | 2874164154 | 2874162495 | Bacteria | 6174670 |
| 1430 | 2874593220 | 2874590934 | Bacteria | 8299676 |
| 1431 | 2874617178 | 2874612657 | Bacteria | 8252029 |
| 1432 | 2874621405 | 2874620515 | Bacteria | 8290088 |
| 1433 | 2874629207 | 2874628541 | Bacteria | 8630250 |
| 1434 | 2874647803 | 2874645413 | Bacteria | 8214782 |
| 1435 | 2876369496 | 2876363079 | Bacteria | 6544991 |
| 1436 | 2876386004 | 2876377896 | Bacteria | 6565995 |
| 1437 | 2876386569 | 2876386047 | Bacteria | 6698674 |
| 1438 | 2876403341 | 2876399893 | Bacteria | 6927900 |
| 1439 | 2876410088 | 2876406927 | Bacteria | 6191900 |
| 1440 | 2876416505 | 2876413966 | Bacteria | 6831344 |
| 1441 | 2876422225 | 2876420981 | Bacteria | 6687741 |
| 1442 | 2876762869 | 2876761206 | Bacteria | 10111113 |
| 1443 | 2876773260 | 2876771140 | Bacteria | 8287509 |
| 1444 | 2876820567 | 2876818435 | Bacteria | 8274608 |
| 1445 | 2878738329 | 2878730984 | Bacteria | 6380721 |
| 1446 | 2878740041 | 2878738818 | Bacteria | 7136951 |
| 1447 | 2878747695 | 2878745973 | Bacteria | 6867388 |
| 1448 | 2878777805 | 2878774303 | Bacteria | 6108671 |
| 1449 | 2878781088 | 2878781027 | Bacteria | 6834456 |
| 1450 | 2879076794 | 2879074833 | Bacteria | 8279565 |
| 1451 | 2879083557 | 2879083081 | Bacteria | 8587928 |
| 1452 | 2879101211 | 2879099564 | Bacteria | 10442239 |
| 1453 | 2879128747 | 2879127579 | Bacteria | 8294491 |
| 1454 | 2879145534 | 2879142872 | Bacteria | 8267021 |
| 1455 | 2881367167 | 2881364244 | Bacteria | 7710352 |
| 1456 | 2881668454 | 2881665667 | Bacteria | 8175609 |
| 1457 | 2882637507 | 2882632389 | Bacteria | 8154593 |
| 1458 | 2885368973 | 2885366525 | Bacteria | 8326213 |
| 1459 | 2885380443 | 2885374607 | Bacteria | 8927485 |
| 1460 | 2885386348 | 2885383462 | Bacteria | 9473874 |
| 1461 | 2885414250 | 2885409591 | Bacteria | 9235467 |
| 1462 | 2885431821 | 2885429604 | Bacteria | 3642894 |
| 1463 | 2888342394 | 2888337043 | Bacteria | 6629336 |
| 1464 | 2888352100 | 2888350351 | Bacteria | 7372807 |
| 1465 | 2888379078 | 2888378607 | Bacteria | 9652610 |
| 1466 | 2888390253 | 2888388044 | Bacteria | 7304136 |
| 1467 | 2888427482 | 2888419890 | Bacteria | 7857137 |
| 1468 | 2889014087 | 2889010040 | Bacteria | 6749192 |
| 1469 | 2889021204 | 2889016732 | Bacteria | 6700763 |
| 1470 | 2894822197 | 2894817345 | Bacteria | 4892941 |
| 1471 | 2898329880 | 2898329390 | Bacteria | 5168154 |
| 1472 | 2903453084 | 2903448605 | Bacteria | 7357801 |
| 1473 | 2903498811 | 2903492973 | Bacteria | 13473544 |
| 1474 | 2903515917 | 2903513507 | Bacteria | 6344008 |
| 1475 | 2903526902 | 2903521522 | Bacteria | 6525694 |
| 1476 | 2903530235 | 2903528002 | Bacteria | 6586099 |
| 1477 | 2903731840 | 2903727486 | Bacteria | 8281579 |
| 1478 | 2903753289 | 2903748898 | Bacteria | 9972761 |
| 1479 | 2903771414 | 2903768456 | Bacteria | 9749579 |
| 1480 | 2904668075 | 2904666416 | Bacteria | 8226587 |
| 1481 | 2904692277 | 2904690495 | Bacteria | 9412302 |
| 1482 | 2904707783 | |||
| 1483 | 2904718215 | 2904711408 | Bacteria | 9771557 |
| 1484 | 2906310096 | 2906308376 | Bacteria | 6841989 |
| 1485 | 2906322968 | 2906321335 | Bacteria | 6579571 |
| 1486 | 2906361143 | 2906354277 | Bacteria | 6991324 |
| 1487 | 2906376926 | 2906370794 | Bacteria | 6881062 |
| 1488 | 2906402112 | 2906401398 | Bacteria | 6693206 |
| 1489 | 2906414353 | 2906408224 | Bacteria | 6162342 |
| 1490 | 2906432697 | 2906427513 | Bacteria | 6375796 |
| 1491 | 2906603633 | 2906602504 | Bacteria | 8295279 |
| 1492 | 2906614253 | |||
| 1493 | 2906631759 | 2906626472 | Bacteria | 8826946 |
| 1494 | 2906640750 | 2906635258 | Bacteria | 8601019 |
| 1495 | 2906646267 | 2906643746 | Bacteria | 8722424 |
| 1496 | 2906660868 | 2906660503 | Bacteria | 8595048 |
| 1497 | 2908746919 | 2908739725 | Bacteria | 8628932 |
| 1498 | 2908758915 | 2908756301 | Bacteria | 8864324 |
| 1499 | 2908776605 | 2908775508 | Bacteria | 8092255 |
| 1500 | 2909048404 | 2909042592 | Bacteria | 6499737 |
| 1501 | 2919454171 | 2919450847 | Bacteria | 5631160 |
| 1502 | 2922137046 | 2922130491 | Bacteria | 7173936 |
| 1503 | 2922153766 | 2922151315 | Bacteria | 6902399 |
| 1504 | 2922173096 | 2922172374 | Bacteria | 6167644 |
| 1505 | 2922187442 | 2922185730 | Bacteria | 7113964 |
| 1506 | 2922400369 | 2922393267 | Bacteria | 8285685 |
| 1507 | 2922426076 | |||
| 1508 | 2924714882 | 2924710171 | Bacteria | 6752351 |
| 1509 | 2924723335 | 2924718760 | Bacteria | 6331356 |
| 1510 | 2924734661 | 2924733363 | Bacteria | 7574837 |
| 1511 | 2924743177 | 2924741084 | Bacteria | 6661321 |
| 1512 | 2924752112 | 2924748358 | Bacteria | 6154725 |
| 1513 | 2924777640 | 2924776078 | Bacteria | 7492003 |
| 1514 | 2928027414 | 2928027323 | Bacteria | 4382488 |
| 1515 | 2928525836 | 2928521798 | Bacteria | 4960112 |
| 1516 | 2928974752 | 2928972540 | Bacteria | 3058286 |
| 1517 | 2929205260 | 2929199973 | Bacteria | 7260745 |
| 1518 | 2929619039 | 2929615660 | Bacteria | 9193770 |
| 1519 | 2929631116 | 2929624759 | Bacteria | 9339455 |
| 1520 | 2932789081 | 2932784394 | Bacteria | 9704911 |
| 1521 | 2932800186 | 2932794094 | Bacteria | 7915132 |
| 1522 | 2932808231 | 2932801729 | Bacteria | 7987968 |
| 1523 | 2932814282 | 2932809354 | Bacteria | 9135765 |
| 1524 | 2932820408 | 2932818245 | Bacteria | 9955613 |
| 1525 | 2932834330 | 2932828146 | Bacteria | 9745859 |
| 1526 | 2933580251 | 2933577622 | Bacteria | 9116884 |
| 1527 | 2935614714 | 2935608549 | Bacteria | 8203142 |
| 1528 | 2935620015 | 2935616580 | Bacteria | 9032984 |
| 1529 | 2935632488 | 2935630451 | Bacteria | 8169952 |
| 1530 | 2935640334 | 2935638405 | Bacteria | 10015038 |
| 1531 | 2935649101 | 2935648319 | Bacteria | 8801166 |
| 1532 | 2935658127 | 2935656913 | Bacteria | 8965014 |
| 1533 | 2935673379 | 2935665750 | Bacteria | 9571747 |
| 1534 | 2935683860 | 2935675223 | Bacteria | 9928132 |
| 1535 | 2935686829 | 2935684952 | Bacteria | 9590419 |
| 1536 | 2935702125 | 2935694250 | Bacteria | 9291695 |
| 1537 | 2935710535 | 2935703347 | Bacteria | 10242284 |
| 1538 | 2935716517 | 2935713505 | Bacteria | 9608509 |
| 1539 | 2935723358 | 2935722832 | Bacteria | 9608746 |
| 1540 | 2935734914 | 2935732158 | Bacteria | 9706831 |
| 1541 | 2935744295 | 2935741537 | Bacteria | 9707219 |
| 1542 | 2935752795 | 2935750917 | Bacteria | 9590372 |
| 1543 | 2935764657 | 2935760218 | Bacteria | 9817913 |
| 1544 | 2935774707 | 2935769743 | Bacteria | 7878163 |
| 1545 | 2935785071 | 2935777560 | Bacteria | 8077691 |
| 1546 | 2935789778 | 2935785616 | Bacteria | 7962367 |
| 1547 | 2935797854 | 2935793552 | Bacteria | 8012592 |
| 1548 | 2935806232 | 2935801545 | Bacteria | 9301974 |
| 1549 | 2935818088 | 2935810662 | Bacteria | 9401221 |
| 1550 | 2935826246 | 2935819856 | Bacteria | 8261050 |
| 1551 | 2935837149 | 2935827899 | Bacteria | 10038562 |
| 1552 | 2935841330 | 2935837841 | Bacteria | 9454360 |
| 1553 | 2935853742 | 2935847175 | Bacteria | 8228321 |
| 1554 | 2935858901 | 2935855204 | Bacteria | 9035059 |
| 1555 | 2935864082 | 2935864058 | Bacteria | 9784707 |
| 1556 | 2935875604 | 2935873716 | Bacteria | 9632195 |
| 1557 | 2935883335 | 2935883170 | Bacteria | 7964738 |
| 1558 | 2935910964 | 2935908558 | Bacteria | 8568796 |
| 1559 | 2935924125 | 2935916978 | Bacteria | 9113783 |
| 1560 | 2935932822 | 2935926038 | Bacteria | 8601059 |
| 1561 | 2935937385 | 2935934488 | Bacteria | 8602579 |
| 1562 | 2935949414 | 2935942939 | Bacteria | 8599779 |
| 1563 | 2935958187 | 2935951376 | Bacteria | 8602333 |
| 1564 | 2935964115 | 2935959822 | Bacteria | 7869783 |
| 1565 | 2935971158 | 2935967501 | Bacteria | 8603075 |
| 1566 | 2935982250 | 2935975950 | Bacteria | 8347125 |
| 1567 | 2935985385 | 2935984226 | Bacteria | 8302647 |
| 1568 | 2935995452 | 2935992306 | Bacteria | 9802711 |
| 1569 | 2936007875 | 2936002035 | Bacteria | 9362176 |
| 1570 | 2936012346 | 2936011229 | Bacteria | 8801034 |
| 1571 | 2936020573 | 2936019824 | Bacteria | 8804134 |
| 1572 | 2936029639 | 2936028420 | Bacteria | 8965941 |
| 1573 | 2936044698 | 2936037263 | Bacteria | 9446081 |
| 1574 | 2936051896 | 2936046547 | Bacteria | 8903709 |
| 1575 | 2936056848 | 2936055302 | Bacteria | 8785755 |
| 1576 | 2937815382 | 2937813078 | Bacteria | 7783518 |
| 1577 | 2937851435 | 2937848649 | Bacteria | 6983481 |
| 1578 | 2937864224 | 2937861824 | Bacteria | 6660327 |
| 1579 | 2937873166 | 2937868953 | Bacteria | 6639878 |
| 1580 | 2937883859 | 2937877337 | Bacteria | 7246526 |
| 1581 | 2937976609 | 2937972304 | Bacteria | 7532020 |
| 1582 | 2937988302 | 2937980651 | Bacteria | 6517427 |
| 1583 | 2938021085 | 2938014810 | Bacteria | 6700592 |
| 1584 | 2939634624 | 2939631187 | Bacteria | 6118131 |
| 1585 | 2940558708 | 2940556831 | Bacteria | 9590747 |
| 1586 | 2941508848 | 2941507105 | Bacteria | 8166816 |
| 1587 | 2941516678 | 2941515067 | Bacteria | 8166720 |
| 1588 | 2941524306 | 2941523033 | Bacteria | 8169134 |
| 1589 | 2941535738 | 2941531003 | Bacteria | 7653939 |
| 1590 | 2941543557 | 2941538514 | Bacteria | 9402094 |
| 1591 | 2945910195 | 2945909444 | Bacteria | 7065066 |
| 1592 | 2945987779 | 2945984333 | Bacteria | 7358892 |
| 1593 | 2954012075 | 2954011201 | Bacteria | 4762601 |
| 1594 | 2958038440 | 2958034702 | Bacteria | 6989922 |
| 1595 | 2958044405 | 2958041894 | Bacteria | 13082850 |
| 1596 | 2958056051 | 2958041894 | Bacteria | 13082850 |
| 1597 | 2958069727 | 2958064165 | Bacteria | 7158582 |
| 1598 | 2958091137 | 2958084443 | Bacteria | 7312792 |
| 1599 | 2958096218 | 2958092219 | Bacteria | 6861151 |
| 1600 | 2958101107 | 2958100919 | Bacteria | 6800575 |
| 1601 | 2958108939 | 2958108152 | Bacteria | 6681128 |
| 1602 | 2958128360 | 2958122699 | Bacteria | 7280457 |
| 1603 | 2958131960 | 2958130278 | Bacteria | 6897202 |
| 1604 | 2958140723 | 2958137437 | Bacteria | 6050276 |
| 1605 | 2958147463 | 2958144490 | Bacteria | 6677056 |
| 1606 | 2958164571 | 2958158011 | Bacteria | 6058449 |
| 1607 | 2958176565 | 2958172287 | Bacteria | 6716688 |
| 1608 | 2958181763 | 2958179912 | Bacteria | 6874908 |
| 1609 | 2961079607 | 2961077736 | Bacteria | 7079850 |
| 1610 | 2961186779 | 2961183825 | Bacteria | 6688536 |
| 1611 | 2963650204 | 2963644680 | Bacteria | 6530403 |
| 1612 | 2965029258 | 2965025482 | Bacteria | 6532201 |
| 1613 | 2965045694 | 2965040258 | Bacteria | 6855979 |
| 1614 | 2965049861 | 2965047637 | Bacteria | 6623551 |
| 1615 | 2965091103 | 2965089291 | Bacteria | 6866420 |
| 1616 | 2965120743 | 2965119406 | Bacteria | 6956431 |
| 1617 | 2968021255 | 2968016561 | Bacteria | 7022047 |
| 1618 | 2968086450 | 2968083720 | Bacteria | 7351627 |
| 1619 | 2968120278 | 2968117919 | Bacteria | 6536078 |
| 1620 | 2968142146 | 2968138860 | Bacteria | 6605449 |
| 1621 | 2970476360 | 2970469710 | Bacteria | 6969209 |
| 1622 | 2970489805 | 2970489779 | Bacteria | 6517260 |
| 1623 | 2970517928 | 2970510686 | Bacteria | 7006402 |
| 1624 | 2970535661 | 2970532167 | Bacteria | 6553173 |
| 1625 | 2970551916 | 2970547951 | Bacteria | 6931819 |
| 1626 | 2970598958 | 2970593180 | Bacteria | 7073582 |
| 1627 | 2970626861 | 2970619444 | Bacteria | 6986144 |
| 1628 | 2970629714 | 2970627176 | Bacteria | 6680862 |
| 1629 | 2977242208 | 2977240413 | Bacteria | 3191065 |
| 1630 | 2977846610 | 2977843712 | Bacteria | 6753583 |
| 1631 | 2977853988 | 2977851361 | Bacteria | 6694324 |
| 1632 | 2977879525 | 2977872689 | Bacteria | 7270173 |
| 1633 | 2977905473 | 2977898635 | Bacteria | 6675551 |
| 1634 | 2977909957 | 2977907340 | Bacteria | 6577984 |
| 1635 | 2977923266 | 2977922695 | Bacteria | 6956781 |
| 1636 | 2977937541 | 2977935797 | Bacteria | 6252826 |
| 1637 | 2977949683 | 2977942078 | Bacteria | 7570577 |
| 1638 | 2977953996 | 2977950692 | Bacteria | 6893264 |
| 1639 | 2977961982 | 2977957713 | Bacteria | 6877875 |
| 1640 | 2977976353 | 2977971508 | Bacteria | 7472917 |
| 1641 | 2977986694 | 2977986579 | Bacteria | 6581278 |
| 1642 | 2979711000 | 2979710463 | Bacteria | 6785254 |
| 1643 | 2979748443 | 2979742915 | Bacteria | 7301278 |
| 1644 | 2979771851 | 2979764755 | Bacteria | 6610066 |
| 1645 | 2979776784 | 2979772303 | Bacteria | 6618277 |
| 1646 | 2979798507 | 2979793036 | Bacteria | 6808957 |
| 1647 | 2984558284 | 2984555340 | Bacteria | 4247089 |
| 1648 | 2984567336 | 2984564862 | Bacteria | 4339992 |
| 1649 | 2987642425 | 2987636660 | Bacteria | 8088555 |
| 1650 | 2987647290 | 2987645492 | Bacteria | 6117018 |
| 1651 | 2987657142 | 2987652177 | Bacteria | 6969023 |
| 1652 | 2987677044 | 2987673487 | Bacteria | 6884027 |
| 1653 | 2993358402 | 2993356040 | Bacteria | 4247105 |
| 1654 | 2995951874 | 2995948881 | Bacteria | 6358104 |
| 1655 | 2996356438 | 2996348954 | Bacteria | 7239054 |
| 1656 | 2996388306 | 2996386984 | Bacteria | 6978667 |
| 1657 | 3002145572 | 3002141150 | Bacteria | 5254435 |
| 1658 | 3003666512 | 3003665799 | Bacteria | 7279786 |
| 1659 | 3004196980 | 3004195979 | Bacteria | 6776956 |
| 1660 | 3004210507 | 3004203850 | Bacteria | 7307914 |
| 1661 | 3004213443 | 3004211236 | Bacteria | 7417683 |
| 1662 | 3004221270 | 3004218560 | Bacteria | 7421728 |
| 1663 | 3004238468 | 3004232784 | Bacteria | 6662140 |
| 1664 | 3004253002 | 3004248173 | Bacteria | 6563236 |
| 1665 | 3004269813 | 3004268573 | Bacteria | 7043476 |
| 1666 | 3004282743 | 3004275668 | Bacteria | 7114440 |
| 1667 | 3004338463 | 3004334049 | Bacteria | 8449246 |
| 1668 | 3005483464 | 3005474847 | Bacteria | 9259049 |
| 1669 | 3005488914 | 3005483717 | Bacteria | 7877331 |
| 1670 | 3005506327 | 3005506211 | Bacteria | 6943378 |
| 1671 | 3005592698 | 3005587118 | Bacteria | 7794411 |
| 1672 | 3005595477 | 3005594810 | Bacteria | 8716512 |
| 1673 | 3005711443 | 3005710791 | Bacteria | 7622528 |
| 1674 | 3005718705 | 3005718088 | Bacteria | 8283608 |
| 1675 | 637078749 | 637000159 | Bacteria | 7596297 |
| 1676 | 649873586 | 649633066 | Bacteria | 6690028 |
| 1677 | 8001846245 | 8001845381 | Bacteria | 5804942 |
| 1678 | 8003405184 | 8003400568 | Bacteria | 5535898 |
| 1679 | 8004302192 | 8004300914 | Bacteria | 6132239 |
| 1680 | 8004367523 | 8004361976 | Bacteria | 6858373 |
| 1681 | 8004390294 | 8004387939 | Bacteria | 7049250 |
| 1682 | 8004642299 | 8004640170 | Bacteria | 6723001 |
| 1683 | 8004699137 | 8004695233 | Bacteria | 6731676 |
| 1684 | 8004716358 | 8004714634 | Bacteria | 6776161 |
| 1685 | 8004732201 | 8004727605 | Bacteria | 6643904 |
| 1686 | 8006932029 | 8006926726 | Bacteria | 6749210 |
| 1687 | 8006936774 | 8006933436 | Bacteria | 10410654 |
| 1688 | 8006976745 | 8006973647 | Bacteria | 10679141 |
| 1689 | 8016517719 | 8016511872 | Bacteria | 9921665 |
| 1690 | 8016525772 | 8016522445 | Bacteria | 8156687 |
| 1691 | 8016539372 | 8016530956 | Bacteria | 8155261 |
| 1692 | 8016543662 | 8016539877 | Bacteria | 8155419 |
| 1693 | 8016549634 | 8016548790 | Bacteria | 8155074 |
| 1694 | 8016558052 | 8016557553 | Bacteria | 8154380 |
| 1695 | 8016569067 | 8016566248 | Bacteria | 8158151 |
| 1696 | 8016581701 | 8016575299 | Bacteria | 8154085 |
| 1697 | 8016585876 | 8016583857 | Bacteria | 10421953 |
| 1698 | 8016596063 | 8016595262 | Bacteria | 8149947 |
| 1699 | 8016606949 | 8016603502 | Bacteria | 8731218 |
| 1700 | 8016618855 | 8016613128 | Bacteria | 8794220 |
| 1701 | 8016622688 | 8016622563 | Bacteria | 7999408 |
| 1702 | 8016635186 | 8016630954 | Bacteria | 9217207 |
| 1703 | 8017058909 | 8017057580 | Bacteria | 10023680 |
| 1704 | 8019530651 | 8019530166 | Bacteria | 8155624 |
| 1705 | 8019540935 | 8019538911 | Bacteria | 7872763 |
| 1706 | 8019549684 | 8019547302 | Bacteria | 7996444 |
| 1707 | 8019561914 | 8019555841 | Bacteria | 9642137 |
| 1708 | 8019571987 | 8019565922 | Bacteria | 9639779 |
| 1709 | 8019576741 | 8019576017 | Bacteria | 10049540 |
| 1710 | 8019594794 | 8019586578 | Bacteria | 10212056 |
| 1711 | 8019606943 | 8019597564 | Bacteria | 10041141 |
| 1712 | 8019611564 | 8019608314 | Bacteria | 10042931 |
| 1713 | 8019623407 | 8019619141 | Bacteria | 9218857 |
| 1714 | 8019638733 | 8019629233 | Bacteria | 8687553 |
| 1715 | 8019640932 | 8019638758 | Bacteria | 9062356 |
| 1716 | 8019653021 | 8019648815 | Bacteria | 10014479 |
| 1717 | 8019666534 | 8019659431 | Bacteria | 8577854 |
| 1718 | 8019676232 | 8019668869 | Bacteria | 8791617 |
| 1719 | 8019679753 | 8019678201 | Bacteria | 8863603 |
| 1720 | 8019695748 | 8019687851 | Bacteria | 8712826 |
| 1721 | 8054007968 | 8054002106 | Bacteria | 7987183 |
| 1722 | 8054568787 | 8054563764 | Bacteria | 5592885 |
| 1723 | 8055742888 | 8055742211 | Bacteria | 9226248 |
| 1724 | 8055913433 | 8055909800 | Bacteria | 7278581 |
| 1725 | 8056683150 | 8056681323 | Bacteria | 8472857 |
| 1726 | 8056970808 | 8056967851 | Bacteria | 9038162 |
| 1727 | Ga0501032_0018503 | |||
| 1728 | JGI24739J22299_10011391 | |||
| 1729 | JGI24739J22299_10096872 | |||
| 1730 | JGI24735J21928_10015613 | |||
| 1731 | JGI25156J39149_1004519 | |||
| 1732 | JGI25156J39149_1007573 | |||
| 1733 | JGI25158J39367_1025012 | |||
| 1734 | JGI25157J39369_1003669 | |||
| 1735 | JGI25152J39213_1003099 | |||
| 1736 | JGI25150J39212_1001285 | |||
| 1737 | JGI25159J45721_1010897 | |||
| 1738 | JGI25151J46595_10038236 | |||
| 1739 | JGI25151J46595_10112289 | |||
| 1740 | JGI25165J46597_1000037 | |||
| 1741 | JGI25153J46596_10008033 | |||
| 1742 | JGI25153J46596_10010518 | |||
| 1743 | JGI25153J46596_10021879 | |||
| 1744 | JGI25153J46596_10023921 | |||
| 1745 | rootH1_10006378 | |||
| 1746 | rootH2_10033453 | |||
| 1747 | rootL2_10024654 | |||
| 1748 | rootL2_10077388 | |||
| 1749 | rootH1_10220232 | |||
| 1750 | JGI25160J50197_1001756 | |||
| 1751 | JGI25160J50197_1008048 | |||
| 1752 | JGI25160J50197_1012962 | |||
| 1753 | JGI25160J50197_1017478 | |||
| 1754 | JGI25161J50226_1009749 | |||
| 1755 | JGI25161J50226_1010515 | |||
| 1756 | JGI25161J50226_1015223 | |||
| 1757 | Ga0006562J51391_1106834 | |||
| 1758 | Ga0006562J51391_1106835 | |||
| 1759 | Ga0055532_1007168 | |||
| 1760 | Ga0055535_1000128 | |||
| 1761 | Ga0055542_1000062 | |||
| 1762 | Ga0055542_1001515 | |||
| 1763 | Ga0055529_1009081 | |||
| 1764 | Ga0055526_1016624 | |||
| 1765 | Ga0055526_1016625 | |||
| 1766 | Ga0055537_1000217 | |||
| 1767 | Ga0055537_1001276 | |||
| 1768 | Ga0055537_1004956 | |||
| 1769 | Ga0055537_1010392 | |||
| 1770 | Ga0055524_1000276 | |||
| 1771 | Ga0055524_1014879 | |||
| 1772 | Ga0055524_1016708 | |||
| 1773 | Ga0055536_1000385 | |||
| 1774 | Ga0055536_1000743 | |||
| 1775 | Ga0055536_1006377 | |||
| 1776 | Ga0055536_1009998 | |||
| 1777 | Ga0055536_1038275 | |||
| 1778 | Ga0055534_1000106 | |||
| 1779 | Ga0055534_1002390 | |||
| 1780 | Ga0055528_1010834 | |||
| 1781 | Ga0055528_1022442 | |||
| 1782 | Ga0055530_10000521 | |||
| 1783 | Ga0055530_10000573 | |||
| 1784 | Ga0055530_10001653 | |||
| 1785 | Ga0055530_10005644 | |||
| 1786 | Ga0055530_10007241 | |||
| 1787 | Ga0055530_10014165 | |||
| 1788 | Ga0055540_1002206 | |||
| 1789 | Ga0055540_1002275 | |||
| 1790 | Ga0055540_1005142 | |||
| 1791 | Ga0055540_1009867 | |||
| 1792 | Ga0055540_1014818 | |||
| 1793 | Ga0055531_10000203 | |||
| 1794 | Ga0055531_10001002 | |||
| 1795 | Ga0055531_10001633 | |||
| 1796 | Ga0055531_10002103 | |||
| 1797 | Ga0055531_10002282 | |||
| 1798 | Ga0055531_10019259 | |||
| 1799 | Ga0055543_1003281 | |||
| 1800 | Ga0055543_1004625 | |||
| 1801 | Ga0055543_1014782 | |||
| 1802 | Ga0065165_1003236 | |||
| 1803 | Ga0065165_1005102 | |||
| 1804 | Ga0065165_1006193 | |||
| 1805 | Ga0065165_1006686 | |||
| 1806 | Ga0065165_1012578 | |||
| 1807 | Ga0065165_1013310 | |||
| 1808 | Ga0065165_1019354 | |||
| 1809 | Ga0065165_1020392 | |||
| 1810 | Ga0065165_1079924 | |||
| 1811 | Ga0065714_10015844 | |||
| 1812 | Ga0065704_10008951 | |||
| 1813 | Ga0065704_10087958 | |||
| 1814 | Ga0065707_10314962 | |||
| 1815 | Ga0070658_10000618 | |||
| 1816 | Ga0070658_10018985 | |||
| 1817 | Ga0070658_10338307 | |||
| 1818 | Ga0070676_10752436 | |||
| 1819 | Ga0070683_100734186 | |||
| 1820 | Ga0070670_100000001 | |||
| 1821 | Ga0070670_100067774 | |||
| 1822 | Ga0070670_100349677 | |||
| 1823 | Ga0070670_100400983 | |||
| 1824 | Ga0068869_100002440 | |||
| 1825 | Ga0070666_10070267 | |||
| 1826 | Ga0070666_10131930 | |||
| 1827 | Ga0070666_10693550 | |||
| 1828 | Ga0070682_100043030 | |||
| 1829 | Ga0068868_100057235 | |||
| 1830 | Ga0070660_100390345 | |||
| 1831 | Ga0070661_100153859 | |||
| 1832 | Ga0070692_10594814 | |||
| 1833 | Ga0070668_100009520 | |||
| 1834 | Ga0070668_100027781 | |||
| 1835 | Ga0070669_100001723 | |||
| 1836 | Ga0070669_100030628 | |||
| 1837 | Ga0070669_100117833 | |||
| 1838 | Ga0070671_100000033 | |||
| 1839 | Ga0070673_100009989 | |||
| 1840 | Ga0070688_100013740 | |||
| 1841 | Ga0070659_100782192 | |||
| 1842 | Ga0070667_100000405 | |||
| 1843 | Ga0070667_100005545 | |||
| 1844 | Ga0070667_100031542 | |||
| 1845 | Ga0070705_100151872 | |||
| 1846 | Ga0070663_100013652 | |||
| 1847 | Ga0070663_100244213 | |||
| 1848 | Ga0070662_100264302 | |||
| 1849 | Ga0070681_10932245 | |||
| 1850 | Ga0068867_100146911 | |||
| 1851 | Ga0068867_100239521 | |||
| 1852 | Ga0070685_10000008 | |||
| 1853 | Ga0070706_100471230 | |||
| 1854 | Ga0070679_100196348 | |||
| 1855 | Ga0070679_100581460 | |||
| 1856 | Ga0070684_100848522 | |||
| 1857 | Ga0070697_101542758 | |||
| 1858 | Ga0068853_100014261 | |||
| 1859 | Ga0068853_100024199 | |||
| 1860 | Ga0068853_100069849 | |||
| 1861 | Ga0070672_100230040 | |||
| 1862 | Ga0070695_100835981 | |||
| 1863 | Ga0070665_100040876 | |||
| 1864 | Ga0070665_100056363 | |||
| 1865 | Ga0070665_100058254 | |||
| 1866 | Ga0070665_100067417 | |||
| 1867 | Ga0070665_100116127 | |||
| 1868 | Ga0070665_100426378 | |||
| 1869 | Ga0070665_100732490 | |||
| 1870 | Ga0068855_100091195 | |||
| 1871 | Ga0068855_100122687 | |||
| 1872 | Ga0068855_100259174 | |||
| 1873 | Ga0068855_100282223 | |||
| 1874 | Ga0068857_100085660 | |||
| 1875 | Ga0068857_100102866 | |||
| 1876 | Ga0068857_100208233 | |||
| 1877 | Ga0068854_100167009 | |||
| 1878 | Ga0068856_100150515 | |||
| 1879 | Ga0068856_100319909 | |||
| 1880 | Ga0068856_100424811 | |||
| 1881 | Ga0068856_100798145 | |||
| 1882 | Ga0068856_100829430 | |||
| 1883 | Ga0068852_100014597 | |||
| 1884 | Ga0068852_100398478 | |||
| 1885 | Ga0068852_100446051 | |||
| 1886 | Ga0068852_100754264 | |||
| 1887 | Ga0068852_100829153 | |||
| 1888 | Ga0068859_100017687 | |||
| 1889 | Ga0068859_100082831 | |||
| 1890 | Ga0068859_100283618 | |||
| 1891 | Ga0068859_101164148 | |||
| 1892 | Ga0068864_100000006 | |||
| 1893 | Ga0068864_100000115 | |||
| 1894 | Ga0068864_100006669 | |||
| 1895 | Ga0068864_100088879 | |||
| 1896 | Ga0068861_100003645 | |||
| 1897 | Ga0068863_100000007 | |||
| 1898 | Ga0068863_100003567 | |||
| 1899 | Ga0068863_100335206 | |||
| 1900 | Ga0068863_100875803 | |||
| 1901 | Ga0068858_100000031 | |||
| 1902 | Ga0068858_100051365 | |||
| 1903 | Ga0068858_100100561 | |||
| 1904 | Ga0068858_100496491 | |||
| 1905 | Ga0068858_100589477 | |||
| 1906 | Ga0068860_100011998 | |||
| 1907 | Ga0068860_100059791 | |||
| 1908 | Ga0068862_100001252 | |||
| 1909 | Ga0068862_100548232 | |||
| 1910 | Ga0068862_101392111 | |||
| 1911 | Ga0081455_10000120 | |||
| 1912 | Ga0075365_10029726 | |||
| 1913 | Ga0075365_10147570 | |||
| 1914 | Ga0075365_10402541 | |||
| 1915 | Ga0075365_10464033 | |||
| 1916 | Ga0075365_10555219 | |||
| 1917 | Ga0075365_10605116 | |||
| 1918 | Ga0075368_10095363 | |||
| 1919 | Ga0075363_100113746 | |||
| 1920 | Ga0075363_100124324 | |||
| 1921 | Ga0075363_100141318 | |||
| 1922 | Ga0075364_10009471 | |||
| 1923 | Ga0075364_10012251 | |||
| 1924 | Ga0075364_10020653 | |||
| 1925 | Ga0075364_10023413 | |||
| 1926 | Ga0075364_10073663 | |||
| 1927 | Ga0075364_10091396 | |||
| 1928 | Ga0075364_10122659 | |||
| 1929 | Ga0075364_10243189 | |||
| 1930 | Ga0075432_10041150 | |||
| 1931 | Ga0075432_10049939 | |||
| 1932 | Ga0070712_100231585 | |||
| 1933 | Ga0070712_100662200 | |||
| 1934 | Ga0075362_10001023 | |||
| 1935 | Ga0075362_10064819 | |||
| 1936 | Ga0075362_10073816 | |||
| 1937 | Ga0075362_10209178 | |||
| 1938 | Ga0075367_10044775 | |||
| 1939 | Ga0075367_10231261 | |||
| 1940 | Ga0075369_10005453 | |||
| 1941 | Ga0075369_10065285 | |||
| 1942 | Ga0075369_10145066 | |||
| 1943 | Ga0075369_10213722 | |||
| 1944 | Ga0075369_10249194 | |||
| 1945 | Ga0075369_10295610 | |||
| 1946 | Ga0075366_10029145 | |||
| 1947 | Ga0075366_10058452 | |||
| 1948 | Ga0075366_10068117 | |||
| 1949 | Ga0075366_10151086 | |||
| 1950 | Ga0075366_10246500 | |||
| 1951 | Ga0075366_10282382 | |||
| 1952 | Ga0075370_10001207 | |||
| 1953 | Ga0075370_10002536 | |||
| 1954 | Ga0075370_10012763 | |||
| 1955 | Ga0075370_10080333 | |||
| 1956 | Ga0075370_10102645 | |||
| 1957 | Ga0068865_101321182 | |||
| 1958 | Ga0075436_100027626 | |||
| 1959 | Ga0097620_100017687 | |||
| 1960 | Ga0097620_100082833 | |||
| 1961 | Ga0097620_100283611 | |||
| 1962 | Ga0097620_101164280 | |||
| 1963 | Ga0099825_1026372 | |||
| 1964 | Ga0099824_1005117 | |||
| 1965 | Ga0099824_1018892 | |||
| 1966 | Ga0079104_1019522 | |||
| 1967 | Ga0079104_1043432 | |||
| 1968 | Ga0099826_10006923 | |||
| 1969 | Ga0105250_10082977 | |||
| 1970 | Ga0105240_10005838 | |||
| 1971 | Ga0105240_10015532 | |||
| 1972 | Ga0105240_10077393 | |||
| 1973 | Ga0105240_10182224 | |||
| 1974 | Ga0105240_10240781 | |||
| 1975 | Ga0105240_10935711 | |||
| 1976 | Ga0105245_10032999 | |||
| 1977 | Ga0105245_10113604 | |||
| 1978 | Ga0105245_10463523 | |||
| 1979 | Ga0105245_10568395 | |||
| 1980 | Ga0105247_10015539 | |||
| 1981 | Ga0105247_10041761 | |||
| 1982 | Ga0105247_10061905 | |||
| 1983 | Ga0105247_10274072 | |||
| 1984 | Ga0105243_10002474 | |||
| 1985 | Ga0105243_10132992 | |||
| 1986 | Ga0105243_10203573 | |||
| 1987 | Ga0105243_10784734 | |||
| 1988 | Ga0105241_10025725 | |||
| 1989 | Ga0105241_10129757 | |||
| 1990 | Ga0105241_10385178 | |||
| 1991 | Ga0105241_10487817 | |||
| 1992 | Ga0105241_11691295 | |||
| 1993 | Ga0105242_11231846 | |||
| 1994 | Ga0105248_10004030 | |||
| 1995 | Ga0105248_10094337 | |||
| 1996 | Ga0105248_10251283 | |||
| 1997 | Ga0105248_10807932 | |||
| 1998 | Ga0105248_10829931 | |||
| 1999 | Ga0105237_10000209 | |||
| 2000 | Ga0105237_10018789 | |||
| 2001 | Ga0105237_10020513 | |||
| 2002 | Ga0105237_10087966 | |||
| 2003 | Ga0105237_10199366 | |||
| 2004 | Ga0105237_10224458 | |||
| 2005 | Ga0105237_10331261 | |||
| 2006 | Ga0105237_10487792 | |||
| 2007 | Ga0105237_10720675 | |||
| 2008 | Ga0105237_10993961 | |||
| 2009 | Ga0105238_10004686 | |||
| 2010 | Ga0105238_10106327 | |||
| 2011 | Ga0105238_10208506 | |||
| 2012 | Ga0105238_10812979 | |||
| 2013 | Ga0105238_11269759 | |||
| 2014 | Ga0105238_11335831 | |||
| 2015 | Ga0105238_11746841 | |||
| 2016 | Ga0105249_10016332 | |||
| 2017 | Ga0105249_10691972 | |||
| 2018 | Ga0105239_10019083 | |||
| 2019 | Ga0105239_10071618 | |||
| 2020 | Ga0105239_10073276 | |||
| 2021 | Ga0105239_10111109 | |||
| 2022 | Ga0105239_10197116 | |||
| 2023 | Ga0105239_10201886 | |||
| 2024 | Ga0105239_10483651 | |||
| 2025 | Ga0105239_10618586 | |||
| 2026 | Ga0105239_10919522 | |||
| 2027 | Ga0105239_11681549 | |||
| 2028 | Ga0105246_10007753 | |||
| 2029 | Ga0105246_10368789 | |||
| 2030 | Ga0105246_10371451 | |||
| 2031 | Ga0157371_10095472 | |||
| 2032 | Ga0157370_10020928 | |||
| 2033 | Ga0157370_10029446 | |||
| 2034 | Ga0157369_10015433 | |||
| 2035 | Ga0157369_10148621 | |||
| 2036 | Ga0157369_10297102 | |||
| 2037 | Ga0157369_10576202 | |||
| 2038 | Ga0157369_10683195 | |||
| 2039 | Ga0157374_10221425 | |||
| 2040 | Ga0157374_11150605 | |||
| 2041 | Ga0157374_12145005 | |||
| 2042 | Ga0157378_10192239 | |||
| 2043 | Ga0157378_10429305 | |||
| 2044 | Ga0157372_10114193 | |||
| 2045 | Ga0157372_10149239 | |||
| 2046 | Ga0157375_10047270 | |||
| 2047 | Ga0163163_10000926 | |||
| 2048 | Ga0163163_10082749 | |||
| 2049 | Ga0163163_10115692 | |||
| 2050 | Ga0157380_10949288 | |||
| 2051 | Ga0182008_10012461 | |||
| 2052 | Ga0182008_10074251 | |||
| 2053 | Ga0182008_10185854 | |||
| 2054 | Ga0157377_10265760 | |||
| 2055 | Ga0157379_10017367 | |||
| 2056 | Ga0157379_10397451 | |||
| 2057 | Ga0157379_10641515 | |||
| 2058 | Ga0157379_10895684 | |||
| 2059 | Ga0163161_10002178 | |||
| 2060 | Ga0163161_10090314 | |||
| 2061 | Ga0163161_10244232 | |||
| 2062 | Ga0214544_1000003 | |||
| 2063 | Ga0214542_1000003 | |||
| 2064 | Ga0214545_1000004 | |||
| 2065 | Ga0214543_1000007 | |||
| 2066 | Ga0213872_10000678 | |||
| 2067 | Ga0213872_10003050 | |||
| 2068 | Ga0213872_10004783 | |||
| 2069 | Ga0213872_10006716 | |||
| 2070 | Ga0213872_10008898 | |||
| 2071 | Ga0213872_10032482 | |||
| 2072 | Ga0213872_10089556 | |||
| 2073 | Ga0213872_10091688 | |||
| 2074 | Ga0213872_10154141 | |||
| 2075 | Ga0213874_10315183 | |||
| 2076 | Ga0213876_10014677 | |||
| 2077 | Ga0213876_10116727 | |||
| 2078 | Ga0209672_100326 | |||
| 2079 | Ga0209147_101453 | |||
| 2080 | Ga0209563_104203 | |||
| 2081 | Ga0209258_100154 | |||
| 2082 | Ga0207425_1009030 | |||
| 2083 | Ga0207425_1027585 | |||
| 2084 | Ga0209026_1000013 | |||
| 2085 | Ga0209026_1012883 | |||
| 2086 | Ga0209677_101412 | |||
| 2087 | Ga0209677_118621 | |||
| 2088 | Ga0209148_1000078 | |||
| 2089 | Ga0209148_1000145 | |||
| 2090 | Ga0209148_1000761 | |||
| 2091 | Ga0209148_1007279 | |||
| 2092 | Ga0209759_1000149 | |||
| 2093 | Ga0209129_1000054 | |||
| 2094 | Ga0209129_1002251 | |||
| 2095 | Ga0209129_1006857 | |||
| 2096 | Ga0209233_1000102 | |||
| 2097 | Ga0209233_1000947 | |||
| 2098 | Ga0209233_1017503 | |||
| 2099 | Ga0209565_1000008 | |||
| 2100 | Ga0209565_1000067 | |||
| 2101 | Ga0209565_1000185 | |||
| 2102 | Ga0209565_1005666 | |||
| 2103 | Ga0209455_1000194 | |||
| 2104 | Ga0209455_1001577 | |||
| 2105 | Ga0209455_1004890 | |||
| 2106 | Ga0209673_1000097 | |||
| 2107 | Ga0209673_1000548 | |||
| 2108 | Ga0209673_1002045 | |||
| 2109 | Ga0209673_1002338 | |||
| 2110 | Ga0209673_1002470 | |||
| 2111 | Ga0209130_1000260 | |||
| 2112 | Ga0209130_1000441 | |||
| 2113 | Ga0209130_1003421 | |||
| 2114 | Ga0209675_1000038 | |||
| 2115 | Ga0209675_1001284 | |||
| 2116 | Ga0209675_1001491 | |||
| 2117 | Ga0209675_1013906 | |||
| 2118 | Ga0209676_1000103 | |||
| 2119 | Ga0209676_1000128 | |||
| 2120 | Ga0209676_1000243 | |||
| 2121 | Ga0209676_1000791 | |||
| 2122 | Ga0209676_1001349 | |||
| 2123 | Ga0209676_1042983 | |||
| 2124 | Ga0209025_1000185 | |||
| 2125 | Ga0209025_1000474 | |||
| 2126 | Ga0209025_1016842 | |||
| 2127 | Ga0209025_1017217 | |||
| 2128 | Ga0209564_1000301 | |||
| 2129 | Ga0209564_1000383 | |||
| 2130 | Ga0209564_1000629 | |||
| 2131 | Ga0209564_1005181 | |||
| 2132 | Ga0209564_1021261 | |||
| 2133 | Ga0209564_1035300 | |||
| 2134 | Ga0209564_1054528 | |||
| 2135 | Ga0209758_1000030 | |||
| 2136 | Ga0209758_1000034 | |||
| 2137 | Ga0209758_1005701 | |||
| 2138 | Ga0209758_1011492 | |||
| 2139 | Ga0209758_1020188 | |||
| 2140 | Ga0209758_1033122 | |||
| 2141 | Ga0209758_1033265 | |||
| 2142 | Ga0209758_1037103 | |||
| 2143 | Ga0209050_1000010 | |||
| 2144 | Ga0209050_1000012 | |||
| 2145 | Ga0209050_1000244 | |||
| 2146 | Ga0209050_1001118 | |||
| 2147 | Ga0209050_1001465 | |||
| 2148 | Ga0209256_1000009 | |||
| 2149 | Ga0209256_1000010 | |||
| 2150 | Ga0209256_1000103 | |||
| 2151 | Ga0209256_1000165 | |||
| 2152 | Ga0209256_1010538 | |||
| 2153 | Ga0209256_1014683 | |||
| 2154 | Ga0209256_1023169 | |||
| 2155 | Ga0207426_1000058 | |||
| 2156 | Ga0207426_1000067 | |||
| 2157 | Ga0207426_1000867 | |||
| 2158 | Ga0207426_1004113 | |||
| 2159 | Ga0207426_1011500 | |||
| 2160 | Ga0207426_1013645 | |||
| 2161 | Ga0207426_1065474 | |||
| 2162 | Ga0209051_1000019 | |||
| 2163 | Ga0209051_1000603 | |||
| 2164 | Ga0209051_1000638 | |||
| 2165 | Ga0209051_1001110 | |||
| 2166 | Ga0209051_1002726 | |||
| 2167 | Ga0209051_1018263 | |||
| 2168 | Ga0209051_1044966 | |||
| 2169 | Ga0209051_1066054 | |||
| 2170 | Ga0209257_1000009 | |||
| 2171 | Ga0209257_1000024 | |||
| 2172 | Ga0209257_1000057 | |||
| 2173 | Ga0209257_1000140 | |||
| 2174 | Ga0209257_1003185 | |||
| 2175 | Ga0209257_1007671 | |||
| 2176 | Ga0209257_1021545 | |||
| 2177 | Ga0209257_1042799 | |||
| 2178 | Ga0207697_10064476 | |||
| 2179 | Ga0207656_10002594 | |||
| 2180 | Ga0207656_10223788 | |||
| 2181 | Ga0207710_10041186 | |||
| 2182 | Ga0207710_10108518 | |||
| 2183 | Ga0207710_10128491 | |||
| 2184 | Ga0207688_10035473 | |||
| 2185 | Ga0207680_10091257 | |||
| 2186 | Ga0207680_10386632 | |||
| 2187 | Ga0207680_10535179 | |||
| 2188 | Ga0207647_10007551 | |||
| 2189 | Ga0207647_10008829 | |||
| 2190 | Ga0207647_10028609 | |||
| 2191 | Ga0207647_10129393 | |||
| 2192 | Ga0207643_10042028 | |||
| 2193 | Ga0207705_10047855 | |||
| 2194 | Ga0207705_10331023 | |||
| 2195 | Ga0207705_11096885 | |||
| 2196 | Ga0207684_10398643 | |||
| 2197 | Ga0207654_10419337 | |||
| 2198 | Ga0207695_10000065 | |||
| 2199 | Ga0207695_10042830 | |||
| 2200 | Ga0207695_10411294 | |||
| 2201 | Ga0207671_10000072 | |||
| 2202 | Ga0207671_10024760 | |||
| 2203 | Ga0207671_10439069 | |||
| 2204 | Ga0207671_10872388 | |||
| 2205 | Ga0207693_10316976 | |||
| 2206 | Ga0207693_10491064 | |||
| 2207 | Ga0207663_10502918 | |||
| 2208 | Ga0207663_11146613 | |||
| 2209 | Ga0207660_10007226 | |||
| 2210 | Ga0207649_10261967 | |||
| 2211 | Ga0207652_10001316 | |||
| 2212 | Ga0207652_10004184 | |||
| 2213 | Ga0207652_11368554 | |||
| 2214 | Ga0207681_10005483 | |||
| 2215 | Ga0207681_10035167 | |||
| 2216 | Ga0207694_10043700 | |||
| 2217 | Ga0207694_10062913 | |||
| 2218 | Ga0207694_10177439 | |||
| 2219 | Ga0207694_10341442 | |||
| 2220 | Ga0207650_10000002 | |||
| 2221 | Ga0207650_10040555 | |||
| 2222 | Ga0207650_10216887 | |||
| 2223 | Ga0207650_10439127 | |||
| 2224 | Ga0207687_10032239 | |||
| 2225 | Ga0207687_10095641 | |||
| 2226 | Ga0207644_10000176 | |||
| 2227 | Ga0207644_11091068 | |||
| 2228 | Ga0207706_10275029 | |||
| 2229 | Ga0207709_10000491 | |||
| 2230 | Ga0207709_10555413 | |||
| 2231 | Ga0207709_10812133 | |||
| 2232 | Ga0207709_11358718 | |||
| 2233 | Ga0207704_10163116 | |||
| 2234 | Ga0207665_10072406 | |||
| 2235 | Ga0207665_10284959 | |||
| 2236 | Ga0207691_10101219 | |||
| 2237 | Ga0207691_10256780 | |||
| 2238 | Ga0207711_10000366 | |||
| 2239 | Ga0207711_10011017 | |||
| 2240 | Ga0207711_10100192 | |||
| 2241 | Ga0207711_11045822 | |||
| 2242 | Ga0207689_10017565 | |||
| 2243 | Ga0207689_10133025 | |||
| 2244 | Ga0207689_10592096 | |||
| 2245 | Ga0207689_10772287 | |||
| 2246 | Ga0207661_10984183 | |||
| 2247 | Ga0207667_10083293 | |||
| 2248 | Ga0207667_10664612 | |||
| 2249 | Ga0207667_10815640 | |||
| 2250 | Ga0207667_10921850 | |||
| 2251 | Ga0207667_11335861 | |||
| 2252 | Ga0207651_10175144 | |||
| 2253 | Ga0207712_10058704 | |||
| 2254 | Ga0207668_11093724 | |||
| 2255 | Ga0207640_10027904 | |||
| 2256 | Ga0207640_10155381 | |||
| 2257 | Ga0207658_10000001 | |||
| 2258 | Ga0207658_10018437 | |||
| 2259 | Ga0207658_10030655 | |||
| 2260 | Ga0207677_10037938 | |||
| 2261 | Ga0207703_10000038 | |||
| 2262 | Ga0207703_10006584 | |||
| 2263 | Ga0207703_10265985 | |||
| 2264 | Ga0207703_10311432 | |||
| 2265 | Ga0207703_10692361 | |||
| 2266 | Ga0207639_10002789 | |||
| 2267 | Ga0207639_10042208 | |||
| 2268 | Ga0207639_10064609 | |||
| 2269 | Ga0207639_10144270 | |||
| 2270 | Ga0207639_10252120 | |||
| 2271 | Ga0207639_11052625 | |||
| 2272 | Ga0207678_10006072 | |||
| 2273 | Ga0207678_10075970 | |||
| 2274 | Ga0207678_10182977 | |||
| 2275 | Ga0207678_10269338 | |||
| 2276 | Ga0207702_10273241 | |||
| 2277 | Ga0207702_10294050 | |||
| 2278 | Ga0207702_10382947 | |||
| 2279 | Ga0207702_10591423 | |||
| 2280 | Ga0207702_10890844 | |||
| 2281 | Ga0207702_11056332 | |||
| 2282 | Ga0207641_10000012 | |||
| 2283 | Ga0207641_10038578 | |||
| 2284 | Ga0207641_10094862 | |||
| 2285 | Ga0207641_10295626 | |||
| 2286 | Ga0207648_10003010 | |||
| 2287 | Ga0207648_10092771 | |||
| 2288 | Ga0207676_10000001 | |||
| 2289 | Ga0207676_10000610 | |||
| 2290 | Ga0207676_10050809 | |||
| 2291 | Ga0207674_10001341 | |||
| 2292 | Ga0207674_10050312 | |||
| 2293 | Ga0207674_10092422 | |||
| 2294 | Ga0207674_10152361 | |||
| 2295 | Ga0207675_100008719 | |||
| 2296 | Ga0207675_100856501 | |||
| 2297 | Ga0207675_100922904 | |||
| 2298 | Ga0207698_10052977 | |||
| 2299 | Ga0207698_10375188 | |||
| 2300 | Ga0207698_10575526 | |||
| 2301 | Ga0209281_1029587 | |||
| 2302 | Ga0209389_1000015 | |||
| 2303 | Ga0209389_1000035 | |||
| 2304 | Ga0209589_1000039 | |||
| 2305 | Ga0209589_1001702 | |||
| 2306 | Ga0209489_100084 | |||
| 2307 | Ga0209489_102545 | |||
| 2308 | Ga0209489_102940 | |||
| 2309 | Ga0209700_100034 | |||
| 2310 | Ga0209700_102508 | |||
| 2311 | Ga0209282_1000929 | |||
| 2312 | Ga0209813_10203577 | |||
| 2313 | Ga0207428_10348473 | |||
| 2314 | Ga0268266_10003368 | |||
| 2315 | Ga0268266_10201553 | |||
| 2316 | Ga0268266_10252783 | |||
| 2317 | Ga0268266_10271585 | |||
| 2318 | Ga0268266_10857013 | |||
| 2319 | Ga0268266_10878814 | |||
| 2320 | Ga0268266_10983406 | |||
| 2321 | Ga0268266_11346816 | |||
| 2322 | Ga0268265_10000639 | |||
| 2323 | Ga0268265_10063708 | |||
| 2324 | Ga0268265_10223249 | |||
| 2325 | Ga0268265_10868378 | |||
| 2326 | Ga0268264_10000004 | |||
| 2327 | Ga0268264_10030875 | |||
| 2328 | Ga0268264_10263950 | |||
| 2329 | Ga0265337_1004460 | |||
| 2330 | Ga0265326_10008660 | |||
| 2331 | Ga0265319_1002535 | |||
| 2332 | Ga0265319_1114219 | |||
| 2333 | Ga0265334_10000692 | |||
| 2334 | Ga0265318_10005512 | |||
| 2335 | Ga0265323_10000487 | |||
| 2336 | Ga0265336_10000116 | |||
| 2337 | Ga0307517_10242884 | |||
| 2338 | Ga0307515_10000306 | |||
| 2339 | Ga0307515_10073133 | |||
| 2340 | Ga0307515_10091389 | |||
| 2341 | Ga0265338_10000094 | |||
| 2342 | Ga0265324_10001770 | |||
| 2343 | Ga0307512_10077299 | |||
| 2344 | Ga0316177_1218212 | |||
| 2345 | Ga0316176_1077164 | |||
| 2346 | Ga0314311_1119909 | |||
| 2347 | Ga0316178_1021912 | |||
| 2348 | Ga0316180_1096038 | |||
| 2349 | Ga0316183_1023532 | |||
| 2350 | Ga0316181_1045265 | |||
| 2351 | Ga0316182_1432467 | |||
| 2352 | Ga0265330_10070025 | |||
| 2353 | Ga0265340_10009477 | |||
| 2354 | Ga0265339_10001522 | |||
| 2355 | Ga0265339_10202618 | |||
| 2356 | Ga0265316_10006562 | |||
| 2357 | Ga0307513_10027606 | |||
| 2358 | Ga0307513_10112484 | |||
| 2359 | Ga0307513_10317575 | |||
| 2360 | Ga0307513_10374244 | |||
| 2361 | Ga0307509_10156210 | |||
| 2362 | Ga0307408_100000030 | |||
| 2363 | Ga0307408_100135180 | |||
| 2364 | Ga0307408_100247478 | |||
| 2365 | Ga0265313_10000181 | |||
| 2366 | Ga0265313_10009198 | |||
| 2367 | Ga0265313_10014374 | |||
| 2368 | Ga0307514_10003152 | |||
| 2369 | Ga0265314_10306564 | |||
| 2370 | Ga0265342_10100640 | |||
| 2371 | Ga0307405_10604158 | |||
| 2372 | Ga0307413_10695691 | |||
| 2373 | Ga0307406_10498753 | |||
| 2374 | Ga0307407_10126408 | |||
| 2375 | Ga0307412_10020383 | |||
| 2376 | Ga0307412_10031555 | |||
| 2377 | Ga0307412_10144525 | |||
| 2378 | Ga0307412_10223632 | |||
| 2379 | Ga0307412_10265449 | |||
| 2380 | Ga0307412_10360592 | |||
| 2381 | Ga0307416_100138604 | |||
| 2382 | Ga0307416_101393900 | |||
| 2383 | Ga0307414_10039618 | |||
| 2384 | Ga0307414_10272243 | |||
| 2385 | Ga0307414_11074879 | |||
| 2386 | Ga0307411_10002074 | |||
| 2387 | Ga0307411_10191162 | |||
| 2388 | Ga0307411_10744465 | |||
| 2389 | Ga0307411_11267663 | |||
| 2390 | Ga0307510_10081070 | |||
| 2391 | Ga0307510_10123919 | |||
| 2392 | Ga0315911_1000042 | |||
| 2393 | Ga0373954_0224454 | |||
| 2394 | Ga0373955_0442203 | |||
| 2395 | Ga0373947_0630710 | |||
| 2396 | Ga0373937_1080809 | |||
| 2397 | Ga0395899_0000107 | |||
| 2398 | Ga0395899_0000264 | |||
| 2399 | Ga0395899_0000589 | |||
| 2400 | Ga0395899_0000854 | |||
| 2401 | Ga0395899_0033456 | |||
| 2402 | Ga0395899_0184442 | |||
| 2403 | Ga0395899_0267838 | |||
| 2404 | Ga0395899_0491720 | |||
| 2405 | Ga0395899_0837568 | |||
| 2406 | Ga0395900_0000072 | |||
| 2407 | Ga0395900_0000101 | |||
| 2408 | Ga0395900_0000375 | |||
| 2409 | Ga0395900_0000924 | |||
| 2410 | Ga0395900_0007118 | |||
| 2411 | Ga0395900_0023664 | |||
| 2412 | Ga0395900_0038244 | |||
| 2413 | Ga0395900_0227712 | |||
| 2414 | Ga0395900_0702299 | |||
| 2415 | Ga0395900_0835755 | |||
| 2416 | Ga0395900_0924838 | |||
| 2417 | Ga0395900_1023328 | |||
| 2418 | Ga0395900_1378096 | |||
| 2419 | Ga0395898_0000043 | |||
| 2420 | Ga0395898_0000629 | |||
| 2421 | Ga0395898_0027961 | |||
| 2422 | Ga0395898_0030665 | |||
| 2423 | Ga0395898_0046845 | |||
| 2424 | Ga0395898_0093907 | |||
| 2425 | Ga0395898_0474518 | |||
| 2426 | Ga0395898_0502156 | |||
| 2427 | Ga0395898_0585479 | |||
| 2428 | Ga0395905_0000101 | |||
| 2429 | Ga0395905_0000361 | |||
| 2430 | Ga0395905_0000678 | |||
| 2431 | Ga0395905_0020944 | |||
| 2432 | Ga0395905_0038381 | |||
| 2433 | Ga0395905_0048180 | |||
| 2434 | Ga0395905_0052161 | |||
| 2435 | Ga0395905_0054838 | |||
| 2436 | Ga0395905_0066764 | |||
| 2437 | Ga0395905_0139686 | |||
| 2438 | Ga0395905_0173407 | |||
| 2439 | Ga0395905_0521152 | |||
| 2440 | Ga0395901_0000052 | |||
| 2441 | Ga0395901_0000068 | |||
| 2442 | Ga0395901_0000273 | |||
| 2443 | Ga0395901_0057959 | |||
| 2444 | Ga0395901_0111619 | |||
| 2445 | Ga0395901_0264643 | |||
| 2446 | Ga0395901_0370830 | |||
| 2447 | Ga0395901_0425360 | |||
| 2448 | Ga0395901_0460995 | |||
| 2449 | Ga0395901_0951562 | |||
| 2450 | Ga0436365_0367404 | |||
| 2451 | Ga0436365_1284605 | |||
| 2452 | Ga0436365_1811392 | |||
| 2453 | Ga0436360_0885706 | |||
| 2454 | Ga0436361_0092690 | |||
| 2455 | Ga0436361_0105866 | |||
| 2456 | Ga0436361_0320757 | |||
| 2457 | Ga0436361_0325425 | |||
| 2458 | Ga0436361_0347304 | |||
| 2459 | Ga0436361_0347340 | |||
| 2460 | Ga0436361_0428897 | |||
| 2461 | Ga0436361_0444413 | |||
| 2462 | Ga0436361_0558784 | |||
| 2463 | Ga0436361_0585531 | |||
| 2464 | Ga0436361_0689358 | |||
| 2465 | Ga0436361_0795199 | |||
| 2466 | Ga0436361_0871756 | |||
| 2467 | Ga0436361_0975940 | |||
| 2468 | Ga0436363_0436704 | |||
| 2469 | Ga0439436_0005797 | |||
| 2470 | Ga0439436_0018111 | |||
| 2471 | Ga0439439_0001395 | |||
| 2472 | Ga0439439_0078268 | |||
| 2473 | Ga0439447_009190 | |||
| 2474 | Ga0439461_0000338 | |||
| 2475 | Ga0439461_0012958 | |||
| 2476 | Ga0439466_0008919 | |||
| 2477 | Ga0439466_0054384 | |||
| 2478 | Ga0439465_0001362 | |||
| 2479 | Ga0439465_0013022 | |||
| 2480 | Ga0451793_0484513 | |||
| 2481 | Ga0451798_0229046 | |||
| 2482 | Ga0451800_0517189 | |||
| 2483 | Ga0451802_1574410 | |||
| 2484 | Ga0451806_090485 | |||
| 2485 | Ga0451806_223475 | |||
| 2486 | Ga0451807_1439184 | |||
| 2487 | Ga0451833_0019008 | |||
| 2488 | Ga0451839_1344540 | |||
| 2489 | Ga0451845_0447342 | |||
| 2490 | Ga0451843_1695995 | |||
| 2491 | Ga0451853_2497818 | |||
| 2492 | Ga0451853_3703070 | |||
| 2493 | Ga0439431_0001989 | |||
| 2494 | Ga0439431_0011302 | |||
| 2495 | Ga0439442_002682 | |||
| 2496 | Ga0439442_013875 | |||
| 2497 | Ga0439445_0000584 | |||
| 2498 | Ga0439445_0011308 | |||
| 2499 | Ga0439432_000736 | |||
| 2500 | Ga0439449_0032811 | |||
| 2501 | Ga0439449_0188187 | |||
| 2502 | Ga0439452_015478 | |||
| 2503 | Ga0439452_016405 | |||
| 2504 | Ga0439452_021212 | |||
| 2505 | Ga0439457_002395 | |||
| 2506 | Ga0439462_0001500 | |||
| 2507 | Ga0439462_0004148 | |||
| 2508 | Ga0439462_0066352 | |||
| 2509 | Ga0450911_000134 | |||
| 2510 | Ga0450919_010575 | |||
| 2511 | Ga0450921_001010 | |||
| 2512 | Ga0450922_011408 | |||
| 2513 | Ga0450923_021486 | |||
| 2514 | Ga0450888_000272 | |||
| 2515 | Ga0450890_003629 | |||
| 2516 | Ga0450890_015300 | |||
| 2517 | Ga0450891_001401 | |||
| 2518 | Ga0450892_000472 | |||
| 2519 | Ga0450894_028707 | |||
| 2520 | Ga0450898_006086 | |||
| 2521 | Ga0450898_007877 | |||
| 2522 | Ga0450900_033784 | |||
| 2523 | Ga0450889_009467 | |||
| 2524 | Ga0450906_008220 | |||
| 2525 | Ga0450906_017028 | |||
| 2526 | Ga0450910_004640 | |||
| 2527 | Ga0439446_0014107 | |||
| 2528 | Ga0439446_0031700 | |||
| 2529 | Ga0439434_0000210 | |||
| 2530 | Ga0439434_0002390 | |||
| 2531 | Ga0439434_0013492 | |||
| 2532 | Ga0439459_0052398 | |||
| 2533 | Ga0450918_000761 | |||
| 2534 | Ga0450893_0001075 | |||
| 2535 | Ga0450893_0018034 | |||
| 2536 | Ga0451577_0003919 | |||
| 2537 | Ga0451577_0004095 | |||
| 2538 | Ga0466969_0056066 | |||
| 2539 | Ga0466972_0006287 | |||
| 2540 | Ga0466972_0092644 | |||
| 2541 | Ga0466972_0097997 | |||
| 2542 | Ga0466972_0124065 | |||
| 2543 | Ga0466972_0128525 | |||
| 2544 | Ga0466965_0156740 | |||
| 2545 | Ga0466966_0009251 | |||
| 2546 | Ga0466966_0051238 | |||
| 2547 | Ga0466961_0001449 | |||
| 2548 | Ga0466961_0629790 | |||
| 2549 | Ga0466964_0115308 | |||
| 2550 | Ga0466964_0143971 | |||
| 2551 | Ga0453684_0178300 | |||
| 2552 | Ga0453684_0944967 | |||
| 2553 | Ga0466971_0135585 | |||
| 2554 | Ga0466968_0003118 | |||
| 2555 | Ga0466970_0257622 | |||
| 2556 | Ga0466957_0526156 | |||
| 2557 | Ga0466957_1052621 | |||
| 2558 | Ga0466960_0007309 | |||
| 2559 | Ga0466960_0079605 | |||
| 2560 | Ga0466960_0119690 | |||
| 2561 | Ga0466959_0003192 | |||
| 2562 | Ga0466959_0044627 | |||
| 2563 | Ga0466958_0008129 | |||
| 2564 | Ga0466958_0112405 | |||
| 2565 | Ga0466967_0085388 | |||
| 2566 | Ga0466967_0553630 | |||
| 2567 | Ga0495627_013446 | |||
| 2568 | Ga0495592_0054735 | |||
| 2569 | Ga0495592_0678325 | |||
| 2570 | Ga0495590_0019400 | |||
| 2571 | Ga0495629_0008209 | |||
| 2572 | Ga0495638_0007506 | |||
| 2573 | Ga0495638_0238952 | |||
| 2574 | Ga0495651_0017763 | |||
| 2575 | Ga0495651_0034392 | |||
| 2576 | Ga0495653_0055208 | |||
| 2577 | Ga0495605_0057631 | |||
| 2578 | Ga0495639_0146697 | |||
| 2579 | Ga0495664_0013389 | |||
| 2580 | Ga0495664_0038578 | |||
| 2581 | Ga0495585_0329478 | |||
| 2582 | Ga0495607_0108397 | |||
| 2583 | Ga0495583_0000024 | |||
| 2584 | Ga0495583_0060284 | |||
| 2585 | Ga0495583_0119066 | |||
| 2586 | Ga0495606_0056889 | |||
| 2587 | Ga0495606_0302832 | |||
| 2588 | Ga0495608_0095065 | |||
| 2589 | Ga0495616_0077637 | |||
| 2590 | Ga0495620_0030296 | |||
| 2591 | Ga0495620_0108092 | |||
| 2592 | Ga0495628_0037903 | |||
| 2593 | Ga0495628_0568165 | |||
| 2594 | Ga0495630_0433509 | |||
| 2595 | Ga0495630_0707507 | |||
| 2596 | Ga0495631_0160163 | |||
| 2597 | Ga0495632_0030226 | |||
| 2598 | Ga0495632_0272332 | |||
| 2599 | Ga0495632_0284786 | |||
| 2600 | Ga0495637_0008735 | |||
| 2601 | Ga0495637_0100302 | |||
| 2602 | Ga0495643_0005950 | |||
| 2603 | Ga0495643_0043864 | |||
| 2604 | Ga0495643_0110535 | |||
| 2605 | Ga0495643_0161471 | |||
| 2606 | Ga0495643_0246945 | |||
| 2607 | Ga0495648_0001207 | |||
| 2608 | Ga0495663_0167630 | |||
| 2609 | Ga0495642_0012335 | |||
| 2610 | Ga0495652_0030167 | |||
| 2611 | Ga0495652_0103323 | |||
| 2612 | Ga0495640_0015972 | |||
| 2613 | Ga0495640_0027981 | |||
| 2614 | Ga0495587_0006868 | |||
| 2615 | Ga0495597_0001605 | |||
| 2616 | Ga0495597_0012409 | |||
| 2617 | Ga0495622_0008216 | |||
| 2618 | Ga0495622_0021100 | |||
| 2619 | Ga0495633_0000871 | |||
| 2620 | Ga0495633_0014709 | |||
| 2621 | Ga0495667_0042387 | |||
| 2622 | Ga0495668_0024509 | |||
| 2623 | Ga0495668_0047976 | |||
| 2624 | Ga0495668_0158108 | |||
| 2625 | Ga0495668_0283565 | |||
| 2626 | Ga0495611_0165996 | |||
| 2627 | Ga0495625_0000661 | |||
| 2628 | Ga0495625_0051113 | |||
| 2629 | Ga0495625_0214547 | |||
| 2630 | Ga0495625_0450965 | |||
| 2631 | Ga0495635_0010642 | |||
| 2632 | Ga0495661_0017236 | |||
| 2633 | Ga0495661_0219511 | |||
| 2634 | Ga0495588_0015869 | |||
| 2635 | Ga0495657_0010266 | |||
| 2636 | Ga0495657_0029366 | |||
| 2637 | Ga0495599_0031929 | |||
| 2638 | Ga0495623_0053661 | |||
| 2639 | Ga0495646_0082543 | |||
| 2640 | Ga0495669_0256037 | |||
| 2641 | Ga0495613_0013192 | |||
| 2642 | Ga0495624_0306664 | |||
| 2643 | Ga0495670_0000034 | |||
| 2644 | Ga0495670_0088845 | |||
| 2645 | Ga0495671_0005640 | |||
| 2646 | Ga0495671_0035828 | |||
| 2647 | Ga0495671_0385169 | |||
| 2648 | Ga0495649_0015662 | |||
| 2649 | Ga0495649_0038349 | |||
| 2650 | Ga0495589_0090942 | |||
| 2651 | Ga0495600_0009990 | |||
| 2652 | Ga0495660_0037841 | |||
| 2653 | Ga0495660_0065627 | |||
| 2654 | Ga0495660_0274839 | |||
| 2655 | Ga0495581_0094671 | |||
| 2656 | Ga0495604_0040795 | |||
| 2657 | Ga0495604_0050432 | |||
| 2658 | Ga0495674_0022726 | |||
| 2659 | Ga0495672_0046228 | |||
| 2660 | Ga0495672_0046400 | |||
| 2661 | Ga0495676_0037455 | |||
| 2662 | Ga0495680_0007641 | |||
| 2663 | Ga0495683_0039430 | |||
| 2664 | Ga0495683_0049204 | |||
| 2665 | Ga0495687_011306 | |||
| 2666 | Ga0495687_055523 | |||
| 2667 | Ga0495687_084996 | |||
| 2668 | Ga0495675_0010586 | |||
| 2669 | Ga0495677_0060603 | |||
| 2670 | Ga0495673_0047410 | |||
| 2671 | Ga0495681_0021947 | |||
| 2672 | Ga0495684_0146922 | |||
| 2673 | Ga0495686_0027203 | |||
| 2674 | Ga0495686_0066061 | |||
| 2675 | Ga0495686_0075449 | |||
| 2676 | Ga0495686_0205830 | |||
| 2677 | Ga0495686_0205984 | |||
| 2678 | Ga0495686_0483967 | |||
| 2679 | Ga0495593_0027633 | |||
| 2680 | Ga0495593_0205615 | |||
| 2681 | Ga0495602_0013736 | |||
| 2682 | Ga0495614_0085393 | |||
| 2683 | Ga0496100_0126311 | |||
| 2684 | Ga0496100_0441055 | |||
| 2685 | Ga0496101_0005794 | |||
| 2686 | Ga0496101_0182361 | |||
| 2687 | Ga0496101_0404276 | |||
| 2688 | Ga0496102_0040088 | |||
| 2689 | Ga0496102_0110237 | |||
| 2690 | Ga0496102_0170304 | |||
| 2691 | Ga0496102_0289399 | |||
| 2692 | Ga0496102_0583486 | |||
| 2693 | Ga0496102_0861378 | |||
| 2694 | Ga0496102_1071204 | |||
| 2695 | Ga0496103_0144459 | |||
| 2696 | Ga0496103_0224472 | |||
| 2697 | Ga0496104_0034944 | |||
| 2698 | Ga0496104_0061336 | |||
| 2699 | Ga0496104_0186575 | |||
| 2700 | Ga0496104_0492395 | |||
| 2701 | Ga0496105_0055861 | |||
| 2702 | Ga0496105_0068847 | |||
| 2703 | Ga0496106_0008009 | |||
| 2704 | Ga0496106_0117954 | |||
| 2705 | Ga0496107_0032954 | |||
| 2706 | Ga0496107_0033498 | |||
| 2707 | Ga0496107_0056811 | |||
| 2708 | Ga0496107_0154085 | |||
| 2709 | Ga0496108_0446804 | |||
| 2710 | Ga0496109_0020128 | |||
| 2711 | Ga0496109_0035717 | |||
| 2712 | Ga0496109_0079304 | |||
| 2713 | Ga0496109_0338989 | |||
| 2714 | Ga0496110_0059452 | |||
| 2715 | Ga0496111_0138168 | |||
| 2716 | Ga0496112_0132215 | |||
| 2717 | Ga0496112_0344962 | |||
| 2718 | Ga0496113_0076453 | |||
| 2719 | Ga0496113_0709227 | |||
| 2720 | Ga0496113_0711314 | |||
| 2721 | Ga0496114_0026528 | |||
| 2722 | Ga0496114_0314262 | |||
| 2723 | Ga0496115_0179355 | |||
| 2724 | Ga0496115_0182219 | |||
| 2725 | Ga0496115_0223528 | |||
| 2726 | Ga0496116_0149126 | |||
| 2727 | Ga0496117_0051694 | |||
| 2728 | Ga0496118_0010190 | |||
| 2729 | Ga0496118_0041072 | |||
| 2730 | Ga0496118_0154618 | |||
| 2731 | Ga0496118_0306668 | |||
| 2732 | Ga0496119_0012917 | |||
| 2733 | Ga0496119_0078747 | |||
| 2734 | Ga0496119_0083482 | |||
| 2735 | Ga0496119_0099360 | |||
| 2736 | Ga0496119_0154960 | |||
| 2737 | Ga0496120_0000435 | |||
| 2738 | Ga0496120_0021764 | |||
| 2739 | Ga0496120_0033527 | |||
| 2740 | Ga0496120_0044804 | |||
| 2741 | Ga0496120_0069714 | |||
| 2742 | Ga0496120_0217169 | |||
| 2743 | Ga0496121_0000091 | |||
| 2744 | Ga0496121_0006917 | |||
| 2745 | Ga0496121_0015919 | |||
| 2746 | Ga0496121_0044637 | |||
| 2747 | Ga0496121_0045073 | |||
| 2748 | Ga0496121_0113744 | |||
| 2749 | Ga0496121_0184812 | |||
| 2750 | Ga0496121_0212339 | |||
| 2751 | Ga0496121_0297836 | |||
| 2752 | Ga0496121_0573820 | |||
| 2753 | Ga0496121_0668779 | |||
| 2754 | Ga0496122_0035517 | |||
| 2755 | Ga0496122_0039013 | |||
| 2756 | Ga0496122_0074747 | |||
| 2757 | Ga0496122_0142567 | |||
| 2758 | Ga0496123_0004305 | |||
| 2759 | Ga0496123_0048893 | |||
| 2760 | Ga0496124_0028741 | |||
| 2761 | Ga0496124_0049080 | |||
| 2762 | Ga0496124_0058454 | |||
| 2763 | Ga0496124_0191405 | |||
| 2764 | Ga0496124_0278167 | |||
| 2765 | Ga0496124_0344703 | |||
| 2766 | Ga0496124_0365434 | |||
| 2767 | Ga0496124_0483987 | |||
| 2768 | Ga0496124_0841026 | |||
| 2769 | Ga0496125_0000352 | |||
| 2770 | Ga0496125_0016745 | |||
| 2771 | Ga0496125_0016750 | |||
| 2772 | Ga0496125_0044128 | |||
| 2773 | Ga0496125_0212638 | |||
| 2774 | Ga0496125_0236479 | |||
| 2775 | Ga0496126_0007394 | |||
| 2776 | Ga0496126_0023157 | |||
| 2777 | Ga0496126_0027931 | |||
| 2778 | Ga0496126_0059973 | |||
| 2779 | Ga0496126_0061639 | |||
| 2780 | Ga0496126_0077591 | |||
| 2781 | Ga0496126_0107156 | |||
| 2782 | Ga0496126_0129166 | |||
| 2783 | Ga0496126_0237816 | |||
| 2784 | Ga0496126_0266800 | |||
| 2785 | Ga0496126_0547400 | |||
| 2786 | Ga0496126_0569428 | |||
| 2787 | Ga0501310_029544 | |||
| 2788 | Ga0501294_007359 | |||
| 2789 | Ga0501300_005430 | |||
| 2790 | Ga0501031_0129954 | |||
| 2791 | Ga0501031_0411918 | |||
| 2792 | Ga0501032_0006968 | |||
| 2793 | Ga0501032_0023507 | |||
| 2794 | Ga0501032_0111332 | |||
| 2795 | Ga0501033_0007935 | |||
| 2796 | Ga0501033_0048490 | |||
| 2797 | Ga0501033_0073442 | |||
| 2798 | Ga0501033_0117411 | |||
| 2799 | Ga0501033_0170694 | |||
| 2800 | Ga0501033_0205263 | |||
| 2801 | Ga0501033_0369248 | |||
| 2802 | Ga0501033_0578043 | |||
| 2803 | Ga0501034_0006155 | |||
| 2804 | Ga0501034_0009755 | |||
| 2805 | Ga0501034_0025344 | |||
| 2806 | Ga0501034_0025864 | |||
| 2807 | Ga0501034_0029777 | |||
| 2808 | Ga0501034_0076321 | |||
| 2809 | Ga0501034_0414000 | |||
| 2810 | Ga0501034_0529334 | |||
| 2811 | Ga0501034_0690326 | |||
| 2812 | Ga0501036_0001698 | |||
| 2813 | Ga0501036_0152991 | |||
| 2814 | Ga0501036_0188319 | |||
| 2815 | Ga0501036_0285367 | |||
| 2816 | Ga0501036_0356885 | |||
| 2817 | Ga0501037_0021179 | |||
| 2818 | Ga0501037_0031114 | |||
| 2819 | Ga0501037_0035110 | |||
| 2820 | Ga0501037_0115841 | |||
| 2821 | Ga0501037_0312295 | |||
| 2822 | Ga0501038_0016637 | |||
| 2823 | Ga0501038_0018939 | |||
| 2824 | Ga0501038_0020329 | |||
| 2825 | Ga0501038_0206876 | |||
| 2826 | Ga0501038_0317014 | |||
| 2827 | Ga0501038_0461937 | |||
| 2828 | Ga0501038_0633520 | |||
| 2829 | Ga0501039_0152154 | |||
| 2830 | Ga0501039_0181004 | |||
| 2831 | Ga0501040_0106110 | |||
| 2832 | Ga0501042_0061964 | |||
| 2833 | Ga0501043_0014288 | |||
| 2834 | Ga0501043_0014731 | |||
| 2835 | Ga0501043_0146383 | |||
| 2836 | Ga0501043_0178804 | |||
| 2837 | Ga0501046_0008710 | |||
| 2838 | Ga0501046_0840601 | |||
| 2839 | Ga0501047_0018727 | |||
| 2840 | Ga0501047_0025481 | |||
| 2841 | Ga0501047_0062178 | |||
| 2842 | Ga0501047_0088364 | |||
| 2843 | Ga0501047_0198864 | |||
| 2844 | Ga0501047_0199795 | |||
| 2845 | Ga0501047_0314389 | |||
| 2846 | Ga0501047_0314395 | |||
| 2847 | Ga0501047_0376744 | |||
| 2848 | Ga0501048_0072858 | |||
| 2849 | Ga0501048_0166654 | |||
| 2850 | Ga0501048_0376103 | |||
| 2851 | Ga0501067_0104061 | |||
| 2852 | Ga0501068_0078871 | |||
| 2853 | Ga0501068_0255419 | |||
| 2854 | Ga0501070_0159115 | |||
| 2855 | Ga0501070_0182568 | |||
| 2856 | Ga0501070_0233999 | |||
| 2857 | Ga0501070_0512275 | |||
| 2858 | Ga0501073_0011914 | |||
| 2859 | Ga0501073_0042668 | |||
| 2860 | Ga0501073_0090090 | |||
| 2861 | Ga0501074_0172343 | |||
| 2862 | Ga0501074_0187422 | |||
| 2863 | Ga0501211_001650 | |||
| 2864 | Ga0501217_022639 | |||
| 2865 | Ga0501222_012228 | |||
| 2866 | Ga0501235_046995 | |||
| 2867 | Ga0501249_002521 | |||
| 2868 | Ga0501257_000883 | |||
| 2869 | Ga0501258_000994 | |||
| 2870 | Ga0501259_066400 | |||
| 2871 | Ga0501229_002101 | |||
| 2872 | Ga0501080_0000625 | |||
| 2873 | Ga0501080_0085300 | |||
| 2874 | Ga0501080_0110133 | |||
| 2875 | Ga0501080_0122796 | |||
| 2876 | Ga0501080_0688588 | |||
| 2877 | Ga0501083_0023237 | |||
| 2878 | Ga0501083_0267834 | |||
| 2879 | Ga0501241_031036 | |||
| 2880 | Ga0501262_000489 | |||
| 2881 | Ga0501267_010271 | |||
| 2882 | Ga0501035_0011712 | |||
| 2883 | Ga0501035_0077553 | |||
| 2884 | Ga0501035_0082194 | |||
| 2885 | Ga0501035_0107220 | |||
| 2886 | Ga0501035_0130654 | |||
| 2887 | Ga0501035_0156326 | |||
| 2888 | Ga0501035_0281105 | |||
| 2889 | Ga0501035_0319959 | |||
| 2890 | Ga0501044_0024139 | |||
| 2891 | Ga0501044_0035800 | |||
| 2892 | Ga0501044_0037635 | |||
| 2893 | Ga0501044_0043203 | |||
| 2894 | Ga0501044_0107275 | |||
| 2895 | Ga0501044_0183152 | |||
| 2896 | Ga0501044_0215536 | |||
| 2897 | Ga0501044_0273502 | |||
| 2898 | Ga0501044_1092902 | |||
| 2899 | Ga0501045_0039912 | |||
| 2900 | nmdc:mga03683_11473_c1 | |||
| 2901 | nmdc:mga03683_174394_c1 | |||
| 2902 | nmdc:mga03683_32994_c1 | |||
| 2903 | nmdc:mga03683_65825_c1 | |||
| 2904 | nmdc:mga03683_87305_c1 | |||
| 2905 | nmdc:mga03n38_11305_c1 | |||
| 2906 | nmdc:mga00v17_16100_c1 | |||
| 2907 | nmdc:mga00v17_29018_c1 | |||
| 2908 | nmdc:mga00v17_37311_c1 | |||
| 2909 | nmdc:mga00v17_69892_c1 | |||
| 2910 | nmdc:mga00v17_86082_c1 | |||
| 2911 | nmdc:mga0yw44_17340_c1 | |||
| 2912 | nmdc:mga0yw44_19198_c1 | |||
| 2913 | nmdc:mga0yw44_34925_c1 | |||
| 2914 | nmdc:mga0yw44_452584_c1 | |||
| 2915 | nmdc:mga0k408_10077_c1 | |||
| 2916 | nmdc:mga0k408_13160_c3 | |||
| 2917 | nmdc:mga0k408_379440_c1 | |||
| 2918 | nmdc:mga0k408_41720_c1 | |||
| 2919 | nmdc:mga0k408_53718_c2 | |||
| 2920 | nmdc:mga06z11_189016_c1 | |||
| 2921 | nmdc:mga06z11_88562_c1 | |||
| 2922 | nmdc:mga04h51_31440_c1 | |||
| 2923 | nmdc:mga07m45_12486_c1 | |||
| 2924 | nmdc:mga07m45_1970_c1 | |||
| 2925 | nmdc:mga07m45_2447_c1 | |||
| 2926 | nmdc:mga07m45_26459_c1 | |||
| 2927 | nmdc:mga07m45_36002_c1 | |||
| 2928 | nmdc:mga07m45_88246_c1 | |||
| 2929 | nmdc:mga08x19_252343_c1 | |||
| 2930 | nmdc:mga0sz30_143250_c1 | |||
| 2931 | nmdc:mga0sz30_279959_c1 | |||
| 2932 | nmdc:mga0sz30_290396_c1 | |||
| 2933 | nmdc:mga0sz30_359214_c1 | |||
| 2934 | nmdc:mga0sz30_55009_c1 | |||
| 2935 | Ga0500610_0097753 | |||
| 2936 | Ga0500578_0017074 | |||
| 2937 | Ga0500643_000117 | |||
| 2938 | Ga0500643_013466 | |||
| 2939 | Ga0500643_025299 | |||
| 2940 | Ga0500644_0318434 | |||
| 2941 | Ga0500646_0081632 | |||
| 2942 | Ga0500647_0043082 | |||
| 2943 | Ga0500583_0008979 | |||
| 2944 | Ga0500583_0013885 | |||
| 2945 | Ga0500583_0114636 | |||
| 2946 | Ga0500651_0029989 | |||
| 2947 | Ga0500566_0000089 | |||
| 2948 | Ga0500566_0007716 | |||
| 2949 | Ga0500566_0284604 | |||
| 2950 | Ga0500566_0365025 | |||
| 2951 | Ga0500641_0016651 | |||
| 2952 | Ga0500650_0043101 | |||
| 2953 | Ga0500650_0121583 | |||
| 2954 | Ga0500555_022776 | |||
| 2955 | Ga0500556_0110918 | |||
| 2956 | Ga0500556_0165983 | |||
| 2957 | Ga0500557_000089 | |||
| 2958 | Ga0500562_001563 | |||
| 2959 | Ga0500562_008747 | |||
| 2960 | Ga0500569_001966 | |||
| 2961 | Ga0500593_001529 | |||
| 2962 | Ga0500594_0023917 | |||
| 2963 | Ga0500595_105080 | |||
| 2964 | Ga0500597_009365 | |||
| 2965 | Ga0500597_087200 | |||
| 2966 | Ga0500607_000992 | |||
| 2967 | Ga0500607_084049 | |||
| 2968 | Ga0500608_000056 | |||
| 2969 | Ga0500608_065252 | |||
| 2970 | Ga0500617_141819 | |||
| 2971 | Ga0500642_0002259 | |||
| 2972 | Ga0500642_0010858 | |||
| 2973 | Ga0500652_007545 | |||
| 2974 | Ga0500652_221352 | |||
| 2975 | Ga0500658_0002356 | |||
| 2976 | Ga0500658_0023945 | |||
| 2977 | Ga0500658_0042641 | |||
| 2978 | Ga0500658_0273580 | |||
| 2979 | Ga0500559_0000251 | |||
| 2980 | Ga0500559_0003661 | |||
| 2981 | Ga0500559_0022448 | |||
| 2982 | Ga0500559_0025312 | |||
| 2983 | Ga0500559_0097098 | |||
| 2984 | Ga0500559_0295541 | |||
| 2985 | Ga0500564_106654 | |||
| 2986 | Ga0500568_0006855 | |||
| 2987 | Ga0500568_0010336 | |||
| 2988 | Ga0500568_0013851 | |||
| 2989 | Ga0500568_0087030 | |||
| 2990 | Ga0500568_0131743 | |||
| 2991 | Ga0500568_0146741 | |||
| 2992 | Ga0500573_0000021 | |||
| 2993 | Ga0500577_0002096 | |||
| 2994 | Ga0500577_0008824 | |||
| 2995 | Ga0500577_0036812 | |||
| 2996 | Ga0500604_0128541 | |||
| 2997 | Ga0500616_0000011 | |||
| 2998 | Ga0500616_0005790 | |||
| 2999 | Ga0500616_0034153 | |||
| 3000 | Ga0500616_0047942 | |||
| 3001 | Ga0500619_036863 | |||
| 3002 | Ga0500620_002504 | |||
| 3003 | Ga0500622_0006962 | |||
| 3004 | Ga0500622_0012884 | |||
| 3005 | Ga0500624_000020 | |||
| 3006 | Ga0500627_0006872 | |||
| 3007 | Ga0500627_0039756 | |||
| 3008 | Ga0500633_0192256 | |||
| 3009 | Ga0500634_0007272 | |||
| 3010 | Ga0500636_0000526 | |||
| 3011 | Ga0500637_0000074 | |||
| 3012 | Ga0500637_0297756 | |||
| 3013 | Ga0500625_027984 | |||
| 3014 | Ga0500625_089535 | |||
| 3015 | Ga0500645_009627 | |||
| 3016 | Ga0500599_007459 | |||
| 3017 | Ga0500601_000577 | |||
| 3018 | Ga0501084_0777206 | |||
| 3019 | Ga0500661_012337 | |||
| 3020 | Ga0501082_0012479 | |||
| 3021 | Ga0466962_0090141 | |||
| 3022 | 2507505660 | |||
| 3023 | 2508539551 | |||
| 3024 | 2508695918 | |||
| 3025 | 2509116914 | |||
| 3026 | 2509146792 | |||
| 3027 | 2509373192 | |||
| 3028 | 2509395536 | |||
| 3029 | 2510317153 | |||
| 3030 | 2511388512 | |||
| 3031 | 2511398991 | |||
| 3032 | 2512035794 | |||
| 3033 | 2512929030 | |||
| 3034 | 2512963594 | |||
| 3035 | 2513589890 | |||
| 3036 | 2513612450 | |||
| 3037 | 2513625025 | |||
| 3038 | 2513640820 | |||
| 3039 | 2513651805 | |||
| 3040 | 2513659395 | |||
| 3041 | 2513673974 | |||
| 3042 | 2513699782 | |||
| 3043 | 2513722035 | |||
| 3044 | 2513860662 | |||
| 3045 | 2513876888 | |||
| 3046 | 2513889954 | |||
| 3047 | 2513919070 | |||
| 3048 | 2514010297 | |||
| 3049 | 2514038147 | |||
| 3050 | 2514423412 | |||
| 3051 | 2515624057 | |||
| 3052 | 2517106584 | |||
| 3053 | 2517888393 | |||
| 3054 | 2524440101 | |||
| 3055 | 2524470037 | |||
| 3056 | 2524535304 | |||
| 3057 | 2528854419 | |||
| 3058 | 2588514563 | |||
| 3059 | 2599104042 | |||
| 3060 | 2599935920 | |||
| 3061 | 2617350063 | |||
| 3062 | 2617374131 | |||
| 3063 | 2643745642 | |||
| 3064 | 2643757465 | |||
| 3065 | 2644126219 | |||
| 3066 | 2644257709 | |||
| 3067 | 2644325470 | |||
| 3068 | 2671124216 | |||
| 3069 | 2671694043 | |||
| 3070 | 2688599156 | |||
| 3071 | 2694633523 | |||
| 3072 | 2694635227 | |||
| 3073 | 2723578230 | |||
| 3074 | 2728747924 | |||
| 3075 | 2739252154 | |||
| 3076 | 2745077791 | |||
| 3077 | 2792460705 | |||
| 3078 | 2793065960 | |||
| 3079 | 2793067207 | |||
| 3080 | 2805922215 | |||
| 3081 | 2818239289 | |||
| 3082 | 2824606262 | |||
| 3083 | 2824616118 | |||
| 3084 | 2824625514 | |||
| 3085 | 2824634378 | |||
| 3086 | 2824641655 | |||
| 3087 | 2824648940 | |||
| 3088 | 2824658283 | |||
| 3089 | 2824669721 | |||
| 3090 | 2824677072 | |||
| 3091 | 2824684858 | |||
| 3092 | 2824693561 | |||
| 3093 | 2824701794 | |||
| 3094 | 2824711972 | |||
| 3095 | 2824718977 | |||
| 3096 | 2824729180 | |||
| 3097 | 2824734867 | |||
| 3098 | 2824748126 | |||
| 3099 | 2824762575 | |||
| 3100 | 2824772749 | |||
| 3101 | 2824780039 | |||
| 3102 | 2828306905 | |||
| 3103 | 2838125786 | |||
| 3104 | 2841913612 | |||
| 3105 | 2841919359 | |||
| 3106 | 2841948380 | |||
| 3107 | 2841952827 | |||
| 3108 | 2841965657 | |||
| 3109 | 2841972824 | |||
| 3110 | 2841977599 | |||
| 3111 | 2841984840 | |||
| 3112 | 2842041408 | |||
| 3113 | 2842049450 | |||
| 3114 | 2842697195 | |||
| 3115 | 2842875377 | |||
| 3116 | 2843747987 | |||
| 3117 | 2844014334 | |||
| 3118 | 2844315890 | |||
| 3119 | 2846957082 | |||
| 3120 | 2847939884 | |||
| 3121 | 2847942720 | |||
| 3122 | 2848863089 | |||
| 3123 | 2849076714 | |||
| 3124 | 2849561426 | |||
| 3125 | 2849574673 | |||
| 3126 | 2851153574 | |||
| 3127 | 2856328122 | |||
| 3128 | 2856329105 | |||
| 3129 | 2856341982 | |||
| 3130 | 2856367275 | |||
| 3131 | 2857354165 | |||
| 3132 | 2857372330 | |||
| 3133 | 2857506512 | |||
| 3134 | 2857515669 | |||
| 3135 | 2857577080 | |||
| 3136 | 2869175361 | |||
| 3137 | 2869238856 | |||
| 3138 | 2869252227 | |||
| 3139 | 2869263523 | |||
| 3140 | 2869268166 | |||
| 3141 | 2869278022 | |||
| 3142 | 2869284343 | |||
| 3143 | 2869287558 | |||
| 3144 | 2871431082 | |||
| 3145 | 2871439012 | |||
| 3146 | 2871452002 | |||
| 3147 | 2871460132 | |||
| 3148 | 2871487416 | |||
| 3149 | 2874110949 | |||
| 3150 | 2874120890 | |||
| 3151 | 2874134171 | |||
| 3152 | 2874139194 | |||
| 3153 | 2874150354 | |||
| 3154 | 2874157409 | |||
| 3155 | 2874164154 | |||
| 3156 | 2874593220 | |||
| 3157 | 2874617178 | |||
| 3158 | 2874621405 | |||
| 3159 | 2874629207 | |||
| 3160 | 2874647803 | |||
| 3161 | 2876369496 | |||
| 3162 | 2876386004 | |||
| 3163 | 2876386569 | |||
| 3164 | 2876403341 | |||
| 3165 | 2876410088 | |||
| 3166 | 2876416505 | |||
| 3167 | 2876422225 | |||
| 3168 | 2876762869 | |||
| 3169 | 2876773260 | |||
| 3170 | 2876820567 | |||
| 3171 | 2878738329 | |||
| 3172 | 2878740041 | |||
| 3173 | 2878747695 | |||
| 3174 | 2878777805 | |||
| 3175 | 2878781088 | |||
| 3176 | 2879076794 | |||
| 3177 | 2879083557 | |||
| 3178 | 2879101211 | |||
| 3179 | 2879128747 | |||
| 3180 | 2879145534 | |||
| 3181 | 2881367167 | |||
| 3182 | 2881668454 | |||
| 3183 | 2882637507 | |||
| 3184 | 2885368973 | |||
| 3185 | 2885380443 | |||
| 3186 | 2885386348 | |||
| 3187 | 2885414250 | |||
| 3188 | 2885431821 | |||
| 3189 | 2888342394 | |||
| 3190 | 2888352100 | |||
| 3191 | 2888379078 | |||
| 3192 | 2888390253 | |||
| 3193 | 2888427482 | |||
| 3194 | 2889014087 | |||
| 3195 | 2889021204 | |||
| 3196 | 2894822197 | |||
| 3197 | 2898329880 | |||
| 3198 | 2903453084 | |||
| 3199 | 2903498811 | |||
| 3200 | 2903515917 | |||
| 3201 | 2903526902 | |||
| 3202 | 2903530235 | |||
| 3203 | 2903731840 | |||
| 3204 | 2903753289 | |||
| 3205 | 2903771414 | |||
| 3206 | 2904668075 | |||
| 3207 | 2904692277 | |||
| 3208 | 2904707783 | |||
| 3209 | 2904718215 | |||
| 3210 | 2906310096 | |||
| 3211 | 2906322968 | |||
| 3212 | 2906361143 | |||
| 3213 | 2906376926 | |||
| 3214 | 2906402112 | |||
| 3215 | 2906414353 | |||
| 3216 | 2906432697 | |||
| 3217 | 2906603633 | |||
| 3218 | 2906614253 | |||
| 3219 | 2906631759 | |||
| 3220 | 2906640750 | |||
| 3221 | 2906646267 | |||
| 3222 | 2906660868 | |||
| 3223 | 2908746919 | |||
| 3224 | 2908758915 | |||
| 3225 | 2908776605 | |||
| 3226 | 2909048404 | |||
| 3227 | 2919454171 | |||
| 3228 | 2922137046 | |||
| 3229 | 2922153766 | |||
| 3230 | 2922173096 | |||
| 3231 | 2922187442 | |||
| 3232 | 2922400369 | |||
| 3233 | 2922426076 | |||
| 3234 | 2924714882 | |||
| 3235 | 2924723335 | |||
| 3236 | 2924734661 | |||
| 3237 | 2924743177 | |||
| 3238 | 2924752112 | |||
| 3239 | 2924777640 | |||
| 3240 | 2928027414 | |||
| 3241 | 2928525836 | |||
| 3242 | 2928974752 | |||
| 3243 | 2929205260 | |||
| 3244 | 2929619039 | |||
| 3245 | 2929631116 | |||
| 3246 | 2932789081 | |||
| 3247 | 2932800186 | |||
| 3248 | 2932808231 | |||
| 3249 | 2932814282 | |||
| 3250 | 2932820408 | |||
| 3251 | 2932834330 | |||
| 3252 | 2933580251 | |||
| 3253 | 2935614714 | |||
| 3254 | 2935620015 | |||
| 3255 | 2935632488 | |||
| 3256 | 2935640334 | |||
| 3257 | 2935649101 | |||
| 3258 | 2935658127 | |||
| 3259 | 2935673379 | |||
| 3260 | 2935683860 | |||
| 3261 | 2935686829 | |||
| 3262 | 2935702125 | |||
| 3263 | 2935710535 | |||
| 3264 | 2935716517 | |||
| 3265 | 2935723358 | |||
| 3266 | 2935734914 | |||
| 3267 | 2935744295 | |||
| 3268 | 2935752795 | |||
| 3269 | 2935764657 | |||
| 3270 | 2935774707 | |||
| 3271 | 2935785071 | |||
| 3272 | 2935789778 | |||
| 3273 | 2935797854 | |||
| 3274 | 2935806232 | |||
| 3275 | 2935818088 | |||
| 3276 | 2935826246 | |||
| 3277 | 2935837149 | |||
| 3278 | 2935841330 | |||
| 3279 | 2935853742 | |||
| 3280 | 2935858901 | |||
| 3281 | 2935864082 | |||
| 3282 | 2935875604 | |||
| 3283 | 2935883335 | |||
| 3284 | 2935910964 | |||
| 3285 | 2935924125 | |||
| 3286 | 2935932822 | |||
| 3287 | 2935937385 | |||
| 3288 | 2935949414 | |||
| 3289 | 2935958187 | |||
| 3290 | 2935964115 | |||
| 3291 | 2935971158 | |||
| 3292 | 2935982250 | |||
| 3293 | 2935985385 | |||
| 3294 | 2935995452 | |||
| 3295 | 2936007875 | |||
| 3296 | 2936012346 | |||
| 3297 | 2936020573 | |||
| 3298 | 2936029639 | |||
| 3299 | 2936044698 | |||
| 3300 | 2936051896 | |||
| 3301 | 2936056848 | |||
| 3302 | 2937815382 | |||
| 3303 | 2937851435 | |||
| 3304 | 2937864224 | |||
| 3305 | 2937873166 | |||
| 3306 | 2937883859 | |||
| 3307 | 2937976609 | |||
| 3308 | 2937988302 | |||
| 3309 | 2938021085 | |||
| 3310 | 2939634624 | |||
| 3311 | 2940558708 | |||
| 3312 | 2941508848 | |||
| 3313 | 2941516678 | |||
| 3314 | 2941524306 | |||
| 3315 | 2941535738 | |||
| 3316 | 2941543557 | |||
| 3317 | 2945910195 | |||
| 3318 | 2945987779 | |||
| 3319 | 2954012075 | |||
| 3320 | 2958038440 | |||
| 3321 | 2958044405 | |||
| 3322 | 2958056051 | |||
| 3323 | 2958069727 | |||
| 3324 | 2958091137 | |||
| 3325 | 2958096218 | |||
| 3326 | 2958101107 | |||
| 3327 | 2958108939 | |||
| 3328 | 2958128360 | |||
| 3329 | 2958131960 | |||
| 3330 | 2958140723 | |||
| 3331 | 2958147463 | |||
| 3332 | 2958164571 | |||
| 3333 | 2958176565 | |||
| 3334 | 2958181763 | |||
| 3335 | 2961079607 | |||
| 3336 | 2961186779 | |||
| 3337 | 2963650204 | |||
| 3338 | 2965029258 | |||
| 3339 | 2965045694 | |||
| 3340 | 2965049861 | |||
| 3341 | 2965091103 | |||
| 3342 | 2965120743 | |||
| 3343 | 2968021255 | |||
| 3344 | 2968086450 | |||
| 3345 | 2968120278 | |||
| 3346 | 2968142146 | |||
| 3347 | 2970476360 | |||
| 3348 | 2970489805 | |||
| 3349 | 2970517928 | |||
| 3350 | 2970535661 | |||
| 3351 | 2970551916 | |||
| 3352 | 2970598958 | |||
| 3353 | 2970626861 | |||
| 3354 | 2970629714 | |||
| 3355 | 2977242208 | |||
| 3356 | 2977846610 | |||
| 3357 | 2977853988 | |||
| 3358 | 2977879525 | |||
| 3359 | 2977905473 | |||
| 3360 | 2977909957 | |||
| 3361 | 2977923266 | |||
| 3362 | 2977937541 | |||
| 3363 | 2977949683 | |||
| 3364 | 2977953996 | |||
| 3365 | 2977961982 | |||
| 3366 | 2977976353 | |||
| 3367 | 2977986694 | |||
| 3368 | 2979711000 | |||
| 3369 | 2979748443 | |||
| 3370 | 2979771851 | |||
| 3371 | 2979776784 | |||
| 3372 | 2979798507 | |||
| 3373 | 2984558284 | |||
| 3374 | 2984567336 | |||
| 3375 | 2987642425 | |||
| 3376 | 2987647290 | |||
| 3377 | 2987657142 | |||
| 3378 | 2987677044 | |||
| 3379 | 2993358402 | |||
| 3380 | 2995951874 | |||
| 3381 | 2996356438 | |||
| 3382 | 2996388306 | |||
| 3383 | 3002145572 | |||
| 3384 | 3003666512 | |||
| 3385 | 3004196980 | |||
| 3386 | 3004210507 | |||
| 3387 | 3004213443 | |||
| 3388 | 3004221270 | |||
| 3389 | 3004238468 | |||
| 3390 | 3004253002 | |||
| 3391 | 3004269813 | |||
| 3392 | 3004282743 | |||
| 3393 | 3004338463 | |||
| 3394 | 3005483464 | |||
| 3395 | 3005488914 | |||
| 3396 | 3005506327 | |||
| 3397 | 3005592698 | |||
| 3398 | 3005595477 | |||
| 3399 | 3005711443 | |||
| 3400 | 3005718705 | |||
| 3401 | 637078749 | |||
| 3402 | 649873586 | |||
| 3403 | 8001846245 | |||
| 3404 | 8003405184 | |||
| 3405 | 8004302192 | |||
| 3406 | 8004367523 | |||
| 3407 | 8004390294 | |||
| 3408 | 8004642299 | |||
| 3409 | 8004699137 | |||
| 3410 | 8004716358 | |||
| 3411 | 8004732201 | |||
| 3412 | 8006932029 | |||
| 3413 | 8006936774 | |||
| 3414 | 8006976745 | |||
| 3415 | 8016517719 | |||
| 3416 | 8016525772 | |||
| 3417 | 8016539372 | |||
| 3418 | 8016543662 | |||
| 3419 | 8016549634 | |||
| 3420 | 8016558052 | |||
| 3421 | 8016569067 | |||
| 3422 | 8016581701 | |||
| 3423 | 8016585876 | |||
| 3424 | 8016596063 | |||
| 3425 | 8016606949 | |||
| 3426 | 8016618855 | |||
| 3427 | 8016622688 | |||
| 3428 | 8016635186 | |||
| 3429 | 8017058909 | |||
| 3430 | 8019530651 | |||
| 3431 | 8019540935 | |||
| 3432 | 8019549684 | |||
| 3433 | 8019561914 | |||
| 3434 | 8019571987 | |||
| 3435 | 8019576741 | |||
| 3436 | 8019594794 | |||
| 3437 | 8019606943 | |||
| 3438 | 8019611564 | |||
| 3439 | 8019623407 | |||
| 3440 | 8019638733 | |||
| 3441 | 8019640932 | |||
| 3442 | 8019653021 | |||
| 3443 | 8019666534 | |||
| 3444 | 8019676232 | |||
| 3445 | 8019679753 | |||
| 3446 | 8019695748 | |||
| 3447 | 8054007968 | |||
| 3448 | 8054568787 | |||
| 3449 | 8055742888 | |||
| 3450 | 8055913433 | |||
| 3451 | 8056683150 | |||
| 3452 | 8056970808 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4l5e-assembly1.cif.gz_A-2 | crystal structure of a. aeolicus ntrc1 dna binding domain | 0.9773 | 137 | 180 |
| 5ds9-assembly1.cif.gz_A | crystal structure of fis bound to 27bp dna f1-8a (aaattagtttgaattttgagctaattt) | 0.9435 | 141 | 177 |
| 2qzj-assembly5.cif.gz_E | crystal structure of a two-component response regulator from clostridium difficile | 0.9305 | 9 | 118 |
| 1f36-assembly1.cif.gz_B | the crystal structure of fis mutant k36e reveals that the transactivation region of the fis protein contains extended mobile beta-hairpin arms | 0.9302 | 139 | 177 |
| 1etq-assembly2.cif.gz_D | the crystal structure of e. coli fis mutant r71y | 0.9281 | 139 | 177 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4l5eA00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.9772 | 137 | 180 | 1.10.10.60 |
| 3rqiA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.952 | 8 | 122 | 3.40.50.2300 |
| 3jriB00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.935 | 139 | 177 | 1.10.10.60 |
| 5e3oA00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.9315 | 139 | 177 | 1.10.10.60 |
| 1f36B00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.9302 | 139 | 177 | 1.10.10.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A519L8J2-F1-model_v4 | Response regulator | 0.9778 | 9 | 124 |
GO:0000160
|
| AF-A0A1G0NHW1-F1-model_v4 | Two-component system response regulator | 0.9634 | 10 | 122 |
GO:0000160
|
| AF-A0A7C3E8B7-F1-model_v4 | Response regulator | 0.9598 | 9 | 122 |
GO:0000160
|
| AF-A0A2H0LHK0-F1-model_v4 | Type II secretion system protein GspE | 0.9463 | 9 | 119 |
GO:0000160
GO:0005524 GO:0005886 GO:0016887 |
| AF-A0A0F9BAK8-F1-model_v4 | Response regulatory domain-containing protein | 0.9462 | 9 | 118 |
GO:0000160
|