metagRoot

F495533

General Info

Members	Datasets	Scaffolds	Average Seq Length
1738	770	1485	423

Family's Representative Sequence

Representative Sequence	3300005536\|Ga0070697_100015494\|Ga0070697_1000154944
Length	490
Sequence	MPDTHFTITIFIVLLLIASGLAMITKWVPVLYTLALVIVTIQISAFCSNLSFVDKFRIRGGNQIKGRVAISGAKNSALPCMAAAILTADDVTLHNLPYVRDIITMRRLLEDIGAHVLTPELRTHKISAAHVELMTAPYELVKTMRASVLALGPLLARFGKARVSLPGGCAIGARPIDQHLAGFTKLGAEVFLEAGDVVARVPQTGRLIGAEVSFDKVSVTGTENLMMAATLARGRTTIHNAAREPEVRDLAELLNKMGARVRGAGTPTIQIDGVETLGGAEHAIIPDRIETGTFIVAGAITNGELEIKNCNPEHCNRIIAKLRETGVEIEEVNQSTLMVRGTGKALKASDVATEPYPSFPTDMQAQYMTLMTQSKGRSTISETIFENRFMHASELQRMGARVQISRDQAIVDGPSKLIGARVQASDLRASASLVLAGLVAEGETTIDRVYHIDRGYEKIETKLKAVGADIERVRDSVTSPLGTSQDGRIE

Samples

	Sample ID	Description	Type	Environment
1	2010549000	Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes	Metagenome	Endosphere
2	2162886007	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1	Metagenome	Rhizosphere
3	2162886012	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1	Metagenome	Rhizosphere
4	2501025502	Paraburkholderia unamae MTI-641	Isolate	Rhizosphere
5	2506520007	Serratia plymuthica AS9	Isolate	Rhizosphere
6	2506520008	Serratia plymuthica AS12	Isolate	Unclassified
7	2508501071	Serratia proteamaculans S4	Isolate	Rhizosphere
8	2510917013	Paraburkholderia unamae MTI-641	Isolate	Rhizosphere
9	2510917027	Brevibacillus sp. CF112	Isolate	Rhizosphere
10	2511231025	Pantoea sp. YR343	Isolate	Rhizosphere
11	2511231035	Pantoea sp. GM01	Isolate	Rhizosphere
12	2512564013	Brevibacillus sp. BC25	Isolate	Rhizosphere
13	2513237082	Paraburkholderia mimosarum STM3621	Isolate	Nodule
14	2513237083	Paraburkholderia mimosarum LMG 23256	Isolate	Nodule
15	2515154189	Paraburkholderia nodosa DSM 21604	Isolate	Unclassified
16	2526164512	Azovibrio restrictus DSM 23866	Isolate	Unclassified
17	2537561728	Pectobacterium wasabiae CFBP 3304	Isolate	Rhizoplane
18	2545555834	Methylobacterium sp. WSM2598	Isolate	Nodule
19	2547132181	Kosakonia sacchari SP1	Isolate	Stem
20	2547132416	Enterobacter sp. MR1	Isolate	Rhizoplane
21	2551306519	Bacillus sp. WBUNB004	Isolate	Rhizosphere
22	2554235234	Klebsiella michiganensis SA2	Isolate	Unclassified
23	2561511199	Enterobacter sp. R4-368	Isolate	Nodule
24	2565956521	Vibrio rhizosphaerae DSM 18581	Isolate	Rhizosphere
25	2574179768	Azoarcus communis DSM 12120	Isolate	Unclassified
26	2585427591	Rahnella aquatilis OV744	Isolate	Rhizosphere
27	2585427592	Rahnella aquatilis OV588	Isolate	Rhizosphere
28	2593339131	Bacillus sp. UNCCL81	Isolate	Unclassified
29	2595698237	Methylobacterium sp. UNCCL125	Isolate	Unclassified
30	2599185169	Klebsiella quasipneumoniae NFPP35	Isolate	Rhizoplane
31	2599185299	Pantoea ananatis NFR11	Isolate	Rhizoplane
32	2600255067	Paraburkholderia kururiensis thiooxydans NBRC 107107	Isolate	Unclassified
33	2600255254	Klebsiella quasipneumoniae NFIX15	Isolate	Rhizoplane
34	2600255255	Klebsiella quasipneumoniae NFIX23	Isolate	Rhizoplane
35	2600255256	Enterobacter sp. NFIX08	Isolate	Rhizoplane
36	2600255257	Enterobacter sp. NFIX03	Isolate	Rhizoplane
37	2600255280	Klebsiella quasipneumoniae NFIX42	Isolate	Rhizoplane
38	2600255281	Klebsiella quasipneumoniae NFIX43	Isolate	Rhizoplane
39	2600255287	Klebsiella quasipneumoniae NFIX11	Isolate	Rhizoplane
40	2600255288	Klebsiella quasipneumoniae NFIX14	Isolate	Rhizoplane
41	2600255289	Klebsiella quasipneumoniae NFIX16	Isolate	Rhizoplane
42	2600255290	Klebsiella quasipneumoniae NFIX17	Isolate	Rhizoplane
43	2600255291	Klebsiella quasipneumoniae NFIX19	Isolate	Rhizoplane
44	2600255292	Janthinobacterium lividum NFR18	Isolate	Rhizoplane
45	2600255298	Klebsiella quasipneumoniae NFIX21	Isolate	Rhizoplane
46	2600255299	Klebsiella quasipneumoniae NFIX22	Isolate	Rhizoplane
47	2600255300	Klebsiella quasipneumoniae NFIX30	Isolate	Rhizoplane
48	2600255301	Klebsiella quasipneumoniae NFIX33	Isolate	Rhizoplane
49	2600255302	Klebsiella quasipneumoniae NFIX35	Isolate	Rhizoplane
50	2600255303	Klebsiella quasipneumoniae NFIX36	Isolate	Rhizoplane
51	2600255304	Klebsiella quasipneumoniae NFIX37	Isolate	Rhizoplane
52	2600255305	Klebsiella quasipneumoniae NFIX41	Isolate	Rhizoplane
53	2600255306	Klebsiella quasipneumoniae NFIX44	Isolate	Rhizoplane
54	2600255307	Klebsiella quasipneumoniae NFIX56	Isolate	Rhizoplane
55	2600255309	Klebsiella sp. NFIX53	Isolate	Rhizoplane
56	2600255310	Enterobacter sp. NFIX06	Isolate	Rhizoplane
57	2600255311	Enterobacter sp. NFIX04	Isolate	Rhizoplane
58	2600255392	Klebsiella quasipneumoniae NFIX54	Isolate	Rhizoplane
59	2602042046	Enterobacter sp. NFIX09	Isolate	Rhizoplane
60	2602042047	Enterobacter sp. NFIX59	Isolate	Rhizoplane
61	2602042052	Klebsiella quasipneumoniae NFIX18	Isolate	Rhizoplane
62	2602042053	Klebsiella quasipneumoniae NFIX12	Isolate	Rhizoplane
63	2602042066	Enterobacter sp. NFIX45	Isolate	Rhizoplane
64	2602042067	Enterobacter sp. NFIX58	Isolate	Rhizoplane
65	2602042103	Klebsiella quasipneumoniae NFIX29	Isolate	Rhizoplane
66	2602042104	Klebsiella quasipneumoniae NFIX26	Isolate	Rhizoplane
67	2602042105	Klebsiella quasipneumoniae NFIX25	Isolate	Rhizoplane
68	2602042106	Klebsiella quasipneumoniae NFIX13	Isolate	Rhizoplane
69	2602042109	Klebsiella aerogenes NFIX39	Isolate	Rhizoplane
70	2602042110	Klebsiella quasipneumoniae NFIX40	Isolate	Rhizoplane
71	2602042111	Klebsiella quasipneumoniae NFIX20	Isolate	Rhizoplane
72	2603880178	Klebsiella quasipneumoniae NFIX34	Isolate	Rhizoplane
73	2603880184	Klebsiella quasipneumoniae NFIX27	Isolate	Rhizoplane
74	2603880202	Klebsiella quasipneumoniae NFIX38	Isolate	Rhizoplane
75	2603880211	Klebsiella quasipneumoniae NFIX24	Isolate	Rhizoplane
76	2608642108	Pantoea agglomerans NFPP29	Isolate	Rhizoplane
77	2609459761	Enterobacter sp. NFR05	Isolate	Rhizoplane
78	2636415599	Klebsiella variicola DX120E	Isolate	Unclassified
79	2643221729	Bacillus sp. Root11	Isolate	Unclassified
80	2643221730	Bacillus sp. Root131	Isolate	Unclassified
81	2643221731	Bacillus sp. Root147	Isolate	Unclassified
82	2643221732	Bacillus sp. Root239	Isolate	Unclassified
83	2648501241	Vibrio splendidus UCD-SED7	Isolate	Rhizosphere
84	2648501693	Pantoea ananatis B1-9	Isolate	Rhizosphere
85	2651869818	Vibrio splendidus UCD-SED10	Isolate	Rhizosphere
86	2654587920	Serratia plymuthica HRO-C48	Isolate	Rhizosphere
87	2667528172	Enterobacteriaceae bacterium NFIX31	Isolate	Rhizoplane
88	2667528173	Rahnella sp. NFIX50	Isolate	Rhizoplane
89	2671180115	Cedecea sp. NFIX57	Isolate	Rhizoplane
90	2671180330	Peribacillus simplex SH-B26	Isolate	Unclassified
91	2675903046	Klebsiella quasipneumoniae NFIX52	Isolate	Rhizoplane
92	2681812866	Enterobacter asburiae NFIX55	Isolate	Rhizoplane
93	2681812869	Enterobacter ludwigii NFPP41	Isolate	Rhizoplane
94	2684622632	Bacillus cereus 905	Isolate	Unclassified
95	2684622997	Pantoea ananatis NFIX48	Isolate	Rhizoplane
96	2687453601	Serratia plymuthica 3Rp8	Isolate	Unclassified
97	2695420987	Bacillus thuringiensis KNU-07	Isolate	Unclassified
98	2703719227	Bacillus mycoides GOE6	Isolate	Rhizosphere
99	2706794495	Dickeya zeae ZJU1202	Isolate	Unclassified
100	2711768156	Atlantibacter hermannii DDE1	Isolate	Unclassified
101	2718218445	Bacillus sp. B25(2016b)	Isolate	Rhizosphere
102	2738541295	Bacillus sp. OK085	Isolate	Unclassified
103	2738541358	Bacillus sp. OV752	Isolate	Unclassified
104	2738543006	Bacillus sp. OK077	Isolate	Unclassified
105	2738543017	Bacillus sp. OV186	Isolate	Unclassified
106	2738543032	Methylobacterium sp. GV104	Isolate	Unclassified
107	2744054657	Brevibacillus sp. SKDU10	Isolate	Unclassified
108	2751185917	Enterobacter sp. HK169	Isolate	Unclassified
109	2757320391	Bacillus sp. NFR08	Isolate	Rhizoplane
110	2765235842	Enterobacter ludwigii AA4	Isolate	Unclassified
111	2772190666	Serratia surfactantfaciens YD25	Isolate	Unclassified
112	2775506706	Enterobacter asburiae 1216	Isolate	Unclassified
113	2775507074	Klebsiella sp. D5A	Isolate	Unclassified
114	2775507177	Bacillus sp. AFS055030	Isolate	Unclassified
115	2775507192	Bacillus sp. AFS041924	Isolate	Unclassified
116	2791354903	Mangrovibacter phragmitis MP23	Isolate	Unclassified
117	2791355010	Kosakonia pseudosacchari NN143	Isolate	Unclassified
118	2791355275	Enterobacter sp. Sa187	Isolate	Unclassified
119	2808606414	Pantoea sp. SJZ147	Isolate	Rhizosphere
120	2811995292	Kosakonia oryzae Ola 51	Isolate	Unclassified
121	2814123068	Kosakonia radicincitans GXGL-4A	Isolate	Rhizosphere
122	2816332186	Peribacillus frigoritolerans 3612	Isolate	Unclassified
123	2816332336	Brevibacillus laterosporus ZQ2	Isolate	Unclassified
124	2818991443	Bacillus thuringiensis 1230	Isolate	Unclassified
125	2818991465	Priestia megaterium 3291	Isolate	Rhizosphere
126	2821118458	Enterobacter asburiae 609	Isolate	Unclassified
127	2823373977	Enterobacter ludwigii NCR3	Isolate	Rhizosphere
128	2829745981	Methylorubrum rhodinum DSM 2163	Isolate	Rhizosphere
129	2831905167	Ammoniphilus oxalaticus RAOx-1	Isolate	Rhizosphere
130	2842682962	Bacillus sp. R-72492	Isolate	Unclassified
131	2842882022	Bacillus sp. R-71893	Isolate	Unclassified
132	2844425489	Enterobacter cloacae SBP-8	Isolate	Rhizosphere
133	2844528606	Pantoea sp. R-72498 v. 2	Isolate	Unclassified
134	2846540461	Photorhabdus luminescens HIM3	Isolate	Rhizosphere
135	2847085930	Erwinia persicina B64	Isolate	Bulb
136	2847797336	Pantoea ananatis NN08200	Isolate	Unclassified
137	2849139964	Bacillus sp. R-71875	Isolate	Unclassified
138	2852103415	Edaphovirga cremea DSM 105170	Isolate	Rhizosphere
139	2854601825	Dickeya dianthicola SS70	Isolate	Stem Tuber
140	2855195626	Pectobacterium atrosepticum SS26	Isolate	Stem Tuber
141	2857460504	Brevibacillus sp. R-74223	Isolate	Unclassified
142	2857465823	Brevibacillus sp. R-74266	Isolate	Unclassified
143	2857547612	Janthinobacterium sp. R-74502	Isolate	Unclassified
144	2857581216	Bacillus sp. R-71922	Isolate	Unclassified
145	2857586860	Bacillus sp. R-71935	Isolate	Unclassified
146	2857591370	Brevibacillus sp. R-71934	Isolate	Unclassified
147	2858466076	Pectobacterium polaris SS28	Isolate	Stem Tuber
148	2861691609	Methylorubrum thiocyanatum DSM 11490	Isolate	Rhizosphere
149	2865014394	Pantoea sp. R-71966	Isolate	Unclassified
150	2869551831	Serratia inhibens PRI-2C	Isolate	Rhizosphere
151	2871272651	Pectobacterium carotovorum SS96	Isolate	Stem Tuber
152	2871282230	Pectobacterium parmentieri SS90	Isolate	Stem Tuber
153	2876601092	Pantoea endophytica 596	Isolate	Unclassified
154	2881609920	Pantoea sp. ARC607	Isolate	Rhizosphere
155	2881714928	Pseudidiomarina mangrovi ZQ330	Isolate	Rhizosphere
156	2884086401	Kluyvera sp. PO2S7	Isolate	Rhizosphere
157	2887630918	Psychrosphaera haliotis UCD-MCMsp1aY	Isolate	Unclassified
158	2888366609	Serratia sp. NGAS9	Isolate	Rhizosphere
159	2888373701	Serratia rhizosphaerae KUDC3025	Isolate	Rhizosphere
160	2889306138	Methylobacterium sp. PvR107	Isolate	Rhizosphere
161	2891633521	Azoarcus rhizosphaerae CC-YHH848	Isolate	Rhizosphere
162	2891670763	Buttiauxella sp. B2	Isolate	Rhizosphere
163	2898907183	Brevibacillus sp. SYP-B805	Isolate	Rhizosphere
164	2900051742	Pectobacterium zantedeschiae 2M	Isolate	Stem Tuber
165	2902330777	Methylobacterium sp. 2A	Isolate	Unclassified
166	2902405164	Methylobacterium sp. P1-11	Isolate	Unclassified
167	2904474040	Rahnella aquatilis 4485	Isolate	Rhizosphere
168	2904504865	Serratia marcescens 1822	Isolate	Unclassified
169	2904513164	Klebsiella variicola 1431	Isolate	Rhizosphere
170	2904524088	Priestia megaterium 1428	Isolate	Rhizosphere
171	2908669403	Pantoea coffeiphila 1480	Isolate	Rhizosphere
172	2915597211	Brevibacillus brevis Ag35	Isolate	Nodule
173	2915606848	Brevibacillus sp. HD1.4A	Isolate	Rhizosphere
174	2916178963	Pseudoalteromonas rhizosphaerae RA15	Isolate	Rhizosphere
175	2919108558	Klebsiella sp. 1400	Isolate	Rhizosphere
176	2919143609	Priestia megaterium 1751	Isolate	Rhizosphere
177	2919150387	Rahnella aceris 1817	Isolate	Unclassified
178	2919517244	Priestia aryabhattai 3820	Isolate	Unclassified
179	2919720352	Priestia megaterium 4340	Isolate	Unclassified
180	2923634449	Enterobacter kobei SLBN-76	Isolate	Rhizosphere
181	2927143783	Rahnella sp. 2050	Isolate	Unclassified
182	2927833300	Enterobacter sp. SLBN-59	Isolate	Rhizosphere
183	2928093941	Priestia aryabhattai 1389	Isolate	Rhizosphere
184	2928125067	Methylobacterium sp. 1973	Isolate	Unclassified
185	2929004312	Priestia megaterium 1104	Isolate	Unclassified
186	2929183550	Brevibacillus sp. R-71971 Hybrid assembly	Isolate	Unclassified
187	2929233124	Bacillus sp. R-74298 Hybrid assembly	Isolate	Unclassified
188	2932406140	Serratia sp. 2723	Isolate	Rhizosphere
189	2932410948	Janthinobacterium lividum 2829	Isolate	Rhizosphere
190	2932416698	Janthinobacterium lividum 2830	Isolate	Rhizosphere
191	2935625433	Kosakonia sp. 1610	Isolate	Rhizosphere
192	2936340661	Gottfriedia acidiceleris 1-17	Isolate	Rhizosphere
193	2937539931	Pantoea sp. LS15	Isolate	Unclassified
194	2937967321	Serratia sp. YC16	Isolate	Unclassified
195	2938917290	Bacillus sp. CR71	Isolate	Unclassified
196	2939568625	Lelliottia sp. 489	Isolate	Rhizosphere
197	2939573065	Citrobacter sp. 506	Isolate	Rhizosphere
198	2939577877	Serratia sp. 509	Isolate	Rhizosphere
199	2939602548	Pantoea dispersa 1175	Isolate	Rhizosphere
200	2939607340	Leclercia sp. 1548	Isolate	Rhizosphere
201	2939617950	Kosakonia cowanii 2056	Isolate	Rhizosphere
202	2939642701	Lelliottia nimipressuralis 2756	Isolate	Rhizosphere
203	2945874760	Phytobacter diazotrophicus UAEU22	Isolate	Rhizosphere
204	2945951305	Pantoea agglomerans W2I1	Isolate	Rhizosphere
205	2947426588	Bacillus sp. RZ2MS9	Isolate	Rhizosphere
206	2956897341	Ectobacillus funiculus W18-2	Isolate	Rhizosphere
207	2960319331	Priestia megaterium AFS057444	Isolate	Unclassified
208	2960375949	Priestia megaterium AFS067084	Isolate	Unclassified
209	2964375228	Anaerobacillus alkaliphilus B16-10	Isolate	Rhizosphere
210	2965761152	Bacillus sp. COPE52	Isolate	Unclassified
211	2969079654	Klebsiella variicola E57-7	Isolate	Unclassified
212	2971820967	Klebsiella sp. MPUS7	Isolate	Rhizosphere
213	2974310843	Enterobacter sp. SORGH_AS 287	Isolate	Unclassified
214	2974435778	Kosakonia cowanii SORGH_AS 304	Isolate	Unclassified
215	2977254563	Bacillus sp. SORGH_AS 510	Isolate	Unclassified
216	2978975091	Pantoea anthophila SORGH_AS 797	Isolate	Unclassified
217	2979083700	Bacillus toyonensis SORGH_AS 407	Isolate	Unclassified
218	2984494565	Pantoea ananatis SORGH_AS197	Isolate	Aerial Root
219	2984559226	Klebsiella variicola SORGH_AS834	Isolate	Aerial Root
220	2984595703	Klebsiella variicola SORGH_AS1070	Isolate	Aerial Root
221	2990261002	Pantoea ananatis SORGH_AS213	Isolate	Aerial Root
222	2990275345	Bacillus sp. SLBN-46	Isolate	Unclassified
223	3000376612	Enterobacteriaceae bacterium 4M9	Isolate	Rhizosphere
224	3001892409	Neobacillus rhizophilus FJAT-49825	Isolate	Rhizosphere
225	3003665799	Methylobacterium aquaticum BG2	Isolate	Unclassified
226	3006973921	Bacillus sp. FJAT-49736	Isolate	Rhizosphere
227	3300000549	Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled	Metagenome	Rhizosphere
228	3300001432	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2	Metagenome	Rhizosphere
229	3300001989	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5	Metagenome	Rhizosphere
230	3300002074	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1	Metagenome	Rhizosphere
231	3300002239	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2	Metagenome	Rhizosphere
232	3300002737	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA	Metagenome	Endosphere
233	3300002771	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB	Metagenome	Endosphere
234	3300002772	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS	Metagenome	Endosphere
235	3300002773	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS	Metagenome	Endosphere
236	3300003187	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB	Metagenome	Endosphere
237	3300003203	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
238	3300003316	Sugarcane root Sample L1	Metagenome	Unclassified
239	3300003320	Sugarcane root Sample H2	Metagenome	Unclassified
240	3300003322	Sugarcane root Sample L2	Metagenome	Unclassified
241	3300003323	Sugarcane root Sample H1	Metagenome	Unclassified
242	3300003578	Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Unclassified
243	3300003751	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2	Metagenome	Endosphere
244	3300003752	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2	Metagenome	Endosphere
245	3300003756	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2	Metagenome	Endosphere
246	3300003758	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2	Metagenome	Endosphere
247	3300003759	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2	Metagenome	Endosphere
248	3300003790	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2	Metagenome	Endosphere
249	3300003841	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2	Metagenome	Endosphere
250	3300003856	Agave microbial communities from Guanajuato, Mexico - At.Am.rz	Metagenome	Rhizosphere
251	3300005272	Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1	Metagenome	Rhizosphere
252	3300005289	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2)	Metagenome	Rhizosphere
253	3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
254	3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2)	Metagenome	Rhizosphere
255	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
256	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
257	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
258	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
259	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
260	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
261	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
262	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
263	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
264	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
265	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
266	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
267	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
268	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
269	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
270	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
271	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
272	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
273	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
274	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
275	3300005406	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG	Metagenome	Rhizosphere
276	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
277	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
278	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
279	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
280	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
281	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
282	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
283	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
284	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
285	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
286	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
287	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
288	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
289	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
290	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
291	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
292	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
293	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
294	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
295	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
296	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
297	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
298	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
299	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
300	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
301	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
302	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
303	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
304	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
305	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
306	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
307	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
308	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
309	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
310	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
311	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
312	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
313	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
314	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
315	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
316	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
317	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
318	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
319	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
320	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
321	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
322	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
323	3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Metagenome	Rhizosphere
324	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
325	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
326	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
327	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
328	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
329	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
330	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
331	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
332	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
333	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
334	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
335	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
336	3300006946	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG	Metagenome	Nodule
337	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
338	3300007265	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1	Metagenome	Rhizosphere
339	3300007788	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2	Metagenome	Rhizosphere
340	3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Metagenome	Rhizosphere
341	3300009036	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG	Metagenome	Rhizosphere
342	3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Metagenome	Rhizosphere
343	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
344	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
345	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
346	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
347	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
348	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
349	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
350	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
351	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
352	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
353	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
354	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
355	3300010159	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3	Metagenome	Rhizosphere
356	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
357	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
358	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
359	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
360	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
361	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
362	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
363	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
364	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
365	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
366	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
367	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
368	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
369	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
370	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
371	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
372	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
373	3300015261	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG	Metagenome	Rhizosphere
374	3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Metagenome	Rhizosphere
375	3300015265	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG	Metagenome	Rhizosphere
376	3300015679	Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08	Metagenome	Unclassified
377	3300015680	Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03	Metagenome	Rhizosphere
378	3300015685	Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12	Metagenome	Unclassified
379	3300015687	Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08	Metagenome	Rhizosphere
380	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
381	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
382	3300025207	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
383	3300025224	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
384	3300025225	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
385	3300025226	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
386	3300025229	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
387	3300025230	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
388	3300025231	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
389	3300025233	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
390	3300025253	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
391	3300025258	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3)	Metagenome	Endosphere
392	3300025261	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2)	Metagenome	Endosphere
393	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
394	3300025284	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
395	3300025291	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3)	Metagenome	Endosphere
396	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
397	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
398	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
399	3300025711	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
400	3300025728	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
401	3300025735	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
402	3300025885	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
403	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
404	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
405	3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
406	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
407	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
408	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
409	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
410	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
411	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
412	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
413	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
414	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
415	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
416	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
417	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
418	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
419	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
420	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
421	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
422	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
423	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
424	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
425	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
426	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
427	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
428	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
429	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
430	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
431	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
432	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
433	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
434	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
435	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
436	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
437	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
438	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
439	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
440	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
441	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
442	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
443	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
444	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
445	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
446	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
447	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
448	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
449	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
450	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
451	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
452	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
453	3300027111	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2)	Metagenome	Nodule
454	3300027312	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2)	Metagenome	Rhizosphere
455	3300027360	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2)	Metagenome	Rhizosphere
456	3300027665	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
457	3300027671	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2)	Metagenome	Rhizosphere
458	3300027682	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
459	3300027876	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
460	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
461	3300028016	Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1	Metagenome	Rhizosphere
462	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
463	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
464	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
465	3300028563	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG	Metagenome	Rhizosphere
466	3300028653	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG	Metagenome	Rhizosphere
467	3300028654	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG	Metagenome	Rhizosphere
468	3300028666	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG	Metagenome	Rhizosphere
469	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
470	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
471	3300029957	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG	Metagenome	Rhizosphere
472	3300030083	Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1	Metagenome	Unclassified
473	3300030500	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3)	Metagenome	Rhizosphere
474	3300030878	Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
475	3300031090	Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
476	3300031238	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG	Metagenome	Rhizosphere
477	3300031239	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG	Metagenome	Rhizosphere
478	3300031240	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG	Metagenome	Rhizosphere
479	3300031241	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG	Metagenome	Rhizosphere
480	3300031247	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG	Metagenome	Rhizosphere
481	3300031249	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG	Metagenome	Rhizosphere
482	3300031250	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG	Metagenome	Rhizosphere
483	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
484	3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Metagenome	Rhizosphere
485	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
486	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
487	3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Metagenome	Unclassified
488	3300031665	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3	Metagenome	Rhizosphere
489	3300031691	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA	Metagenome	Rhizosphere
490	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
491	3300031712	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG	Metagenome	Rhizosphere
492	3300031727	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5	Metagenome	Rhizosphere
493	3300031728	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC	Metagenome	Rhizosphere
494	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
495	3300031733	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1	Metagenome	Rhizosphere
496	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
497	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
498	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
499	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
500	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
501	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
502	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
503	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
504	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
505	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
506	3300032133	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA	Metagenome	Rhizosphere
507	3300032137	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC	Metagenome	Rhizosphere
508	3300032139	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB	Metagenome	Rhizosphere
509	3300032168	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
510	3300033179	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM	Metagenome	Unclassified
511	3300033547	Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1	Metagenome	Unclassified
512	3300035086	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4	Metagenome	Rhizosphere
513	3300035111	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11	Metagenome	Rhizosphere
514	3300035117	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1	Metagenome	Rhizosphere
515	3300035118	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2	Metagenome	Rhizosphere
516	3300035119	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4	Metagenome	Rhizosphere
517	3300035120	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5	Metagenome	Rhizosphere
518	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
519	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
520	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
521	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
522	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
523	3300036647	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA	Metagenome	Rhizosphere
524	3300036712	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA	Metagenome	Rhizosphere
525	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
526	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
527	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
528	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
529	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
530	3300037588	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA	Metagenome	Rhizosphere
531	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
532	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
533	3300038725	Seagrass microbial communities from Seahorse Key, FL, USA - HV0818	Metagenome	Unclassified
534	3300038726	Seagrass microbial communities from Seahorse Key, FL, USA - TH0319	Metagenome	Unclassified
535	3300038727	Seagrass microbial communities from Seahorse Key, FL, USA - TV0818	Metagenome	Unclassified
536	3300038735	Seagrass microbial communities from Seahorse Key, FL, USA - SH0319	Metagenome	Unclassified
537	3300038741	Seagrass microbial communities from Seahorse Key, FL, USA - SV0818	Metagenome	Unclassified
538	3300038742	Seagrass microbial communities from Seahorse Key, FL, USA - SH0818	Metagenome	Unclassified
539	3300039062	Seagrass microbial communities from Seahorse Key, FL, USA - HH0818	Metagenome	Unclassified
540	3300039093	Seagrass microbial communities from Seahorse Key, FL, USA - TH0818	Metagenome	Unclassified
541	3300039110	Seagrass microbial communities from Seahorse Key, FL, USA - SV0319	Metagenome	Unclassified
542	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
543	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
544	3300039450	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2	Metagenome	Unclassified
545	3300041405	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414	Metagenome	Rhizosphere
546	3300041407	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416	Metagenome	Rhizosphere
547	3300041411	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708	Metagenome	Rhizosphere
548	3300042001	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542	Metagenome	Rhizosphere
549	3300042006	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437	Metagenome	Rhizosphere
550	3300042010	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431	Metagenome	Rhizosphere
551	3300042016	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357	Metagenome	Rhizosphere
552	3300042146	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979	Metagenome	Rhizosphere
553	3300042435	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613	Metagenome	Rhizosphere
554	3300042439	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363	Metagenome	Rhizosphere
555	3300042461	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366	Metagenome	Rhizosphere
556	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
557	3300044656	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R	Metagenome	Rhizosphere
558	3300044669	Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E	Metagenome	Unclassified
559	3300044673	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED	Metagenome	Rhizosphere
560	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
561	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
562	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
563	3300046452	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere	Metagenome	Rhizosphere
564	3300046453	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere	Metagenome	Rhizosphere
565	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
566	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
567	3300046458	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere	Metagenome	Rhizosphere
568	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
569	3300046461	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere	Metagenome	Rhizosphere
570	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
571	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
572	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
573	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
574	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
575	3300046474	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere	Metagenome	Rhizosphere
576	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
577	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
578	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
579	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
580	3300046500	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere	Metagenome	Rhizosphere
581	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
582	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
583	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
584	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
585	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
586	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
587	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
588	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
589	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
590	3300046525	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere	Metagenome	Rhizosphere
591	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
592	3300046528	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere	Metagenome	Rhizosphere
593	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
594	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
595	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
596	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
597	3300046537	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere	Metagenome	Rhizosphere
598	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
599	3300046539	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere	Metagenome	Rhizosphere
600	3300046542	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere	Metagenome	Rhizosphere
601	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
602	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
603	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
604	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
605	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
606	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
607	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
608	3300046664	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere	Metagenome	Rhizosphere
609	3300046665	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere	Metagenome	Rhizosphere
610	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
611	3300046681	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere	Metagenome	Rhizosphere
612	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
613	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
614	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
615	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
616	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
617	3300046794	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere	Metagenome	Rhizosphere
618	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
619	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
620	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
621	3300047318	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere	Metagenome	Rhizosphere
622	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
623	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
624	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
625	3300047323	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere	Metagenome	Rhizosphere
626	3300047443	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere	Metagenome	Rhizosphere
627	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
628	3300047445	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere	Metagenome	Rhizosphere
629	3300047446	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere	Metagenome	Rhizosphere
630	3300047447	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere	Metagenome	Rhizosphere
631	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
632	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
633	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
634	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
635	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
636	3300048089	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere	Metagenome	Rhizosphere
637	3300048091	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere	Metagenome	Rhizosphere
638	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
639	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
640	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
641	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
642	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
643	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
644	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
645	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
646	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
647	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
648	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
649	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
650	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
651	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
652	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
653	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
654	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
655	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
656	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
657	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
658	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
659	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
660	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
661	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
662	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
663	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
664	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
665	3300049128	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
666	3300049129	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
667	3300049132	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
668	3300049134	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
669	3300049162	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
670	3300049459	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere	Metagenome	Rhizosphere
671	3300049460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere	Metagenome	Rhizosphere
672	3300049527	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
673	3300049528	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
674	3300049529	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
675	3300049531	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
676	3300049532	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
677	3300049533	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
678	3300049534	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
679	3300049536	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
680	3300049537	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
681	3300049539	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
682	3300049540	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
683	3300049541	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
684	3300049549	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
685	3300049552	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
686	3300049556	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
687	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
688	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
689	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
690	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
691	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
692	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
693	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
694	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
695	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
696	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
697	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
698	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
699	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
700	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
701	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
702	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
703	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
704	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
705	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
706	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
707	3300049661	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control	Metagenome	Rhizosphere
708	3300049679	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought	Metagenome	Rhizosphere
709	3300049686	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control	Metagenome	Rhizosphere
710	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
711	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
712	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
713	3300049760	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control	Metagenome	Rhizosphere
714	3300049765	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought	Metagenome	Rhizosphere
715	3300049767	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought	Metagenome	Rhizosphere
716	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
717	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
718	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
719	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
720	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
721	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
722	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
723	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
724	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
725	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
726	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
727	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
728	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
729	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
730	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
731	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
732	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
733	3300053103	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere	Metagenome	Endosphere
734	3300053119	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere	Metagenome	Endosphere
735	3300053126	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere	Metagenome	Endosphere
736	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
737	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
738	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
739	3300059641	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
740	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
741	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere
742	639633007	Azoarcus olearius BH72	Isolate	Unclassified
743	640753048	Serratia proteamaculans 568	Isolate	Endosphere
744	641522639	Methylobacterium sp. 4-46	Isolate	Nodule
745	643348564	Methylobacterium nodulans ORS 2060	Isolate	Nodule
746	8003955200	Paraburkholderia mimosarum LMG 23256	Isolate	Nodule
747	8004592986	Serratia sp. S119	Isolate	Unclassified
748	8007375930	Clostridium sp. YIM B02565	Isolate	Unclassified
749	8015394850	Serratia sp. PGPR-27	Isolate	Rhizosphere
750	8016733728	Pantoea sp. SORGH_AS 659	Isolate	Unclassified
751	8018221730	Enterobacter sp. CM29	Isolate	Unclassified
752	8018405270	Enterobacter sp. 198	Isolate	Rhizosphere
753	8019499862	Kluyvera sp. 1366	Isolate	Rhizosphere
754	8019504834	Atlantibacter hermannii 1903	Isolate	Rhizosphere
755	8022621104	Bacillus sp. PIC28	Isolate	Rhizosphere
756	8022792930	Bacillus sp. Xin	Isolate	Rhizosphere
757	8022893055	Bacillus aryabhattai AFS007213	Isolate	Unclassified
758	8022914991	Bacillus aryabhattai SQU-R12	Isolate	Unclassified
759	8022948649	Bacillus endophyticus FH5	Isolate	Rhizosphere
760	8023438354	Bacillus sp. BH2	Isolate	Unclassified
761	8023444577	Bacillus sp. BH32	Isolate	Unclassified
762	8054357960	Idiomarina rhizosphaerae M1R2S28	Isolate	Rhizosphere
763	8054844752	Dryocola boscaweniae H18W14	Isolate	Rhizosphere
764	8054849141	Dryocola clanedunensis H11S18	Isolate	Rhizosphere
765	8055087960	Silvania hatchlandensis H19S6	Isolate	Rhizosphere
766	8055092621	Silvania confinis H4N4	Isolate	Rhizosphere
767	8055097453	Leclercia tamurae H6W5	Isolate	Rhizosphere
768	8055693939	Hafnia alvei A23BA	Isolate	Rhizosphere
769	8057304971	Scandinavium manionii H17S15	Isolate	Rhizosphere
770	8057582654	Bacillus arachidis YX15	Isolate	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	83.2
Metatranscriptomes	2.24
Isolates	14.56

Biome Distribution

Category	Percentage (%)
Aerial Root	0.23
Bulb	0.06
Endosphere	3.57
Nodule	2.01
Rhizoplane	5.29
Rhizosphere	73.42
Stem	0.06
Stem Tuber	0.35
Unclassified	15.02

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	RicEn_C910	2010549000	Bacteria	1876
2	SwRhRL2b_contig_1556469	2162886007	Bacteria	3620
3	SwRhRL2b_contig_333222	2162886007	Bacteria	3175
4	MBSR1b_contig_702837	2162886012	Bacteria	3122
5	LJQas_1000024	3300000549	Bacteria	22939
6	JGI24034J14986_100622	3300001432	Bacteria	2098
7	JGI24739J22299_10000013	3300001989	Bacteria	52390
8	JGI24748J21848_1000017	3300002074	Bacteria	133780
9	JGI24034J26672_10000017	3300002239	Bacteria	133784
10	JGI25162J39368_1000031	3300002737	Bacteria	210480
11	JGI25162J39368_1002365	3300002737	Bacteria	7462
12	JGI25163J39215_1000261	3300002771	Bacteria	18973
13	JGI25164J39214_1000001	3300002772	Bacteria	477015
14	JGI25152J39213_1001182	3300002773	Bacteria	12067
15	JGI25151J46595_10000070	3300003187	Bacteria	139035
16	JGI25151J46595_10001287	3300003187	Bacteria	17661
17	JGI25151J46595_10004190	3300003187	Bacteria	7682
18	JGI25406J46586_10012364	3300003203	Bacteria	3708
19	JGI25406J46586_10033014	3300003203	Bacteria	1916
20	rootH1_10001329	3300003316	Bacteria	28300
21	rootH2_10005270	3300003320	Bacteria	6824
22	rootH2_10018420	3300003320	Bacteria	42773
23	rootH2_10300971	3300003320	Bacteria	2737
24	rootL2_10006646	3300003322	Bacteria	13271
25	rootL2_10023751	3300003322	Bacteria	7002
26	rootH1_10186136	3300003323	Bacteria	4271
27	Ga0006562J51391_1000271	3300003578	Bacteria	3719
28	Ga0006562J51391_1004179	3300003578	Bacteria	2624
29	Ga0055538_1000004	3300003751	Bacteria	615646
30	Ga0055539_1000004	3300003752	Bacteria	615646
31	Ga0055533_1000007	3300003756	Bacteria	615646
32	Ga0055532_1000091	3300003758	Bacteria	103710
33	Ga0055532_1000403	3300003758	Bacteria	21264
34	Ga0055532_1006160	3300003758	Bacteria	1622
35	Ga0055525_1000007	3300003759	Bacteria	615646
36	Ga0055528_1001898	3300003790	Bacteria	11884
37	Ga0055541_1000004	3300003841	Bacteria	615646
38	Ga0058692_1000264	3300003856	Bacteria	28368
39	Ga0058692_1000587	3300003856	Bacteria	15388
40	Ga0058692_1000909	3300003856	Bacteria	11653
41	Ga0058692_1001387	3300003856	Bacteria	8962
42	Ga0058692_1001448	3300003856	Bacteria	8750
43	Ga0058692_1003081	3300003856	Bacteria	5302
44	Ga0058692_1003245	3300003856	Bacteria	5093
45	Ga0058692_1004902	3300003856	Bacteria	3890
46	Ga0058692_1007101	3300003856	Bacteria	3005
47	Ga0058692_1007374	3300003856	Bacteria	2923
48	Ga0058692_1008682	3300003856	Bacteria	2610
49	Ga0058692_1013931	3300003856	Bacteria	1857
50	Ga0065703_1019967	3300005272	Bacteria	2212
51	Ga0065704_10001070	3300005289	Bacteria	9761
52	Ga0065704_10001534	3300005289	Bacteria	24742
53	Ga0065704_10001858	3300005289	Bacteria	23782
54	Ga0065704_10002429	3300005289	Bacteria	11867
55	Ga0065704_10005293	3300005289	Bacteria	3757
56	Ga0065704_10014520	3300005289	Bacteria	1783
57	Ga0065704_10073841	3300005289	Bacteria	6741
58	Ga0065715_10093561	3300005293	Bacteria	4638
59	Ga0065707_10000935	3300005295	Bacteria	9396
60	Ga0070658_10001882	3300005327	Bacteria	17688
61	Ga0070676_10017273	3300005328	Bacteria	3993
62	Ga0070676_10053028	3300005328	Bacteria	2387
63	Ga0070683_100094016	3300005329	Bacteria	2817
64	Ga0070690_100000449	3300005330	Bacteria	20664
65	Ga0070690_100001853	3300005330	Bacteria	11222
66	Ga0070690_100002188	3300005330	Bacteria	10448
67	Ga0070670_100041173	3300005331	Bacteria	3970
68	Ga0070670_100042936	3300005331	Bacteria	3888
69	Ga0070670_100063843	3300005331	Bacteria	3160
70	Ga0068869_100004657	3300005334	Bacteria	8557
71	Ga0068869_100144901	3300005334	Unclassified	1837
72	Ga0070680_100036102	3300005336	Bacteria	3993
73	Ga0070680_100176748	3300005336	Bacteria	1797
74	Ga0070682_100000076	3300005337	Bacteria	90097
75	Ga0068868_100094301	3300005338	Unclassified	2414
76	Ga0068868_100112052	3300005338	Bacteria	2218
77	Ga0070660_100027161	3300005339	Bacteria	4270
78	Ga0070689_100003280	3300005340	Bacteria	10742
79	Ga0070689_100020693	3300005340	Bacteria	4885
80	Ga0070689_100029237	3300005340	Bacteria	4169
81	Ga0070689_100037285	3300005340	Bacteria	3718
82	Ga0070687_100027951	3300005343	Bacteria	2730
83	Ga0070687_100040964	3300005343	Bacteria	2337
84	Ga0070661_100048577	3300005344	Bacteria	3106
85	Ga0070668_100065092	3300005347	Bacteria	2827
86	Ga0070668_100083878	3300005347	Bacteria	2502
87	Ga0070669_100002341	3300005353	Bacteria	13694
88	Ga0070669_100030922	3300005353	Bacteria	3865
89	Ga0070669_100090666	3300005353	Unclassified	2291
90	Ga0070669_100140853	3300005353	Bacteria	1859
91	Ga0070669_100148242	3300005353	Bacteria	1814
92	Ga0070675_100032069	3300005354	Bacteria	4250
93	Ga0070675_100094742	3300005354	Bacteria	2506
94	Ga0070671_100012686	3300005355	Bacteria	6792
95	Ga0070671_100015474	3300005355	Bacteria	6164
96	Ga0070671_100054518	3300005355	Bacteria	3324
97	Ga0070673_100004490	3300005364	Bacteria	8827
98	Ga0070673_100065692	3300005364	Bacteria	2895
99	Ga0070673_100120541	3300005364	Bacteria	2188
100	Ga0070688_100000462	3300005365	Bacteria	20664
101	Ga0070688_100000827	3300005365	Bacteria	15330
102	Ga0070688_100040205	3300005365	Unclassified	2864
103	Ga0070667_100000224	3300005367	Bacteria	65145
104	Ga0070667_100034620	3300005367	Unclassified	4226
105	Ga0070703_10000106	3300005406	Bacteria	43115
106	Ga0070703_10003339	3300005406	Bacteria	4580
107	Ga0070709_10001278	3300005434	Bacteria	13751
108	Ga0070709_10098729	3300005434	Bacteria	1941
109	Ga0070714_100003171	3300005435	Bacteria	12222
110	Ga0070714_100110283	3300005435	Bacteria	2436
111	Ga0070713_100001883	3300005436	Bacteria	13532
112	Ga0070713_100009152	3300005436	Bacteria	7068
113	Ga0070701_10018901	3300005438	Bacteria	3246
114	Ga0070701_10086460	3300005438	Bacteria	1709
115	Ga0070711_100050894	3300005439	Bacteria	2842
116	Ga0070705_100037936	3300005440	Bacteria	2722
117	Ga0070705_100127114	3300005440	Bacteria	1657
118	Ga0070700_100006579	3300005441	Bacteria	6222
119	Ga0070700_100027884	3300005441	Bacteria	3354
120	Ga0070700_100045717	3300005441	Bacteria	2702
121	Ga0070694_100000458	3300005444	Bacteria	22285
122	Ga0070694_100004705	3300005444	Bacteria	8217
123	Ga0070694_100011037	3300005444	Bacteria	5590
124	Ga0070694_100020121	3300005444	Bacteria	4252
125	Ga0070694_100022166	3300005444	Bacteria	4067
126	Ga0070694_100089437	3300005444	Bacteria	2158
127	Ga0070708_100000257	3300005445	Bacteria	39748
128	Ga0070708_100026814	3300005445	Bacteria	4936
129	Ga0070708_100086571	3300005445	Bacteria	2846
130	Ga0070708_100125131	3300005445	Bacteria	2375
131	Ga0070708_100141826	3300005445	Bacteria	2228
132	Ga0070708_100166789	3300005445	Bacteria	2054
133	Ga0070708_100189881	3300005445	Bacteria	1921
134	Ga0070678_100020120	3300005456	Unclassified	4372
135	Ga0070678_100109325	3300005456	Bacteria	2160
136	Ga0070662_100012516	3300005457	Bacteria	5627
137	Ga0070662_100068989	3300005457	Bacteria	2600
138	Ga0070681_10004725	3300005458	Bacteria	13042
139	Ga0068867_100114510	3300005459	Bacteria	2076
140	Ga0070685_10002584	3300005466	Bacteria	9275
141	Ga0070685_10016511	3300005466	Unclassified	3935
142	Ga0070706_100000500	3300005467	Bacteria	45929
143	Ga0070706_100027588	3300005467	Bacteria	5225
144	Ga0070706_100118972	3300005467	Bacteria	2462
145	Ga0070706_100191959	3300005467	Bacteria	1908
146	Ga0070707_100000313	3300005468	Bacteria	47522
147	Ga0070707_100001419	3300005468	Bacteria	23506
148	Ga0070707_100009215	3300005468	Bacteria	9160
149	Ga0070707_100017999	3300005468	Bacteria	6646
150	Ga0070707_100043724	3300005468	Bacteria	4287
151	Ga0070707_100104847	3300005468	Bacteria	2741
152	Ga0070707_100167034	3300005468	Bacteria	2144
153	Ga0070707_100180663	3300005468	Unclassified	2057
154	Ga0070698_100001118	3300005471	Bacteria	29600
155	Ga0070698_100001167	3300005471	Bacteria	29154
156	Ga0070698_100029924	3300005471	Bacteria	5650
157	Ga0070698_100031318	3300005471	Bacteria	5515
158	Ga0070698_100038316	3300005471	Bacteria	4940
159	Ga0070698_100043277	3300005471	Bacteria	4618
160	Ga0070698_100045282	3300005471	Bacteria	4504
161	Ga0070698_100078733	3300005471	Bacteria	3294
162	Ga0070698_100109166	3300005471	Bacteria	2734
163	Ga0070698_100142597	3300005471	Bacteria	2346
164	Ga0070699_100000196	3300005518	Bacteria	59314
165	Ga0070699_100014485	3300005518	Bacteria	6781
166	Ga0070699_100023593	3300005518	Bacteria	5299
167	Ga0070699_100082982	3300005518	Bacteria	2794
168	Ga0070699_100090105	3300005518	Bacteria	2680
169	Ga0070699_100108199	3300005518	Bacteria	2440
170	Ga0070679_100017652	3300005530	Bacteria	6908
171	Ga0070684_100079876	3300005535	Bacteria	2893
172	Ga0070697_100000983	3300005536	Bacteria	21549
173	Ga0070697_100015494	3300005536	Bacteria	5984
174	Ga0070697_100023565	3300005536	Bacteria	4895
175	Ga0070697_100035531	3300005536	Bacteria	4019
176	Ga0070697_100044150	3300005536	Bacteria	3610
177	Ga0070697_100132510	3300005536	Bacteria	2091
178	Ga0068853_100009644	3300005539	Bacteria	7781
179	Ga0068853_100032709	3300005539	Bacteria	4408
180	Ga0068853_100037589	3300005539	Bacteria	4119
181	Ga0068853_100038674	3300005539	Bacteria	4064
182	Ga0068853_100264464	3300005539	Bacteria	1582
183	Ga0070672_100054174	3300005543	Bacteria	3139
184	Ga0070672_100148871	3300005543	Bacteria	1935
185	Ga0070686_100002945	3300005544	Bacteria	9346
186	Ga0070686_100004806	3300005544	Bacteria	7457
187	Ga0070686_100042287	3300005544	Bacteria	2853
188	Ga0070686_100044598	3300005544	Bacteria	2788
189	Ga0070686_100047354	3300005544	Bacteria	2719
190	Ga0070695_100006828	3300005545	Bacteria	6757
191	Ga0070695_100007191	3300005545	Bacteria	6600
192	Ga0070695_100016534	3300005545	Bacteria	4466
193	Ga0070695_100017589	3300005545	Bacteria	4337
194	Ga0070695_100029265	3300005545	Bacteria	3421
195	Ga0070696_100025722	3300005546	Bacteria	4003
196	Ga0070696_100026124	3300005546	Bacteria	3972
197	Ga0070696_100046824	3300005546	Bacteria	3000
198	Ga0070696_100065239	3300005546	Bacteria	2552
199	Ga0070696_100165850	3300005546	Bacteria	1630
200	Ga0070693_100000010	3300005547	Bacteria	73515
201	Ga0070693_100010613	3300005547	Bacteria	4618
202	Ga0070665_100001311	3300005548	Bacteria	29698
203	Ga0070665_100002206	3300005548	Bacteria	21732
204	Ga0070665_100010158	3300005548	Bacteria	9520
205	Ga0070665_100297208	3300005548	Bacteria	1617
206	Ga0070704_100000160	3300005549	Bacteria	26301
207	Ga0070704_100001376	3300005549	Bacteria	12909
208	Ga0070704_100002175	3300005549	Bacteria	10915
209	Ga0070704_100025683	3300005549	Bacteria	3881
210	Ga0070704_100116718	3300005549	Bacteria	2041
211	Ga0070704_100213330	3300005549	Bacteria	1566
212	Ga0068855_100039381	3300005563	Bacteria	5611
213	Ga0068855_100191763	3300005563	Bacteria	2304
214	Ga0070664_100044481	3300005564	Bacteria	3749
215	Ga0068857_100079312	3300005577	Bacteria	2931
216	Ga0068857_100215910	3300005577	Bacteria	1751
217	Ga0068854_100111480	3300005578	Bacteria	2064
218	Ga0070702_100002112	3300005615	Bacteria	8441
219	Ga0068859_100004313	3300005617	Bacteria	14503
220	Ga0068859_100007534	3300005617	Bacteria	11052
221	Ga0068859_100107933	3300005617	Bacteria	2845
222	Ga0068864_100026609	3300005618	Bacteria	4878
223	Ga0068864_100059461	3300005618	Bacteria	3307
224	Ga0068866_10015071	3300005718	Bacteria	3428
225	Ga0068861_100002524	3300005719	Bacteria	11961
226	Ga0068861_100065176	3300005719	Bacteria	2805
227	Ga0068851_10000221	3300005834	Bacteria	27516
228	Ga0068863_100005126	3300005841	Bacteria	12922
229	Ga0068863_100030000	3300005841	Bacteria	5194
230	Ga0068863_100253882	3300005841	Bacteria	1699
231	Ga0068858_100000314	3300005842	Bacteria	51631
232	Ga0068858_100247716	3300005842	Bacteria	1692
233	Ga0068860_100002665	3300005843	Bacteria	18590
234	Ga0068860_100038049	3300005843	Bacteria	4603
235	Ga0068860_100126321	3300005843	Bacteria	2451
236	Ga0068860_100225779	3300005843	Bacteria	1819
237	Ga0068862_100012174	3300005844	Bacteria	7111
238	Ga0068862_100036550	3300005844	Bacteria	4163
239	Ga0068862_100061431	3300005844	Bacteria	3230
240	Ga0068862_100156614	3300005844	Bacteria	2031
241	Ga0068862_100168846	3300005844	Unclassified	1957
242	Ga0081539_10000230	3300005985	Bacteria	131269
243	Ga0081539_10002424	3300005985	Bacteria	26343
244	Ga0070717_10037330	3300006028	Unclassified	3945
245	Ga0070717_10163540	3300006028	Bacteria	1932
246	Ga0075365_10013451	3300006038	Bacteria	4896
247	Ga0075364_10004400	3300006051	Bacteria	8100
248	Ga0070715_10000057	3300006163	Bacteria	40962
249	Ga0070716_100000004	3300006173	Bacteria	296614
250	Ga0070716_100007543	3300006173	Bacteria	5365
251	Ga0070716_100062287	3300006173	Bacteria	2162
252	Ga0070716_100087893	3300006173	Bacteria	1874
253	Ga0070712_100023479	3300006175	Bacteria	4075
254	Ga0070712_100157598	3300006175	Bacteria	1750
255	Ga0070712_100169138	3300006175	Bacteria	1694
256	Ga0075366_10000193	3300006195	Bacteria	26864
257	Ga0075366_10008950	3300006195	Bacteria	5581
258	Ga0097621_100023313	3300006237	Bacteria	4817
259	Ga0068871_100016947	3300006358	Bacteria	5502
260	Ga0068871_100023948	3300006358	Unclassified	4730
261	Ga0075431_100035093	3300006847	Bacteria	5165
262	Ga0075431_100043576	3300006847	Bacteria	4628
263	Ga0075433_10000098	3300006852	Bacteria	41696
264	Ga0075433_10002633	3300006852	Bacteria	13703
265	Ga0075433_10032909	3300006852	Bacteria	4443
266	Ga0075433_10152644	3300006852	Bacteria	2054
267	Ga0075434_100000754	3300006871	Bacteria	25527
268	Ga0075434_100010240	3300006871	Bacteria	8781
269	Ga0075434_100057548	3300006871	Bacteria	3864
270	Ga0075434_100086106	3300006871	Bacteria	3142
271	Ga0075434_100174386	3300006871	Bacteria	2170
272	Ga0075434_100188986	3300006871	Bacteria	2080
273	Ga0075429_100000100	3300006880	Bacteria	47693
274	Ga0075429_100009422	3300006880	Bacteria	8479
275	Ga0075429_100012076	3300006880	Bacteria	7485
276	Ga0075429_100272672	3300006880	Bacteria	1482
277	Ga0068865_100028941	3300006881	Unclassified	3671
278	Ga0068865_100035607	3300006881	Bacteria	3349
279	Ga0068865_100077379	3300006881	Bacteria	2377
280	Ga0068865_100107159	3300006881	Bacteria	2055
281	Ga0075436_100000176	3300006914	Bacteria	39845
282	Ga0075436_100008276	3300006914	Bacteria	7116
283	Ga0075436_100010713	3300006914	Bacteria	6288
284	Ga0097620_100004313	3300006931	Bacteria	14503
285	Ga0097620_100007535	3300006931	Bacteria	11052
286	Ga0097620_100107935	3300006931	Bacteria	2845
287	Ga0079104_1000485	3300006946	Bacteria	43922
288	Ga0079104_1000490	3300006946	Bacteria	42967
289	Ga0079104_1000624	3300006946	Bacteria	34658
290	Ga0079104_1000660	3300006946	Bacteria	32875
291	Ga0079104_1000796	3300006946	Bacteria	26712
292	Ga0079104_1001897	3300006946	Bacteria	12619
293	Ga0079104_1002794	3300006946	Bacteria	8797
294	Ga0079104_1003960	3300006946	Bacteria	6593
295	Ga0079104_1004173	3300006946	Bacteria	6297
296	Ga0079104_1004175	3300006946	Bacteria	6294
297	Ga0079104_1004824	3300006946	Bacteria	5610
298	Ga0079104_1008973	3300006946	Bacteria	3431
299	Ga0079104_1011894	3300006946	Bacteria	2768
300	Ga0075435_100001871	3300007076	Bacteria	13689
301	Ga0075435_100002278	3300007076	Bacteria	12670
302	Ga0075435_100055514	3300007076	Bacteria	3199
303	Ga0075435_100066360	3300007076	Bacteria	2936
304	Ga0099794_10003059	3300007265	Bacteria	6316
305	Ga0099794_10005005	3300007265	Bacteria	5276
306	Ga0099794_10013701	3300007265	Bacteria	3536
307	Ga0099794_10016299	3300007265	Bacteria	3291
308	Ga0099795_10001343	3300007788	Bacteria	5268
309	Ga0105251_10001425	3300009011	Bacteria	20604
310	Ga0105251_10002220	3300009011	Bacteria	15494
311	Ga0105251_10002228	3300009011	Bacteria	15467
312	Ga0105251_10002491	3300009011	Bacteria	14415
313	Ga0105251_10002841	3300009011	Bacteria	13080
314	Ga0105251_10004823	3300009011	Bacteria	9018
315	Ga0105251_10011480	3300009011	Bacteria	5058
316	Ga0105251_10018780	3300009011	Bacteria	3666
317	Ga0105251_10022252	3300009011	Bacteria	3295
318	Ga0105251_10025547	3300009011	Bacteria	3020
319	Ga0105251_10026031	3300009011	Bacteria	2983
320	Ga0105251_10030604	3300009011	Bacteria	2700
321	Ga0105251_10041145	3300009011	Bacteria	2251
322	Ga0105244_10000033	3300009036	Bacteria	172219
323	Ga0105244_10000205	3300009036	Bacteria	60526
324	Ga0105244_10000505	3300009036	Bacteria	34917
325	Ga0105244_10000565	3300009036	Bacteria	33084
326	Ga0105244_10000822	3300009036	Bacteria	26216
327	Ga0105244_10001412	3300009036	Bacteria	19445
328	Ga0105244_10002138	3300009036	Bacteria	15170
329	Ga0105244_10002840	3300009036	Bacteria	12855
330	Ga0105244_10004471	3300009036	Bacteria	9606
331	Ga0105244_10005243	3300009036	Bacteria	8658
332	Ga0105244_10011535	3300009036	Bacteria	5288
333	Ga0105244_10025242	3300009036	Bacteria	3233
334	Ga0105244_10031572	3300009036	Bacteria	2810
335	Ga0105244_10041264	3300009036	Bacteria	2392
336	Ga0105244_10087641	3300009036	Bacteria	1534
337	Ga0105250_10000098	3300009092	Bacteria	78269
338	Ga0105250_10000165	3300009092	Bacteria	57113
339	Ga0105250_10000321	3300009092	Bacteria	36864
340	Ga0105250_10000351	3300009092	Bacteria	35223
341	Ga0105250_10001790	3300009092	Bacteria	11256
342	Ga0105250_10001907	3300009092	Bacteria	10821
343	Ga0105250_10006148	3300009092	Bacteria	5276
344	Ga0105250_10007719	3300009092	Bacteria	4609
345	Ga0105250_10009109	3300009092	Bacteria	4191
346	Ga0105250_10015924	3300009092	Bacteria	3071
347	Ga0105250_10016442	3300009092	Bacteria	3014
348	Ga0105240_10011254	3300009093	Bacteria	12475
349	Ga0105240_10241103	3300009093	Bacteria	2096
350	Ga0111539_10017556	3300009094	Bacteria	8857
351	Ga0111539_10028373	3300009094	Bacteria	6829
352	Ga0111539_10041319	3300009094	Bacteria	5545
353	Ga0111539_10154814	3300009094	Bacteria	2682
354	Ga0111539_10182405	3300009094	Bacteria	2451
355	Ga0105245_10002648	3300009098	Bacteria	16115
356	Ga0105247_10000027	3300009101	Bacteria	201966
357	Ga0105247_10000135	3300009101	Bacteria	71840
358	Ga0105247_10002273	3300009101	Bacteria	13193
359	Ga0105247_10025821	3300009101	Bacteria	3545
360	Ga0105247_10052448	3300009101	Bacteria	2515
361	Ga0114129_10019736	3300009147	Bacteria	9593
362	Ga0114129_10023948	3300009147	Bacteria	8652
363	Ga0114129_10044191	3300009147	Bacteria	6267
364	Ga0114129_10052198	3300009147	Bacteria	5738
365	Ga0114129_10493854	3300009147	Bacteria	1599
366	Ga0105243_10000209	3300009148	Bacteria	68700
367	Ga0105243_10000610	3300009148	Bacteria	35654
368	Ga0105243_10001044	3300009148	Bacteria	25379
369	Ga0105243_10003148	3300009148	Bacteria	13544
370	Ga0105243_10016277	3300009148	Bacteria	5627
371	Ga0105241_10000006	3300009174	Bacteria	373608
372	Ga0105242_10000022	3300009176	Bacteria	111855
373	Ga0105242_10001532	3300009176	Bacteria	18165
374	Ga0105242_10004935	3300009176	Bacteria	10332
375	Ga0105242_10006592	3300009176	Bacteria	8944
376	Ga0105248_10011119	3300009177	Bacteria	9933
377	Ga0105248_10045161	3300009177	Bacteria	4941
378	Ga0105248_10105390	3300009177	Bacteria	3179
379	Ga0105248_10142234	3300009177	Bacteria	2706
380	Ga0105237_10004947	3300009545	Bacteria	15217
381	Ga0105238_10031789	3300009551	Bacteria	5371
382	Ga0105238_10280268	3300009551	Bacteria	1648
383	Ga0105249_10000003	3300009553	Bacteria	370855
384	Ga0105249_10002104	3300009553	Bacteria	17273
385	Ga0105249_10019213	3300009553	Bacteria	6094
386	Ga0105249_10024734	3300009553	Bacteria	5399
387	Ga0105249_10027395	3300009553	Bacteria	5141
388	Ga0105249_10032694	3300009553	Bacteria	4707
389	Ga0105249_10033483	3300009553	Bacteria	4652
390	Ga0105249_10052564	3300009553	Bacteria	3721
391	Ga0105249_10121750	3300009553	Bacteria	2480
392	Ga0099796_10002019	3300010159	Bacteria	4327
393	Ga0105239_10063579	3300010375	Unclassified	4052
394	Ga0105239_10134337	3300010375	Bacteria	2754
395	Ga0105246_10003506	3300011119	Bacteria	9494
396	Ga0105246_10019168	3300011119	Bacteria	4367
397	Ga0105246_10021619	3300011119	Bacteria	4142
398	Ga0157373_10000301	3300013100	Bacteria	40059
399	Ga0157373_10002101	3300013100	Bacteria	15084
400	Ga0157373_10002114	3300013100	Bacteria	15036
401	Ga0157373_10029123	3300013100	Bacteria	3980
402	Ga0157373_10056959	3300013100	Bacteria	2773
403	Ga0157373_10081803	3300013100	Bacteria	2277
404	Ga0157371_10000003	3300013102	Bacteria	543317
405	Ga0157371_10000159	3300013102	Bacteria	98984
406	Ga0157371_10000349	3300013102	Bacteria	59337
407	Ga0157371_10001320	3300013102	Bacteria	26053
408	Ga0157371_10013787	3300013102	Bacteria	6125
409	Ga0157371_10015987	3300013102	Bacteria	5613
410	Ga0157370_10001424	3300013104	Bacteria	29698
411	Ga0157370_10003454	3300013104	Bacteria	18545
412	Ga0157370_10032567	3300013104	Bacteria	5089
413	Ga0157369_10005227	3300013105	Bacteria	15143
414	Ga0157369_10016447	3300013105	Bacteria	8319
415	Ga0157369_10031273	3300013105	Bacteria	5863
416	Ga0157369_10065620	3300013105	Bacteria	3906
417	Ga0157369_10067276	3300013105	Bacteria	3852
418	Ga0157369_10096935	3300013105	Bacteria	3146
419	Ga0157369_10113194	3300013105	Bacteria	2883
420	Ga0157374_10011214	3300013296	Bacteria	7751
421	Ga0157374_10028018	3300013296	Bacteria	5088
422	Ga0157374_10190194	3300013296	Bacteria	2008
423	Ga0157374_10362050	3300013296	Bacteria	1442
424	Ga0157378_10000032	3300013297	Bacteria	122562
425	Ga0157378_10000198	3300013297	Bacteria	58644
426	Ga0157378_10002598	3300013297	Bacteria	16083
427	Ga0157378_10011775	3300013297	Bacteria	7657
428	Ga0157378_10020323	3300013297	Bacteria	5840
429	Ga0157378_10050199	3300013297	Bacteria	3712
430	Ga0157378_10120544	3300013297	Bacteria	2417
431	Ga0157378_10143776	3300013297	Bacteria	2217
432	Ga0163162_10000020	3300013306	Bacteria	220558
433	Ga0163162_10003172	3300013306	Bacteria	15716
434	Ga0163162_10037064	3300013306	Bacteria	4864
435	Ga0163162_10071275	3300013306	Bacteria	3527
436	Ga0163162_10071438	3300013306	Bacteria	3524
437	Ga0163162_10073862	3300013306	Bacteria	3467
438	Ga0163162_10107005	3300013306	Bacteria	2892
439	Ga0157372_10000517	3300013307	Bacteria	42523
440	Ga0157372_10008131	3300013307	Bacteria	11154
441	Ga0157372_10024378	3300013307	Bacteria	6570
442	Ga0157372_10026685	3300013307	Bacteria	6286
443	Ga0157372_10026686	3300013307	Bacteria	6286
444	Ga0157372_10083350	3300013307	Bacteria	3621
445	Ga0157372_10141832	3300013307	Bacteria	2769
446	Ga0157372_10311406	3300013307	Bacteria	1832
447	Ga0157375_10000803	3300013308	Bacteria	27579
448	Ga0157375_10006931	3300013308	Bacteria	9892
449	Ga0157375_10050456	3300013308	Bacteria	4081
450	Ga0157375_10090316	3300013308	Unclassified	3121
451	Ga0157375_10104931	3300013308	Bacteria	2915
452	Ga0157375_10182821	3300013308	Bacteria	2249
453	Ga0157375_10215921	3300013308	Bacteria	2076
454	Ga0163163_10018502	3300014325	Bacteria	6524
455	Ga0163163_10057289	3300014325	Bacteria	3852
456	Ga0163163_10118619	3300014325	Unclassified	2679
457	Ga0163163_10160729	3300014325	Bacteria	2292
458	Ga0157380_10001368	3300014326	Bacteria	15891
459	Ga0157380_10002195	3300014326	Bacteria	13119
460	Ga0157380_10003353	3300014326	Bacteria	10985
461	Ga0157380_10016365	3300014326	Bacteria	5468
462	Ga0157380_10018065	3300014326	Bacteria	5231
463	Ga0182008_10004600	3300014497	Bacteria	8034
464	Ga0182008_10026343	3300014497	Bacteria	2949
465	Ga0157377_10030176	3300014745	Bacteria	2935
466	Ga0157379_10076920	3300014968	Bacteria	2988
467	Ga0157376_10000036	3300014969	Bacteria	145496
468	Ga0157376_10000766	3300014969	Bacteria	20943
469	Ga0157376_10011646	3300014969	Bacteria	6492
470	Ga0182006_1000125	3300015261	Bacteria	82143
471	Ga0182006_1000376	3300015261	Bacteria	37065
472	Ga0182006_1000652	3300015261	Bacteria	24669
473	Ga0182007_10000082	3300015262	Bacteria	71660
474	Ga0182005_1000047	3300015265	Bacteria	126754
475	Ga0183366_1002	3300015679	Bacteria	791639
476	Ga0183370_1002	3300015680	Bacteria	791639
477	Ga0183369_1002	3300015685	Bacteria	791621
478	Ga0183368_1005	3300015687	Bacteria	791621
479	Ga0163161_10000036	3300017792	Bacteria	153121
480	Ga0163161_10000529	3300017792	Bacteria	31218
481	Ga0163161_10003383	3300017792	Bacteria	11195
482	Ga0163161_10011889	3300017792	Bacteria	6040
483	Ga0163161_10030011	3300017792	Unclassified	3867
484	Ga0163161_10041321	3300017792	Bacteria	3314
485	Ga0213876_10000013	3300021384	Bacteria	342052
486	Ga0213876_10000085	3300021384	Bacteria	106580
487	Ga0213876_10000323	3300021384	Bacteria	41908
488	Ga0213876_10082477	3300021384	Bacteria	1701
489	Ga0209760_100006	3300025207	Bacteria	224535
490	Ga0209784_100001	3300025224	Bacteria	3600592
491	Ga0209566_100001	3300025225	Bacteria	3600765
492	Ga0209674_100002	3300025226	Bacteria	3600592
493	Ga0209147_100062	3300025229	Bacteria	242831
494	Ga0209147_100101	3300025229	Bacteria	161976
495	Ga0209147_101145	3300025229	Bacteria	10884
496	Ga0209147_102824	3300025229	Bacteria	3869
497	Ga0209563_100008	3300025230	Bacteria	1554545
498	Ga0207427_100002	3300025231	Bacteria	1355321
499	Ga0209437_100100	3300025233	Bacteria	228479
500	Ga0209437_100114	3300025233	Bacteria	210697
501	Ga0209677_100004	3300025253	Bacteria	1554545
502	Ga0209129_1000010	3300025258	Bacteria	583357
503	Ga0209233_1001399	3300025261	Bacteria	9542
504	Ga0209673_1002798	3300025273	Bacteria	11313
505	Ga0209130_1004437	3300025284	Bacteria	5320
506	Ga0209675_1015458	3300025291	Bacteria	2265
507	Ga0209676_1000164	3300025292	Bacteria	156826
508	Ga0209676_1000244	3300025292	Bacteria	116654
509	Ga0209025_1000191	3300025294	Bacteria	152552
510	Ga0209025_1002445	3300025294	Bacteria	19663
511	Ga0209025_1004118	3300025294	Bacteria	12924
512	Ga0209025_1004239	3300025294	Bacteria	12622
513	Ga0209025_1010308	3300025294	Bacteria	6349
514	Ga0209025_1011096	3300025294	Bacteria	6001
515	Ga0207656_10014754	3300025321	Bacteria	3017
516	Ga0207696_1000014	3300025711	Bacteria	517939
517	Ga0207696_1000027	3300025711	Bacteria	412783
518	Ga0207696_1000137	3300025711	Bacteria	127683
519	Ga0207696_1000188	3300025711	Bacteria	95866
520	Ga0207696_1000272	3300025711	Bacteria	62222
521	Ga0207696_1000356	3300025711	Bacteria	46221
522	Ga0207696_1000466	3300025711	Bacteria	35122
523	Ga0207696_1000800	3300025711	Bacteria	20360
524	Ga0207696_1001902	3300025711	Bacteria	10645
525	Ga0207696_1003889	3300025711	Bacteria	6603
526	Ga0207696_1022717	3300025711	Bacteria	1988
527	Ga0207696_1025758	3300025711	Bacteria	1829
528	Ga0207696_1030466	3300025711	Bacteria	1639
529	Ga0207655_1000024	3300025728	Bacteria	459774
530	Ga0207655_1000028	3300025728	Bacteria	437324
531	Ga0207655_1000065	3300025728	Bacteria	252767
532	Ga0207655_1000072	3300025728	Bacteria	236536
533	Ga0207655_1000186	3300025728	Bacteria	110125
534	Ga0207655_1000222	3300025728	Bacteria	96831
535	Ga0207655_1000397	3300025728	Bacteria	60486
536	Ga0207655_1001028	3300025728	Bacteria	28168
537	Ga0207655_1001295	3300025728	Bacteria	23673
538	Ga0207655_1002151	3300025728	Bacteria	16419
539	Ga0207655_1003209	3300025728	Bacteria	12295
540	Ga0207655_1004076	3300025728	Bacteria	10520
541	Ga0207655_1005165	3300025728	Bacteria	8983
542	Ga0207655_1012043	3300025728	Bacteria	5091
543	Ga0207655_1020990	3300025728	Bacteria	3333
544	Ga0207655_1025169	3300025728	Bacteria	2896
545	Ga0207713_1000007	3300025735	Bacteria	564979
546	Ga0207713_1000019	3300025735	Bacteria	361225
547	Ga0207713_1000157	3300025735	Bacteria	102471
548	Ga0207713_1000181	3300025735	Bacteria	90733
549	Ga0207713_1000272	3300025735	Bacteria	63323
550	Ga0207713_1000300	3300025735	Bacteria	56459
551	Ga0207713_1000672	3300025735	Bacteria	32332
552	Ga0207713_1001641	3300025735	Bacteria	17426
553	Ga0207713_1003970	3300025735	Bacteria	9803
554	Ga0207713_1004072	3300025735	Bacteria	9639
555	Ga0207713_1006057	3300025735	Bacteria	7458
556	Ga0207713_1007265	3300025735	Bacteria	6571
557	Ga0207713_1010697	3300025735	Bacteria	5054
558	Ga0207713_1015968	3300025735	Bacteria	3831
559	Ga0207713_1024058	3300025735	Bacteria	2849
560	Ga0207713_1037520	3300025735	Bacteria	2065
561	Ga0207713_1042008	3300025735	Bacteria	1902
562	Ga0207653_10000237	3300025885	Bacteria	36624
563	Ga0207642_10006368	3300025899	Bacteria	3920
564	Ga0207710_10000002	3300025900	Bacteria	1251998
565	Ga0207710_10000007	3300025900	Bacteria	488292
566	Ga0207710_10005114	3300025900	Bacteria	5676
567	Ga0207710_10005216	3300025900	Bacteria	5615
568	Ga0207685_10000024	3300025905	Bacteria	113741
569	Ga0207699_10000044	3300025906	Bacteria	116342
570	Ga0207699_10004823	3300025906	Bacteria	6454
571	Ga0207699_10008642	3300025906	Bacteria	5037
572	Ga0207645_10103867	3300025907	Bacteria	1835
573	Ga0207643_10006590	3300025908	Bacteria	6226
574	Ga0207643_10037266	3300025908	Bacteria	2728
575	Ga0207684_10022101	3300025910	Bacteria	5432
576	Ga0207684_10022185	3300025910	Bacteria	5423
577	Ga0207654_10000008	3300025911	Bacteria	375871
578	Ga0207707_10020786	3300025912	Bacteria	5733
579	Ga0207707_10068790	3300025912	Bacteria	3086
580	Ga0207695_10071306	3300025913	Bacteria	3548
581	Ga0207695_10257543	3300025913	Bacteria	1643
582	Ga0207671_10162649	3300025914	Bacteria	1729
583	Ga0207693_10022053	3300025915	Bacteria	5063
584	Ga0207693_10062208	3300025915	Bacteria	2925
585	Ga0207693_10119528	3300025915	Bacteria	2069
586	Ga0207663_10024247	3300025916	Bacteria	3493
587	Ga0207660_10072589	3300025917	Bacteria	2507
588	Ga0207662_10003433	3300025918	Bacteria	8152
589	Ga0207649_10052400	3300025920	Bacteria	2531
590	Ga0207652_10011174	3300025921	Bacteria	7237
591	Ga0207652_10166770	3300025921	Bacteria	1975
592	Ga0207646_10000015	3300025922	Bacteria	337243
593	Ga0207646_10009759	3300025922	Bacteria	9457
594	Ga0207646_10011718	3300025922	Bacteria	8477
595	Ga0207646_10015612	3300025922	Bacteria	7167
596	Ga0207646_10016367	3300025922	Bacteria	6959
597	Ga0207646_10017594	3300025922	Bacteria	6679
598	Ga0207646_10026086	3300025922	Bacteria	5339
599	Ga0207646_10045485	3300025922	Bacteria	3941
600	Ga0207646_10239606	3300025922	Bacteria	1639
601	Ga0207681_10115289	3300025923	Unclassified	1961
602	Ga0207650_10024160	3300025925	Bacteria	4318
603	Ga0207650_10087712	3300025925	Bacteria	2371
604	Ga0207650_10142221	3300025925	Bacteria	1887
605	Ga0207659_10093986	3300025926	Bacteria	2246
606	Ga0207687_10014037	3300025927	Bacteria	5237
607	Ga0207687_10200391	3300025927	Unclassified	1560
608	Ga0207700_10001399	3300025928	Bacteria	13688
609	Ga0207700_10022889	3300025928	Bacteria	4295
610	Ga0207664_10060391	3300025929	Bacteria	3021
611	Ga0207644_10038174	3300025931	Bacteria	3381
612	Ga0207644_10052930	3300025931	Bacteria	2919
613	Ga0207644_10080817	3300025931	Bacteria	2401
614	Ga0207686_10000013	3300025934	Bacteria	204636
615	Ga0207686_10003298	3300025934	Bacteria	8679
616	Ga0207686_10003657	3300025934	Bacteria	8239
617	Ga0207686_10045845	3300025934	Bacteria	2692
618	Ga0207709_10000009	3300025935	Bacteria	619238
619	Ga0207709_10000726	3300025935	Bacteria	26397
620	Ga0207709_10001256	3300025935	Bacteria	18196
621	Ga0207709_10012854	3300025935	Bacteria	4616
622	Ga0207670_10004012	3300025936	Bacteria	7864
623	Ga0207670_10013512	3300025936	Bacteria	4818
624	Ga0207670_10153027	3300025936	Bacteria	1713
625	Ga0207669_10052857	3300025937	Bacteria	2443
626	Ga0207704_10018979	3300025938	Unclassified	3602
627	Ga0207704_10072447	3300025938	Bacteria	2190
628	Ga0207665_10000297	3300025939	Bacteria	34362
629	Ga0207665_10000876	3300025939	Bacteria	20302
630	Ga0207665_10012965	3300025939	Bacteria	5480
631	Ga0207665_10103734	3300025939	Bacteria	1989
632	Ga0207691_10012609	3300025940	Bacteria	8102
633	Ga0207691_10024395	3300025940	Bacteria	5687
634	Ga0207711_10053771	3300025941	Bacteria	3454
635	Ga0207711_10060439	3300025941	Bacteria	3266
636	Ga0207711_10088878	3300025941	Unclassified	2713
637	Ga0207711_10089739	3300025941	Bacteria	2701
638	Ga0207711_10310038	3300025941	Bacteria	1457
639	Ga0207689_10004558	3300025942	Bacteria	12544
640	Ga0207689_10004920	3300025942	Bacteria	12031
641	Ga0207689_10008514	3300025942	Bacteria	8945
642	Ga0207679_10043918	3300025945	Bacteria	3221
643	Ga0207679_10087828	3300025945	Bacteria	2395
644	Ga0207679_10090635	3300025945	Bacteria	2364
645	Ga0207651_10079994	3300025960	Bacteria	2350
646	Ga0207712_10000232	3300025961	Bacteria	54804
647	Ga0207712_10036903	3300025961	Bacteria	3331
648	Ga0207712_10040820	3300025961	Bacteria	3187
649	Ga0207640_10054073	3300025981	Bacteria	2624
650	Ga0207703_10000120	3300026035	Bacteria	94585
651	Ga0207703_10004189	3300026035	Bacteria	11890
652	Ga0207639_10003615	3300026041	Bacteria	10387
653	Ga0207639_10019858	3300026041	Bacteria	4800
654	Ga0207639_10040697	3300026041	Bacteria	3470
655	Ga0207678_10038026	3300026067	Bacteria	4184
656	Ga0207708_10003250	3300026075	Bacteria	11978
657	Ga0207708_10007709	3300026075	Bacteria	7970
658	Ga0207708_10198347	3300026075	Bacteria	1600
659	Ga0207702_10310698	3300026078	Bacteria	1499
660	Ga0207641_10075986	3300026088	Bacteria	2902
661	Ga0207648_10026587	3300026089	Bacteria	5141
662	Ga0207648_10051052	3300026089	Bacteria	3615
663	Ga0207648_10084977	3300026089	Bacteria	2760
664	Ga0207676_10004697	3300026095	Bacteria	9677
665	Ga0207676_10048005	3300026095	Bacteria	3312
666	Ga0207676_10102031	3300026095	Bacteria	2380
667	Ga0207674_10000119	3300026116	Bacteria	91959
668	Ga0207674_10003584	3300026116	Bacteria	18930
669	Ga0207675_100000607	3300026118	Bacteria	34962
670	Ga0207675_100011099	3300026118	Bacteria	8441
671	Ga0207675_100051301	3300026118	Unclassified	3849
672	Ga0207675_100170856	3300026118	Bacteria	2078
673	Ga0207683_10022597	3300026121	Bacteria	5400
674	Ga0207683_10142538	3300026121	Bacteria	2160
675	Ga0207698_10043435	3300026142	Unclassified	3367
676	Ga0207698_10127938	3300026142	Bacteria	2164
677	Ga0209281_1000025	3300027111	Bacteria	488275
678	Ga0209281_1000096	3300027111	Bacteria	236276
679	Ga0209281_1000213	3300027111	Bacteria	128367
680	Ga0209281_1000279	3300027111	Bacteria	96898
681	Ga0209281_1000281	3300027111	Bacteria	96061
682	Ga0209281_1000328	3300027111	Bacteria	82899
683	Ga0209281_1000369	3300027111	Bacteria	73041
684	Ga0209281_1000539	3300027111	Bacteria	47680
685	Ga0209281_1000558	3300027111	Bacteria	45216
686	Ga0209281_1000723	3300027111	Bacteria	32737
687	Ga0209281_1000953	3300027111	Bacteria	23576
688	Ga0209281_1001042	3300027111	Bacteria	21087
689	Ga0209281_1005043	3300027111	Bacteria	3762
690	Ga0209281_1006438	3300027111	Bacteria	3064
691	Ga0209371_1000013	3300027312	Bacteria	691516
692	Ga0209371_1000019	3300027312	Bacteria	583561
693	Ga0209371_1000069	3300027312	Bacteria	207967
694	Ga0209371_1000083	3300027312	Bacteria	184176
695	Ga0209371_1000149	3300027312	Bacteria	110455
696	Ga0209371_1000346	3300027312	Bacteria	50802
697	Ga0209371_1000351	3300027312	Bacteria	50314
698	Ga0209371_1000509	3300027312	Bacteria	37163
699	Ga0209371_1000663	3300027312	Bacteria	30042
700	Ga0209371_1000759	3300027312	Bacteria	26909
701	Ga0209371_1002463	3300027312	Bacteria	10317
702	Ga0209371_1004362	3300027312	Bacteria	6212
703	Ga0209371_1005293	3300027312	Bacteria	5194
704	Ga0209371_1008802	3300027312	Bacteria	3295
705	Ga0209371_1009303	3300027312	Bacteria	3136
706	Ga0209371_1014929	3300027312	Bacteria	2110
707	Ga0209371_1016264	3300027312	Bacteria	1969
708	Ga0209969_1002305	3300027360	Bacteria	2633
709	Ga0209983_1001331	3300027665	Bacteria	5511
710	Ga0209588_1002878	3300027671	Bacteria	4724
711	Ga0209588_1015041	3300027671	Bacteria	2377
712	Ga0209971_1001657	3300027682	Bacteria	5504
713	Ga0209974_10010197	3300027876	Bacteria	3171
714	Ga0207428_10006088	3300027907	Bacteria	11155
715	Ga0265354_1000013	3300028016	Bacteria	27465
716	Ga0265354_1000933	3300028016	Bacteria	4630
717	Ga0268266_10000142	3300028379	Bacteria	138183
718	Ga0268266_10120932	3300028379	Bacteria	2330
719	Ga0268265_10092033	3300028380	Unclassified	2426
720	Ga0268265_10141358	3300028380	Bacteria	2016
721	Ga0268265_10249271	3300028380	Bacteria	1572
722	Ga0268264_10002249	3300028381	Bacteria	17099
723	Ga0268264_10018274	3300028381	Bacteria	5734
724	Ga0268264_10082860	3300028381	Bacteria	2746
725	Ga0268264_10142956	3300028381	Bacteria	2136
726	Ga0265319_1012387	3300028563	Bacteria	3451
727	Ga0265323_10012200	3300028653	Bacteria	3451
728	Ga0265323_10013424	3300028653	Bacteria	3267
729	Ga0265322_10000068	3300028654	Bacteria	49602
730	Ga0265336_10012205	3300028666	Bacteria	2893
731	Ga0307515_10092535	3300028794	Bacteria	3762
732	Ga0265338_10002410	3300028800	Bacteria	28145
733	Ga0265338_10003117	3300028800	Bacteria	23719
734	Ga0265338_10003885	3300028800	Bacteria	20670
735	Ga0265338_10118861	3300028800	Bacteria	2111
736	Ga0265324_10007845	3300029957	Bacteria	4285
737	Ga0237817_10002	3300030083	Bacteria	100594
738	Ga0268256_1000014	3300030500	Bacteria	691435
739	Ga0268256_1000024	3300030500	Bacteria	488637
740	Ga0268256_1000066	3300030500	Bacteria	199115
741	Ga0268256_1000074	3300030500	Bacteria	184102
742	Ga0268256_1000293	3300030500	Bacteria	50802
743	Ga0268256_1000294	3300030500	Bacteria	50324
744	Ga0268256_1000734	3300030500	Bacteria	24107
745	Ga0268256_1000910	3300030500	Bacteria	20410
746	Ga0268256_1000918	3300030500	Bacteria	20350
747	Ga0268256_1002373	3300030500	Bacteria	9687
748	Ga0268256_1002616	3300030500	Bacteria	8950
749	Ga0268256_1005162	3300030500	Bacteria	5194
750	Ga0268256_1006944	3300030500	Bacteria	4128
751	Ga0268256_1007632	3300030500	Bacteria	3825
752	Ga0268256_1009251	3300030500	Bacteria	3295
753	Ga0268256_1009830	3300030500	Bacteria	3136
754	Ga0268256_1012534	3300030500	Bacteria	2617
755	Ga0268256_1016536	3300030500	Bacteria	2111
756	Ga0268256_1027782	3300030500	Bacteria	1405
757	Ga0265770_1000010	3300030878	Bacteria	19154
758	Ga0265770_1000581	3300030878	Bacteria	5063
759	Ga0265760_10001163	3300031090	Bacteria	7677
760	Ga0265760_10003760	3300031090	Bacteria	4397
761	Ga0265332_10002073	3300031238	Bacteria	10466
762	Ga0265328_10000007	3300031239	Bacteria	224310
763	Ga0265320_10001251	3300031240	Bacteria	18674
764	Ga0265320_10007633	3300031240	Bacteria	6696
765	Ga0265325_10003550	3300031241	Bacteria	10131
766	Ga0265325_10015326	3300031241	Bacteria	4311
767	Ga0265340_10000871	3300031247	Bacteria	17100
768	Ga0265339_10010711	3300031249	Bacteria	5679
769	Ga0265339_10062997	3300031249	Bacteria	1992
770	Ga0265331_10015546	3300031250	Bacteria	4016
771	Ga0265331_10033491	3300031250	Bacteria	2540
772	Ga0265327_10002135	3300031251	Bacteria	21837
773	Ga0265327_10014891	3300031251	Bacteria	5062
774	Ga0265327_10029616	3300031251	Bacteria	3111
775	Ga0265327_10056777	3300031251	Bacteria	2016
776	Ga0265316_10001683	3300031344	Bacteria	23510
777	Ga0265316_10020850	3300031344	Bacteria	5566
778	Ga0265316_10035601	3300031344	Bacteria	4033
779	Ga0265316_10080493	3300031344	Bacteria	2498
780	Ga0307513_10026866	3300031456	Bacteria	6622
781	Ga0307513_10059905	3300031456	Bacteria	4039
782	Ga0307408_100009658	3300031548	Bacteria	6360
783	Ga0307408_100057942	3300031548	Bacteria	2814
784	Ga0307408_100125174	3300031548	Bacteria	1997
785	Ga0307408_100234139	3300031548	Bacteria	1506
786	Ga0307508_10100738	3300031616	Bacteria	2484
787	Ga0316575_10000162	3300031665	Bacteria	17016
788	Ga0316579_10001586	3300031691	Bacteria	8299
789	Ga0265314_10000307	3300031711	Bacteria	70029
790	Ga0265314_10012695	3300031711	Bacteria	6851
791	Ga0265314_10023504	3300031711	Bacteria	4697
792	Ga0265314_10027897	3300031711	Bacteria	4219
793	Ga0265314_10064127	3300031711	Bacteria	2489
794	Ga0265314_10145939	3300031711	Bacteria	1457
795	Ga0265342_10000376	3300031712	Bacteria	49231
796	Ga0265342_10004443	3300031712	Bacteria	11051
797	Ga0265342_10008905	3300031712	Bacteria	7136
798	Ga0265342_10024589	3300031712	Bacteria	3800
799	Ga0316576_10004628	3300031727	Bacteria	8280
800	Ga0316576_10009511	3300031727	Bacteria	6278
801	Ga0316578_10021832	3300031728	Bacteria	3558
802	Ga0307405_10003993	3300031731	Bacteria	6913
803	Ga0307405_10069943	3300031731	Bacteria	2252
804	Ga0307405_10107281	3300031731	Bacteria	1885
805	Ga0316577_10005100	3300031733	Bacteria	6859
806	Ga0307413_10000170	3300031824	Bacteria	18240
807	Ga0307410_10002450	3300031852	Bacteria	8957
808	Ga0307406_10044940	3300031901	Bacteria	2770
809	Ga0307406_10117839	3300031901	Bacteria	1840
810	Ga0307406_10138184	3300031901	Unclassified	1721
811	Ga0307407_10000350	3300031903	Bacteria	13916
812	Ga0307407_10080601	3300031903	Bacteria	1967
813	Ga0307412_10006755	3300031911	Bacteria	6506
814	Ga0307409_100017016	3300031995	Bacteria	4832
815	Ga0307409_100051588	3300031995	Bacteria	3148
816	Ga0307416_100010524	3300032002	Bacteria	6114
817	Ga0307416_100014460	3300032002	Bacteria	5413
818	Ga0307416_100098150	3300032002	Bacteria	2540
819	Ga0307416_100131904	3300032002	Bacteria	2251
820	Ga0307416_100265758	3300032002	Bacteria	1680
821	Ga0307416_100302655	3300032002	Bacteria	1590
822	Ga0307416_100351490	3300032002	Unclassified	1492
823	Ga0307414_10008756	3300032004	Bacteria	5767
824	Ga0307414_10151597	3300032004	Bacteria	1830
825	Ga0307411_10029717	3300032005	Bacteria	3341
826	Ga0307411_10041909	3300032005	Bacteria	2917
827	Ga0307411_10082775	3300032005	Bacteria	2214
828	Ga0307411_10111539	3300032005	Bacteria	1958
829	Ga0307411_10153229	3300032005	Bacteria	1716
830	Ga0307415_100001283	3300032126	Bacteria	11842
831	Ga0307415_100015858	3300032126	Bacteria	4474
832	Ga0316583_10006109	3300032133	Bacteria	4332
833	Ga0316585_10001396	3300032137	Bacteria	6363
834	Ga0316580_10003028	3300032139	Bacteria	4731
835	Ga0316593_10015093	3300032168	Bacteria	2318
836	Ga0307507_10077786	3300033179	Bacteria	2947
837	Ga0316212_1004452	3300033547	Bacteria	2037
838	Ga0373934_0001039	3300035086	Bacteria	10019
839	Ga0373934_0001170	3300035086	Bacteria	9579
840	Ga0373923_0082371	3300035111	Bacteria	1397
841	Ga0373953_0004961	3300035117	Bacteria	4285
842	Ga0373954_0000314	3300035118	Bacteria	17686
843	Ga0373954_0051445	3300035118	Bacteria	1935
844	Ga0373956_0000836	3300035119	Bacteria	12785
845	Ga0373957_0000721	3300035120	Bacteria	8571
846	Ga0373957_0032346	3300035120	Bacteria	1926
847	Ga0373955_0002966	3300035172	Bacteria	7430
848	Ga0373931_0040141	3300035691	Bacteria	2455
849	Ga0373931_0056980	3300035691	Bacteria	2095
850	Ga0373931_0127753	3300035691	Bacteria	1460
851	Ga0373927_0002793	3300035695	Bacteria	12743
852	Ga0373933_0003914	3300035724	Bacteria	8217
853	Ga0373933_0003996	3300035724	Bacteria	8125
854	Ga0373937_0029645	3300036401	Bacteria	4957
855	Ga0373937_0060602	3300036401	Bacteria	3477
856	Ga0373937_0124832	3300036401	Bacteria	2401
857	Ga0316582_0006906	3300036647	Bacteria	6004
858	Ga0316582_0033161	3300036647	Bacteria	3169
859	Ga0316584_0013384	3300036712	Bacteria	5805
860	Ga0373925_0002913	3300037068	Bacteria	13495
861	Ga0373925_0165285	3300037068	Bacteria	1745
862	Ga0395899_0022447	3300037312	Bacteria	4786
863	Ga0395899_0112413	3300037312	Bacteria	1957
864	Ga0395900_0002573	3300037418	Bacteria	19864
865	Ga0395900_0124312	3300037418	Bacteria	2646
866	Ga0395900_0191077	3300037418	Bacteria	2077
867	Ga0395900_0251490	3300037418	Bacteria	1769
868	Ga0395898_0121937	3300037466	Bacteria	2498
869	Ga0395905_0000755	3300037471	Bacteria	42658
870	Ga0395905_0007727	3300037471	Bacteria	10668
871	Ga0395905_0011772	3300037471	Bacteria	8445
872	Ga0395905_0021512	3300037471	Bacteria	6099
873	Ga0395905_0030775	3300037471	Bacteria	5055
874	Ga0395905_0032185	3300037471	Bacteria	4933
875	Ga0395905_0050646	3300037471	Bacteria	3890
876	Ga0395905_0055782	3300037471	Bacteria	3698
877	Ga0316581_0003547	3300037588	Bacteria	3893
878	Ga0436364_1252304	3300037853	Bacteria	5012
879	Ga0395901_0002912	3300038443	Bacteria	17284
880	Ga0395901_0004418	3300038443	Bacteria	14181
881	Ga0395901_0142390	3300038443	Bacteria	2520
882	Ga0400484_18569	3300038725	Bacteria	7398
883	Ga0400484_22195	3300038725	Bacteria	4656
884	Ga0400490_25259	3300038726	Bacteria	11815
885	Ga0400490_28987	3300038726	Bacteria	57885
886	Ga0400490_34331	3300038726	Bacteria	51219
887	Ga0400491_14422	3300038727	Bacteria	4928
888	Ga0400491_17478	3300038727	Bacteria	1350
889	Ga0400485_03650	3300038735	Bacteria	14340
890	Ga0400485_20357	3300038735	Bacteria	55491
891	Ga0400485_21204	3300038735	Bacteria	44972
892	Ga0400488_27793	3300038741	Bacteria	4341
893	Ga0400488_39081	3300038741	Bacteria	1542
894	Ga0400488_43321	3300038741	Bacteria	14407
895	Ga0400488_56365	3300038741	Bacteria	4119
896	Ga0400488_57678	3300038741	Bacteria	2207
897	Ga0400486_04210	3300038742	Bacteria	9770
898	Ga0400486_05246	3300038742	Bacteria	75088
899	Ga0400486_32414	3300038742	Bacteria	97031
900	Ga0400483_091080	3300039062	Bacteria	9725
901	Ga0400483_096039	3300039062	Bacteria	5002
902	Ga0400483_110940	3300039062	Bacteria	25482
903	Ga0400483_149892	3300039062	Bacteria	7502
904	Ga0400483_178063	3300039062	Bacteria	2016
905	Ga0400483_187020	3300039062	Bacteria	6150
906	Ga0400483_236414	3300039062	Bacteria	6073
907	Ga0400483_255177	3300039062	Bacteria	34067
908	Ga0400483_256612	3300039062	Bacteria	14684
909	Ga0400489_29884	3300039093	Bacteria	6820
910	Ga0400489_53776	3300039093	Bacteria	2169
911	Ga0400489_94259	3300039093	Bacteria	2844
912	Ga0400487_00745	3300039110	Bacteria	8134
913	Ga0400487_11212	3300039110	Bacteria	45326
914	Ga0400487_19891	3300039110	Bacteria	6766
915	Ga0436365_0471682	3300039437	Bacteria	352256
916	Ga0436365_0671013	3300039437	Bacteria	1516
917	Ga0436365_0722093	3300039437	Bacteria	7570
918	Ga0436361_0811654	3300039447	Bacteria	2509
919	Ga0436361_1034850	3300039447	Bacteria	2259
920	Ga0436361_1108147	3300039447	Bacteria	10468
921	Ga0436363_0653605	3300039450	Bacteria	11645
922	Ga0439438_000003	3300041405	Bacteria	464587
923	Ga0439438_000282	3300041405	Bacteria	22830
924	Ga0439438_000434	3300041405	Bacteria	19009
925	Ga0439438_011966	3300041405	Bacteria	2679
926	Ga0439447_000460	3300041407	Bacteria	15181
927	Ga0439447_005888	3300041407	Bacteria	4029
928	Ga0439466_0000002	3300041411	Bacteria	494198
929	Ga0439441_002080	3300042001	Bacteria	2757
930	Ga0439432_000566	3300042006	Bacteria	13854
931	Ga0439432_001003	3300042006	Bacteria	10667
932	Ga0439432_002996	3300042006	Bacteria	6288
933	Ga0439452_000004	3300042010	Bacteria	764268
934	Ga0439452_000011	3300042010	Bacteria	428451
935	Ga0439452_000078	3300042010	Bacteria	83572
936	Ga0439452_000079	3300042010	Bacteria	83084
937	Ga0439452_000498	3300042010	Bacteria	21480
938	Ga0439452_001372	3300042010	Bacteria	10056
939	Ga0439452_003286	3300042010	Bacteria	5696
940	Ga0439463_009858	3300042016	Bacteria	2346
941	Ga0450907_000012	3300042146	Bacteria	89037
942	Ga0439434_0009882	3300042435	Bacteria	2807
943	Ga0439464_0004073	3300042439	Bacteria	3717
944	Ga0439460_0042768	3300042461	Bacteria	1336
945	Ga0451577_0000055	3300042876	Bacteria	276883
946	Ga0451577_0000094	3300042876	Bacteria	196498
947	Ga0451577_0001251	3300042876	Bacteria	35154
948	Ga0451577_0001330	3300042876	Bacteria	33600
949	Ga0451577_0002309	3300042876	Bacteria	23046
950	Ga0451577_0005927	3300042876	Bacteria	12320
951	Ga0451577_0006260	3300042876	Bacteria	11925
952	Ga0451577_0014648	3300042876	Bacteria	7307
953	Ga0451577_0018007	3300042876	Bacteria	6513
954	Ga0451577_0019713	3300042876	Bacteria	6199
955	Ga0451577_0021835	3300042876	Bacteria	5853
956	Ga0451577_0044068	3300042876	Bacteria	3994
957	Ga0451577_0063542	3300042876	Bacteria	3292
958	Ga0451577_0105323	3300042876	Bacteria	2521
959	Ga0451577_0113705	3300042876	Bacteria	2423
960	Ga0451577_0119684	3300042876	Bacteria	2358
961	Ga0451577_0146939	3300042876	Bacteria	2120
962	Ga0466969_0023210	3300044656	Bacteria	3197
963	Ga0466981_0000050	3300044669	Bacteria	33071
964	Ga0453683_0000001	3300044673	Bacteria	1384965
965	Ga0453683_0000027	3300044673	Bacteria	248505
966	Ga0453683_0000076	3300044673	Bacteria	149358
967	Ga0453683_0000132	3300044673	Bacteria	108582
968	Ga0453683_0000185	3300044673	Bacteria	86588
969	Ga0453683_0000295	3300044673	Bacteria	63809
970	Ga0453683_0000767	3300044673	Bacteria	31868
971	Ga0453683_0001723	3300044673	Bacteria	18154
972	Ga0453683_0002950	3300044673	Bacteria	12790
973	Ga0453683_0003873	3300044673	Bacteria	10853
974	Ga0453683_0007140	3300044673	Bacteria	7611
975	Ga0453683_0020704	3300044673	Bacteria	4203
976	Ga0453683_0024295	3300044673	Bacteria	3857
977	Ga0453683_0047497	3300044673	Bacteria	2692
978	Ga0453683_0050470	3300044673	Bacteria	2607
979	Ga0453683_0070155	3300044673	Bacteria	2191
980	Ga0453683_0080313	3300044673	Unclassified	2043
981	Ga0453684_0000011	3300044712	Bacteria	1108399
982	Ga0453684_0000183	3300044712	Bacteria	277052
983	Ga0453684_0000254	3300044712	Bacteria	229888
984	Ga0453684_0000491	3300044712	Bacteria	155597
985	Ga0453684_0000569	3300044712	Bacteria	138184
986	Ga0453684_0000645	3300044712	Bacteria	125986
987	Ga0453684_0000716	3300044712	Bacteria	117287
988	Ga0453684_0005480	3300044712	Bacteria	25106
989	Ga0453684_0008305	3300044712	Bacteria	18690
990	Ga0453684_0017545	3300044712	Bacteria	11077
991	Ga0453684_0022733	3300044712	Bacteria	9286
992	Ga0453684_0023032	3300044712	Bacteria	9203
993	Ga0453684_0023175	3300044712	Bacteria	9162
994	Ga0453684_0027030	3300044712	Bacteria	8253
995	Ga0453684_0043186	3300044712	Bacteria	6063
996	Ga0453684_0045399	3300044712	Bacteria	5862
997	Ga0453684_0054539	3300044712	Bacteria	5206
998	Ga0453684_0093822	3300044712	Bacteria	3695
999	Ga0453684_0109497	3300044712	Bacteria	3360
1000	Ga0453684_0112751	3300044712	Bacteria	3300
1001	Ga0453684_0133906	3300044712	Bacteria	2970
1002	Ga0453684_0156068	3300044712	Bacteria	2706
1003	Ga0453684_0161931	3300044712	Bacteria	2645
1004	Ga0453684_0176685	3300044712	Bacteria	2510
1005	Ga0453684_0206280	3300044712	Bacteria	2287
1006	Ga0451576_0000155	3300045051	Bacteria	175508
1007	Ga0451576_0000226	3300045051	Bacteria	138181
1008	Ga0451576_0000256	3300045051	Bacteria	130491
1009	Ga0451576_0000453	3300045051	Bacteria	93077
1010	Ga0451576_0000477	3300045051	Bacteria	90099
1011	Ga0451576_0000602	3300045051	Bacteria	75780
1012	Ga0451576_0000871	3300045051	Bacteria	57999
1013	Ga0451576_0002168	3300045051	Bacteria	30361
1014	Ga0451576_0002171	3300045051	Bacteria	30352
1015	Ga0451576_0008528	3300045051	Bacteria	12017
1016	Ga0451576_0009766	3300045051	Bacteria	11092
1017	Ga0451576_0015544	3300045051	Bacteria	8425
1018	Ga0451576_0016875	3300045051	Bacteria	8044
1019	Ga0451576_0021019	3300045051	Bacteria	7100
1020	Ga0451576_0025721	3300045051	Bacteria	6340
1021	Ga0451576_0058686	3300045051	Bacteria	4020
1022	Ga0451576_0081320	3300045051	Bacteria	3369
1023	Ga0451576_0136359	3300045051	Bacteria	2559
1024	Ga0451576_0153021	3300045051	Bacteria	2405
1025	Ga0451576_0326767	3300045051	Bacteria	1605
1026	Ga0451576_0367835	3300045051	Bacteria	1506
1027	Ga0451576_0459411	3300045051	Bacteria	1337
1028	Ga0466967_0000187	3300045976	Bacteria	25700
1029	Ga0466967_0225185	3300045976	Bacteria	1784
1030	Ga0495617_014046	3300046452	Bacteria	2722
1031	Ga0495617_018563	3300046452	Bacteria	2351
1032	Ga0495627_000017	3300046453	Bacteria	317280
1033	Ga0495592_0003795	3300046454	Bacteria	10907
1034	Ga0495592_0168997	3300046454	Bacteria	1499
1035	Ga0495603_0031856	3300046455	Bacteria	3173
1036	Ga0495603_0120062	3300046455	Bacteria	1532
1037	Ga0495591_000010	3300046458	Bacteria	327794
1038	Ga0495591_000090	3300046458	Bacteria	101695
1039	Ga0495591_004205	3300046458	Bacteria	7132
1040	Ga0495591_008311	3300046458	Bacteria	4271
1041	Ga0495638_0006905	3300046460	Bacteria	8190
1042	Ga0495638_0030883	3300046460	Bacteria	3444
1043	Ga0495641_0037374	3300046461	Bacteria	2276
1044	Ga0495651_0057721	3300046462	Bacteria	2980
1045	Ga0495653_0005359	3300046463	Bacteria	10436
1046	Ga0495653_0061169	3300046463	Bacteria	2850
1047	Ga0495653_0178405	3300046463	Bacteria	1460
1048	Ga0495650_0000004	3300046471	Bacteria	779487
1049	Ga0495650_0000008	3300046471	Bacteria	688246
1050	Ga0495650_0000040	3300046471	Bacteria	366254
1051	Ga0495650_0000077	3300046471	Bacteria	245511
1052	Ga0495650_0015698	3300046471	Bacteria	3873
1053	Ga0495650_0028856	3300046471	Bacteria	2537
1054	Ga0495580_0002312	3300046472	Bacteria	16618
1055	Ga0495580_0054293	3300046472	Bacteria	2826
1056	Ga0495580_0057710	3300046472	Bacteria	2732
1057	Ga0495582_0003535	3300046473	Bacteria	8804
1058	Ga0495582_0042386	3300046473	Bacteria	2507
1059	Ga0495605_0011263	3300046474	Bacteria	4993
1060	Ga0495664_0035031	3300046477	Bacteria	2955
1061	Ga0495584_0005708	3300046491	Bacteria	6570
1062	Ga0495584_0006161	3300046491	Bacteria	6306
1063	Ga0495584_0072377	3300046491	Bacteria	1732
1064	Ga0495585_0016662	3300046492	Bacteria	4257
1065	Ga0495585_0023345	3300046492	Bacteria	3549
1066	Ga0495585_0033255	3300046492	Bacteria	2919
1067	Ga0495585_0103946	3300046492	Bacteria	1516
1068	Ga0495594_0003092	3300046499	Bacteria	8617
1069	Ga0495594_0005074	3300046499	Bacteria	6776
1070	Ga0495594_0032602	3300046499	Bacteria	2828
1071	Ga0495596_0002831	3300046500	Bacteria	9064
1072	Ga0495607_0007704	3300046501	Bacteria	7417
1073	Ga0495583_0000115	3300046506	Bacteria	135762
1074	Ga0495583_0002235	3300046506	Bacteria	17049
1075	Ga0495606_0000399	3300046507	Bacteria	73352
1076	Ga0495606_0027510	3300046507	Bacteria	4030
1077	Ga0495606_0064333	3300046507	Bacteria	2335
1078	Ga0495608_0022282	3300046511	Bacteria	4342
1079	Ga0495608_0058474	3300046511	Bacteria	2542
1080	Ga0495610_0008287	3300046512	Bacteria	6751
1081	Ga0495610_0060101	3300046512	Bacteria	1811
1082	Ga0495620_0010230	3300046515	Bacteria	4949
1083	Ga0495628_0008735	3300046516	Bacteria	8671
1084	Ga0495628_0014037	3300046516	Bacteria	6724
1085	Ga0495628_0207518	3300046516	Bacteria	1474
1086	Ga0495643_0000085	3300046522	Bacteria	157223
1087	Ga0495643_0003201	3300046522	Bacteria	12147
1088	Ga0495643_0016840	3300046522	Bacteria	4289
1089	Ga0495643_0037129	3300046522	Bacteria	2674
1090	Ga0495648_0000732	3300046524	Bacteria	35084
1091	Ga0495648_0002723	3300046524	Bacteria	15966
1092	Ga0495663_0000189	3300046525	Bacteria	24645
1093	Ga0495666_0010013	3300046526	Bacteria	4734
1094	Ga0495666_0027173	3300046526	Bacteria	2818
1095	Ga0495642_0024476	3300046528	Bacteria	2388
1096	Ga0495654_0000036	3300046530	Bacteria	191434
1097	Ga0495654_0000089	3300046530	Bacteria	102765
1098	Ga0495654_0002508	3300046530	Bacteria	11792
1099	Ga0495654_0011011	3300046530	Bacteria	4911
1100	Ga0495654_0013228	3300046530	Bacteria	4419
1101	Ga0495654_0043407	3300046530	Bacteria	2228
1102	Ga0495654_0048860	3300046530	Bacteria	2074
1103	Ga0495640_0011662	3300046533	Bacteria	6748
1104	Ga0495586_0090732	3300046535	Bacteria	1688
1105	Ga0495586_0093111	3300046535	Bacteria	1666
1106	Ga0495587_0001378	3300046536	Bacteria	16152
1107	Ga0495598_0001052	3300046537	Bacteria	5304
1108	Ga0495598_0001591	3300046537	Bacteria	4547
1109	Ga0495609_0000537	3300046538	Bacteria	30126
1110	Ga0495621_0023584	3300046539	Bacteria	2048
1111	Ga0495597_0001169	3300046542	Bacteria	19719
1112	Ga0495645_0013500	3300046543	Bacteria	5777
1113	Ga0495622_0128741	3300046557	Bacteria	1153
1114	Ga0495633_0000217	3300046558	Bacteria	71892
1115	Ga0495633_0033167	3300046558	Bacteria	2491
1116	Ga0495668_0001889	3300046616	Bacteria	18759
1117	Ga0495634_0037156	3300046642	Bacteria	3329
1118	Ga0495625_0004372	3300046660	Bacteria	13408
1119	Ga0495625_0011910	3300046660	Bacteria	7061
1120	Ga0495635_0009665	3300046663	Bacteria	6744
1121	Ga0495635_0103274	3300046663	Bacteria	1948
1122	Ga0495659_0000272	3300046664	Bacteria	21144
1123	Ga0495659_0060352	3300046664	Bacteria	1399
1124	Ga0495661_0002878	3300046665	Bacteria	13018
1125	Ga0495599_0045735	3300046678	Bacteria	2745
1126	Ga0495599_0047968	3300046678	Bacteria	2677
1127	Ga0495647_0025849	3300046681	Bacteria	2147
1128	Ga0495658_0011548	3300046683	Bacteria	4447
1129	Ga0495658_0155796	3300046683	Bacteria	1406
1130	Ga0495669_0000032	3300046684	Bacteria	100472
1131	Ga0495613_0057035	3300046689	Bacteria	2867
1132	Ga0495613_0079148	3300046689	Bacteria	2390
1133	Ga0495671_0001824	3300046692	Bacteria	13726
1134	Ga0495649_0033630	3300046694	Bacteria	2821
1135	Ga0495649_0054079	3300046694	Bacteria	2172
1136	Ga0495649_0082538	3300046694	Bacteria	1717
1137	Ga0495589_0000013	3300046794	Bacteria	248616
1138	Ga0495589_0001531	3300046794	Bacteria	13310
1139	Ga0495589_0072285	3300046794	Bacteria	1685
1140	Ga0495660_0000022	3300046810	Bacteria	284337
1141	Ga0495660_0000184	3300046810	Bacteria	67383
1142	Ga0495660_0038806	3300046810	Bacteria	2646
1143	Ga0495581_0012662	3300047315	Bacteria	4888
1144	Ga0495604_0002655	3300047317	Bacteria	14351
1145	Ga0495604_0014576	3300047317	Bacteria	6266
1146	Ga0495604_0251190	3300047317	Bacteria	1205
1147	Ga0495636_0000635	3300047318	Bacteria	12874
1148	Ga0495636_0000793	3300047318	Bacteria	11615
1149	Ga0495672_0000003	3300047320	Bacteria	728845
1150	Ga0495672_0000019	3300047320	Bacteria	448153
1151	Ga0495672_0000082	3300047320	Bacteria	159422
1152	Ga0495672_0000103	3300047320	Bacteria	136164
1153	Ga0495672_0015255	3300047320	Bacteria	5223
1154	Ga0495676_0029329	3300047321	Bacteria	4686
1155	Ga0495680_0009104	3300047322	Bacteria	8960
1156	Ga0495680_0051022	3300047322	Bacteria	3232
1157	Ga0495680_0117724	3300047322	Bacteria	1964
1158	Ga0495683_0007236	3300047323	Bacteria	6023
1159	Ga0495683_0010211	3300047323	Bacteria	4972
1160	Ga0495683_0050331	3300047323	Bacteria	2085
1161	Ga0495683_0080402	3300047323	Bacteria	1591
1162	Ga0495687_000446	3300047443	Bacteria	50964
1163	Ga0495675_0006408	3300047444	Bacteria	7203
1164	Ga0495675_0006452	3300047444	Bacteria	7179
1165	Ga0495677_0020955	3300047445	Bacteria	2369
1166	Ga0495679_000059	3300047446	Bacteria	109922
1167	Ga0495679_004411	3300047446	Bacteria	6511
1168	Ga0495679_005815	3300047446	Bacteria	5426
1169	Ga0495685_000034	3300047447	Bacteria	56654
1170	Ga0495673_0000008	3300047469	Bacteria	752462
1171	Ga0495673_0000011	3300047469	Bacteria	674140
1172	Ga0495673_0000117	3300047469	Bacteria	148662
1173	Ga0495673_0021744	3300047469	Bacteria	3159
1174	Ga0495684_0069401	3300047471	Bacteria	2680
1175	Ga0495686_0000007	3300047472	Bacteria	732622
1176	Ga0495686_0000677	3300047472	Bacteria	46044
1177	Ga0495593_0002595	3300047673	Bacteria	10859
1178	Ga0495593_0074515	3300047673	Bacteria	1760
1179	Ga0495602_0011677	3300048088	Bacteria	9071
1180	Ga0495614_0034061	3300048089	Bacteria	2190
1181	Ga0495626_0003725	3300048091	Bacteria	9629
1182	Ga0495626_0009196	3300048091	Bacteria	5349
1183	Ga0495626_0016797	3300048091	Bacteria	3709
1184	Ga0495626_0018784	3300048091	Bacteria	3463
1185	Ga0495626_0020436	3300048091	Bacteria	3299
1186	Ga0495626_0038876	3300048091	Bacteria	2253
1187	Ga0496100_0096071	3300048903	Bacteria	2032
1188	Ga0496101_0000144	3300048904	Bacteria	63019
1189	Ga0496101_0007266	3300048904	Bacteria	7167
1190	Ga0496101_0036245	3300048904	Bacteria	3493
1191	Ga0496102_0003781	3300048905	Bacteria	12800
1192	Ga0496102_0004647	3300048905	Bacteria	11623
1193	Ga0496102_0018620	3300048905	Bacteria	6106
1194	Ga0496102_0022561	3300048905	Bacteria	5578
1195	Ga0496102_0049020	3300048905	Bacteria	3841
1196	Ga0496103_0004746	3300048906	Bacteria	8219
1197	Ga0496104_0000153	3300048907	Bacteria	63666
1198	Ga0496104_0001602	3300048907	Bacteria	19480
1199	Ga0496104_0004076	3300048907	Bacteria	12676
1200	Ga0496104_0235131	3300048907	Bacteria	1744
1201	Ga0496104_0253809	3300048907	Bacteria	1671
1202	Ga0496105_0002589	3300048908	Bacteria	13148
1203	Ga0496105_0118333	3300048908	Bacteria	2185
1204	Ga0496106_0000868	3300048909	Bacteria	21980
1205	Ga0496106_0013946	3300048909	Bacteria	5943
1206	Ga0496106_0049919	3300048909	Bacteria	3153
1207	Ga0496107_0002442	3300048910	Bacteria	12044
1208	Ga0496108_0001784	3300048911	Bacteria	17141
1209	Ga0496108_0124180	3300048911	Bacteria	2215
1210	Ga0496109_0001461	3300048912	Bacteria	19604
1211	Ga0496110_0000099	3300048913	Bacteria	46759
1212	Ga0496110_0006352	3300048913	Bacteria	9343
1213	Ga0496110_0192768	3300048913	Bacteria	1851
1214	Ga0496111_0024389	3300048914	Bacteria	4258
1215	Ga0496112_0044380	3300048915	Bacteria	4355
1216	Ga0496112_0127975	3300048915	Bacteria	2510
1217	Ga0496112_0192173	3300048915	Bacteria	2003
1218	Ga0496113_0005540	3300048916	Bacteria	7884
1219	Ga0496114_0006065	3300048917	Bacteria	9510
1220	Ga0496115_0008110	3300048918	Bacteria	7760
1221	Ga0496115_0030457	3300048918	Bacteria	4245
1222	Ga0496116_0000009	3300048919	Bacteria	716119
1223	Ga0496116_0000016	3300048919	Bacteria	555146
1224	Ga0496116_0000148	3300048919	Bacteria	142458
1225	Ga0496116_0000777	3300048919	Bacteria	40580
1226	Ga0496116_0001014	3300048919	Bacteria	34246
1227	Ga0496116_0002078	3300048919	Bacteria	21426
1228	Ga0496116_0002172	3300048919	Bacteria	20890
1229	Ga0496116_0003977	3300048919	Bacteria	14348
1230	Ga0496116_0009533	3300048919	Bacteria	8268
1231	Ga0496116_0034488	3300048919	Bacteria	3569
1232	Ga0496116_0137077	3300048919	Bacteria	1383
1233	Ga0496117_0000075	3300048920	Bacteria	232451
1234	Ga0496117_0000078	3300048920	Bacteria	227068
1235	Ga0496117_0000116	3300048920	Bacteria	178919
1236	Ga0496117_0002319	3300048920	Bacteria	24411
1237	Ga0496117_0005006	3300048920	Bacteria	14211
1238	Ga0496117_0005369	3300048920	Bacteria	13499
1239	Ga0496117_0005435	3300048920	Bacteria	13378
1240	Ga0496117_0011056	3300048920	Bacteria	8127
1241	Ga0496117_0021805	3300048920	Bacteria	5167
1242	Ga0496117_0044110	3300048920	Bacteria	3233
1243	Ga0496118_0000055	3300048921	Bacteria	232451
1244	Ga0496118_0000059	3300048921	Bacteria	226336
1245	Ga0496118_0004732	3300048921	Bacteria	15930
1246	Ga0496118_0004852	3300048921	Bacteria	15658
1247	Ga0496118_0007265	3300048921	Bacteria	11805
1248	Ga0496118_0007795	3300048921	Bacteria	11237
1249	Ga0496118_0014364	3300048921	Bacteria	7421
1250	Ga0496118_0034736	3300048921	Bacteria	4107
1251	Ga0496118_0053050	3300048921	Bacteria	3087
1252	Ga0496119_0000096	3300048922	Bacteria	129464
1253	Ga0496119_0000472	3300048922	Bacteria	54962
1254	Ga0496119_0000586	3300048922	Bacteria	49220
1255	Ga0496119_0002196	3300048922	Bacteria	21812
1256	Ga0496119_0002663	3300048922	Bacteria	19316
1257	Ga0496119_0003291	3300048922	Bacteria	16893
1258	Ga0496119_0006215	3300048922	Bacteria	11159
1259	Ga0496119_0007553	3300048922	Bacteria	9765
1260	Ga0496119_0008068	3300048922	Bacteria	9344
1261	Ga0496119_0009572	3300048922	Bacteria	8284
1262	Ga0496119_0011114	3300048922	Bacteria	7498
1263	Ga0496119_0020980	3300048922	Bacteria	4737
1264	Ga0496119_0021298	3300048922	Bacteria	4690
1265	Ga0496119_0029947	3300048922	Bacteria	3678
1266	Ga0496120_0000068	3300048923	Bacteria	166108
1267	Ga0496120_0000166	3300048923	Bacteria	111571
1268	Ga0496120_0000389	3300048923	Bacteria	70922
1269	Ga0496120_0000572	3300048923	Bacteria	56188
1270	Ga0496120_0000602	3300048923	Bacteria	54478
1271	Ga0496120_0001236	3300048923	Bacteria	32273
1272	Ga0496120_0001364	3300048923	Bacteria	29931
1273	Ga0496120_0001521	3300048923	Bacteria	27309
1274	Ga0496120_0007004	3300048923	Bacteria	8478
1275	Ga0496120_0018989	3300048923	Bacteria	4413
1276	Ga0496120_0038053	3300048923	Bacteria	2849
1277	Ga0496120_0045326	3300048923	Bacteria	2548
1278	Ga0496121_0000052	3300048924	Bacteria	313410
1279	Ga0496121_0003985	3300048924	Bacteria	20369
1280	Ga0496121_0007946	3300048924	Bacteria	12678
1281	Ga0496121_0010723	3300048924	Bacteria	10279
1282	Ga0496121_0015675	3300048924	Bacteria	7908
1283	Ga0496121_0039504	3300048924	Bacteria	4156
1284	Ga0496121_0069910	3300048924	Bacteria	2830
1285	Ga0496122_0000070	3300048925	Bacteria	223198
1286	Ga0496122_0000392	3300048925	Bacteria	93045
1287	Ga0496122_0002311	3300048925	Bacteria	27505
1288	Ga0496122_0003176	3300048925	Bacteria	21923
1289	Ga0496122_0003665	3300048925	Bacteria	19943
1290	Ga0496122_0006666	3300048925	Bacteria	13155
1291	Ga0496122_0008374	3300048925	Bacteria	11180
1292	Ga0496122_0022358	3300048925	Bacteria	5624
1293	Ga0496122_0029898	3300048925	Bacteria	4579
1294	Ga0496123_0000017	3300048926	Bacteria	415261
1295	Ga0496123_0000131	3300048926	Bacteria	153642
1296	Ga0496123_0001554	3300048926	Bacteria	31553
1297	Ga0496123_0001924	3300048926	Bacteria	27116
1298	Ga0496123_0002763	3300048926	Bacteria	20995
1299	Ga0496123_0004679	3300048926	Bacteria	14185
1300	Ga0496123_0006706	3300048926	Bacteria	11090
1301	Ga0496123_0008164	3300048926	Bacteria	9657
1302	Ga0496123_0009555	3300048926	Bacteria	8717
1303	Ga0496123_0009642	3300048926	Bacteria	8665
1304	Ga0496123_0011880	3300048926	Bacteria	7485
1305	Ga0496123_0038961	3300048926	Bacteria	3331
1306	Ga0496124_0000053	3300048927	Bacteria	252285
1307	Ga0496124_0000303	3300048927	Bacteria	91070
1308	Ga0496124_0000630	3300048927	Bacteria	58501
1309	Ga0496124_0001210	3300048927	Bacteria	39962
1310	Ga0496124_0001921	3300048927	Bacteria	28471
1311	Ga0496124_0002062	3300048927	Bacteria	27252
1312	Ga0496124_0003880	3300048927	Bacteria	17881
1313	Ga0496124_0008580	3300048927	Bacteria	10663
1314	Ga0496124_0009686	3300048927	Bacteria	9864
1315	Ga0496124_0012468	3300048927	Bacteria	8389
1316	Ga0496124_0033559	3300048927	Bacteria	4514
1317	Ga0496124_0042430	3300048927	Bacteria	3918
1318	Ga0496124_0057779	3300048927	Bacteria	3267
1319	Ga0496124_0063191	3300048927	Bacteria	3094
1320	Ga0496124_0114836	3300048927	Bacteria	2162
1321	Ga0496125_0000056	3300048928	Bacteria	271016
1322	Ga0496125_0000329	3300048928	Bacteria	91776
1323	Ga0496125_0002880	3300048928	Bacteria	21658
1324	Ga0496125_0008126	3300048928	Bacteria	11051
1325	Ga0496125_0008724	3300048928	Bacteria	10549
1326	Ga0496125_0013471	3300048928	Bacteria	8034
1327	Ga0496126_0000108	3300048929	Bacteria	197529
1328	Ga0496126_0000137	3300048929	Bacteria	167415
1329	Ga0496126_0000818	3300048929	Bacteria	55553
1330	Ga0496126_0011057	3300048929	Bacteria	9380
1331	Ga0496126_0017161	3300048929	Bacteria	7218
1332	Ga0496126_0098569	3300048929	Bacteria	2560
1333	Ga0501308_004035	3300049128	Bacteria	1393
1334	Ga0501309_005609	3300049129	Bacteria	1502
1335	Ga0501343_000423	3300049132	Bacteria	2438
1336	Ga0501345_00066	3300049134	Bacteria	2486
1337	Ga0501307_000574	3300049162	Bacteria	2611
1338	Ga0495678_000142	3300049459	Bacteria	86788
1339	Ga0495682_0000034	3300049460	Bacteria	131806
1340	Ga0501311_000575	3300049527	Bacteria	2660
1341	Ga0501311_001724	3300049527	Bacteria	1973
1342	Ga0501312_000565	3300049528	Bacteria	3094
1343	Ga0501312_001056	3300049528	Bacteria	2564
1344	Ga0501313_001870	3300049529	Bacteria	1919
1345	Ga0501313_002425	3300049529	Bacteria	1766
1346	Ga0501313_004826	3300049529	Bacteria	1400
1347	Ga0501315_005329	3300049531	Bacteria	1388
1348	Ga0501315_008958	3300049531	Bacteria	1174
1349	Ga0501316_000602	3300049532	Bacteria	2601
1350	Ga0501316_002359	3300049532	Bacteria	1741
1351	Ga0501317_000412	3300049533	Bacteria	2936
1352	Ga0501317_000550	3300049533	Bacteria	2732
1353	Ga0501318_000308	3300049534	Bacteria	2866
1354	Ga0501318_002942	3300049534	Bacteria	1521
1355	Ga0501320_001083	3300049536	Bacteria	1873
1356	Ga0501321_003214	3300049537	Bacteria	1480
1357	Ga0501321_004311	3300049537	Bacteria	1354
1358	Ga0501323_000694	3300049539	Bacteria	2628
1359	Ga0501323_000833	3300049539	Bacteria	2490
1360	Ga0501323_003121	3300049539	Bacteria	1670
1361	Ga0501324_002005	3300049540	Bacteria	1435
1362	Ga0501325_000169	3300049541	Bacteria	2540
1363	Ga0501333_002136	3300049549	Bacteria	1135
1364	Ga0501336_001303	3300049552	Bacteria	1464
1365	Ga0501340_000987	3300049556	Bacteria	1444
1366	Ga0501031_0086962	3300049568	Bacteria	2038
1367	Ga0501032_0002849	3300049569	Bacteria	13452
1368	Ga0501034_0000834	3300049571	Bacteria	45735
1369	Ga0501034_0008675	3300049571	Bacteria	10711
1370	Ga0501034_0089150	3300049571	Bacteria	3082
1371	Ga0501036_0015965	3300049572	Bacteria	6272
1372	Ga0501036_0074299	3300049572	Bacteria	2875
1373	Ga0501036_0085167	3300049572	Bacteria	2672
1374	Ga0501036_0210067	3300049572	Bacteria	1636
1375	Ga0501037_0027440	3300049573	Bacteria	4207
1376	Ga0501037_0044577	3300049573	Bacteria	3257
1377	Ga0501037_0050824	3300049573	Bacteria	3033
1378	Ga0501038_0004216	3300049574	Bacteria	13361
1379	Ga0501043_0018152	3300049579	Bacteria	5515
1380	Ga0501043_0042834	3300049579	Bacteria	3558
1381	Ga0501046_0044453	3300049580	Bacteria	3533
1382	Ga0501047_0002863	3300049581	Bacteria	16373
1383	Ga0501047_0003421	3300049581	Bacteria	15008
1384	Ga0501047_0063211	3300049581	Bacteria	3571
1385	Ga0501067_0001663	3300049583	Bacteria	12207
1386	Ga0501067_0001711	3300049583	Bacteria	12078
1387	Ga0501067_0005145	3300049583	Bacteria	7270
1388	Ga0501067_0095323	3300049583	Bacteria	1652
1389	Ga0501068_0000553	3300049584	Bacteria	18999
1390	Ga0501068_0001734	3300049584	Bacteria	11588
1391	Ga0501068_0048493	3300049584	Bacteria	2564
1392	Ga0501069_0006092	3300049585	Bacteria	6296
1393	Ga0501069_0010089	3300049585	Bacteria	4995
1394	Ga0501069_0025027	3300049585	Bacteria	3260
1395	Ga0501070_0001740	3300049586	Bacteria	19247
1396	Ga0501070_0027174	3300049586	Bacteria	4800
1397	Ga0501071_0045724	3300049587	Bacteria	3143
1398	Ga0501071_0094628	3300049587	Bacteria	2198
1399	Ga0501072_0001185	3300049588	Bacteria	19419
1400	Ga0501072_0007377	3300049588	Bacteria	8342
1401	Ga0501072_0049125	3300049588	Bacteria	3321
1402	Ga0501073_0000018	3300049589	Bacteria	155244
1403	Ga0501073_0003124	3300049589	Bacteria	12414
1404	Ga0501074_0043327	3300049590	Bacteria	3257
1405	Ga0501074_0063045	3300049590	Bacteria	2670
1406	Ga0501075_0017270	3300049591	Bacteria	5211
1407	Ga0501075_0185012	3300049591	Bacteria	1589
1408	Ga0501076_0011894	3300049592	Bacteria	6499
1409	Ga0501076_0031092	3300049592	Bacteria	4162
1410	Ga0501077_0000054	3300049593	Bacteria	58519
1411	Ga0501077_0006849	3300049593	Bacteria	7012
1412	Ga0501217_010121	3300049661	Bacteria	2061
1413	Ga0501217_014008	3300049661	Bacteria	1806
1414	Ga0501217_031520	3300049661	Bacteria	1307
1415	Ga0501249_002747	3300049679	Bacteria	3545
1416	Ga0501257_006745	3300049686	Bacteria	2554
1417	Ga0501079_0067363	3300049741	Bacteria	2763
1418	Ga0501080_0000837	3300049742	Bacteria	25129
1419	Ga0501080_0003035	3300049742	Bacteria	14813
1420	Ga0501080_0003344	3300049742	Bacteria	14161
1421	Ga0501080_0028296	3300049742	Bacteria	5213
1422	Ga0501080_0037384	3300049742	Bacteria	4534
1423	Ga0501083_0019491	3300049744	Bacteria	4726
1424	Ga0501083_0041033	3300049744	Bacteria	3140
1425	Ga0501263_000864	3300049760	Bacteria	2594
1426	Ga0501268_002763	3300049765	Bacteria	2339
1427	Ga0501270_001433	3300049767	Bacteria	2276
1428	Ga0501035_0101120	3300049822	Bacteria	2530
1429	Ga0501044_0009988	3300049823	Bacteria	10311
1430	Ga0501045_0015600	3300049824	Bacteria	5391
1431	nmdc:mga00v17_18473_c1	3300050491	Bacteria	3962
1432	nmdc:mga00v17_5577_c1	3300050491	Bacteria	6634
1433	nmdc:mga00v17_98342_c1	3300050491	Bacteria	1845
1434	nmdc:mga0yw44_1218_c1	3300050492	Bacteria	10086
1435	nmdc:mga0k408_7203_c2	3300050493	Bacteria	5655
1436	nmdc:mga0k408_730_c1	3300050493	Bacteria	18036
1437	nmdc:mga05p37_12448_c1	3300050507	Bacteria	10160
1438	nmdc:mga05p37_1255_c1	3300050507	Bacteria	29442
1439	nmdc:mga05p37_279888_c1	3300050507	Bacteria	1990
1440	nmdc:mga09592_109_c1	3300050508	Bacteria	51482
1441	nmdc:mga09592_9786_c1	3300050508	Bacteria	7790
1442	nmdc:mga0qj67_34404_c1	3300050509	Bacteria	3958
1443	nmdc:mga06r32_116159_c1	3300050510	Bacteria	2636
1444	nmdc:mga06r32_214873_c1	3300050510	Bacteria	1911
1445	nmdc:mga06r32_96142_c1	3300050510	Bacteria	2900
1446	nmdc:mga08y16_10683_c1	3300050511	Bacteria	9636
1447	nmdc:mga08y16_33362_c1	3300050511	Bacteria	5406
1448	nmdc:mga08y16_38382_c1	3300050511	Bacteria	5029
1449	nmdc:mga08y16_54762_c1	3300050511	Bacteria	4168
1450	nmdc:mga0n895_10218_c1	3300050512	Bacteria	8269
1451	nmdc:mga0n895_143589_c1	3300050512	Bacteria	2416
1452	nmdc:mga0n895_4133_c1	3300050512	Bacteria	11835
1453	nmdc:mga0rr50_119153_c1	3300050513	Bacteria	2098
1454	nmdc:mga0rr50_3207_c1	3300050513	Bacteria	9364
1455	nmdc:mga0rr50_45114_c1	3300050513	Bacteria	3237
1456	nmdc:mga0rr50_46_c1	3300050513	Bacteria	74452
1457	nmdc:mga08x19_3757_c1	3300050514	Bacteria	9036
1458	nmdc:mga08x19_3_c1	3300050514	Bacteria	654433
1459	nmdc:mga08x19_7409_c1	3300050514	Bacteria	6516
1460	nmdc:mga0a205_21279_c1	3300050515	Bacteria	6134
1461	nmdc:mga0a205_230346_c1	3300050515	Bacteria	1736
1462	nmdc:mga0a205_3348_c1	3300050515	Bacteria	14276
1463	nmdc:mga0a205_38550_c1	3300050515	Bacteria	4597
1464	nmdc:mga0a205_90234_c2	3300050515	Bacteria	2126
1465	Ga0495595_0014513	3300053084	Bacteria	3344
1466	Ga0495595_0105105	3300053084	Bacteria	1365
1467	Ga0495619_0013078	3300053085	Bacteria	5230
1468	Ga0495619_0018284	3300053085	Bacteria	4448
1469	Ga0495619_0081181	3300053085	Bacteria	2183
1470	Ga0500555_000015	3300053103	Bacteria	230204
1471	Ga0500595_003588	3300053119	Bacteria	7206
1472	Ga0500595_008076	3300053119	Bacteria	4318
1473	Ga0500621_000010	3300053126	Bacteria	169537
1474	Ga0500568_0016663	3300053139	Unclassified	3260
1475	Ga0500616_0000534	3300053153	Bacteria	47584
1476	Ga0500616_0024317	3300053153	Bacteria	3368
1477	Ga0501084_0000222	3300054114	Bacteria	43472
1478	Ga0501084_0134049	3300054114	Bacteria	2085
1479	Ga0501084_0136752	3300054114	Bacteria	2063
1480	Ga0587068_000188	3300059641	Bacteria	4690
1481	Ga0501082_0000576	3300060353	Bacteria	32598
1482	Ga0501082_0111588	3300060353	Bacteria	2367
1483	Ga0530510_0008739	3300061734	Bacteria	7084
1484	Ga0530510_0019308	3300061734	Bacteria	4837
1485	Ga0530510_0036730	3300061734	Bacteria	3531

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300049549	Ga0501333_002136	Ga0501333_002136_43_1119	342
2	3300046557	Ga0495622_0128741	Ga0495622_0128741_20_1138	352
3	3300049661	Ga0501217_031520	Ga0501217_031520_25_1143	352
4	3300049531	Ga0501315_008958	Ga0501315_008958_30_1160	356
5	3300044673	Ga0453683_0080313	Ga0453683_0080313_20_1255	360
6	3300025938	Ga0207704_10072447	Ga0207704_100724472	365
7	iso_pu_bacteria	2898907183	2898910932	372
8	3300005295	Ga0065707_10000935	Ga0065707_100009353	374
9	3300005441	Ga0070700_100006579	Ga0070700_1000065795	374
10	3300005546	Ga0070696_100065239	Ga0070696_1000652392	374
11	3300009094	Ga0111539_10182405	Ga0111539_101824052	374
12	3300009553	Ga0105249_10121750	Ga0105249_101217503	374
13	3300014326	Ga0157380_10002195	Ga0157380_100021957	374
14	3300050511	nmdc:mga08y16_38382_c1	nmdc:mga08y16_38382_c1_3648_4865	374
15	3300005289	Ga0065704_10014520	Ga0065704_100145202	377
16	3300046463	Ga0495653_0178405	Ga0495653_0178405_281_1450	379
17	3300048915	Ga0496112_0044380	Ga0496112_0044380_3172_4338	379
18	3300048927	Ga0496124_0063191	Ga0496124_0063191_23_1174	382
19	3300049590	Ga0501074_0043327	Ga0501074_0043327_1403_2650	382
20	3300049591	Ga0501075_0185012	Ga0501075_0185012_238_1485	382
21	3300049741	Ga0501079_0067363	Ga0501079_0067363_974_2221	382
22	3300060353	Ga0501082_0111588	Ga0501082_0111588_317_1564	382
23	3300005545	Ga0070695_100017589	Ga0070695_1000175893	384
24	3300005843	Ga0068860_100038049	Ga0068860_1000380492	384
25	3300009553	Ga0105249_10002104	Ga0105249_100021042	384
26	3300025942	Ga0207689_10004920	Ga0207689_100049206	384
27	3300047317	Ga0495604_0251190	Ga0495604_0251190_25_1194	386
28	3300005545	Ga0070695_100016534	Ga0070695_1000165346	387
29	3300005334	Ga0068869_100144901	Ga0068869_1001449011	388
30	3300005338	Ga0068868_100094301	Ga0068868_1000943012	388
31	3300005340	Ga0070689_100029237	Ga0070689_1000292373	388
32	3300005353	Ga0070669_100090666	Ga0070669_1000906662	388
33	3300005364	Ga0070673_100004490	Ga0070673_1000044908	388
34	3300005365	Ga0070688_100040205	Ga0070688_1000402053	388
35	3300005367	Ga0070667_100034620	Ga0070667_1000346202	388
36	3300005444	Ga0070694_100000458	Ga0070694_1000004589	388
37	3300005445	Ga0070708_100000257	Ga0070708_10000025730	388
38	3300005445	Ga0070708_100086571	Ga0070708_1000865712	388
39	3300005456	Ga0070678_100020120	Ga0070678_1000201203	388
40	3300005466	Ga0070685_10016511	Ga0070685_100165113	388
41	3300005467	Ga0070706_100027588	Ga0070706_1000275884	388
42	3300005467	Ga0070706_100118972	Ga0070706_1001189723	388
43	3300005468	Ga0070707_100167034	Ga0070707_1001670343	388
44	3300005468	Ga0070707_100180663	Ga0070707_1001806632	388
45	3300005471	Ga0070698_100001167	Ga0070698_10000116722	388
46	3300005471	Ga0070698_100078733	Ga0070698_1000787333	388
47	3300005518	Ga0070699_100000196	Ga0070699_10000019642	388
48	3300005518	Ga0070699_100023593	Ga0070699_1000235935	388
49	3300005536	Ga0070697_100023565	Ga0070697_1000235653	388
50	3300005536	Ga0070697_100044150	Ga0070697_1000441504	388
51	3300005544	Ga0070686_100044598	Ga0070686_1000445982	388
52	3300005549	Ga0070704_100002175	Ga0070704_1000021757	388
53	3300005615	Ga0070702_100002112	Ga0070702_1000021127	388
54	3300005841	Ga0068863_100030000	Ga0068863_1000300002	388
55	3300005844	Ga0068862_100012174	Ga0068862_1000121743	388
56	3300005844	Ga0068862_100168846	Ga0068862_1001688462	388
57	3300006358	Ga0068871_100023948	Ga0068871_1000239483	388
58	3300006880	Ga0075429_100012076	Ga0075429_1000120762	388
59	3300006881	Ga0068865_100028941	Ga0068865_1000289413	388
60	3300009148	Ga0105243_10016277	Ga0105243_100162774	388
61	3300009176	Ga0105242_10004935	Ga0105242_100049356	388
62	3300009177	Ga0105248_10045161	Ga0105248_100451614	388
63	3300010375	Ga0105239_10063579	Ga0105239_100635791	388
64	3300013296	Ga0157374_10028018	Ga0157374_100280183	388
65	3300013297	Ga0157378_10011775	Ga0157378_100117756	388
66	3300013307	Ga0157372_10311406	Ga0157372_103114062	388
67	3300013308	Ga0157375_10090316	Ga0157375_100903162	388
68	3300014745	Ga0157377_10030176	Ga0157377_100301762	388
69	3300014969	Ga0157376_10011646	Ga0157376_100116463	388
70	3300017792	Ga0163161_10030011	Ga0163161_100300112	388
71	3300025908	Ga0207643_10006590	Ga0207643_100065904	388
72	3300025922	Ga0207646_10016367	Ga0207646_100163673	388
73	3300025922	Ga0207646_10017594	Ga0207646_100175946	388
74	3300025923	Ga0207681_10115289	Ga0207681_101152891	388
75	3300025927	Ga0207687_10200391	Ga0207687_102003911	388
76	3300025934	Ga0207686_10000013	Ga0207686_1000001327	388
77	3300025935	Ga0207709_10000009	Ga0207709_10000009351	388
78	3300025938	Ga0207704_10018979	Ga0207704_100189792	388
79	3300025940	Ga0207691_10012609	Ga0207691_100126097	388
80	3300025941	Ga0207711_10088878	Ga0207711_100888782	388
81	3300025942	Ga0207689_10008514	Ga0207689_100085149	388
82	3300025945	Ga0207679_10090635	Ga0207679_100906353	388
83	3300026089	Ga0207648_10026587	Ga0207648_100265873	388
84	3300026118	Ga0207675_100051301	Ga0207675_1000513014	388
85	3300026121	Ga0207683_10022597	Ga0207683_100225976	388
86	3300026142	Ga0207698_10043435	Ga0207698_100434352	388
87	3300046535	Ga0495586_0090732	Ga0495586_0090732_12_1190	388
88	3300005518	Ga0070699_100014485	Ga0070699_1000144858	389
89	3300005617	Ga0068859_100107933	Ga0068859_1001079333	389
90	3300006931	Ga0097620_100107935	Ga0097620_1001079353	389
91	3300037312	Ga0395899_0112413	Ga0395899_0112413_663_1904	389
92	3300027665	Ga0209983_1001331	Ga0209983_10013314	391
93	3300027682	Ga0209971_1001657	Ga0209971_10016574	391
94	3300027876	Ga0209974_10010197	Ga0209974_100101972	391
95	3300014326	Ga0157380_10001368	Ga0157380_100013685	395
96	3300049572	Ga0501036_0210067	Ga0501036_0210067_14_1303	395
97	3300049587	Ga0501071_0045724	Ga0501071_0045724_781_2070	395
98	3300049592	Ga0501076_0031092	Ga0501076_0031092_2766_4055	395
99	3300061734	Ga0530510_0019308	Ga0530510_0019308_1057_2346	395
100	3300005456	Ga0070678_100109325	Ga0070678_1001093252	397
101	3300014326	Ga0157380_10003353	Ga0157380_100033532	397
102	3300026121	Ga0207683_10142538	Ga0207683_101425382	397
103	3300001432	JGI24034J14986_100622	JGI24034J14986_1006222	398
104	3300002074	JGI24748J21848_1000017	JGI24748J21848_100001732	398
105	3300002239	JGI24034J26672_10000017	JGI24034J26672_1000001779	398
106	3300005355	Ga0070671_100015474	Ga0070671_1000154743	398
107	3300005842	Ga0068858_100000314	Ga0068858_10000031427	398
108	3300009101	Ga0105247_10000135	Ga0105247_1000013531	398
109	3300025900	Ga0207710_10000002	Ga0207710_100000021037	398
110	3300025931	Ga0207644_10052930	Ga0207644_100529302	398
111	3300026035	Ga0207703_10000120	Ga0207703_1000012032	398
112	3300028016	Ga0265354_1000933	Ga0265354_10009332	398
113	3300030878	Ga0265770_1000581	Ga0265770_10005813	398
114	3300031090	Ga0265760_10001163	Ga0265760_100011634	398
115	3300006881	Ga0068865_100077379	Ga0068865_1000773792	401
116	3300049573	Ga0501037_0027440	Ga0501037_0027440_2629_3849	401
117	3300049574	Ga0501038_0004216	Ga0501038_0004216_10193_11413	401
118	3300049579	Ga0501043_0018152	Ga0501043_0018152_2866_4086	401
119	3300049581	Ga0501047_0002863	Ga0501047_0002863_13555_14775	401
120	3300049583	Ga0501067_0005145	Ga0501067_0005145_3184_4404	401
121	3300049584	Ga0501068_0000553	Ga0501068_0000553_13548_14768	401
122	3300049585	Ga0501069_0010089	Ga0501069_0010089_933_2153	401
123	3300049588	Ga0501072_0001185	Ga0501072_0001185_13947_15167	401
124	3300049592	Ga0501076_0011894	Ga0501076_0011894_1645_2865	401
125	3300049593	Ga0501077_0006849	Ga0501077_0006849_1540_2760	401
126	3300049742	Ga0501080_0037384	Ga0501080_0037384_1223_2443	401
127	3300049744	Ga0501083_0019491	Ga0501083_0019491_2285_3505	401
128	3300054114	Ga0501084_0000222	Ga0501084_0000222_30223_31443	401
129	3300060353	Ga0501082_0000576	Ga0501082_0000576_17814_19034	401
130	3300061734	Ga0530510_0008739	Ga0530510_0008739_4272_5492	401
131	3300005353	Ga0070669_100002341	Ga0070669_1000023418	402
132	3300005719	Ga0068861_100002524	Ga0068861_1000025246	402
133	3300025961	Ga0207712_10036903	Ga0207712_100369032	402
134	3300026075	Ga0207708_10003250	Ga0207708_100032502	402
135	3300026118	Ga0207675_100011099	Ga0207675_1000110996	402
136	3300028380	Ga0268265_10092033	Ga0268265_100920333	402
137	3300009101	Ga0105247_10052448	Ga0105247_100524482	403
138	3300005471	Ga0070698_100038316	Ga0070698_1000383163	404
139	3300031548	Ga0307408_100009658	Ga0307408_1000096585	404
140	3300031731	Ga0307405_10003993	Ga0307405_100039933	404
141	3300031824	Ga0307413_10000170	Ga0307413_1000017012	404
142	3300031852	Ga0307410_10002450	Ga0307410_100024505	404
143	3300031903	Ga0307407_10000350	Ga0307407_1000035011	404
144	3300031911	Ga0307412_10006755	Ga0307412_100067555	404
145	3300031995	Ga0307409_100051588	Ga0307409_1000515882	404
146	3300032002	Ga0307416_100010524	Ga0307416_1000105244	404
147	3300032002	Ga0307416_100265758	Ga0307416_1002657581	404
148	3300032126	Ga0307415_100001283	Ga0307415_1000012837	404
149	3300038727	Ga0400491_14422	Ga0400491_14422_2540_3793	404
150	3300038735	Ga0400485_21204	Ga0400485_21204_27644_28897	404
151	3300038741	Ga0400488_39081	Ga0400488_39081_52_1305	404
152	3300038742	Ga0400486_32414	Ga0400486_32414_31686_32939	404
153	3300039093	Ga0400489_53776	Ga0400489_53776_837_2090	404
154	3300039110	Ga0400487_11212	Ga0400487_11212_8761_10014	404
155	3300005546	Ga0070696_100026124	Ga0070696_1000261244	405
156	3300021384	Ga0213876_10000323	Ga0213876_1000032313	406
157	3300035086	Ga0373934_0001039	Ga0373934_0001039_6250_7500	406
158	3300035118	Ga0373954_0000314	Ga0373954_0000314_13710_14960	406
159	3300035119	Ga0373956_0000836	Ga0373956_0000836_7787_9037	406
160	3300035120	Ga0373957_0000721	Ga0373957_0000721_4929_6179	406
161	3300035172	Ga0373955_0002966	Ga0373955_0002966_3917_5167	406
162	3300035724	Ga0373933_0003914	Ga0373933_0003914_2672_3922	406
163	3300036401	Ga0373937_0124832	Ga0373937_0124832_164_1420	406
164	3300046462	Ga0495651_0057721	Ga0495651_0057721_1564_2814	406
165	3300046473	Ga0495582_0003535	Ga0495582_0003535_2009_3265	406
166	3300046511	Ga0495608_0058474	Ga0495608_0058474_1272_2522	406
167	3300046536	Ga0495587_0001378	Ga0495587_0001378_10098_11348	406
168	3300046663	Ga0495635_0103274	Ga0495635_0103274_376_1626	406
169	3300046683	Ga0495658_0011548	Ga0495658_0011548_3006_4262	406
170	3300047317	Ga0495604_0002655	Ga0495604_0002655_2625_3875	406
171	3300048088	Ga0495602_0011677	Ga0495602_0011677_4577_5827	406
172	3300053085	Ga0495619_0081181	Ga0495619_0081181_97_1347	406
173	3300005334	Ga0068869_100004657	Ga0068869_1000046575	407
174	3300025942	Ga0207689_10004558	Ga0207689_100045588	407
175	3300028016	Ga0265354_1000013	Ga0265354_10000135	407
176	3300030878	Ga0265770_1000010	Ga0265770_100001013	407
177	3300031090	Ga0265760_10003760	Ga0265760_100037602	407
178	3300045051	Ga0451576_0000155	Ga0451576_0000155_7047_8303	408
179	3300045051	Ga0451576_0000477	Ga0451576_0000477_33046_34302	408
180	3300046539	Ga0495621_0023584	Ga0495621_0023584_129_1364	408
181	3300049572	Ga0501036_0074299	Ga0501036_0074299_276_1508	408
182	3300005347	Ga0070668_100083878	Ga0070668_1000838783	410
183	3300005445	Ga0070708_100166789	Ga0070708_1001667893	410
184	3300005467	Ga0070706_100191959	Ga0070706_1001919593	410
185	3300005518	Ga0070699_100090105	Ga0070699_1000901053	410
186	3300007076	Ga0075435_100055514	Ga0075435_1000555143	410
187	3300009147	Ga0114129_10044191	Ga0114129_100441916	410
188	3300017792	Ga0163161_10000529	Ga0163161_100005296	410
189	3300025910	Ga0207684_10022185	Ga0207684_100221855	410
190	3300025922	Ga0207646_10011718	Ga0207646_100117183	410
191	3300039437	Ga0436365_0671013	Ga0436365_0671013_195_1448	410
192	3300050507	nmdc:mga05p37_279888_c1	nmdc:mga05p37_279888_c1_451_1698	410
193	3300050513	nmdc:mga0rr50_119153_c1	nmdc:mga0rr50_119153_c1_293_1540	410
194	iso_pu_bacteria	2671180330	2672338627	410
195	iso_pu_bacteria	2816332186	2816865447	410
196	iso_pu_bacteria	2842682962	2842686606	410
197	iso_pu_bacteria	2849139964	2849142892	410
198	iso_pu_bacteria	2857581216	2857583236	410
199	iso_pu_bacteria	2881609920	2881611329	410
200	iso_pu_bacteria	2915597211	2915597811	410
201	iso_pu_bacteria	2990275345	2990280410	410
202	3300005439	Ga0070711_100050894	Ga0070711_1000508942	411
203	3300005471	Ga0070698_100001118	Ga0070698_10000111821	411
204	3300005842	Ga0068858_100247716	Ga0068858_1002477161	411
205	3300006028	Ga0070717_10037330	Ga0070717_100373304	411
206	3300006175	Ga0070712_100023479	Ga0070712_1000234793	411
207	3300009553	Ga0105249_10032694	Ga0105249_100326942	411
208	3300013297	Ga0157378_10143776	Ga0157378_101437762	411
209	3300013306	Ga0163162_10071275	Ga0163162_100712754	411
210	3300013307	Ga0157372_10083350	Ga0157372_100833502	411
211	3300013308	Ga0157375_10104931	Ga0157375_101049312	411
212	3300014325	Ga0163163_10057289	Ga0163163_100572893	411
213	3300014325	Ga0163163_10160729	Ga0163163_101607292	411
214	3300025915	Ga0207693_10119528	Ga0207693_101195282	411
215	3300025916	Ga0207663_10024247	Ga0207663_100242472	411
216	3300025925	Ga0207650_10087712	Ga0207650_100877122	411
217	3300026089	Ga0207648_10051052	Ga0207648_100510523	411
218	3300026095	Ga0207676_10102031	Ga0207676_101020313	411
219	3300031241	Ga0265325_10015326	Ga0265325_100153263	411
220	3300035111	Ga0373923_0082371	Ga0373923_0082371_123_1379	411
221	3300036401	Ga0373937_0029645	Ga0373937_0029645_1384_2640	411
222	3300037068	Ga0373925_0165285	Ga0373925_0165285_411_1667	411
223	3300037471	Ga0395905_0030775	Ga0395905_0030775_2493_3803	411
224	3300042876	Ga0451577_0113705	Ga0451577_0113705_933_2183	411
225	3300044673	Ga0453683_0007140	Ga0453683_0007140_150_1400	411
226	3300044712	Ga0453684_0000645	Ga0453684_0000645_109068_110318	411
227	3300045051	Ga0451576_0000602	Ga0451576_0000602_58793_60043	411
228	3300046537	Ga0495598_0001591	Ga0495598_0001591_2040_3341	411
229	3300049588	Ga0501072_0007377	Ga0501072_0007377_1100_2392	411
230	iso_pu_bacteria	2510917027	2511176961	411
231	iso_pu_bacteria	2512564013	2512638165	411
232	iso_pu_bacteria	2526164512	2526211260	411
233	iso_pu_bacteria	2551306519	2553395863	411
234	iso_pu_bacteria	2574179768	2574430170	411
235	iso_pu_bacteria	2593339131	2595091845	411
236	iso_pu_bacteria	2600255292	2601666861	411
237	iso_pu_bacteria	2643221729	2644707153	411
238	iso_pu_bacteria	2643221730	2644714108	411
239	iso_pu_bacteria	2643221731	2644720428	411
240	iso_pu_bacteria	2643221732	2644726487	411
241	iso_pu_bacteria	2684622632	2685153245	411
242	iso_pu_bacteria	2695420987	2698319949	411
243	iso_pu_bacteria	2703719227	2705997162	411
244	iso_pu_bacteria	2718218445	2721508406	411
245	iso_pu_bacteria	2738541295	2738813697	411
246	iso_pu_bacteria	2738541358	2739156948	411
247	iso_pu_bacteria	2738543006	2739209302	411
248	iso_pu_bacteria	2738543017	2739269468	411
249	iso_pu_bacteria	2744054657	2745166005	411
250	iso_pu_bacteria	2757320391	2757567065	411
251	iso_pu_bacteria	2775507177	2777762749	411
252	iso_pu_bacteria	2775507192	2777837472	411
253	iso_pu_bacteria	2816332336	2817620796	411
254	iso_pu_bacteria	2818991443	2819582277	411
255	iso_pu_bacteria	2818991465	2819711071	411
256	iso_pu_bacteria	2831905167	2831908188	411
257	iso_pu_bacteria	2842882022	2842886369	411
258	iso_pu_bacteria	2857460504	2857460743	411
259	iso_pu_bacteria	2857465823	2857471268	411
260	iso_pu_bacteria	2857547612	2857552746	411
261	iso_pu_bacteria	2857586860	2857588907	411
262	iso_pu_bacteria	2857591370	2857597383	411
263	iso_pu_bacteria	2891633521	2891635485	411
264	iso_pu_bacteria	2904524088	2904528782	411
265	iso_pu_bacteria	2915606848	2915610606	411
266	iso_pu_bacteria	2919143609	2919148412	411
267	iso_pu_bacteria	2919517244	2919521820	411
268	iso_pu_bacteria	2919720352	2919724950	411
269	iso_pu_bacteria	2928093941	2928098243	411
270	iso_pu_bacteria	2929004312	2929007677	411
271	iso_pu_bacteria	2929183550	2929189320	411
272	iso_pu_bacteria	2929233124	2929238956	411
273	iso_pu_bacteria	2932410948	2932415683	411
274	iso_pu_bacteria	2932416698	2932421673	411
275	iso_pu_bacteria	2936340661	2936344545	411
276	iso_pu_bacteria	2938917290	2938923179	411
277	iso_pu_bacteria	2947426588	2947432048	411
278	iso_pu_bacteria	2956897341	2956902558	411
279	iso_pu_bacteria	2960319331	2960321350	411
280	iso_pu_bacteria	2960375949	2960378618	411
281	iso_pu_bacteria	2964375228	2964375344	411
282	iso_pu_bacteria	2965761152	2965766576	411
283	iso_pu_bacteria	2977254563	2977255078	411
284	iso_pu_bacteria	2979083700	2979088939	411
285	iso_pu_bacteria	2990275345	2990276056	411
286	iso_pu_bacteria	3001892409	3001894537	411
287	iso_pu_bacteria	3006973921	3006978052	411
288	iso_pu_bacteria	639633007	639785933	411
289	iso_pu_bacteria	8007375930	8007378327	411
290	iso_pu_bacteria	8022621104	8022626761	411
291	iso_pu_bacteria	8022792930	8022798908	411
292	iso_pu_bacteria	8022893055	8022894399	411
293	iso_pu_bacteria	8022914991	8022918489	411
294	iso_pu_bacteria	8022948649	8022953462	411
295	iso_pu_bacteria	8023438354	8023441427	411
296	iso_pu_bacteria	8023444577	8023448948	411
297	iso_pu_bacteria	8057582654	8057587707	411
298	3300005330	Ga0070690_100000449	Ga0070690_10000044913	412
299	3300021384	Ga0213876_10082477	Ga0213876_100824772	412
300	3300039437	Ga0436365_0722093	Ga0436365_0722093_6113_7372	412
301	3300039450	Ga0436363_0653605	Ga0436363_0653605_1415_2674	412
302	3300044712	Ga0453684_0017545	Ga0453684_0017545_722_1984	412
303	iso_pu_bacteria	2545555834	2545676814	412
304	iso_pu_bacteria	2595698237	2596377255	412
305	iso_pu_bacteria	2738543032	2739354174	412
306	iso_pu_bacteria	2829745981	2829748771	412
307	iso_pu_bacteria	2861691609	2861691966	412
308	iso_pu_bacteria	2881714928	2881715860	412
309	iso_pu_bacteria	2902330777	2902335122	412
310	iso_pu_bacteria	2902405164	2902410631	412
311	iso_pu_bacteria	2928125067	2928127705	412
312	iso_pu_bacteria	3003665799	3003669811	412
313	iso_pu_bacteria	641522639	641642855	412
314	iso_pu_bacteria	643348564	643602570	412
315	3300005343	Ga0070687_100027951	Ga0070687_1000279512	413
316	3300005444	Ga0070694_100022166	Ga0070694_1000221662	413
317	3300005444	Ga0070694_100089437	Ga0070694_1000894372	413
318	3300005471	Ga0070698_100029924	Ga0070698_1000299244	413
319	3300005545	Ga0070695_100006828	Ga0070695_1000068284	413
320	3300005545	Ga0070695_100007191	Ga0070695_1000071914	413
321	3300005546	Ga0070696_100165850	Ga0070696_1001658502	413
322	3300005549	Ga0070704_100001376	Ga0070704_10000137610	413
323	3300005617	Ga0068859_100007534	Ga0068859_10000753414	413
324	3300005844	Ga0068862_100156614	Ga0068862_1001566142	413
325	3300006847	Ga0075431_100035093	Ga0075431_1000350935	413
326	3300006847	Ga0075431_100043576	Ga0075431_1000435764	413
327	3300006880	Ga0075429_100000100	Ga0075429_10000010051	413
328	3300006931	Ga0097620_100007535	Ga0097620_10000753514	413
329	3300009147	Ga0114129_10023948	Ga0114129_100239488	413
330	3300009553	Ga0105249_10024734	Ga0105249_100247344	413
331	3300013105	Ga0157369_10016447	Ga0157369_100164473	413
332	3300025294	Ga0209025_1004118	Ga0209025_100411812	413
333	3300028380	Ga0268265_10141358	Ga0268265_101413582	413
334	3300035691	Ga0373931_0056980	Ga0373931_0056980_114_1364	413
335	3300036401	Ga0373937_0060602	Ga0373937_0060602_1143_2393	413
336	3300042876	Ga0451577_0000094	Ga0451577_0000094_83804_85072	413
337	3300044712	Ga0453684_0000011	Ga0453684_0000011_114958_116226	413
338	3300049568	Ga0501031_0086962	Ga0501031_0086962_77_1378	413
339	3300049571	Ga0501034_0089150	Ga0501034_0089150_1171_2472	413
340	3300050507	nmdc:mga05p37_1255_c1	nmdc:mga05p37_1255_c1_14311_15561	413
341	3300050508	nmdc:mga09592_109_c1	nmdc:mga09592_109_c1_7952_9202	413
342	3300050510	nmdc:mga06r32_116159_c1	nmdc:mga06r32_116159_c1_901_2151	413
343	3300050510	nmdc:mga06r32_214873_c1	nmdc:mga06r32_214873_c1_206_1456	413
344	3300050511	nmdc:mga08y16_54762_c1	nmdc:mga08y16_54762_c1_1713_2963	413
345	3300050515	nmdc:mga0a205_90234_c2	nmdc:mga0a205_90234_c2_178_1428	413
346	iso_pu_bacteria	2501025502	2501084063	413
347	iso_pu_bacteria	2510917013	2511093382	413
348	iso_pu_bacteria	2513237082	2513556091	413
349	iso_pu_bacteria	2513237083	2513564277	413
350	iso_pu_bacteria	2515154189	2516022284	413
351	iso_pu_bacteria	2600255067	2600813851	413
352	iso_pu_bacteria	2889306138	2889308484	413
353	iso_pu_bacteria	8003955200	8003956769	413
354	iso_pu_bacteria	8054357960	8054358707	413
355	3300005340	Ga0070689_100003280	Ga0070689_1000032803	414
356	3300005340	Ga0070689_100020693	Ga0070689_1000206936	414
357	3300005343	Ga0070687_100040964	Ga0070687_1000409642	414
358	3300005365	Ga0070688_100000462	Ga0070688_1000004623	414
359	3300005365	Ga0070688_100000827	Ga0070688_1000008279	414
360	3300005434	Ga0070709_10098729	Ga0070709_100987291	414
361	3300005438	Ga0070701_10086460	Ga0070701_100864601	414
362	3300005440	Ga0070705_100037936	Ga0070705_1000379363	414
363	3300005440	Ga0070705_100127114	Ga0070705_1001271141	414
364	3300005441	Ga0070700_100045717	Ga0070700_1000457173	414
365	3300005444	Ga0070694_100004705	Ga0070694_1000047054	414
366	3300005444	Ga0070694_100011037	Ga0070694_1000110372	414
367	3300005466	Ga0070685_10002584	Ga0070685_100025842	414
368	3300005471	Ga0070698_100031318	Ga0070698_1000313184	414
369	3300005544	Ga0070686_100047354	Ga0070686_1000473543	414
370	3300005844	Ga0068862_100061431	Ga0068862_1000614313	414
371	3300006173	Ga0070716_100087893	Ga0070716_1000878931	414
372	3300006852	Ga0075433_10000098	Ga0075433_1000009812	414
373	3300006871	Ga0075434_100000754	Ga0075434_10000075418	414
374	3300006871	Ga0075434_100057548	Ga0075434_1000575482	414
375	3300006871	Ga0075434_100086106	Ga0075434_1000861062	414
376	3300006871	Ga0075434_100188986	Ga0075434_1001889862	414
377	3300006880	Ga0075429_100009422	Ga0075429_1000094224	414
378	3300006880	Ga0075429_100272672	Ga0075429_1002726721	414
379	3300007076	Ga0075435_100001871	Ga0075435_1000018718	414
380	3300009094	Ga0111539_10028373	Ga0111539_100283735	414
381	3300009177	Ga0105248_10105390	Ga0105248_101053902	414
382	3300025918	Ga0207662_10003433	Ga0207662_100034333	414
383	3300025936	Ga0207670_10004012	Ga0207670_100040125	414
384	3300025936	Ga0207670_10013512	Ga0207670_100135124	414
385	3300028380	Ga0268265_10249271	Ga0268265_102492712	414
386	3300031238	Ga0265332_10002073	Ga0265332_100020739	414
387	3300031712	Ga0265342_10008905	Ga0265342_100089054	414
388	3300032002	Ga0307416_100014460	Ga0307416_1000144602	414
389	3300035086	Ga0373934_0001170	Ga0373934_0001170_8074_9327	414
390	3300035117	Ga0373953_0004961	Ga0373953_0004961_1571_2878	414
391	3300035691	Ga0373931_0040141	Ga0373931_0040141_522_1829	414
392	3300045051	Ga0451576_0002168	Ga0451576_0002168_12307_13563	414
393	3300045051	Ga0451576_0009766	Ga0451576_0009766_679_1986	414
394	3300045051	Ga0451576_0136359	Ga0451576_0136359_840_2147	414
395	3300046454	Ga0495592_0003795	Ga0495592_0003795_1646_2953	414
396	3300046455	Ga0495603_0120062	Ga0495603_0120062_185_1495	414
397	3300046463	Ga0495653_0061169	Ga0495653_0061169_832_2139	414
398	3300046511	Ga0495608_0022282	Ga0495608_0022282_544_1851	414
399	3300046516	Ga0495628_0014037	Ga0495628_0014037_5180_6487	414
400	3300046642	Ga0495634_0037156	Ga0495634_0037156_1785_3092	414
401	3300046678	Ga0495599_0047968	Ga0495599_0047968_219_1526	414
402	3300046683	Ga0495658_0155796	Ga0495658_0155796_47_1300	414
403	3300047444	Ga0495675_0006452	Ga0495675_0006452_4998_6305	414
404	3300048913	Ga0496110_0000099	Ga0496110_0000099_9454_10755	414
405	3300049529	Ga0501313_004826	Ga0501313_004826_70_1371	414
406	3300049537	Ga0501321_004311	Ga0501321_004311_30_1331	414
407	3300049587	Ga0501071_0094628	Ga0501071_0094628_94_1344	414
408	3300049591	Ga0501075_0017270	Ga0501075_0017270_2361_3611	414
409	3300049661	Ga0501217_014008	Ga0501217_014008_134_1435	414
410	3300050513	nmdc:mga0rr50_3207_c1	nmdc:mga0rr50_3207_c1_710_2053	414
411	3300050515	nmdc:mga0a205_230346_c1	nmdc:mga0a205_230346_c1_402_1709	414
412	3300050515	nmdc:mga0a205_3348_c1	nmdc:mga0a205_3348_c1_7183_8526	414
413	3300053084	Ga0495595_0014513	Ga0495595_0014513_931_2238	414
414	3300053085	Ga0495619_0018284	Ga0495619_0018284_1064_2371	414
415	3300053103	Ga0500555_000015	Ga0500555_000015_69383_70639	414
416	3300053119	Ga0500595_003588	Ga0500595_003588_4400_5683	414
417	3300053139	Ga0500568_0016663	Ga0500568_0016663_600_1895	414
418	3300053153	Ga0500616_0024317	Ga0500616_0024317_76_1332	414
419	iso_pu_bacteria	2887630918	2887632838	414
420	iso_pu_bacteria	2916178963	2916179880	414
421	3300003187	JGI25151J46595_10001287	JGI25151J46595_1000128716	415
422	3300003187	JGI25151J46595_10004190	JGI25151J46595_100041907	415
423	3300003316	rootH1_10001329	rootH1_1000132910	415
424	3300003320	rootH2_10300971	rootH2_103009713	415
425	3300003322	rootL2_10006646	rootL2_100066465	415
426	3300003323	rootH1_10186136	rootH1_101861362	415
427	3300003578	Ga0006562J51391_1000271	Ga0006562J51391_10002713	415
428	3300003578	Ga0006562J51391_1004179	Ga0006562J51391_10041793	415
429	3300003758	Ga0055532_1000091	Ga0055532_100009182	415
430	3300003758	Ga0055532_1000403	Ga0055532_100040324	415
431	3300003790	Ga0055528_1001898	Ga0055528_10018986	415
432	3300005328	Ga0070676_10053028	Ga0070676_100530282	415
433	3300005336	Ga0070680_100036102	Ga0070680_1000361023	415
434	3300005344	Ga0070661_100048577	Ga0070661_1000485772	415
435	3300005353	Ga0070669_100030922	Ga0070669_1000309223	415
436	3300005353	Ga0070669_100140853	Ga0070669_1001408531	415
437	3300005353	Ga0070669_100148242	Ga0070669_1001482422	415
438	3300005354	Ga0070675_100094742	Ga0070675_1000947422	415
439	3300005355	Ga0070671_100012686	Ga0070671_1000126863	415
440	3300005367	Ga0070667_100000224	Ga0070667_10000022439	415
441	3300005445	Ga0070708_100189881	Ga0070708_1001898811	415
442	3300005458	Ga0070681_10004725	Ga0070681_1000472512	415
443	3300005459	Ga0068867_100114510	Ga0068867_1001145102	415
444	3300005468	Ga0070707_100001419	Ga0070707_1000014195	415
445	3300005539	Ga0068853_100009644	Ga0068853_1000096444	415
446	3300005544	Ga0070686_100042287	Ga0070686_1000422873	415
447	3300005548	Ga0070665_100297208	Ga0070665_1002972081	415
448	3300005549	Ga0070704_100213330	Ga0070704_1002133301	415
449	3300005577	Ga0068857_100079312	Ga0068857_1000793122	415
450	3300005719	Ga0068861_100065176	Ga0068861_1000651761	415
451	3300006038	Ga0075365_10013451	Ga0075365_100134514	415
452	3300006195	Ga0075366_10000193	Ga0075366_1000019312	415
453	3300006852	Ga0075433_10032909	Ga0075433_100329094	415
454	3300006852	Ga0075433_10152644	Ga0075433_101526441	415
455	3300006881	Ga0068865_100107159	Ga0068865_1001071592	415
456	3300006946	Ga0079104_1000796	Ga0079104_100079625	415
457	3300006946	Ga0079104_1004824	Ga0079104_10048244	415
458	3300009092	Ga0105250_10007719	Ga0105250_100077194	415
459	3300009098	Ga0105245_10002648	Ga0105245_1000264810	415
460	3300009101	Ga0105247_10002273	Ga0105247_1000227310	415
461	3300009147	Ga0114129_10019736	Ga0114129_100197368	415
462	3300009147	Ga0114129_10052198	Ga0114129_100521984	415
463	3300009148	Ga0105243_10000209	Ga0105243_1000020935	415
464	3300009148	Ga0105243_10000610	Ga0105243_1000061031	415
465	3300009176	Ga0105242_10001532	Ga0105242_100015324	415
466	3300009176	Ga0105242_10006592	Ga0105242_100065926	415
467	3300009553	Ga0105249_10027395	Ga0105249_100273953	415
468	3300009553	Ga0105249_10052564	Ga0105249_100525643	415
469	3300011119	Ga0105246_10003506	Ga0105246_100035065	415
470	3300011119	Ga0105246_10019168	Ga0105246_100191682	415
471	3300013100	Ga0157373_10002101	Ga0157373_1000210111	415
472	3300013102	Ga0157371_10000003	Ga0157371_10000003369	415
473	3300013296	Ga0157374_10011214	Ga0157374_100112146	415
474	3300013297	Ga0157378_10000032	Ga0157378_1000003258	415
475	3300013297	Ga0157378_10002598	Ga0157378_100025985	415
476	3300013297	Ga0157378_10020323	Ga0157378_100203233	415
477	3300013306	Ga0163162_10003172	Ga0163162_100031728	415
478	3300013307	Ga0157372_10141832	Ga0157372_101418321	415
479	3300013308	Ga0157375_10000803	Ga0157375_100008031	415
480	3300014326	Ga0157380_10016365	Ga0157380_100163653	415
481	3300014497	Ga0182008_10004600	Ga0182008_1000460010	415
482	3300015261	Ga0182006_1000125	Ga0182006_100012555	415
483	3300015262	Ga0182007_10000082	Ga0182007_1000008212	415
484	3300015265	Ga0182005_1000047	Ga0182005_100004757	415
485	3300025229	Ga0209147_100062	Ga0209147_100062194	415
486	3300025229	Ga0209147_100101	Ga0209147_100101122	415
487	3300025229	Ga0209147_101145	Ga0209147_10114513	415
488	3300025229	Ga0209147_102824	Ga0209147_1028243	415
489	3300025273	Ga0209673_1002798	Ga0209673_10027987	415
490	3300025284	Ga0209130_1004437	Ga0209130_10044374	415
491	3300025291	Ga0209675_1015458	Ga0209675_10154582	415
492	3300025292	Ga0209676_1000164	Ga0209676_1000164110	415
493	3300025292	Ga0209676_1000244	Ga0209676_100024480	415
494	3300025294	Ga0209025_1000191	Ga0209025_1000191106	415
495	3300025294	Ga0209025_1002445	Ga0209025_10024458	415
496	3300025294	Ga0209025_1004239	Ga0209025_10042392	415
497	3300025294	Ga0209025_1010308	Ga0209025_10103081	415
498	3300025294	Ga0209025_1011096	Ga0209025_10110965	415
499	3300025711	Ga0207696_1001902	Ga0207696_10019027	415
500	3300025711	Ga0207696_1030466	Ga0207696_10304661	415
501	3300025728	Ga0207655_1002151	Ga0207655_10021518	415
502	3300025728	Ga0207655_1020990	Ga0207655_10209903	415
503	3300025735	Ga0207713_1001641	Ga0207713_100164114	415
504	3300025735	Ga0207713_1042008	Ga0207713_10420082	415
505	3300025900	Ga0207710_10005216	Ga0207710_100052164	415
506	3300025907	Ga0207645_10103867	Ga0207645_101038672	415
507	3300025917	Ga0207660_10072589	Ga0207660_100725892	415
508	3300025920	Ga0207649_10052400	Ga0207649_100524002	415
509	3300025921	Ga0207652_10166770	Ga0207652_101667702	415
510	3300025922	Ga0207646_10000015	Ga0207646_100000155	415
511	3300025926	Ga0207659_10093986	Ga0207659_100939862	415
512	3300025927	Ga0207687_10014037	Ga0207687_100140371	415
513	3300025934	Ga0207686_10003298	Ga0207686_100032985	415
514	3300025934	Ga0207686_10003657	Ga0207686_100036577	415
515	3300025935	Ga0207709_10001256	Ga0207709_1000125616	415
516	3300025960	Ga0207651_10079994	Ga0207651_100799941	415
517	3300026041	Ga0207639_10040697	Ga0207639_100406974	415
518	3300026118	Ga0207675_100000607	Ga0207675_10000060721	415
519	3300026118	Ga0207675_100170856	Ga0207675_1001708563	415
520	3300027111	Ga0209281_1000213	Ga0209281_100021325	415
521	3300027111	Ga0209281_1000539	Ga0209281_100053950	415
522	3300027111	Ga0209281_1005043	Ga0209281_10050433	415
523	3300028654	Ga0265322_10000068	Ga0265322_1000006831	415
524	3300028794	Ga0307515_10092535	Ga0307515_100925353	415
525	3300030083	Ga0237817_10002	Ga0237817_1000277	415
526	3300031241	Ga0265325_10003550	Ga0265325_100035508	415
527	3300031250	Ga0265331_10015546	Ga0265331_100155463	415
528	3300031250	Ga0265331_10033491	Ga0265331_100334912	415
529	3300031251	Ga0265327_10014891	Ga0265327_100148912	415
530	3300031251	Ga0265327_10029616	Ga0265327_100296163	415
531	3300031251	Ga0265327_10056777	Ga0265327_100567772	415
532	3300031344	Ga0265316_10035601	Ga0265316_100356012	415
533	3300031548	Ga0307408_100057942	Ga0307408_1000579424	415
534	3300031616	Ga0307508_10100738	Ga0307508_101007382	415
535	3300031665	Ga0316575_10000162	Ga0316575_100001625	415
536	3300031691	Ga0316579_10001586	Ga0316579_100015866	415
537	3300031711	Ga0265314_10145939	Ga0265314_101459391	415
538	3300031727	Ga0316576_10004628	Ga0316576_100046286	415
539	3300031727	Ga0316576_10009511	Ga0316576_100095111	415
540	3300031728	Ga0316578_10021832	Ga0316578_100218323	415
541	3300031731	Ga0307405_10069943	Ga0307405_100699432	415
542	3300031733	Ga0316577_10005100	Ga0316577_100051006	415
543	3300032004	Ga0307414_10008756	Ga0307414_100087566	415
544	3300032133	Ga0316583_10006109	Ga0316583_100061093	415
545	3300032137	Ga0316585_10001396	Ga0316585_100013965	415
546	3300032139	Ga0316580_10003028	Ga0316580_100030284	415
547	3300033179	Ga0307507_10077786	Ga0307507_100777863	415
548	3300036647	Ga0316582_0006906	Ga0316582_0006906_767_2020	415
549	3300036647	Ga0316582_0033161	Ga0316582_0033161_1111_2364	415
550	3300036712	Ga0316584_0013384	Ga0316584_0013384_4074_5327	415
551	3300037418	Ga0395900_0251490	Ga0395900_0251490_398_1654	415
552	3300037471	Ga0395905_0011772	Ga0395905_0011772_6247_7497	415
553	3300037471	Ga0395905_0055782	Ga0395905_0055782_2332_3582	415
554	3300037588	Ga0316581_0003547	Ga0316581_0003547_1176_2429	415
555	3300038443	Ga0395901_0142390	Ga0395901_0142390_525_1781	415
556	3300039062	Ga0400483_187020	Ga0400483_187020_3627_4880	415
557	3300039093	Ga0400489_29884	Ga0400489_29884_1054_2307	415
558	3300039447	Ga0436361_0811654	Ga0436361_0811654_282_1565	415
559	3300039447	Ga0436361_1108147	Ga0436361_1108147_1640_2893	415
560	3300042001	Ga0439441_002080	Ga0439441_002080_397_1650	415
561	3300042876	Ga0451577_0000055	Ga0451577_0000055_82718_83971	415
562	3300042876	Ga0451577_0001251	Ga0451577_0001251_23737_24990	415
563	3300042876	Ga0451577_0001330	Ga0451577_0001330_17270_18523	415
564	3300042876	Ga0451577_0002309	Ga0451577_0002309_13351_14718	415
565	3300042876	Ga0451577_0005927	Ga0451577_0005927_5935_7185	415
566	3300042876	Ga0451577_0006260	Ga0451577_0006260_6433_7686	415
567	3300042876	Ga0451577_0014648	Ga0451577_0014648_3762_5129	415
568	3300042876	Ga0451577_0018007	Ga0451577_0018007_3721_4974	415
569	3300042876	Ga0451577_0019713	Ga0451577_0019713_1020_2273	415
570	3300042876	Ga0451577_0021835	Ga0451577_0021835_1554_2816	415
571	3300042876	Ga0451577_0044068	Ga0451577_0044068_642_1910	415
572	3300042876	Ga0451577_0063542	Ga0451577_0063542_278_1546	415
573	3300042876	Ga0451577_0105323	Ga0451577_0105323_615_1865	415
574	3300042876	Ga0451577_0119684	Ga0451577_0119684_590_1843	415
575	3300042876	Ga0451577_0146939	Ga0451577_0146939_107_1360	415
576	3300044673	Ga0453683_0000001	Ga0453683_0000001_21011_22264	415
577	3300044673	Ga0453683_0000027	Ga0453683_0000027_20988_22241	415
578	3300044673	Ga0453683_0000076	Ga0453683_0000076_131003_132256	415
579	3300044673	Ga0453683_0000132	Ga0453683_0000132_47679_48932	415
580	3300044673	Ga0453683_0000185	Ga0453683_0000185_36944_38197	415
581	3300044673	Ga0453683_0000295	Ga0453683_0000295_58582_59835	415
582	3300044673	Ga0453683_0001723	Ga0453683_0001723_16599_17861	415
583	3300044673	Ga0453683_0003873	Ga0453683_0003873_8678_9931	415
584	3300044673	Ga0453683_0020704	Ga0453683_0020704_284_1537	415
585	3300044673	Ga0453683_0024295	Ga0453683_0024295_452_1720	415
586	3300044673	Ga0453683_0047497	Ga0453683_0047497_1079_2329	415
587	3300044673	Ga0453683_0050470	Ga0453683_0050470_920_2173	415
588	3300044673	Ga0453683_0070155	Ga0453683_0070155_301_1608	415
589	3300044712	Ga0453684_0000183	Ga0453684_0000183_193196_194449	415
590	3300044712	Ga0453684_0000254	Ga0453684_0000254_145905_147158	415
591	3300044712	Ga0453684_0000491	Ga0453684_0000491_80780_82033	415
592	3300044712	Ga0453684_0000569	Ga0453684_0000569_63576_64829	415
593	3300044712	Ga0453684_0000716	Ga0453684_0000716_94374_95624	415
594	3300044712	Ga0453684_0005480	Ga0453684_0005480_5046_6299	415
595	3300044712	Ga0453684_0008305	Ga0453684_0008305_11105_12358	415
596	3300044712	Ga0453684_0023032	Ga0453684_0023032_4660_5949	415
597	3300044712	Ga0453684_0027030	Ga0453684_0027030_5792_7042	415
598	3300044712	Ga0453684_0043186	Ga0453684_0043186_1489_2742	415
599	3300044712	Ga0453684_0045399	Ga0453684_0045399_2787_4055	415
600	3300044712	Ga0453684_0054539	Ga0453684_0054539_1039_2307	415
601	3300044712	Ga0453684_0112751	Ga0453684_0112751_946_2199	415
602	3300044712	Ga0453684_0133906	Ga0453684_0133906_518_1771	415
603	3300044712	Ga0453684_0156068	Ga0453684_0156068_993_2246	415
604	3300044712	Ga0453684_0161931	Ga0453684_0161931_1242_2495	415
605	3300044712	Ga0453684_0176685	Ga0453684_0176685_806_2059	415
606	3300044712	Ga0453684_0206280	Ga0453684_0206280_746_1999	415
607	3300045051	Ga0451576_0000226	Ga0451576_0000226_45089_46342	415
608	3300045051	Ga0451576_0000871	Ga0451576_0000871_31698_32951	415
609	3300045051	Ga0451576_0002171	Ga0451576_0002171_26176_27426	415
610	3300045051	Ga0451576_0008528	Ga0451576_0008528_9655_11022	415
611	3300045051	Ga0451576_0015544	Ga0451576_0015544_1893_3200	415
612	3300045051	Ga0451576_0016875	Ga0451576_0016875_6270_7520	415
613	3300045051	Ga0451576_0021019	Ga0451576_0021019_4329_5582	415
614	3300045051	Ga0451576_0025721	Ga0451576_0025721_447_1700	415
615	3300045051	Ga0451576_0058686	Ga0451576_0058686_2169_3422	415
616	3300045051	Ga0451576_0081320	Ga0451576_0081320_575_1828	415
617	3300045051	Ga0451576_0153021	Ga0451576_0153021_940_2193	415
618	3300045051	Ga0451576_0367835	Ga0451576_0367835_89_1339	415
619	3300045051	Ga0451576_0459411	Ga0451576_0459411_36_1286	415
620	3300045976	Ga0466967_0000187	Ga0466967_0000187_7647_8951	415
621	3300045976	Ga0466967_0225185	Ga0466967_0225185_361_1611	415
622	3300046452	Ga0495617_018563	Ga0495617_018563_802_2052	415
623	3300046455	Ga0495603_0031856	Ga0495603_0031856_1394_2719	415
624	3300046460	Ga0495638_0006905	Ga0495638_0006905_5974_7224	415
625	3300046463	Ga0495653_0005359	Ga0495653_0005359_5243_6493	415
626	3300046473	Ga0495582_0042386	Ga0495582_0042386_377_1627	415
627	3300046474	Ga0495605_0011263	Ga0495605_0011263_3427_4677	415
628	3300046491	Ga0495584_0005708	Ga0495584_0005708_838_2088	415
629	3300046491	Ga0495584_0006161	Ga0495584_0006161_3546_4871	415
630	3300046491	Ga0495584_0072377	Ga0495584_0072377_328_1578	415
631	3300046492	Ga0495585_0023345	Ga0495585_0023345_1501_2826	415
632	3300046492	Ga0495585_0033255	Ga0495585_0033255_857_2107	415
633	3300046492	Ga0495585_0103946	Ga0495585_0103946_38_1288	415
634	3300046499	Ga0495594_0003092	Ga0495594_0003092_5691_6941	415
635	3300046499	Ga0495594_0032602	Ga0495594_0032602_722_1972	415
636	3300046506	Ga0495583_0000115	Ga0495583_0000115_64352_65602	415
637	3300046507	Ga0495606_0027510	Ga0495606_0027510_2338_3588	415
638	3300046507	Ga0495606_0064333	Ga0495606_0064333_541_1791	415
639	3300046512	Ga0495610_0008287	Ga0495610_0008287_3968_5218	415
640	3300046512	Ga0495610_0060101	Ga0495610_0060101_204_1454	415
641	3300046522	Ga0495643_0000085	Ga0495643_0000085_69719_70969	415
642	3300046522	Ga0495643_0003201	Ga0495643_0003201_377_1627	415
643	3300046522	Ga0495643_0016840	Ga0495643_0016840_2255_3505	415
644	3300046524	Ga0495648_0000732	Ga0495648_0000732_1072_2322	415
645	3300046526	Ga0495666_0027173	Ga0495666_0027173_967_2217	415
646	3300046528	Ga0495642_0024476	Ga0495642_0024476_467_1717	415
647	3300046530	Ga0495654_0013228	Ga0495654_0013228_1897_3147	415
648	3300046530	Ga0495654_0043407	Ga0495654_0043407_336_1610	415
649	3300046530	Ga0495654_0048860	Ga0495654_0048860_313_1587	415
650	3300046538	Ga0495609_0000537	Ga0495609_0000537_28577_29827	415
651	3300046558	Ga0495633_0000217	Ga0495633_0000217_58822_60072	415
652	3300046558	Ga0495633_0033167	Ga0495633_0033167_197_1522	415
653	3300046660	Ga0495625_0011910	Ga0495625_0011910_5676_6926	415
654	3300046663	Ga0495635_0009665	Ga0495635_0009665_4554_5804	415
655	3300046664	Ga0495659_0000272	Ga0495659_0000272_9521_10771	415
656	3300046665	Ga0495661_0002878	Ga0495661_0002878_6443_7693	415
657	3300046684	Ga0495669_0000032	Ga0495669_0000032_83324_84574	415
658	3300046689	Ga0495613_0079148	Ga0495613_0079148_1027_2277	415
659	3300046694	Ga0495649_0054079	Ga0495649_0054079_679_1953	415
660	3300046794	Ga0495589_0072285	Ga0495589_0072285_26_1336	415
661	3300047315	Ga0495581_0012662	Ga0495581_0012662_1372_2622	415
662	3300047317	Ga0495604_0014576	Ga0495604_0014576_4678_5928	415
663	3300047318	Ga0495636_0000635	Ga0495636_0000635_4952_6202	415
664	3300047318	Ga0495636_0000793	Ga0495636_0000793_1545_2795	415
665	3300047320	Ga0495672_0000019	Ga0495672_0000019_253993_255243	415
666	3300047320	Ga0495672_0015255	Ga0495672_0015255_547_1797	415
667	3300047322	Ga0495680_0051022	Ga0495680_0051022_684_1934	415
668	3300047323	Ga0495683_0007236	Ga0495683_0007236_3427_4677	415
669	3300047323	Ga0495683_0010211	Ga0495683_0010211_1604_2929	415
670	3300047443	Ga0495687_000446	Ga0495687_000446_10768_12018	415
671	3300047444	Ga0495675_0006408	Ga0495675_0006408_2295_3545	415
672	3300047445	Ga0495677_0020955	Ga0495677_0020955_817_2067	415
673	3300047447	Ga0495685_000034	Ga0495685_000034_30213_31463	415
674	3300047469	Ga0495673_0000008	Ga0495673_0000008_587384_588634	415
675	3300047469	Ga0495673_0021744	Ga0495673_0021744_817_2067	415
676	3300047472	Ga0495686_0000677	Ga0495686_0000677_9391_10641	415
677	3300047673	Ga0495593_0002595	Ga0495593_0002595_6285_7535	415
678	3300048089	Ga0495614_0034061	Ga0495614_0034061_279_1529	415
679	3300048091	Ga0495626_0009196	Ga0495626_0009196_980_2230	415
680	3300048091	Ga0495626_0016797	Ga0495626_0016797_1600_2850	415
681	3300048091	Ga0495626_0020436	Ga0495626_0020436_1919_3169	415
682	3300048091	Ga0495626_0038876	Ga0495626_0038876_200_1450	415
683	3300048903	Ga0496100_0096071	Ga0496100_0096071_442_1767	415
684	3300048904	Ga0496101_0007266	Ga0496101_0007266_305_1630	415
685	3300048905	Ga0496102_0003781	Ga0496102_0003781_7079_8404	415
686	3300048905	Ga0496102_0022561	Ga0496102_0022561_1505_2809	415
687	3300048906	Ga0496103_0004746	Ga0496103_0004746_6065_7390	415
688	3300048907	Ga0496104_0004076	Ga0496104_0004076_5814_7139	415
689	3300048908	Ga0496105_0002589	Ga0496105_0002589_6158_7483	415
690	3300048909	Ga0496106_0000868	Ga0496106_0000868_8960_10285	415
691	3300048909	Ga0496106_0013946	Ga0496106_0013946_1133_2440	415
692	3300048910	Ga0496107_0002442	Ga0496107_0002442_3557_4882	415
693	3300048911	Ga0496108_0001784	Ga0496108_0001784_7207_8532	415
694	3300048912	Ga0496109_0001461	Ga0496109_0001461_9320_10645	415
695	3300048913	Ga0496110_0006352	Ga0496110_0006352_4815_6140	415
696	3300048914	Ga0496111_0024389	Ga0496111_0024389_2459_3784	415
697	3300048915	Ga0496112_0127975	Ga0496112_0127975_920_2245	415
698	3300048915	Ga0496112_0192173	Ga0496112_0192173_529_1839	415
699	3300048916	Ga0496113_0005540	Ga0496113_0005540_4856_6181	415
700	3300048919	Ga0496116_0002078	Ga0496116_0002078_1548_2873	415
701	3300048919	Ga0496116_0003977	Ga0496116_0003977_9414_10664	415
702	3300048920	Ga0496117_0000075	Ga0496117_0000075_164738_165988	415
703	3300048920	Ga0496117_0044110	Ga0496117_0044110_1189_2514	415
704	3300048921	Ga0496118_0000055	Ga0496118_0000055_164738_165988	415
705	3300048922	Ga0496119_0006215	Ga0496119_0006215_175_1500	415
706	3300048924	Ga0496121_0039504	Ga0496121_0039504_256_1506	415
707	3300048925	Ga0496122_0003176	Ga0496122_0003176_8124_9374	415
708	3300048925	Ga0496122_0022358	Ga0496122_0022358_1745_3070	415
709	3300048926	Ga0496123_0008164	Ga0496123_0008164_5878_7128	415
710	3300048926	Ga0496123_0038961	Ga0496123_0038961_960_2285	415
711	3300048927	Ga0496124_0008580	Ga0496124_0008580_1267_2517	415
712	3300048928	Ga0496125_0013471	Ga0496125_0013471_1951_3276	415
713	3300048929	Ga0496126_0000108	Ga0496126_0000108_150772_152046	415
714	3300048929	Ga0496126_0011057	Ga0496126_0011057_1316_2641	415
715	3300049128	Ga0501308_004035	Ga0501308_004035_48_1358	415
716	3300049129	Ga0501309_005609	Ga0501309_005609_145_1455	415
717	3300049132	Ga0501343_000423	Ga0501343_000423_62_1372	415
718	3300049134	Ga0501345_00066	Ga0501345_00066_62_1372	415
719	3300049162	Ga0501307_000574	Ga0501307_000574_59_1369	415
720	3300049527	Ga0501311_000575	Ga0501311_000575_1329_2639	415
721	3300049527	Ga0501311_001724	Ga0501311_001724_627_1937	415
722	3300049528	Ga0501312_000565	Ga0501312_000565_1341_2651	415
723	3300049528	Ga0501312_001056	Ga0501312_001056_1193_2503	415
724	3300049529	Ga0501313_001870	Ga0501313_001870_162_1472	415
725	3300049529	Ga0501313_002425	Ga0501313_002425_371_1681	415
726	3300049531	Ga0501315_005329	Ga0501315_005329_62_1372	415
727	3300049532	Ga0501316_000602	Ga0501316_000602_1227_2537	415
728	3300049532	Ga0501316_002359	Ga0501316_002359_420_1730	415
729	3300049533	Ga0501317_000412	Ga0501317_000412_317_1627	415
730	3300049533	Ga0501317_000550	Ga0501317_000550_62_1372	415
731	3300049534	Ga0501318_000308	Ga0501318_000308_212_1522	415
732	3300049534	Ga0501318_002942	Ga0501318_002942_124_1434	415
733	3300049536	Ga0501320_001083	Ga0501320_001083_48_1358	415
734	3300049537	Ga0501321_003214	Ga0501321_003214_106_1416	415
735	3300049539	Ga0501323_000694	Ga0501323_000694_1296_2606	415
736	3300049539	Ga0501323_000833	Ga0501323_000833_19_1344	415
737	3300049539	Ga0501323_003121	Ga0501323_003121_59_1369	415
738	3300049540	Ga0501324_002005	Ga0501324_002005_62_1372	415
739	3300049541	Ga0501325_000169	Ga0501325_000169_59_1369	415
740	3300049552	Ga0501336_001303	Ga0501336_001303_59_1369	415
741	3300049556	Ga0501340_000987	Ga0501340_000987_59_1369	415
742	3300049572	Ga0501036_0015965	Ga0501036_0015965_4523_5776	415
743	3300049581	Ga0501047_0063211	Ga0501047_0063211_1636_2889	415
744	3300049583	Ga0501067_0095323	Ga0501067_0095323_26_1279	415
745	3300049586	Ga0501070_0027174	Ga0501070_0027174_2200_3453	415
746	3300049588	Ga0501072_0049125	Ga0501072_0049125_1003_2256	415
747	3300049661	Ga0501217_010121	Ga0501217_010121_484_1794	415
748	3300049742	Ga0501080_0003344	Ga0501080_0003344_9234_10487	415
749	3300049742	Ga0501080_0028296	Ga0501080_0028296_2322_3584	415
750	3300049744	Ga0501083_0041033	Ga0501083_0041033_969_2222	415
751	3300049824	Ga0501045_0015600	Ga0501045_0015600_3292_4545	415
752	3300050492	nmdc:mga0yw44_1218_c1	nmdc:mga0yw44_1218_c1_220_1488	415
753	3300050493	nmdc:mga0k408_730_c1	nmdc:mga0k408_730_c1_2013_3263	415
754	3300050507	nmdc:mga05p37_12448_c1	nmdc:mga05p37_12448_c1_2659_3966	415
755	3300050512	nmdc:mga0n895_10218_c1	nmdc:mga0n895_10218_c1_4804_6111	415
756	3300050515	nmdc:mga0a205_21279_c1	nmdc:mga0a205_21279_c1_1863_3170	415
757	3300050515	nmdc:mga0a205_38550_c1	nmdc:mga0a205_38550_c1_3104_4411	415
758	3300059641	Ga0587068_000188	Ga0587068_000188_1251_2501	415
759	iso_pu_bacteria	2506520007	2506580559	415
760	iso_pu_bacteria	2506520008	2506585698	415
761	iso_pu_bacteria	2508501071	2508854356	415
762	iso_pu_bacteria	2511231025	2511379632	415
763	iso_pu_bacteria	2511231035	2511433694	415
764	iso_pu_bacteria	2537561728	2538427986	415
765	iso_pu_bacteria	2547132181	2547695987	415
766	iso_pu_bacteria	2547132416	2548649431	415
767	iso_pu_bacteria	2554235234	2555258918	415
768	iso_pu_bacteria	2561511199	2562464627	415
769	iso_pu_bacteria	2565956521	2566037205	415
770	iso_pu_bacteria	2585427591	2585826366	415
771	iso_pu_bacteria	2585427592	2585830600	415
772	iso_pu_bacteria	2599185169	2599410296	415
773	iso_pu_bacteria	2599185299	2599927912	415
774	iso_pu_bacteria	2600255254	2601523508	415
775	iso_pu_bacteria	2600255255	2601528667	415
776	iso_pu_bacteria	2600255256	2601534433	415
777	iso_pu_bacteria	2600255257	2601538788	415
778	iso_pu_bacteria	2600255280	2601615500	415
779	iso_pu_bacteria	2600255281	2601619574	415
780	iso_pu_bacteria	2600255287	2601644011	415
781	iso_pu_bacteria	2600255288	2601647979	415
782	iso_pu_bacteria	2600255289	2601653552	415
783	iso_pu_bacteria	2600255290	2601658327	415
784	iso_pu_bacteria	2600255291	2601663836	415
785	iso_pu_bacteria	2600255298	2601696283	415
786	iso_pu_bacteria	2600255299	2601701468	415
787	iso_pu_bacteria	2600255300	2601706207	415
788	iso_pu_bacteria	2600255301	2601711792	415
789	iso_pu_bacteria	2600255302	2601716810	415
790	iso_pu_bacteria	2600255303	2601721307	415
791	iso_pu_bacteria	2600255304	2601727216	415
792	iso_pu_bacteria	2600255305	2601731756	415
793	iso_pu_bacteria	2600255306	2601736768	415
794	iso_pu_bacteria	2600255307	2601740266	415
795	iso_pu_bacteria	2600255309	2601751203	415
796	iso_pu_bacteria	2600255310	2601757137	415
797	iso_pu_bacteria	2600255311	2601762262	415
798	iso_pu_bacteria	2600255392	2602018937	415
799	iso_pu_bacteria	2602042046	2603639486	415
800	iso_pu_bacteria	2602042047	2603644337	415
801	iso_pu_bacteria	2602042052	2603661224	415
802	iso_pu_bacteria	2602042053	2603666499	415
803	iso_pu_bacteria	2602042066	2603701138	415
804	iso_pu_bacteria	2602042067	2603704944	415
805	iso_pu_bacteria	2602042103	2603839153	415
806	iso_pu_bacteria	2602042104	2603843587	415
807	iso_pu_bacteria	2602042105	2603849310	415
808	iso_pu_bacteria	2602042106	2603854380	415
809	iso_pu_bacteria	2602042109	2603865719	415
810	iso_pu_bacteria	2602042110	2603872435	415
811	iso_pu_bacteria	2602042111	2603877311	415
812	iso_pu_bacteria	2603880178	2606049616	415
813	iso_pu_bacteria	2603880184	2606070931	415
814	iso_pu_bacteria	2603880202	2606147300	415
815	iso_pu_bacteria	2603880211	2606177025	415
816	iso_pu_bacteria	2608642108	2608670715	415
817	iso_pu_bacteria	2609459761	2609911405	415
818	iso_pu_bacteria	2636415599	2637223142	415
819	iso_pu_bacteria	2648501241	2649122910	415
820	iso_pu_bacteria	2648501693	2650897371	415
821	iso_pu_bacteria	2651869818	2652975689	415
822	iso_pu_bacteria	2654587920	2656276368	415
823	iso_pu_bacteria	2667528172	2671104537	415
824	iso_pu_bacteria	2667528173	2671106660	415
825	iso_pu_bacteria	2671180115	2671586127	415
826	iso_pu_bacteria	2675903046	2676408667	415
827	iso_pu_bacteria	2681812866	2681998101	415
828	iso_pu_bacteria	2681812869	2682008221	415
829	iso_pu_bacteria	2684622997	2686354658	415
830	iso_pu_bacteria	2687453601	2689447113	415
831	iso_pu_bacteria	2706794495	2707101131	415
832	iso_pu_bacteria	2711768156	2712471298	415
833	iso_pu_bacteria	2751185917	2753857733	415
834	iso_pu_bacteria	2765235842	2765590848	415
835	iso_pu_bacteria	2772190666	2772440915	415
836	iso_pu_bacteria	2775506706	2775540415	415
837	iso_pu_bacteria	2775507074	2777019466	415
838	iso_pu_bacteria	2791354903	2791925298	415
839	iso_pu_bacteria	2791355010	2792312570	415
840	iso_pu_bacteria	2791355275	2793403870	415
841	iso_pu_bacteria	2808606414	2809124021	415
842	iso_pu_bacteria	2811995292	2813726773	415
843	iso_pu_bacteria	2814123068	2814694146	415
844	iso_pu_bacteria	2821118458	2821120731	415
845	iso_pu_bacteria	2823373977	2823376609	415
846	iso_pu_bacteria	2844425489	2844429222	415
847	iso_pu_bacteria	2844528606	2844531318	415
848	iso_pu_bacteria	2846540461	2846543980	415
849	iso_pu_bacteria	2847085930	2847090320	415
850	iso_pu_bacteria	2847797336	2847801530	415
851	iso_pu_bacteria	2852103415	2852106059	415
852	iso_pu_bacteria	2854601825	2854604949	415
853	iso_pu_bacteria	2855195626	2855196664	415
854	iso_pu_bacteria	2858466076	2858466140	415
855	iso_pu_bacteria	2865014394	2865016076	415
856	iso_pu_bacteria	2869551831	2869556521	415
857	iso_pu_bacteria	2871272651	2871273449	415
858	iso_pu_bacteria	2871282230	2871282865	415
859	iso_pu_bacteria	2876601092	2876605882	415
860	iso_pu_bacteria	2884086401	2884087020	415
861	iso_pu_bacteria	2888366609	2888371020	415
862	iso_pu_bacteria	2888373701	2888376278	415
863	iso_pu_bacteria	2891670763	2891675512	415
864	iso_pu_bacteria	2900051742	2900056293	415
865	iso_pu_bacteria	2904474040	2904474192	415
866	iso_pu_bacteria	2904504865	2904507191	415
867	iso_pu_bacteria	2904513164	2904517056	415
868	iso_pu_bacteria	2908669403	2908672878	415
869	iso_pu_bacteria	2919108558	2919113488	415
870	iso_pu_bacteria	2919150387	2919150539	415
871	iso_pu_bacteria	2923634449	2923636739	415
872	iso_pu_bacteria	2927143783	2927145412	415
873	iso_pu_bacteria	2927833300	2927836800	415
874	iso_pu_bacteria	2932406140	2932407111	415
875	iso_pu_bacteria	2935625433	2935629506	415
876	iso_pu_bacteria	2937539931	2937544120	415
877	iso_pu_bacteria	2937967321	2937971244	415
878	iso_pu_bacteria	2939568625	2939572423	415
879	iso_pu_bacteria	2939573065	2939576597	415
880	iso_pu_bacteria	2939577877	2939582367	415
881	iso_pu_bacteria	2939602548	2939605884	415
882	iso_pu_bacteria	2939607340	2939610564	415
883	iso_pu_bacteria	2939617950	2939620569	415
884	iso_pu_bacteria	2939642701	2939645634	415
885	iso_pu_bacteria	2945874760	2945875836	415
886	iso_pu_bacteria	2945951305	2945954534	415
887	iso_pu_bacteria	2969079654	2969080173	415
888	iso_pu_bacteria	2971820967	2971821521	415
889	iso_pu_bacteria	2974310843	2974314923	415
890	iso_pu_bacteria	2974435778	2974440302	415
891	iso_pu_bacteria	2978975091	2978977008	415
892	iso_pu_bacteria	2984494565	2984498370	415
893	iso_pu_bacteria	2984559226	2984562628	415
894	iso_pu_bacteria	2984595703	2984600688	415
895	iso_pu_bacteria	2990261002	2990263472	415
896	iso_pu_bacteria	3000376612	3000377483	415
897	iso_pu_bacteria	640753048	640939916	415
898	iso_pu_bacteria	8004592986	8004593821	415
899	iso_pu_bacteria	8015394850	8015397114	415
900	iso_pu_bacteria	8016733728	8016737424	415
901	iso_pu_bacteria	8018221730	8018226379	415
902	iso_pu_bacteria	8018405270	8018407087	415
903	iso_pu_bacteria	8019499862	8019502650	415
904	iso_pu_bacteria	8019504834	8019507474	415
905	iso_pu_bacteria	8054844752	8054848509	415
906	iso_pu_bacteria	8054849141	8054849752	415
907	iso_pu_bacteria	8055087960	8055089531	415
908	iso_pu_bacteria	8055092621	8055095984	415
909	iso_pu_bacteria	8055097453	8055101728	415
910	iso_pu_bacteria	8055693939	8055697666	415
911	iso_pu_bacteria	8057304971	8057308466	415
912	3300003320	rootH2_10005270	rootH2_100052703	416
913	3300005329	Ga0070683_100094016	Ga0070683_1000940163	416
914	3300005337	Ga0070682_100000076	Ga0070682_10000007656	416
915	3300005406	Ga0070703_10000106	Ga0070703_1000010625	416
916	3300005438	Ga0070701_10018901	Ga0070701_100189014	416
917	3300005441	Ga0070700_100027884	Ga0070700_1000278842	416
918	3300005444	Ga0070694_100020121	Ga0070694_1000201212	416
919	3300005468	Ga0070707_100000313	Ga0070707_10000031339	416
920	3300005468	Ga0070707_100009215	Ga0070707_1000092157	416
921	3300005468	Ga0070707_100104847	Ga0070707_1001048472	416
922	3300005471	Ga0070698_100043277	Ga0070698_1000432774	416
923	3300005471	Ga0070698_100142597	Ga0070698_1001425971	416
924	3300005536	Ga0070697_100000983	Ga0070697_10000098313	416
925	3300005543	Ga0070672_100148871	Ga0070672_1001488712	416
926	3300005544	Ga0070686_100004806	Ga0070686_1000048063	416
927	3300005546	Ga0070696_100025722	Ga0070696_1000257222	416
928	3300005546	Ga0070696_100046824	Ga0070696_1000468242	416
929	3300005549	Ga0070704_100025683	Ga0070704_1000256834	416
930	3300005563	Ga0068855_100191763	Ga0068855_1001917632	416
931	3300005578	Ga0068854_100111480	Ga0068854_1001114802	416
932	3300005617	Ga0068859_100004313	Ga0068859_1000043133	416
933	3300005718	Ga0068866_10015071	Ga0068866_100150713	416
934	3300005841	Ga0068863_100253882	Ga0068863_1002538821	416
935	3300005843	Ga0068860_100225779	Ga0068860_1002257791	416
936	3300005844	Ga0068862_100036550	Ga0068862_1000365503	416
937	3300006852	Ga0075433_10002633	Ga0075433_100026339	416
938	3300006914	Ga0075436_100000176	Ga0075436_10000017636	416
939	3300006931	Ga0097620_100004313	Ga0097620_1000043133	416
940	3300007076	Ga0075435_100002278	Ga0075435_1000022785	416
941	3300009093	Ga0105240_10241103	Ga0105240_102411032	416
942	3300009094	Ga0111539_10017556	Ga0111539_100175566	416
943	3300009148	Ga0105243_10001044	Ga0105243_1000104417	416
944	3300009176	Ga0105242_10000022	Ga0105242_1000002218	416
945	3300009177	Ga0105248_10011119	Ga0105248_100111198	416
946	3300009545	Ga0105237_10004947	Ga0105237_1000494711	416
947	3300009551	Ga0105238_10031789	Ga0105238_100317892	416
948	3300009551	Ga0105238_10280268	Ga0105238_102802681	416
949	3300013102	Ga0157371_10013787	Ga0157371_100137873	416
950	3300013105	Ga0157369_10031273	Ga0157369_100312737	416
951	3300013105	Ga0157369_10065620	Ga0157369_100656202	416
952	3300013296	Ga0157374_10362050	Ga0157374_103620502	416
953	3300013297	Ga0157378_10050199	Ga0157378_100501993	416
954	3300014326	Ga0157380_10018065	Ga0157380_100180654	416
955	3300025885	Ga0207653_10000237	Ga0207653_1000023714	416
956	3300025899	Ga0207642_10006368	Ga0207642_100063683	416
957	3300025908	Ga0207643_10037266	Ga0207643_100372661	416
958	3300025910	Ga0207684_10022101	Ga0207684_100221015	416
959	3300025912	Ga0207707_10020786	Ga0207707_100207863	416
960	3300025913	Ga0207695_10257543	Ga0207695_102575432	416
961	3300025922	Ga0207646_10009759	Ga0207646_100097596	416
962	3300025922	Ga0207646_10045485	Ga0207646_100454852	416
963	3300025936	Ga0207670_10153027	Ga0207670_101530271	416
964	3300025941	Ga0207711_10053771	Ga0207711_100537713	416
965	3300025941	Ga0207711_10060439	Ga0207711_100604392	416
966	3300025945	Ga0207679_10043918	Ga0207679_100439182	416
967	3300025981	Ga0207640_10054073	Ga0207640_100540733	416
968	3300026075	Ga0207708_10007709	Ga0207708_100077093	416
969	3300026075	Ga0207708_10198347	Ga0207708_101983472	416
970	3300027907	Ga0207428_10006088	Ga0207428_100060881	416
971	3300028381	Ga0268264_10082860	Ga0268264_100828601	416
972	3300028381	Ga0268264_10142956	Ga0268264_101429561	416
973	3300028653	Ga0265323_10012200	Ga0265323_100122004	416
974	3300028653	Ga0265323_10013424	Ga0265323_100134242	416
975	3300028800	Ga0265338_10003117	Ga0265338_100031172	416
976	3300028800	Ga0265338_10003885	Ga0265338_1000388518	416
977	3300029957	Ga0265324_10007845	Ga0265324_100078452	416
978	3300031239	Ga0265328_10000007	Ga0265328_10000007141	416
979	3300031247	Ga0265340_10000871	Ga0265340_1000087118	416
980	3300031251	Ga0265327_10002135	Ga0265327_100021358	416
981	3300031344	Ga0265316_10001683	Ga0265316_100016836	416
982	3300031344	Ga0265316_10020850	Ga0265316_100208506	416
983	3300031344	Ga0265316_10080493	Ga0265316_100804932	416
984	3300031456	Ga0307513_10059905	Ga0307513_100599052	416
985	3300031548	Ga0307408_100234139	Ga0307408_1002341391	416
986	3300031711	Ga0265314_10023504	Ga0265314_100235045	416
987	3300031711	Ga0265314_10064127	Ga0265314_100641273	416
988	3300031712	Ga0265342_10000376	Ga0265342_1000037621	416
989	3300031712	Ga0265342_10024589	Ga0265342_100245893	416
990	3300032005	Ga0307411_10153229	Ga0307411_101532293	416
991	3300037312	Ga0395899_0022447	Ga0395899_0022447_1597_2850	416
992	3300037418	Ga0395900_0002573	Ga0395900_0002573_131_1387	416
993	3300037418	Ga0395900_0124312	Ga0395900_0124312_895_2151	416
994	3300037471	Ga0395905_0000755	Ga0395905_0000755_39997_41250	416
995	3300037471	Ga0395905_0050646	Ga0395905_0050646_2440_3693	416
996	3300038443	Ga0395901_0002912	Ga0395901_0002912_14822_16075	416
997	3300038726	Ga0400490_25259	Ga0400490_25259_6370_7635	416
998	3300039062	Ga0400483_178063	Ga0400483_178063_183_1448	416
999	3300039447	Ga0436361_1034850	Ga0436361_1034850_827_2131	416
1000	3300042435	Ga0439434_0009882	Ga0439434_0009882_224_1546	416
1001	3300044656	Ga0466969_0023210	Ga0466969_0023210_475_1779	416
1002	3300044673	Ga0453683_0000767	Ga0453683_0000767_29907_31166	416
1003	3300044673	Ga0453683_0002950	Ga0453683_0002950_6369_7634	416
1004	3300044712	Ga0453684_0022733	Ga0453684_0022733_6101_7357	416
1005	3300044712	Ga0453684_0023175	Ga0453684_0023175_7325_8584	416
1006	3300044712	Ga0453684_0093822	Ga0453684_0093822_947_2371	416
1007	3300045051	Ga0451576_0000453	Ga0451576_0000453_1778_3037	416
1008	3300045051	Ga0451576_0326767	Ga0451576_0326767_107_1369	416
1009	3300046506	Ga0495583_0002235	Ga0495583_0002235_6475_7728	416
1010	3300046525	Ga0495663_0000189	Ga0495663_0000189_14261_15577	416
1011	3300046537	Ga0495598_0001052	Ga0495598_0001052_223_1539	416
1012	3300046664	Ga0495659_0060352	Ga0495659_0060352_56_1372	416
1013	3300048091	Ga0495626_0003725	Ga0495626_0003725_2951_4216	416
1014	3300048091	Ga0495626_0018784	Ga0495626_0018784_192_1445	416
1015	3300048905	Ga0496102_0049020	Ga0496102_0049020_2316_3569	416
1016	3300048911	Ga0496108_0124180	Ga0496108_0124180_32_1285	416
1017	3300049571	Ga0501034_0000834	Ga0501034_0000834_4164_5420	416
1018	3300050508	nmdc:mga09592_9786_c1	nmdc:mga09592_9786_c1_6257_7573	416
1019	3300050513	nmdc:mga0rr50_46_c1	nmdc:mga0rr50_46_c1_65898_67211	416
1020	3300050514	nmdc:mga08x19_3_c1	nmdc:mga08x19_3_c1_214092_215405	416
1021	3300053153	Ga0500616_0000534	Ga0500616_0000534_45115_46470	416
1022	3300061734	Ga0530510_0036730	Ga0530510_0036730_161_1486	416
1023	2162886012	MBSR1b_contig_702837	MBSR1b_0539.00000870	417
1024	3300000549	LJQas_1000024	LJQas_10000245	417
1025	3300003187	JGI25151J46595_10000070	JGI25151J46595_1000007079	417
1026	3300003203	JGI25406J46586_10012364	JGI25406J46586_100123644	417
1027	3300003203	JGI25406J46586_10033014	JGI25406J46586_100330141	417
1028	3300003322	rootL2_10023751	rootL2_100237514	417
1029	3300003758	Ga0055532_1006160	Ga0055532_10061601	417
1030	3300005293	Ga0065715_10093561	Ga0065715_100935612	417
1031	3300005327	Ga0070658_10001882	Ga0070658_100018822	417
1032	3300005328	Ga0070676_10017273	Ga0070676_100172735	417
1033	3300005330	Ga0070690_100001853	Ga0070690_10000185311	417
1034	3300005330	Ga0070690_100002188	Ga0070690_1000021884	417
1035	3300005331	Ga0070670_100041173	Ga0070670_1000411734	417
1036	3300005331	Ga0070670_100042936	Ga0070670_1000429364	417
1037	3300005331	Ga0070670_100063843	Ga0070670_1000638433	417
1038	3300005336	Ga0070680_100176748	Ga0070680_1001767482	417
1039	3300005338	Ga0068868_100112052	Ga0068868_1001120522	417
1040	3300005339	Ga0070660_100027161	Ga0070660_1000271613	417
1041	3300005340	Ga0070689_100037285	Ga0070689_1000372853	417
1042	3300005354	Ga0070675_100032069	Ga0070675_1000320694	417
1043	3300005355	Ga0070671_100054518	Ga0070671_1000545184	417
1044	3300005364	Ga0070673_100065692	Ga0070673_1000656922	417
1045	3300005364	Ga0070673_100120541	Ga0070673_1001205412	417
1046	3300005406	Ga0070703_10003339	Ga0070703_100033392	417
1047	3300005434	Ga0070709_10001278	Ga0070709_100012783	417
1048	3300005435	Ga0070714_100110283	Ga0070714_1001102832	417
1049	3300005436	Ga0070713_100001883	Ga0070713_1000018835	417
1050	3300005436	Ga0070713_100009152	Ga0070713_1000091525	417
1051	3300005445	Ga0070708_100026814	Ga0070708_1000268143	417
1052	3300005445	Ga0070708_100125131	Ga0070708_1001251312	417
1053	3300005445	Ga0070708_100141826	Ga0070708_1001418262	417
1054	3300005457	Ga0070662_100068989	Ga0070662_1000689892	417
1055	3300005467	Ga0070706_100000500	Ga0070706_10000050015	417
1056	3300005468	Ga0070707_100017999	Ga0070707_1000179993	417
1057	3300005468	Ga0070707_100043724	Ga0070707_1000437244	417
1058	3300005471	Ga0070698_100045282	Ga0070698_1000452825	417
1059	3300005471	Ga0070698_100109166	Ga0070698_1001091662	417
1060	3300005518	Ga0070699_100082982	Ga0070699_1000829822	417
1061	3300005518	Ga0070699_100108199	Ga0070699_1001081993	417
1062	3300005530	Ga0070679_100017652	Ga0070679_1000176524	417
1063	3300005535	Ga0070684_100079876	Ga0070684_1000798762	417
1064	3300005536	Ga0070697_100015494	Ga0070697_1000154944	417
1065	3300005536	Ga0070697_100035531	Ga0070697_1000355313	417
1066	3300005536	Ga0070697_100132510	Ga0070697_1001325102	417
1067	3300005539	Ga0068853_100032709	Ga0068853_1000327093	417
1068	3300005539	Ga0068853_100037589	Ga0068853_1000375894	417
1069	3300005539	Ga0068853_100038674	Ga0068853_1000386743	417
1070	3300005539	Ga0068853_100264464	Ga0068853_1002644641	417
1071	3300005543	Ga0070672_100054174	Ga0070672_1000541742	417
1072	3300005544	Ga0070686_100002945	Ga0070686_1000029452	417
1073	3300005545	Ga0070695_100029265	Ga0070695_1000292652	417
1074	3300005547	Ga0070693_100000010	Ga0070693_10000001013	417
1075	3300005547	Ga0070693_100010613	Ga0070693_1000106133	417
1076	3300005548	Ga0070665_100001311	Ga0070665_10000131119	417
1077	3300005549	Ga0070704_100000160	Ga0070704_10000016016	417
1078	3300005549	Ga0070704_100116718	Ga0070704_1001167182	417
1079	3300005563	Ga0068855_100039381	Ga0068855_1000393812	417
1080	3300005564	Ga0070664_100044481	Ga0070664_1000444813	417
1081	3300005577	Ga0068857_100215910	Ga0068857_1002159101	417
1082	3300005618	Ga0068864_100026609	Ga0068864_1000266095	417
1083	3300005618	Ga0068864_100059461	Ga0068864_1000594612	417
1084	3300005841	Ga0068863_100005126	Ga0068863_1000051265	417
1085	3300005843	Ga0068860_100002665	Ga0068860_10000266510	417
1086	3300005843	Ga0068860_100126321	Ga0068860_1001263212	417
1087	3300005985	Ga0081539_10000230	Ga0081539_100002305	417
1088	3300005985	Ga0081539_10002424	Ga0081539_1000242422	417
1089	3300006028	Ga0070717_10163540	Ga0070717_101635401	417
1090	3300006163	Ga0070715_10000057	Ga0070715_1000005724	417
1091	3300006173	Ga0070716_100000004	Ga0070716_10000000427	417
1092	3300006173	Ga0070716_100007543	Ga0070716_1000075432	417
1093	3300006173	Ga0070716_100062287	Ga0070716_1000622872	417
1094	3300006175	Ga0070712_100157598	Ga0070712_1001575981	417
1095	3300006175	Ga0070712_100169138	Ga0070712_1001691382	417
1096	3300006237	Ga0097621_100023313	Ga0097621_1000233133	417
1097	3300006358	Ga0068871_100016947	Ga0068871_1000169473	417
1098	3300006871	Ga0075434_100010240	Ga0075434_1000102406	417
1099	3300006871	Ga0075434_100174386	Ga0075434_1001743862	417
1100	3300006881	Ga0068865_100035607	Ga0068865_1000356073	417
1101	3300006914	Ga0075436_100008276	Ga0075436_1000082764	417
1102	3300006914	Ga0075436_100010713	Ga0075436_1000107133	417
1103	3300007076	Ga0075435_100066360	Ga0075435_1000663603	417
1104	3300007265	Ga0099794_10003059	Ga0099794_100030596	417
1105	3300007265	Ga0099794_10005005	Ga0099794_100050053	417
1106	3300007265	Ga0099794_10013701	Ga0099794_100137014	417
1107	3300007265	Ga0099794_10016299	Ga0099794_100162991	417
1108	3300007788	Ga0099795_10001343	Ga0099795_100013435	417
1109	3300009093	Ga0105240_10011254	Ga0105240_100112544	417
1110	3300009094	Ga0111539_10041319	Ga0111539_100413193	417
1111	3300009094	Ga0111539_10154814	Ga0111539_101548142	417
1112	3300009101	Ga0105247_10025821	Ga0105247_100258212	417
1113	3300009147	Ga0114129_10493854	Ga0114129_104938542	417
1114	3300009177	Ga0105248_10142234	Ga0105248_101422341	417
1115	3300009553	Ga0105249_10000003	Ga0105249_10000003259	417
1116	3300009553	Ga0105249_10019213	Ga0105249_100192134	417
1117	3300009553	Ga0105249_10033483	Ga0105249_100334834	417
1118	3300010159	Ga0099796_10002019	Ga0099796_100020191	417
1119	3300010375	Ga0105239_10134337	Ga0105239_101343372	417
1120	3300013105	Ga0157369_10067276	Ga0157369_100672764	417
1121	3300013105	Ga0157369_10113194	Ga0157369_101131942	417
1122	3300013296	Ga0157374_10190194	Ga0157374_101901942	417
1123	3300013297	Ga0157378_10000198	Ga0157378_1000019841	417
1124	3300013297	Ga0157378_10120544	Ga0157378_101205442	417
1125	3300013306	Ga0163162_10000020	Ga0163162_1000002028	417
1126	3300013306	Ga0163162_10037064	Ga0163162_100370643	417
1127	3300013306	Ga0163162_10107005	Ga0163162_101070053	417
1128	3300013308	Ga0157375_10006931	Ga0157375_100069317	417
1129	3300013308	Ga0157375_10050456	Ga0157375_100504561	417
1130	3300013308	Ga0157375_10182821	Ga0157375_101828212	417
1131	3300013308	Ga0157375_10215921	Ga0157375_102159212	417
1132	3300014325	Ga0163163_10018502	Ga0163163_100185026	417
1133	3300014325	Ga0163163_10118619	Ga0163163_101186191	417
1134	3300014968	Ga0157379_10076920	Ga0157379_100769203	417
1135	3300014969	Ga0157376_10000036	Ga0157376_1000003635	417
1136	3300014969	Ga0157376_10000766	Ga0157376_1000076612	417
1137	3300017792	Ga0163161_10011889	Ga0163161_100118893	417
1138	3300021384	Ga0213876_10000085	Ga0213876_1000008523	417
1139	3300025900	Ga0207710_10005114	Ga0207710_100051143	417
1140	3300025905	Ga0207685_10000024	Ga0207685_1000002491	417
1141	3300025906	Ga0207699_10000044	Ga0207699_1000004468	417
1142	3300025906	Ga0207699_10004823	Ga0207699_100048235	417
1143	3300025906	Ga0207699_10008642	Ga0207699_100086423	417
1144	3300025912	Ga0207707_10068790	Ga0207707_100687902	417
1145	3300025913	Ga0207695_10071306	Ga0207695_100713064	417
1146	3300025915	Ga0207693_10022053	Ga0207693_100220532	417
1147	3300025915	Ga0207693_10062208	Ga0207693_100622083	417
1148	3300025921	Ga0207652_10011174	Ga0207652_100111742	417
1149	3300025922	Ga0207646_10015612	Ga0207646_100156124	417
1150	3300025922	Ga0207646_10026086	Ga0207646_100260862	417
1151	3300025922	Ga0207646_10239606	Ga0207646_102396062	417
1152	3300025925	Ga0207650_10024160	Ga0207650_100241604	417
1153	3300025925	Ga0207650_10142221	Ga0207650_101422212	417
1154	3300025928	Ga0207700_10001399	Ga0207700_100013995	417
1155	3300025928	Ga0207700_10022889	Ga0207700_100228892	417
1156	3300025929	Ga0207664_10060391	Ga0207664_100603913	417
1157	3300025931	Ga0207644_10038174	Ga0207644_100381742	417
1158	3300025931	Ga0207644_10080817	Ga0207644_100808172	417
1159	3300025934	Ga0207686_10045845	Ga0207686_100458453	417
1160	3300025937	Ga0207669_10052857	Ga0207669_100528572	417
1161	3300025939	Ga0207665_10000297	Ga0207665_100002975	417
1162	3300025939	Ga0207665_10000876	Ga0207665_100008764	417
1163	3300025939	Ga0207665_10012965	Ga0207665_100129654	417
1164	3300025939	Ga0207665_10103734	Ga0207665_101037342	417
1165	3300025940	Ga0207691_10024395	Ga0207691_100243953	417
1166	3300025941	Ga0207711_10089739	Ga0207711_100897393	417
1167	3300025941	Ga0207711_10310038	Ga0207711_103100381	417
1168	3300025945	Ga0207679_10087828	Ga0207679_100878282	417
1169	3300025961	Ga0207712_10000232	Ga0207712_1000023230	417
1170	3300025961	Ga0207712_10040820	Ga0207712_100408204	417
1171	3300026035	Ga0207703_10004189	Ga0207703_1000418912	417
1172	3300026041	Ga0207639_10003615	Ga0207639_100036156	417
1173	3300026041	Ga0207639_10019858	Ga0207639_100198583	417
1174	3300026067	Ga0207678_10038026	Ga0207678_100380262	417
1175	3300026078	Ga0207702_10310698	Ga0207702_103106981	417
1176	3300026088	Ga0207641_10075986	Ga0207641_100759862	417
1177	3300026089	Ga0207648_10084977	Ga0207648_100849772	417
1178	3300026095	Ga0207676_10004697	Ga0207676_100046972	417
1179	3300026095	Ga0207676_10048005	Ga0207676_100480053	417
1180	3300026116	Ga0207674_10003584	Ga0207674_100035846	417
1181	3300026142	Ga0207698_10127938	Ga0207698_101279381	417
1182	3300027360	Ga0209969_1002305	Ga0209969_10023052	417
1183	3300027671	Ga0209588_1002878	Ga0209588_10028783	417
1184	3300027671	Ga0209588_1015041	Ga0209588_10150411	417
1185	3300028381	Ga0268264_10002249	Ga0268264_1000224911	417
1186	3300028381	Ga0268264_10018274	Ga0268264_100182743	417
1187	3300028563	Ga0265319_1012387	Ga0265319_10123873	417
1188	3300028666	Ga0265336_10012205	Ga0265336_100122053	417
1189	3300028800	Ga0265338_10002410	Ga0265338_1000241024	417
1190	3300028800	Ga0265338_10118861	Ga0265338_101188611	417
1191	3300031240	Ga0265320_10001251	Ga0265320_100012517	417
1192	3300031240	Ga0265320_10007633	Ga0265320_100076336	417
1193	3300031249	Ga0265339_10010711	Ga0265339_100107114	417
1194	3300031249	Ga0265339_10062997	Ga0265339_100629972	417
1195	3300031456	Ga0307513_10026866	Ga0307513_100268666	417
1196	3300031548	Ga0307408_100125174	Ga0307408_1001251742	417
1197	3300031711	Ga0265314_10000307	Ga0265314_1000030735	417
1198	3300031711	Ga0265314_10012695	Ga0265314_100126952	417
1199	3300031711	Ga0265314_10027897	Ga0265314_100278973	417
1200	3300031712	Ga0265342_10004443	Ga0265342_100044437	417
1201	3300031731	Ga0307405_10107281	Ga0307405_101072812	417
1202	3300031901	Ga0307406_10044940	Ga0307406_100449401	417
1203	3300031901	Ga0307406_10117839	Ga0307406_101178391	417
1204	3300031901	Ga0307406_10138184	Ga0307406_101381842	417
1205	3300031903	Ga0307407_10080601	Ga0307407_100806012	417
1206	3300031995	Ga0307409_100017016	Ga0307409_1000170165	417
1207	3300032002	Ga0307416_100098150	Ga0307416_1000981502	417
1208	3300032002	Ga0307416_100131904	Ga0307416_1001319043	417
1209	3300032002	Ga0307416_100302655	Ga0307416_1003026551	417
1210	3300032002	Ga0307416_100351490	Ga0307416_1003514901	417
1211	3300032004	Ga0307414_10151597	Ga0307414_101515971	417
1212	3300032005	Ga0307411_10029717	Ga0307411_100297174	417
1213	3300032005	Ga0307411_10041909	Ga0307411_100419092	417
1214	3300032005	Ga0307411_10082775	Ga0307411_100827752	417
1215	3300032005	Ga0307411_10111539	Ga0307411_101115391	417
1216	3300032126	Ga0307415_100015858	Ga0307415_1000158582	417
1217	3300032168	Ga0316593_10015093	Ga0316593_100150931	417
1218	3300033547	Ga0316212_1004452	Ga0316212_10044522	417
1219	3300035118	Ga0373954_0051445	Ga0373954_0051445_222_1484	417
1220	3300035120	Ga0373957_0032346	Ga0373957_0032346_618_1880	417
1221	3300035691	Ga0373931_0127753	Ga0373931_0127753_152_1432	417
1222	3300035695	Ga0373927_0002793	Ga0373927_0002793_3034_4332	417
1223	3300035724	Ga0373933_0003996	Ga0373933_0003996_3066_4328	417
1224	3300037068	Ga0373925_0002913	Ga0373925_0002913_6912_8210	417
1225	3300037418	Ga0395900_0191077	Ga0395900_0191077_682_2007	417
1226	3300037466	Ga0395898_0121937	Ga0395898_0121937_1078_2403	417
1227	3300037471	Ga0395905_0007727	Ga0395905_0007727_225_1541	417
1228	3300037471	Ga0395905_0021512	Ga0395905_0021512_2837_4150	417
1229	3300037471	Ga0395905_0032185	Ga0395905_0032185_696_2021	417
1230	3300038725	Ga0400484_18569	Ga0400484_18569_2944_4203	417
1231	3300038725	Ga0400484_22195	Ga0400484_22195_1679_2938	417
1232	3300038726	Ga0400490_28987	Ga0400490_28987_18968_20227	417
1233	3300038726	Ga0400490_34331	Ga0400490_34331_40902_42161	417
1234	3300038727	Ga0400491_17478	Ga0400491_17478_67_1326	417
1235	3300038735	Ga0400485_03650	Ga0400485_03650_8252_9511	417
1236	3300038735	Ga0400485_20357	Ga0400485_20357_33961_35220	417
1237	3300038741	Ga0400488_27793	Ga0400488_27793_1512_2771	417
1238	3300038741	Ga0400488_43321	Ga0400488_43321_2650_3909	417
1239	3300038741	Ga0400488_56365	Ga0400488_56365_2142_3401	417
1240	3300038741	Ga0400488_57678	Ga0400488_57678_549_1808	417
1241	3300038742	Ga0400486_04210	Ga0400486_04210_8234_9493	417
1242	3300038742	Ga0400486_05246	Ga0400486_05246_20238_21497	417
1243	3300039062	Ga0400483_091080	Ga0400483_091080_1847_3106	417
1244	3300039062	Ga0400483_096039	Ga0400483_096039_2808_4067	417
1245	3300039062	Ga0400483_110940	Ga0400483_110940_19863_21122	417
1246	3300039062	Ga0400483_149892	Ga0400483_149892_1543_2802	417
1247	3300039062	Ga0400483_236414	Ga0400483_236414_1917_3176	417
1248	3300039062	Ga0400483_256612	Ga0400483_256612_12528_13787	417
1249	3300039110	Ga0400487_00745	Ga0400487_00745_6293_7552	417
1250	3300039110	Ga0400487_19891	Ga0400487_19891_3880_5139	417
1251	3300042461	Ga0439460_0042768	Ga0439460_0042768_22_1311	417
1252	3300044712	Ga0453684_0109497	Ga0453684_0109497_1230_2549	417
1253	3300045051	Ga0451576_0000256	Ga0451576_0000256_48229_49524	417
1254	3300046454	Ga0495592_0168997	Ga0495592_0168997_178_1458	417
1255	3300046461	Ga0495641_0037374	Ga0495641_0037374_28_1311	417
1256	3300046471	Ga0495650_0000077	Ga0495650_0000077_193233_194492	417
1257	3300046471	Ga0495650_0028856	Ga0495650_0028856_379_1638	417
1258	3300046472	Ga0495580_0002312	Ga0495580_0002312_8290_9570	417
1259	3300046472	Ga0495580_0054293	Ga0495580_0054293_712_1995	417
1260	3300046472	Ga0495580_0057710	Ga0495580_0057710_1066_2349	417
1261	3300046477	Ga0495664_0035031	Ga0495664_0035031_629_1909	417
1262	3300046499	Ga0495594_0005074	Ga0495594_0005074_1855_3138	417
1263	3300046516	Ga0495628_0008735	Ga0495628_0008735_4517_5797	417
1264	3300046516	Ga0495628_0207518	Ga0495628_0207518_98_1381	417
1265	3300046526	Ga0495666_0010013	Ga0495666_0010013_2612_3895	417
1266	3300046533	Ga0495640_0011662	Ga0495640_0011662_3509_4792	417
1267	3300046535	Ga0495586_0093111	Ga0495586_0093111_130_1413	417
1268	3300046543	Ga0495645_0013500	Ga0495645_0013500_854_2134	417
1269	3300046616	Ga0495668_0001889	Ga0495668_0001889_15325_16620	417
1270	3300046678	Ga0495599_0045735	Ga0495599_0045735_461_1741	417
1271	3300046681	Ga0495647_0025849	Ga0495647_0025849_354_1637	417
1272	3300046689	Ga0495613_0057035	Ga0495613_0057035_141_1424	417
1273	3300047321	Ga0495676_0029329	Ga0495676_0029329_2692_3975	417
1274	3300047322	Ga0495680_0009104	Ga0495680_0009104_5790_7073	417
1275	3300047322	Ga0495680_0117724	Ga0495680_0117724_480_1763	417
1276	3300047323	Ga0495683_0050331	Ga0495683_0050331_205_1464	417
1277	3300047471	Ga0495684_0069401	Ga0495684_0069401_572_1855	417
1278	3300047472	Ga0495686_0000007	Ga0495686_0000007_50245_51603	417
1279	3300047673	Ga0495593_0074515	Ga0495593_0074515_386_1669	417
1280	3300048905	Ga0496102_0004647	Ga0496102_0004647_1093_2373	417
1281	3300048909	Ga0496106_0049919	Ga0496106_0049919_139_1419	417
1282	3300048913	Ga0496110_0192768	Ga0496110_0192768_573_1841	417
1283	3300048917	Ga0496114_0006065	Ga0496114_0006065_7846_9129	417
1284	3300048918	Ga0496115_0008110	Ga0496115_0008110_3831_5114	417
1285	3300048918	Ga0496115_0030457	Ga0496115_0030457_705_1982	417
1286	3300049569	Ga0501032_0002849	Ga0501032_0002849_5538_6812	417
1287	3300049571	Ga0501034_0008675	Ga0501034_0008675_9274_10548	417
1288	3300049572	Ga0501036_0085167	Ga0501036_0085167_1355_2629	417
1289	3300049573	Ga0501037_0044577	Ga0501037_0044577_762_2036	417
1290	3300049573	Ga0501037_0050824	Ga0501037_0050824_1615_2889	417
1291	3300049579	Ga0501043_0042834	Ga0501043_0042834_1230_2504	417
1292	3300049580	Ga0501046_0044453	Ga0501046_0044453_1756_3030	417
1293	3300049581	Ga0501047_0003421	Ga0501047_0003421_13572_14846	417
1294	3300049583	Ga0501067_0001663	Ga0501067_0001663_446_1714	417
1295	3300049583	Ga0501067_0001711	Ga0501067_0001711_4929_6203	417
1296	3300049584	Ga0501068_0001734	Ga0501068_0001734_524_1798	417
1297	3300049584	Ga0501068_0048493	Ga0501068_0048493_182_1444	417
1298	3300049585	Ga0501069_0006092	Ga0501069_0006092_4874_6136	417
1299	3300049585	Ga0501069_0025027	Ga0501069_0025027_1690_2952	417
1300	3300049586	Ga0501070_0001740	Ga0501070_0001740_757_2019	417
1301	3300049589	Ga0501073_0000018	Ga0501073_0000018_2809_4083	417
1302	3300049589	Ga0501073_0003124	Ga0501073_0003124_3428_4702	417
1303	3300049590	Ga0501074_0063045	Ga0501074_0063045_122_1384	417
1304	3300049593	Ga0501077_0000054	Ga0501077_0000054_28747_30021	417
1305	3300049679	Ga0501249_002747	Ga0501249_002747_1827_3134	417
1306	3300049686	Ga0501257_006745	Ga0501257_006745_1141_2448	417
1307	3300049742	Ga0501080_0000837	Ga0501080_0000837_13518_14792	417
1308	3300049742	Ga0501080_0003035	Ga0501080_0003035_11792_13066	417
1309	3300049760	Ga0501263_000864	Ga0501263_000864_1138_2445	417
1310	3300049765	Ga0501268_002763	Ga0501268_002763_598_1905	417
1311	3300049767	Ga0501270_001433	Ga0501270_001433_878_2185	417
1312	3300049822	Ga0501035_0101120	Ga0501035_0101120_949_2223	417
1313	3300049823	Ga0501044_0009988	Ga0501044_0009988_7375_8649	417
1314	3300050509	nmdc:mga0qj67_34404_c1	nmdc:mga0qj67_34404_c1_1596_2903	417
1315	3300050510	nmdc:mga06r32_96142_c1	nmdc:mga06r32_96142_c1_388_1695	417
1316	3300050511	nmdc:mga08y16_10683_c1	nmdc:mga08y16_10683_c1_6556_7818	417
1317	3300050511	nmdc:mga08y16_33362_c1	nmdc:mga08y16_33362_c1_2937_4244	417
1318	3300050512	nmdc:mga0n895_143589_c1	nmdc:mga0n895_143589_c1_1068_2348	417
1319	3300050512	nmdc:mga0n895_4133_c1	nmdc:mga0n895_4133_c1_6736_8019	417
1320	3300050513	nmdc:mga0rr50_45114_c1	nmdc:mga0rr50_45114_c1_498_1781	417
1321	3300050514	nmdc:mga08x19_3757_c1	nmdc:mga08x19_3757_c1_7075_8352	417
1322	3300050514	nmdc:mga08x19_7409_c1	nmdc:mga08x19_7409_c1_2093_3487	417
1323	3300053084	Ga0495595_0105105	Ga0495595_0105105_27_1310	417
1324	3300053085	Ga0495619_0013078	Ga0495619_0013078_3337_4620	417
1325	3300053119	Ga0500595_008076	Ga0500595_008076_415_1689	417
1326	3300054114	Ga0501084_0134049	Ga0501084_0134049_454_1743	417
1327	3300054114	Ga0501084_0136752	Ga0501084_0136752_772_2040	417
1328	3300005435	Ga0070714_100003171	Ga0070714_1000031717	418
1329	3300037853	Ga0436364_1252304	Ga0436364_1252304_1636_2898	418
1330	2010549000	RicEn_C910	RicEn_16860	419
1331	2162886007	SwRhRL2b_contig_1556469	SwRhRL2b_0943.00000280	419
1332	2162886007	SwRhRL2b_contig_333222	SwRhRL2b_0358.00005730	419
1333	3300001989	JGI24739J22299_10000013	JGI24739J22299_1000001320	419
1334	3300002737	JGI25162J39368_1000031	JGI25162J39368_1000031153	419
1335	3300002737	JGI25162J39368_1002365	JGI25162J39368_10023653	419
1336	3300002771	JGI25163J39215_1000261	JGI25163J39215_100026115	419
1337	3300002772	JGI25164J39214_1000001	JGI25164J39214_100000122	419
1338	3300002773	JGI25152J39213_1001182	JGI25152J39213_10011824	419
1339	3300003320	rootH2_10018420	rootH2_1001842035	419
1340	3300003751	Ga0055538_1000004	Ga0055538_1000004152	419
1341	3300003752	Ga0055539_1000004	Ga0055539_1000004406	419
1342	3300003756	Ga0055533_1000007	Ga0055533_1000007152	419
1343	3300003759	Ga0055525_1000007	Ga0055525_1000007152	419
1344	3300003841	Ga0055541_1000004	Ga0055541_1000004152	419
1345	3300003856	Ga0058692_1000264	Ga0058692_100026426	419
1346	3300003856	Ga0058692_1000587	Ga0058692_10005874	419
1347	3300003856	Ga0058692_1000909	Ga0058692_10009097	419
1348	3300003856	Ga0058692_1001387	Ga0058692_100138710	419
1349	3300003856	Ga0058692_1001448	Ga0058692_100144810	419
1350	3300003856	Ga0058692_1003081	Ga0058692_10030815	419
1351	3300003856	Ga0058692_1003245	Ga0058692_10032453	419
1352	3300003856	Ga0058692_1004902	Ga0058692_10049024	419
1353	3300003856	Ga0058692_1007101	Ga0058692_10071013	419
1354	3300003856	Ga0058692_1007374	Ga0058692_10073741	419
1355	3300003856	Ga0058692_1008682	Ga0058692_10086823	419
1356	3300003856	Ga0058692_1013931	Ga0058692_10139312	419
1357	3300005272	Ga0065703_1019967	Ga0065703_10199672	419
1358	3300005289	Ga0065704_10001070	Ga0065704_100010703	419
1359	3300005289	Ga0065704_10001534	Ga0065704_1000153419	419
1360	3300005289	Ga0065704_10001858	Ga0065704_100018584	419
1361	3300005289	Ga0065704_10002429	Ga0065704_1000242914	419
1362	3300005289	Ga0065704_10005293	Ga0065704_100052931	419
1363	3300005289	Ga0065704_10073841	Ga0065704_100738419	419
1364	3300005347	Ga0070668_100065092	Ga0070668_1000650922	419
1365	3300005457	Ga0070662_100012516	Ga0070662_1000125166	419
1366	3300005548	Ga0070665_100002206	Ga0070665_10000220624	419
1367	3300005548	Ga0070665_100010158	Ga0070665_1000101583	419
1368	3300005834	Ga0068851_10000221	Ga0068851_1000022116	419
1369	3300006051	Ga0075364_10004400	Ga0075364_100044008	419
1370	3300006195	Ga0075366_10008950	Ga0075366_100089506	419
1371	3300006946	Ga0079104_1000485	Ga0079104_100048527	419
1372	3300006946	Ga0079104_1000490	Ga0079104_100049011	419
1373	3300006946	Ga0079104_1000624	Ga0079104_100062434	419
1374	3300006946	Ga0079104_1000660	Ga0079104_100066036	419
1375	3300006946	Ga0079104_1001897	Ga0079104_100189714	419
1376	3300006946	Ga0079104_1002794	Ga0079104_10027943	419
1377	3300006946	Ga0079104_1003960	Ga0079104_10039604	419
1378	3300006946	Ga0079104_1004173	Ga0079104_10041735	419
1379	3300006946	Ga0079104_1004175	Ga0079104_10041753	419
1380	3300006946	Ga0079104_1008973	Ga0079104_10089732	419
1381	3300006946	Ga0079104_1011894	Ga0079104_10118943	419
1382	3300009011	Ga0105251_10001425	Ga0105251_1000142522	419
1383	3300009011	Ga0105251_10002220	Ga0105251_100022204	419
1384	3300009011	Ga0105251_10002228	Ga0105251_100022284	419
1385	3300009011	Ga0105251_10002491	Ga0105251_1000249117	419
1386	3300009011	Ga0105251_10002841	Ga0105251_100028414	419
1387	3300009011	Ga0105251_10004823	Ga0105251_100048235	419
1388	3300009011	Ga0105251_10011480	Ga0105251_100114806	419
1389	3300009011	Ga0105251_10018780	Ga0105251_100187804	419
1390	3300009011	Ga0105251_10022252	Ga0105251_100222523	419
1391	3300009011	Ga0105251_10025547	Ga0105251_100255472	419
1392	3300009011	Ga0105251_10026031	Ga0105251_100260313	419
1393	3300009011	Ga0105251_10030604	Ga0105251_100306042	419
1394	3300009011	Ga0105251_10041145	Ga0105251_100411453	419
1395	3300009036	Ga0105244_10000033	Ga0105244_10000033165	419
1396	3300009036	Ga0105244_10000205	Ga0105244_1000020559	419
1397	3300009036	Ga0105244_10000505	Ga0105244_1000050521	419
1398	3300009036	Ga0105244_10000565	Ga0105244_1000056533	419
1399	3300009036	Ga0105244_10000822	Ga0105244_1000082227	419
1400	3300009036	Ga0105244_10001412	Ga0105244_100014124	419
1401	3300009036	Ga0105244_10002138	Ga0105244_1000213813	419
1402	3300009036	Ga0105244_10002840	Ga0105244_100028403	419
1403	3300009036	Ga0105244_10004471	Ga0105244_1000447111	419
1404	3300009036	Ga0105244_10005243	Ga0105244_1000524311	419
1405	3300009036	Ga0105244_10011535	Ga0105244_100115354	419
1406	3300009036	Ga0105244_10025242	Ga0105244_100252425	419
1407	3300009036	Ga0105244_10031572	Ga0105244_100315723	419
1408	3300009036	Ga0105244_10041264	Ga0105244_100412642	419
1409	3300009036	Ga0105244_10087641	Ga0105244_100876412	419
1410	3300009092	Ga0105250_10000098	Ga0105250_1000009818	419
1411	3300009092	Ga0105250_10000165	Ga0105250_1000016555	419
1412	3300009092	Ga0105250_10000321	Ga0105250_1000032123	419
1413	3300009092	Ga0105250_10000351	Ga0105250_1000035121	419
1414	3300009092	Ga0105250_10001790	Ga0105250_1000179015	419
1415	3300009092	Ga0105250_10001907	Ga0105250_100019078	419
1416	3300009092	Ga0105250_10006148	Ga0105250_100061483	419
1417	3300009092	Ga0105250_10009109	Ga0105250_100091094	419
1418	3300009092	Ga0105250_10015924	Ga0105250_100159243	419
1419	3300009092	Ga0105250_10016442	Ga0105250_100164423	419
1420	3300009101	Ga0105247_10000027	Ga0105247_1000002760	419
1421	3300009148	Ga0105243_10003148	Ga0105243_1000314817	419
1422	3300009174	Ga0105241_10000006	Ga0105241_1000000647	419
1423	3300011119	Ga0105246_10021619	Ga0105246_100216193	419
1424	3300013100	Ga0157373_10000301	Ga0157373_100003014	419
1425	3300013100	Ga0157373_10002114	Ga0157373_100021143	419
1426	3300013100	Ga0157373_10029123	Ga0157373_100291232	419
1427	3300013100	Ga0157373_10056959	Ga0157373_100569591	419
1428	3300013100	Ga0157373_10081803	Ga0157373_100818033	419
1429	3300013102	Ga0157371_10000159	Ga0157371_1000015971	419
1430	3300013102	Ga0157371_10000349	Ga0157371_1000034917	419
1431	3300013102	Ga0157371_10001320	Ga0157371_1000132022	419
1432	3300013102	Ga0157371_10015987	Ga0157371_100159874	419
1433	3300013104	Ga0157370_10001424	Ga0157370_1000142426	419
1434	3300013104	Ga0157370_10003454	Ga0157370_1000345413	419
1435	3300013104	Ga0157370_10032567	Ga0157370_100325673	419
1436	3300013105	Ga0157369_10005227	Ga0157369_100052278	419
1437	3300013105	Ga0157369_10096935	Ga0157369_100969353	419
1438	3300013306	Ga0163162_10071438	Ga0163162_100714382	419
1439	3300013306	Ga0163162_10073862	Ga0163162_100738623	419
1440	3300013307	Ga0157372_10000517	Ga0157372_1000051722	419
1441	3300013307	Ga0157372_10008131	Ga0157372_1000813112	419
1442	3300013307	Ga0157372_10024378	Ga0157372_100243788	419
1443	3300013307	Ga0157372_10026685	Ga0157372_100266857	419
1444	3300013307	Ga0157372_10026686	Ga0157372_100266867	419
1445	3300014497	Ga0182008_10026343	Ga0182008_100263432	419
1446	3300015261	Ga0182006_1000376	Ga0182006_100037627	419
1447	3300015261	Ga0182006_1000652	Ga0182006_100065212	419
1448	3300015679	Ga0183366_1002	Ga0183366_1002686	419
1449	3300015680	Ga0183370_1002	Ga0183370_1002686	419
1450	3300015685	Ga0183369_1002	Ga0183369_1002686	419
1451	3300015687	Ga0183368_1005	Ga0183368_1005686	419
1452	3300017792	Ga0163161_10000036	Ga0163161_10000036101	419
1453	3300017792	Ga0163161_10003383	Ga0163161_100033837	419
1454	3300017792	Ga0163161_10041321	Ga0163161_100413212	419
1455	3300021384	Ga0213876_10000013	Ga0213876_10000013257	419
1456	3300025207	Ga0209760_100006	Ga0209760_100006132	419
1457	3300025224	Ga0209784_100001	Ga0209784_100001150	419
1458	3300025225	Ga0209566_100001	Ga0209566_100001150	419
1459	3300025226	Ga0209674_100002	Ga0209674_100002150	419
1460	3300025230	Ga0209563_100008	Ga0209563_100008151	419
1461	3300025231	Ga0207427_100002	Ga0207427_1000021129	419
1462	3300025233	Ga0209437_100100	Ga0209437_100100168	419
1463	3300025233	Ga0209437_100114	Ga0209437_10011449	419
1464	3300025253	Ga0209677_100004	Ga0209677_100004151	419
1465	3300025258	Ga0209129_1000010	Ga0209129_100001073	419
1466	3300025261	Ga0209233_1001399	Ga0209233_100139910	419
1467	3300025321	Ga0207656_10014754	Ga0207656_100147544	419
1468	3300025711	Ga0207696_1000014	Ga0207696_1000014305	419
1469	3300025711	Ga0207696_1000027	Ga0207696_1000027302	419
1470	3300025711	Ga0207696_1000137	Ga0207696_100013762	419
1471	3300025711	Ga0207696_1000188	Ga0207696_100018826	419
1472	3300025711	Ga0207696_1000272	Ga0207696_100027239	419
1473	3300025711	Ga0207696_1000356	Ga0207696_100035622	419
1474	3300025711	Ga0207696_1000466	Ga0207696_100046613	419
1475	3300025711	Ga0207696_1000800	Ga0207696_100080026	419
1476	3300025711	Ga0207696_1003889	Ga0207696_10038897	419
1477	3300025711	Ga0207696_1022717	Ga0207696_10227171	419
1478	3300025711	Ga0207696_1025758	Ga0207696_10257582	419
1479	3300025728	Ga0207655_1000024	Ga0207655_1000024265	419
1480	3300025728	Ga0207655_1000028	Ga0207655_1000028147	419
1481	3300025728	Ga0207655_1000065	Ga0207655_100006593	419
1482	3300025728	Ga0207655_1000072	Ga0207655_100007278	419
1483	3300025728	Ga0207655_1000186	Ga0207655_100018630	419
1484	3300025728	Ga0207655_1000222	Ga0207655_100022285	419
1485	3300025728	Ga0207655_1000397	Ga0207655_10003977	419
1486	3300025728	Ga0207655_1001028	Ga0207655_100102817	419
1487	3300025728	Ga0207655_1001295	Ga0207655_100129526	419
1488	3300025728	Ga0207655_1003209	Ga0207655_10032092	419
1489	3300025728	Ga0207655_1004076	Ga0207655_100407613	419
1490	3300025728	Ga0207655_1005165	Ga0207655_10051659	419
1491	3300025728	Ga0207655_1012043	Ga0207655_10120435	419
1492	3300025728	Ga0207655_1025169	Ga0207655_10251693	419
1493	3300025735	Ga0207713_1000007	Ga0207713_1000007339	419
1494	3300025735	Ga0207713_1000019	Ga0207713_100001984	419
1495	3300025735	Ga0207713_1000157	Ga0207713_100015730	419
1496	3300025735	Ga0207713_1000181	Ga0207713_100018120	419
1497	3300025735	Ga0207713_1000272	Ga0207713_100027248	419
1498	3300025735	Ga0207713_1000300	Ga0207713_100030025	419
1499	3300025735	Ga0207713_1000672	Ga0207713_10006724	419
1500	3300025735	Ga0207713_1003970	Ga0207713_10039707	419
1501	3300025735	Ga0207713_1004072	Ga0207713_10040725	419
1502	3300025735	Ga0207713_1006057	Ga0207713_10060578	419
1503	3300025735	Ga0207713_1007265	Ga0207713_10072658	419
1504	3300025735	Ga0207713_1010697	Ga0207713_10106976	419
1505	3300025735	Ga0207713_1015968	Ga0207713_10159683	419
1506	3300025735	Ga0207713_1024058	Ga0207713_10240583	419
1507	3300025735	Ga0207713_1037520	Ga0207713_10375202	419
1508	3300025900	Ga0207710_10000007	Ga0207710_10000007147	419
1509	3300025911	Ga0207654_10000008	Ga0207654_1000000850	419
1510	3300025914	Ga0207671_10162649	Ga0207671_101626491	419
1511	3300025935	Ga0207709_10000726	Ga0207709_1000072613	419
1512	3300025935	Ga0207709_10012854	Ga0207709_100128543	419
1513	3300026116	Ga0207674_10000119	Ga0207674_1000011983	419
1514	3300027111	Ga0209281_1000025	Ga0209281_100002587	419
1515	3300027111	Ga0209281_1000096	Ga0209281_1000096150	419
1516	3300027111	Ga0209281_1000279	Ga0209281_100027927	419
1517	3300027111	Ga0209281_1000281	Ga0209281_100028189	419
1518	3300027111	Ga0209281_1000328	Ga0209281_100032880	419
1519	3300027111	Ga0209281_1000369	Ga0209281_100036934	419
1520	3300027111	Ga0209281_1000558	Ga0209281_100055844	419
1521	3300027111	Ga0209281_1000723	Ga0209281_100072332	419
1522	3300027111	Ga0209281_1000953	Ga0209281_100095325	419
1523	3300027111	Ga0209281_1001042	Ga0209281_10010423	419
1524	3300027111	Ga0209281_1006438	Ga0209281_10064382	419
1525	3300027312	Ga0209371_1000013	Ga0209371_1000013589	419
1526	3300027312	Ga0209371_1000019	Ga0209371_1000019470	419
1527	3300027312	Ga0209371_1000069	Ga0209371_1000069164	419
1528	3300027312	Ga0209371_1000083	Ga0209371_100008311	419
1529	3300027312	Ga0209371_1000149	Ga0209371_100014957	419
1530	3300027312	Ga0209371_1000346	Ga0209371_100034626	419
1531	3300027312	Ga0209371_1000351	Ga0209371_100035115	419
1532	3300027312	Ga0209371_1000509	Ga0209371_100050920	419
1533	3300027312	Ga0209371_1000663	Ga0209371_100066320	419
1534	3300027312	Ga0209371_1000759	Ga0209371_100075924	419
1535	3300027312	Ga0209371_1002463	Ga0209371_10024636	419
1536	3300027312	Ga0209371_1004362	Ga0209371_10043627	419
1537	3300027312	Ga0209371_1005293	Ga0209371_10052933	419
1538	3300027312	Ga0209371_1008802	Ga0209371_10088022	419
1539	3300027312	Ga0209371_1009303	Ga0209371_10093032	419
1540	3300027312	Ga0209371_1014929	Ga0209371_10149292	419
1541	3300027312	Ga0209371_1016264	Ga0209371_10162642	419
1542	3300028379	Ga0268266_10000142	Ga0268266_1000014260	419
1543	3300028379	Ga0268266_10120932	Ga0268266_101209322	419
1544	3300030500	Ga0268256_1000014	Ga0268256_100001489	419
1545	3300030500	Ga0268256_1000024	Ga0268256_100002455	419
1546	3300030500	Ga0268256_1000066	Ga0268256_100006626	419
1547	3300030500	Ga0268256_1000074	Ga0268256_1000074163	419
1548	3300030500	Ga0268256_1000293	Ga0268256_100029326	419
1549	3300030500	Ga0268256_1000294	Ga0268256_100029438	419
1550	3300030500	Ga0268256_1000734	Ga0268256_100073424	419
1551	3300030500	Ga0268256_1000910	Ga0268256_100091015	419
1552	3300030500	Ga0268256_1000918	Ga0268256_10009187	419
1553	3300030500	Ga0268256_1002373	Ga0268256_10023733	419
1554	3300030500	Ga0268256_1002616	Ga0268256_100261610	419
1555	3300030500	Ga0268256_1005162	Ga0268256_10051623	419
1556	3300030500	Ga0268256_1006944	Ga0268256_10069445	419
1557	3300030500	Ga0268256_1007632	Ga0268256_10076325	419
1558	3300030500	Ga0268256_1009251	Ga0268256_10092512	419
1559	3300030500	Ga0268256_1009830	Ga0268256_10098303	419
1560	3300030500	Ga0268256_1012534	Ga0268256_10125341	419
1561	3300030500	Ga0268256_1016536	Ga0268256_10165362	419
1562	3300030500	Ga0268256_1027782	Ga0268256_10277821	419
1563	3300038443	Ga0395901_0004418	Ga0395901_0004418_11629_12924	419
1564	3300039062	Ga0400483_255177	Ga0400483_255177_17265_18530	419
1565	3300039093	Ga0400489_94259	Ga0400489_94259_803_2071	419
1566	3300039437	Ga0436365_0471682	Ga0436365_0471682_76089_77348	419
1567	3300041405	Ga0439438_000003	Ga0439438_000003_396602_397861	419
1568	3300041405	Ga0439438_000282	Ga0439438_000282_3696_4955	419
1569	3300041405	Ga0439438_000434	Ga0439438_000434_5899_7161	419
1570	3300041405	Ga0439438_011966	Ga0439438_011966_932_2191	419
1571	3300041407	Ga0439447_000460	Ga0439447_000460_1175_2434	419
1572	3300041407	Ga0439447_005888	Ga0439447_005888_1932_3194	419
1573	3300041411	Ga0439466_0000002	Ga0439466_0000002_174974_176233	419
1574	3300042006	Ga0439432_000566	Ga0439432_000566_1733_2992	419
1575	3300042006	Ga0439432_001003	Ga0439432_001003_7940_9199	419
1576	3300042006	Ga0439432_002996	Ga0439432_002996_4540_5799	419
1577	3300042010	Ga0439452_000004	Ga0439452_000004_321783_323042	419
1578	3300042010	Ga0439452_000011	Ga0439452_000011_85539_86798	419
1579	3300042010	Ga0439452_000078	Ga0439452_000078_73957_75216	419
1580	3300042010	Ga0439452_000079	Ga0439452_000079_1903_3162	419
1581	3300042010	Ga0439452_000498	Ga0439452_000498_18096_19355	419
1582	3300042010	Ga0439452_001372	Ga0439452_001372_6894_8153	419
1583	3300042010	Ga0439452_003286	Ga0439452_003286_2541_3800	419
1584	3300042016	Ga0439463_009858	Ga0439463_009858_401_1660	419
1585	3300042146	Ga0450907_000012	Ga0450907_000012_1178_2437	419
1586	3300042439	Ga0439464_0004073	Ga0439464_0004073_278_1537	419
1587	3300044669	Ga0466981_0000050	Ga0466981_0000050_20611_21870	419
1588	3300046452	Ga0495617_014046	Ga0495617_014046_432_1691	419
1589	3300046453	Ga0495627_000017	Ga0495627_000017_67000_68259	419
1590	3300046458	Ga0495591_000010	Ga0495591_000010_247385_248644	419
1591	3300046458	Ga0495591_000090	Ga0495591_000090_79503_80762	419
1592	3300046458	Ga0495591_004205	Ga0495591_004205_4911_6173	419
1593	3300046458	Ga0495591_008311	Ga0495591_008311_375_1634	419
1594	3300046460	Ga0495638_0030883	Ga0495638_0030883_1108_2367	419
1595	3300046471	Ga0495650_0000004	Ga0495650_0000004_156728_157987	419
1596	3300046471	Ga0495650_0000008	Ga0495650_0000008_67817_69079	419
1597	3300046471	Ga0495650_0000040	Ga0495650_0000040_93962_95221	419
1598	3300046471	Ga0495650_0015698	Ga0495650_0015698_1487_2746	419
1599	3300046492	Ga0495585_0016662	Ga0495585_0016662_1118_2377	419
1600	3300046500	Ga0495596_0002831	Ga0495596_0002831_1989_3251	419
1601	3300046501	Ga0495607_0007704	Ga0495607_0007704_283_1545	419
1602	3300046507	Ga0495606_0000399	Ga0495606_0000399_67711_68973	419
1603	3300046515	Ga0495620_0010230	Ga0495620_0010230_3240_4499	419
1604	3300046522	Ga0495643_0037129	Ga0495643_0037129_745_2004	419
1605	3300046524	Ga0495648_0002723	Ga0495648_0002723_1872_3131	419
1606	3300046530	Ga0495654_0000036	Ga0495654_0000036_3985_5244	419
1607	3300046530	Ga0495654_0000089	Ga0495654_0000089_33637_34899	419
1608	3300046530	Ga0495654_0002508	Ga0495654_0002508_4702_5961	419
1609	3300046530	Ga0495654_0011011	Ga0495654_0011011_1103_2362	419
1610	3300046542	Ga0495597_0001169	Ga0495597_0001169_2953_4221	419
1611	3300046660	Ga0495625_0004372	Ga0495625_0004372_2400_3668	419
1612	3300046692	Ga0495671_0001824	Ga0495671_0001824_5845_7107	419
1613	3300046694	Ga0495649_0033630	Ga0495649_0033630_84_1343	419
1614	3300046694	Ga0495649_0082538	Ga0495649_0082538_84_1343	419
1615	3300046794	Ga0495589_0000013	Ga0495589_0000013_36985_38244	419
1616	3300046794	Ga0495589_0001531	Ga0495589_0001531_2396_3658	419
1617	3300046810	Ga0495660_0000022	Ga0495660_0000022_156121_157380	419
1618	3300046810	Ga0495660_0000184	Ga0495660_0000184_38338_39600	419
1619	3300046810	Ga0495660_0038806	Ga0495660_0038806_797_2056	419
1620	3300047320	Ga0495672_0000003	Ga0495672_0000003_659690_660952	419
1621	3300047320	Ga0495672_0000082	Ga0495672_0000082_72023_73291	419
1622	3300047320	Ga0495672_0000103	Ga0495672_0000103_91939_93198	419
1623	3300047323	Ga0495683_0080402	Ga0495683_0080402_256_1518	419
1624	3300047446	Ga0495679_000059	Ga0495679_000059_73326_74594	419
1625	3300047446	Ga0495679_004411	Ga0495679_004411_2838_4097	419
1626	3300047446	Ga0495679_005815	Ga0495679_005815_1347_2606	419
1627	3300047469	Ga0495673_0000011	Ga0495673_0000011_68082_69344	419
1628	3300047469	Ga0495673_0000117	Ga0495673_0000117_94349_95608	419
1629	3300048904	Ga0496101_0000144	Ga0496101_0000144_22379_23638	419
1630	3300048904	Ga0496101_0036245	Ga0496101_0036245_1829_3088	419
1631	3300048905	Ga0496102_0018620	Ga0496102_0018620_415_1674	419
1632	3300048907	Ga0496104_0000153	Ga0496104_0000153_6843_8102	419
1633	3300048907	Ga0496104_0001602	Ga0496104_0001602_5588_6847	419
1634	3300048907	Ga0496104_0235131	Ga0496104_0235131_46_1305	419
1635	3300048907	Ga0496104_0253809	Ga0496104_0253809_52_1311	419
1636	3300048908	Ga0496105_0118333	Ga0496105_0118333_59_1318	419
1637	3300048919	Ga0496116_0000009	Ga0496116_0000009_559416_560675	419
1638	3300048919	Ga0496116_0000016	Ga0496116_0000016_32924_34183	419
1639	3300048919	Ga0496116_0000148	Ga0496116_0000148_115474_116742	419
1640	3300048919	Ga0496116_0000777	Ga0496116_0000777_2165_3424	419
1641	3300048919	Ga0496116_0001014	Ga0496116_0001014_9254_10513	419
1642	3300048919	Ga0496116_0002172	Ga0496116_0002172_1595_2854	419
1643	3300048919	Ga0496116_0009533	Ga0496116_0009533_6280_7539	419
1644	3300048919	Ga0496116_0034488	Ga0496116_0034488_1358_2617	419
1645	3300048919	Ga0496116_0137077	Ga0496116_0137077_83_1342	419
1646	3300048920	Ga0496117_0000078	Ga0496117_0000078_21717_22976	419
1647	3300048920	Ga0496117_0000116	Ga0496117_0000116_1358_2617	419
1648	3300048920	Ga0496117_0002319	Ga0496117_0002319_5025_6284	419
1649	3300048920	Ga0496117_0005006	Ga0496117_0005006_1804_3063	419
1650	3300048920	Ga0496117_0005369	Ga0496117_0005369_2876_4135	419
1651	3300048920	Ga0496117_0005435	Ga0496117_0005435_8119_9378	419
1652	3300048920	Ga0496117_0011056	Ga0496117_0011056_1141_2400	419
1653	3300048920	Ga0496117_0021805	Ga0496117_0021805_3124_4383	419
1654	3300048921	Ga0496118_0000059	Ga0496118_0000059_204092_205351	419
1655	3300048921	Ga0496118_0004732	Ga0496118_0004732_12539_13798	419
1656	3300048921	Ga0496118_0004852	Ga0496118_0004852_5918_7177	419
1657	3300048921	Ga0496118_0007265	Ga0496118_0007265_2132_3391	419
1658	3300048921	Ga0496118_0007795	Ga0496118_0007795_9954_11213	419
1659	3300048921	Ga0496118_0014364	Ga0496118_0014364_2808_4067	419
1660	3300048921	Ga0496118_0034736	Ga0496118_0034736_1618_2877	419
1661	3300048921	Ga0496118_0053050	Ga0496118_0053050_801_2060	419
1662	3300048922	Ga0496119_0000096	Ga0496119_0000096_73430_74689	419
1663	3300048922	Ga0496119_0000472	Ga0496119_0000472_17980_19239	419
1664	3300048922	Ga0496119_0000586	Ga0496119_0000586_33473_34735	419
1665	3300048922	Ga0496119_0002196	Ga0496119_0002196_1660_2928	419
1666	3300048922	Ga0496119_0002663	Ga0496119_0002663_3216_4475	419
1667	3300048922	Ga0496119_0003291	Ga0496119_0003291_7462_8721	419
1668	3300048922	Ga0496119_0007553	Ga0496119_0007553_7369_8628	419
1669	3300048922	Ga0496119_0008068	Ga0496119_0008068_4868_6127	419
1670	3300048922	Ga0496119_0009572	Ga0496119_0009572_5396_6655	419
1671	3300048922	Ga0496119_0011114	Ga0496119_0011114_4822_6081	419
1672	3300048922	Ga0496119_0020980	Ga0496119_0020980_1954_3213	419
1673	3300048922	Ga0496119_0021298	Ga0496119_0021298_2296_3555	419
1674	3300048922	Ga0496119_0029947	Ga0496119_0029947_2134_3393	419
1675	3300048923	Ga0496120_0000068	Ga0496120_0000068_56981_58240	419
1676	3300048923	Ga0496120_0000166	Ga0496120_0000166_78915_80174	419
1677	3300048923	Ga0496120_0000389	Ga0496120_0000389_65424_66683	419
1678	3300048923	Ga0496120_0000572	Ga0496120_0000572_50692_51951	419
1679	3300048923	Ga0496120_0000602	Ga0496120_0000602_33473_34735	419
1680	3300048923	Ga0496120_0001236	Ga0496120_0001236_13845_15104	419
1681	3300048923	Ga0496120_0001364	Ga0496120_0001364_1574_2842	419
1682	3300048923	Ga0496120_0001521	Ga0496120_0001521_7369_8628	419
1683	3300048923	Ga0496120_0007004	Ga0496120_0007004_3728_4987	419
1684	3300048923	Ga0496120_0018989	Ga0496120_0018989_1630_2889	419
1685	3300048923	Ga0496120_0038053	Ga0496120_0038053_66_1325	419
1686	3300048923	Ga0496120_0045326	Ga0496120_0045326_226_1485	419
1687	3300048924	Ga0496121_0000052	Ga0496121_0000052_166490_167749	419
1688	3300048924	Ga0496121_0003985	Ga0496121_0003985_13842_15101	419
1689	3300048924	Ga0496121_0007946	Ga0496121_0007946_1803_3062	419
1690	3300048924	Ga0496121_0010723	Ga0496121_0010723_7276_8535	419
1691	3300048924	Ga0496121_0015675	Ga0496121_0015675_1801_3060	419
1692	3300048924	Ga0496121_0069910	Ga0496121_0069910_1537_2796	419
1693	3300048925	Ga0496122_0000070	Ga0496122_0000070_102501_103760	419
1694	3300048925	Ga0496122_0000392	Ga0496122_0000392_73514_74773	419
1695	3300048925	Ga0496122_0002311	Ga0496122_0002311_8126_9385	419
1696	3300048925	Ga0496122_0003665	Ga0496122_0003665_9071_10330	419
1697	3300048925	Ga0496122_0006666	Ga0496122_0006666_4883_6142	419
1698	3300048925	Ga0496122_0008374	Ga0496122_0008374_1802_3061	419
1699	3300048925	Ga0496122_0029898	Ga0496122_0029898_1357_2616	419
1700	3300048926	Ga0496123_0000017	Ga0496123_0000017_18313_19572	419
1701	3300048926	Ga0496123_0000131	Ga0496123_0000131_32945_34204	419
1702	3300048926	Ga0496123_0001554	Ga0496123_0001554_1903_3162	419
1703	3300048926	Ga0496123_0001924	Ga0496123_0001924_17726_18985	419
1704	3300048926	Ga0496123_0002763	Ga0496123_0002763_2695_3954	419
1705	3300048926	Ga0496123_0004679	Ga0496123_0004679_9498_10757	419
1706	3300048926	Ga0496123_0006706	Ga0496123_0006706_8252_9511	419
1707	3300048926	Ga0496123_0009555	Ga0496123_0009555_1329_2588	419
1708	3300048926	Ga0496123_0009642	Ga0496123_0009642_2705_3964	419
1709	3300048926	Ga0496123_0011880	Ga0496123_0011880_4702_5961	419
1710	3300048927	Ga0496124_0000053	Ga0496124_0000053_59124_60383	419
1711	3300048927	Ga0496124_0000303	Ga0496124_0000303_68420_69679	419
1712	3300048927	Ga0496124_0000630	Ga0496124_0000630_21260_22519	419
1713	3300048927	Ga0496124_0001210	Ga0496124_0001210_29317_30576	419
1714	3300048927	Ga0496124_0001921	Ga0496124_0001921_4545_5804	419
1715	3300048927	Ga0496124_0002062	Ga0496124_0002062_5665_6924	419
1716	3300048927	Ga0496124_0003880	Ga0496124_0003880_7238_8497	419
1717	3300048927	Ga0496124_0009686	Ga0496124_0009686_1718_2977	419
1718	3300048927	Ga0496124_0012468	Ga0496124_0012468_4563_5822	419
1719	3300048927	Ga0496124_0033559	Ga0496124_0033559_1313_2572	419
1720	3300048927	Ga0496124_0042430	Ga0496124_0042430_625_1884	419
1721	3300048927	Ga0496124_0057779	Ga0496124_0057779_1799_3058	419
1722	3300048927	Ga0496124_0114836	Ga0496124_0114836_888_2147	419
1723	3300048928	Ga0496125_0000056	Ga0496125_0000056_113640_114899	419
1724	3300048928	Ga0496125_0000329	Ga0496125_0000329_7794_9053	419
1725	3300048928	Ga0496125_0002880	Ga0496125_0002880_2102_3361	419
1726	3300048928	Ga0496125_0008126	Ga0496125_0008126_502_1761	419
1727	3300048928	Ga0496125_0008724	Ga0496125_0008724_3138_4397	419
1728	3300048929	Ga0496126_0000137	Ga0496126_0000137_105246_106505	419
1729	3300048929	Ga0496126_0000818	Ga0496126_0000818_46080_47339	419
1730	3300048929	Ga0496126_0017161	Ga0496126_0017161_1561_2820	419
1731	3300048929	Ga0496126_0098569	Ga0496126_0098569_941_2200	419
1732	3300049459	Ga0495678_000142	Ga0495678_000142_28432_29694	419
1733	3300049460	Ga0495682_0000034	Ga0495682_0000034_62696_63958	419
1734	3300050491	nmdc:mga00v17_18473_c1	nmdc:mga00v17_18473_c1_2571_3830	419
1735	3300050491	nmdc:mga00v17_5577_c1	nmdc:mga00v17_5577_c1_1013_2272	419
1736	3300050491	nmdc:mga00v17_98342_c1	nmdc:mga00v17_98342_c1_417_1676	419
1737	3300050493	nmdc:mga0k408_7203_c2	nmdc:mga0k408_7203_c2_2998_4257	419
1738	3300053126	Ga0500621_000010	Ga0500621_000010_100527_101789	419

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00275

EPSP_synthase

EPSP synthase (3-phosphoshikimate 1-carboxyvinyltransferase)

58

463

0.96 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
2rl1-assembly1.cif.gz_A	crystal structure of udp-n-acetylglucosamine enolpyruvyl transferase from haemophilus influenzae in complex with udp-n-acetylglucosamine	0.9965	1	418
3swd-assembly1.cif.gz_A	e. coli mura in complex with udp-n-acetylmuramic acid and covalent adduct of pep with cys115	0.9963	1	418
1q3g-assembly4.cif.gz_W	mura (asp305ala) liganded with tetrahedral reaction intermediate	0.9961	1	419
3v4t-assembly1.cif.gz_D	e. cloacae c115d mura liganded with unag	0.9959	1	419
4r7u-assembly1.cif.gz_A	structure of udp-n-acetylglucosamine 1-carboxyvinyltransferase from vibrio cholerae in complex with substrate udp-n-acetylglucosamine and the drug fosfomycin	0.9952	1	417

ID	Description	Score	Start	End	Superfamily
af_P0A749_226_417_3.40.50.1370	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Aspartate/ornithine carbamoyltransferase	1.001	226	417	3.40.50.1370
af_P0A749_226_417_3.40.50.1370	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Aspartate/ornithine carbamoyltransferase	0.9961	226	417	3.40.50.1370
3swdA02	Alpha Beta;Alpha-beta prism;UDP-n-acetylglucosamine1-carboxyvinyl-transferase; Chain;Enolpyruvate transferase domain	0.9958	21	228	3.65.10.10
3swdA02	Alpha Beta;Alpha-beta prism;UDP-n-acetylglucosamine1-carboxyvinyl-transferase; Chain;Enolpyruvate transferase domain	0.991	21	228	3.65.10.10
af_P9WJM1_237_415_3.65.10.10	Alpha Beta;Alpha-beta prism;UDP-n-acetylglucosamine1-carboxyvinyl-transferase; Chain;Enolpyruvate transferase domain	0.9907	237	414	3.65.10.10

ID	Description	Score	Start	End	GO Terms
AF-A0A074TU92-F1-model_v4	deleted	1.002	263	391
AF-A0A3M2Z6Z7-F1-model_v4	UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC 2.5.1.7) (Enoylpyruvate transferase) (UDP-N-acetylglucosamine enolpyruvyl transferase)	1.001	229	373	GO:0005737 GO:0008360 GO:0008760 GO:0009252 GO:0051301 GO:0071555
AF-A0A351Q3T8-F1-model_v4	UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC 2.5.1.7) (Enoylpyruvate transferase) (UDP-N-acetylglucosamine enolpyruvyl transferase)	0.9989	231	418	GO:0005737 GO:0008360 GO:0008760 GO:0009252 GO:0051301 GO:0071555
AF-A0A448MM76-F1-model_v4	UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC 2.5.1.7)	0.9982	133	419	GO:0005737 GO:0008360 GO:0008760 GO:0009252 GO:0019277 GO:0051301 GO:0071555
AF-A0A455VJI1-F1-model_v4	UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC 2.5.1.7) (Enoylpyruvate transferase) (UDP-N-acetylglucosamine enolpyruvyl transferase)	0.9981	90	358	GO:0005737 GO:0008360 GO:0008760 GO:0009252 GO:0019277 GO:0051301 GO:0071555

Feature Viewer

pLDDT	pTM	Quality
94.85	0.93	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F495533

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00275

EPSP_synthase

EPSP synthase (3-phosphoshikimate 1-carboxyvinyltransferase)

58

463

0.96

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map