F495535
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1738 | 468 | 3476 | 263 |
Family's Representative Sequence
| Representative Sequence | 3300047320|Ga0495672_0012690|Ga0495672_0012690_1621_2538 |
| Length | 305 |
| Sequence | LRLRDNTPALDLQGVIDLFGKSLLILLILQNSFHEANMVKNREKNDFTEASDQTVKKILITQPRPETDKSPYFELARKYGIELAFHPFIILEPIPAKDFRKQKIEIANYSAVIFTSRHAIDHFFRICEEMKISISQDTKYFCITEAVALYLQKFILYRKRKVFYGADGTNKSMFDVINKHKENEKFLYPCSENQQDNEIVGWLKNNNCGFATPFMYRTISNDIKEVLDRQEYDIICFFTPSGVRSLFDNFPKYKQNGTKIGAFGNNTSRAAEDAGLVLEIKAPLPQAPSMVSALERYLSDTLKKK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 4 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 5 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 6 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 7 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 8 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 9 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 10 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 11 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 12 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 13 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 14 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 15 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 16 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 17 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 18 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 19 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 20 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 21 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 22 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 23 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 24 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 25 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 26 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 27 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 34 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 38 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 40 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 51 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 59 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 60 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 64 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 66 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 68 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 71 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 73 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 74 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 75 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 77 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 78 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 79 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 80 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 81 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 82 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 83 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 84 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 85 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 86 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 87 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 88 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 89 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 90 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 91 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 92 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 94 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 95 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 96 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 97 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 98 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 99 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 100 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 101 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 129 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 133 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 134 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 136 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 137 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 138 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 139 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 140 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 141 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 142 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 145 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 146 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 148 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 149 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 218 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 222 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 223 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 224 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 225 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 226 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 227 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 228 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 229 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 230 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 231 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 232 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 233 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 234 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 235 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 236 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 237 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 238 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 239 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 240 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 241 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 242 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 243 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 244 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 245 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 246 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 247 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 248 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 249 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 250 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 251 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 252 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 253 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 254 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 255 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 256 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 257 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 258 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 259 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 260 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 261 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 262 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 263 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 264 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 265 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 266 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 267 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 268 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 269 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 270 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 271 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 272 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 273 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 274 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 275 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 276 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 277 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 278 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 279 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 280 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 281 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 282 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 283 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 284 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 285 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 286 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 287 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 288 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 289 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 290 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 291 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 292 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 293 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 294 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 295 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 296 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 297 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 298 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 299 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 300 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 301 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 302 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 303 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 304 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 305 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 306 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 307 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 346 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 347 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 348 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 349 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 350 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 351 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 352 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 353 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 354 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 355 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 356 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 357 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 358 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 359 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 360 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 361 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 362 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 363 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 364 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 365 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 366 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 367 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 368 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 369 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 370 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 371 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 372 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 373 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 374 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 375 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 376 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 377 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 378 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 379 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 380 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 381 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 382 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 383 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 384 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 385 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 386 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 387 | 3300049673 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought | Metagenome | Rhizosphere |
| 388 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 389 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 390 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 391 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 392 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 393 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 394 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 395 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 396 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 397 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 398 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 399 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 400 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 401 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 402 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 403 | 3300050005 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought | Metagenome | Rhizosphere |
| 404 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 405 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 406 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 407 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 408 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 409 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 410 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 411 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 412 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 413 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 414 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 415 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 416 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 417 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 418 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 419 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 420 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 421 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 422 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 423 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 424 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 425 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 426 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 427 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 428 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 429 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 430 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 431 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 432 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 433 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 434 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 435 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 436 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 437 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 438 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 439 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 440 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 441 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 442 | 2721755487 | Sphingobacterium sp. B29 | Isolate | Rhizosphere |
| 443 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
| 444 | 2738541283 | Pedobacter sp. OK701 | Isolate | Unclassified |
| 445 | 2738543023 | Pedobacter sp. OK628 | Isolate | Unclassified |
| 446 | 2818991442 | Chitinophaga pinensis 1204 | Isolate | Unclassified |
| 447 | 2818991444 | Filimonas endophytica 3197 | Isolate | Unclassified |
| 448 | 2818991460 | Chitinophaga polysaccharea 1209 | Isolate | Unclassified |
| 449 | 2852627209 | Pedobacter sp. AK017 | Isolate | Rhizosphere |
| 450 | 2881955468 | Edaphocola flava HME-24 | Isolate | Rhizosphere |
| 451 | 2883068021 | Chitinophaga rhizosphaerae T16R-86 | Isolate | Rhizosphere |
| 452 | 2890737413 | Parapedobacter sp. SGR-10 | Isolate | Rhizosphere |
| 453 | 2896317667 | Sphingobacterium sp. SGR-19 | Isolate | Rhizosphere |
| 454 | 2896344016 | Sphingobacterium sp. SGL-16 | Isolate | Rhizosphere |
| 455 | 2898713307 | Sphingobacterium sp. SGG-5 | Isolate | Rhizosphere |
| 456 | 2904780799 | Sphingobacterium sp. 1304 | Isolate | Rhizosphere |
| 457 | 2914759650 | Rhizosphaericola mali | Isolate | Rhizosphere |
| 458 | 2919177583 | Sphingobacterium sp. 2149 | Isolate | Rhizosphere |
| 459 | 2919186247 | Pedobacter africanus 2697 | Isolate | Rhizosphere |
| 460 | 2929154850 | Filimonas sp. R-72421 Hybrid assembly | Isolate | Unclassified |
| 461 | 2929239360 | Chitinophaga sp. R-73072 Hybrid assembly | Isolate | Unclassified |
| 462 | 2929921140 | Chitinophaga sp. R-72609 Hybrid assembly | Isolate | Unclassified |
| 463 | 2939664404 | Pedobacter africanus 2990 | Isolate | Rhizosphere |
| 464 | 2945977869 | Chitinophaga sp. W2I13 | Isolate | Rhizosphere |
| 465 | 2946013367 | Chitinophaga sp. W3I9 | Isolate | Rhizosphere |
| 466 | 3003233435 | Sphingobacterium shayense CrR18 | Isolate | Unclassified |
| 467 | 8003151029 | Chitinophaga sp. GbtcB8 | Isolate | Unclassified |
| 468 | 8055588893 | Parapedobacter lycopersici KACC 18788 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.64 |
| Metatranscriptomes | 0.81 |
| Isolates | 1.55 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.78 |
| Nodule | 0 |
| Rhizoplane | 0.75 |
| Rhizosphere | 90.68 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.06 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495672_0012690 | 3300047320 | Bacteria | 5860 |
| 2 | SwRhRL2b_contig_779164 | 2162886007 | Bacteria | 45880 |
| 3 | MBSR1b_contig_1275727 | 2162886012 | Unclassified | 1026 |
| 4 | MBSR1b_contig_2933601 | 2162886012 | Bacteria | 1193 |
| 5 | MBSR1b_contig_8348456 | 2162886012 | Unclassified | 1103 |
| 6 | JGI24740J21852_10003140 | 3300001979 | Bacteria | 7286 |
| 7 | JGI24740J21852_10018534 | 3300001979 | Bacteria | 2468 |
| 8 | JGI24739J22299_10000259 | 3300001989 | Bacteria | 17820 |
| 9 | JGI24744J21845_10004189 | 3300002077 | Bacteria | 2974 |
| 10 | JGI24742J22300_10009021 | 3300002244 | Bacteria | 1646 |
| 11 | JGI24751J29686_10018083 | 3300002459 | Bacteria | 1457 |
| 12 | JGI25154J39366_1000006 | 3300002738 | Bacteria | 336396 |
| 13 | JGI25406J46586_10002018 | 3300003203 | Bacteria | 9590 |
| 14 | JGI25153J46596_10000485 | 3300003215 | Bacteria | 25536 |
| 15 | JGI25153J46596_10019253 | 3300003215 | Bacteria | 2621 |
| 16 | rootH2_10000092 | 3300003320 | Bacteria | 10196 |
| 17 | rootH2_10000641 | 3300003320 | Bacteria | 3331 |
| 18 | rootH2_10022930 | 3300003320 | Bacteria | 32910 |
| 19 | rootH2_10115691 | 3300003320 | Bacteria | 2215 |
| 20 | rootL2_10060108 | 3300003322 | Bacteria | 6828 |
| 21 | rootL2_10202782 | 3300003322 | Bacteria | 1025 |
| 22 | rootL2_10202783 | 3300003322 | Bacteria | 2812 |
| 23 | rootL2_10292902 | 3300003322 | Bacteria | 2384 |
| 24 | rootH1_10009438 | 3300003323 | Bacteria | 11402 |
| 25 | rootH1_10018931 | 3300003323 | Bacteria | 13203 |
| 26 | rootH1_10019793 | 3300003323 | Bacteria | 2902 |
| 27 | rootH1_10060702 | 3300003323 | Bacteria | 5254 |
| 28 | rootH1_10090089 | 3300003323 | Bacteria | 3876 |
| 29 | rootH1_10108198 | 3300003323 | Bacteria | 2497 |
| 30 | JGI25160J50197_1000629 | 3300003354 | Bacteria | 19720 |
| 31 | JGI25160J50197_1004121 | 3300003354 | Bacteria | 6336 |
| 32 | JGI25160J50197_1014342 | 3300003354 | Bacteria | 2655 |
| 33 | Ga0055535_1005898 | 3300003761 | Bacteria | 2584 |
| 34 | Ga0055542_1004965 | 3300003762 | Bacteria | 3094 |
| 35 | Ga0055526_1029184 | 3300003771 | Bacteria | 1645 |
| 36 | Ga0055528_1000076 | 3300003790 | Bacteria | 76002 |
| 37 | Ga0055531_10000005 | 3300003794 | Bacteria | 242179 |
| 38 | Ga0058862_12715360 | 3300004803 | Bacteria | 952 |
| 39 | Ga0065165_1000042 | 3300005262 | Bacteria | 203874 |
| 40 | Ga0065165_1012716 | 3300005262 | Bacteria | 3405 |
| 41 | Ga0065165_1019191 | 3300005262 | Bacteria | 2450 |
| 42 | Ga0065714_10081301 | 3300005288 | Bacteria | 2364 |
| 43 | Ga0065704_10070133 | 3300005289 | Bacteria | 1266035 |
| 44 | Ga0065704_10071523 | 3300005289 | Bacteria | 10811 |
| 45 | Ga0065704_10093138 | 3300005289 | Bacteria | 2615 |
| 46 | Ga0065704_10137437 | 3300005289 | Unclassified | 1555 |
| 47 | Ga0065712_10012699 | 3300005290 | Bacteria | 4388 |
| 48 | Ga0065712_10018752 | 3300005290 | Bacteria | 1808 |
| 49 | Ga0065712_10073112 | 3300005290 | Bacteria | 4502 |
| 50 | Ga0065715_10140579 | 3300005293 | Bacteria | 1860 |
| 51 | Ga0065715_10166983 | 3300005293 | Bacteria | 1578 |
| 52 | Ga0065715_10315304 | 3300005293 | Bacteria | 1012 |
| 53 | Ga0070658_10000832 | 3300005327 | Bacteria | 26408 |
| 54 | Ga0070658_10008928 | 3300005327 | Bacteria | 8054 |
| 55 | Ga0070658_10033602 | 3300005327 | Bacteria | 4127 |
| 56 | Ga0070658_10086590 | 3300005327 | Bacteria | 2577 |
| 57 | Ga0070658_10342780 | 3300005327 | Bacteria | 1278 |
| 58 | Ga0070676_10000006 | 3300005328 | Bacteria | 72739 |
| 59 | Ga0070676_10247092 | 3300005328 | Bacteria | 1189 |
| 60 | Ga0070683_100006473 | 3300005329 | Bacteria | 9832 |
| 61 | Ga0070683_100052654 | 3300005329 | Bacteria | 3772 |
| 62 | Ga0070683_100232863 | 3300005329 | Bacteria | 1751 |
| 63 | Ga0070683_100248108 | 3300005329 | Bacteria | 1693 |
| 64 | Ga0070683_100605071 | 3300005329 | Bacteria | 1049 |
| 65 | Ga0070690_100004961 | 3300005330 | Bacteria | 7446 |
| 66 | Ga0070690_100005168 | 3300005330 | Bacteria | 7306 |
| 67 | Ga0070690_100204802 | 3300005330 | Bacteria | 1375 |
| 68 | Ga0070670_100008348 | 3300005331 | Bacteria | 8829 |
| 69 | Ga0070670_100011501 | 3300005331 | Bacteria | 7571 |
| 70 | Ga0070670_100021427 | 3300005331 | Bacteria | 5560 |
| 71 | Ga0070670_100021906 | 3300005331 | Bacteria | 5498 |
| 72 | Ga0070670_100044163 | 3300005331 | Bacteria | 3832 |
| 73 | Ga0070670_100244640 | 3300005331 | Bacteria | 1562 |
| 74 | Ga0070670_100265922 | 3300005331 | Bacteria | 1496 |
| 75 | Ga0070670_100712546 | 3300005331 | Unclassified | 903 |
| 76 | Ga0070677_10012650 | 3300005333 | Bacteria | 2933 |
| 77 | Ga0070677_10023660 | 3300005333 | Bacteria | 2276 |
| 78 | Ga0070677_10047438 | 3300005333 | Unclassified | 1722 |
| 79 | Ga0070677_10056344 | 3300005333 | Bacteria | 1607 |
| 80 | Ga0070677_10200642 | 3300005333 | Bacteria | 962 |
| 81 | Ga0068869_100002227 | 3300005334 | Bacteria | 11658 |
| 82 | Ga0068869_100006663 | 3300005334 | Bacteria | 7336 |
| 83 | Ga0068869_100010045 | 3300005334 | Bacteria | 6156 |
| 84 | Ga0068869_100031106 | 3300005334 | Bacteria | 3754 |
| 85 | Ga0068869_100036008 | 3300005334 | Bacteria | 3512 |
| 86 | Ga0068869_100041025 | 3300005334 | Bacteria | 3312 |
| 87 | Ga0068869_100046687 | 3300005334 | Unclassified | 3123 |
| 88 | Ga0068869_100069011 | 3300005334 | Bacteria | 2612 |
| 89 | Ga0068869_100092971 | 3300005334 | Unclassified | 2271 |
| 90 | Ga0070666_10000227 | 3300005335 | Bacteria | 38376 |
| 91 | Ga0070666_10000694 | 3300005335 | Bacteria | 20427 |
| 92 | Ga0070666_10009099 | 3300005335 | Bacteria | 6193 |
| 93 | Ga0070666_10012591 | 3300005335 | Bacteria | 5341 |
| 94 | Ga0070666_10019390 | 3300005335 | Bacteria | 4390 |
| 95 | Ga0070666_10044490 | 3300005335 | Bacteria | 2974 |
| 96 | Ga0070666_10134194 | 3300005335 | Bacteria | 1721 |
| 97 | Ga0070666_10160225 | 3300005335 | Unclassified | 1573 |
| 98 | Ga0070680_100000268 | 3300005336 | Bacteria | 34613 |
| 99 | Ga0070680_100004673 | 3300005336 | Bacteria | 10298 |
| 100 | Ga0070680_100050043 | 3300005336 | Bacteria | 3408 |
| 101 | Ga0070680_100069104 | 3300005336 | Unclassified | 2900 |
| 102 | Ga0070680_100130284 | 3300005336 | Bacteria | 2104 |
| 103 | Ga0070680_100130366 | 3300005336 | Bacteria | 2103 |
| 104 | Ga0070680_100130693 | 3300005336 | Bacteria | 2101 |
| 105 | Ga0070682_100000121 | 3300005337 | Bacteria | 69122 |
| 106 | Ga0070682_100003830 | 3300005337 | Bacteria | 8358 |
| 107 | Ga0070682_100016418 | 3300005337 | Bacteria | 4303 |
| 108 | Ga0070682_100028182 | 3300005337 | Bacteria | 3377 |
| 109 | Ga0070682_100033805 | 3300005337 | Unclassified | 3109 |
| 110 | Ga0068868_100000022 | 3300005338 | Bacteria | 85904 |
| 111 | Ga0068868_100003164 | 3300005338 | Bacteria | 11456 |
| 112 | Ga0068868_100004764 | 3300005338 | Bacteria | 9528 |
| 113 | Ga0068868_100021170 | 3300005338 | Bacteria | 4896 |
| 114 | Ga0068868_100038511 | 3300005338 | Unclassified | 3711 |
| 115 | Ga0068868_100057649 | 3300005338 | Bacteria | 3069 |
| 116 | Ga0068868_100261025 | 3300005338 | Bacteria | 1461 |
| 117 | Ga0068868_100273646 | 3300005338 | Bacteria | 1427 |
| 118 | Ga0068868_100540206 | 3300005338 | Bacteria | 1026 |
| 119 | Ga0070660_100000435 | 3300005339 | Bacteria | 27665 |
| 120 | Ga0070660_100023136 | 3300005339 | Bacteria | 4602 |
| 121 | Ga0070660_100023630 | 3300005339 | Bacteria | 4555 |
| 122 | Ga0070660_100175755 | 3300005339 | Bacteria | 1732 |
| 123 | Ga0070660_100252913 | 3300005339 | Unclassified | 1437 |
| 124 | Ga0070660_100324455 | 3300005339 | Bacteria | 1265 |
| 125 | Ga0070689_100004351 | 3300005340 | Bacteria | 9558 |
| 126 | Ga0070689_100023419 | 3300005340 | Bacteria | 4622 |
| 127 | Ga0070689_100110864 | 3300005340 | Bacteria | 2182 |
| 128 | Ga0070689_100381993 | 3300005340 | Unclassified | 1187 |
| 129 | Ga0070689_100535708 | 3300005340 | Bacteria | 1007 |
| 130 | Ga0070691_10000271 | 3300005341 | Bacteria | 18096 |
| 131 | Ga0070691_10006755 | 3300005341 | Bacteria | 5250 |
| 132 | Ga0070687_100010030 | 3300005343 | Bacteria | 4078 |
| 133 | Ga0070687_100151165 | 3300005343 | Bacteria | 1363 |
| 134 | Ga0070687_100157484 | 3300005343 | Bacteria | 1339 |
| 135 | Ga0070687_100247538 | 3300005343 | Unclassified | 1105 |
| 136 | Ga0070661_100000111 | 3300005344 | Bacteria | 68066 |
| 137 | Ga0070661_100025124 | 3300005344 | Bacteria | 4278 |
| 138 | Ga0070661_100030269 | 3300005344 | Bacteria | 3910 |
| 139 | Ga0070661_100228891 | 3300005344 | Bacteria | 1428 |
| 140 | Ga0070661_100492981 | 3300005344 | Bacteria | 980 |
| 141 | Ga0070692_10163657 | 3300005345 | Bacteria | 1277 |
| 142 | Ga0070668_100000016 | 3300005347 | Bacteria | 104092 |
| 143 | Ga0070668_100004396 | 3300005347 | Bacteria | 10459 |
| 144 | Ga0070668_100061602 | 3300005347 | Bacteria | 2907 |
| 145 | Ga0070668_100079328 | 3300005347 | Bacteria | 2570 |
| 146 | Ga0070668_100100036 | 3300005347 | Bacteria | 2296 |
| 147 | Ga0070668_100421231 | 3300005347 | Bacteria | 1143 |
| 148 | Ga0070669_100004867 | 3300005353 | Bacteria | 9691 |
| 149 | Ga0070669_100041985 | 3300005353 | Bacteria | 3328 |
| 150 | Ga0070669_100068518 | 3300005353 | Bacteria | 2619 |
| 151 | Ga0070669_100343310 | 3300005353 | Bacteria | 1210 |
| 152 | Ga0070669_100411759 | 3300005353 | Bacteria | 1108 |
| 153 | Ga0070669_100491723 | 3300005353 | Bacteria | 1016 |
| 154 | Ga0070675_100005753 | 3300005354 | Bacteria | 9483 |
| 155 | Ga0070675_100006416 | 3300005354 | Bacteria | 9026 |
| 156 | Ga0070675_100008108 | 3300005354 | Bacteria | 8145 |
| 157 | Ga0070675_100036770 | 3300005354 | Bacteria | 3985 |
| 158 | Ga0070675_100048759 | 3300005354 | Bacteria | 3473 |
| 159 | Ga0070675_100071795 | 3300005354 | Bacteria | 2873 |
| 160 | Ga0070675_100130672 | 3300005354 | Bacteria | 2140 |
| 161 | Ga0070675_100178729 | 3300005354 | Bacteria | 1834 |
| 162 | Ga0070675_100308475 | 3300005354 | Unclassified | 1396 |
| 163 | Ga0070675_100400601 | 3300005354 | Bacteria | 1224 |
| 164 | Ga0070671_100001071 | 3300005355 | Bacteria | 20211 |
| 165 | Ga0070671_100016763 | 3300005355 | Bacteria | 5924 |
| 166 | Ga0070671_100034912 | 3300005355 | Unclassified | 4164 |
| 167 | Ga0070671_100063744 | 3300005355 | Bacteria | 3070 |
| 168 | Ga0070671_100069870 | 3300005355 | Bacteria | 2929 |
| 169 | Ga0070671_100216997 | 3300005355 | Unclassified | 1623 |
| 170 | Ga0070671_100279246 | 3300005355 | Bacteria | 1420 |
| 171 | Ga0070671_100282974 | 3300005355 | Bacteria | 1411 |
| 172 | Ga0070674_100004177 | 3300005356 | Bacteria | 8202 |
| 173 | Ga0070674_100008569 | 3300005356 | Bacteria | 6098 |
| 174 | Ga0070674_100046488 | 3300005356 | Bacteria | 2970 |
| 175 | Ga0070674_100073743 | 3300005356 | Bacteria | 2420 |
| 176 | Ga0070674_100167388 | 3300005356 | Bacteria | 1673 |
| 177 | Ga0070674_100241505 | 3300005356 | Bacteria | 1414 |
| 178 | Ga0070674_100257282 | 3300005356 | Unclassified | 1374 |
| 179 | Ga0070673_100000647 | 3300005364 | Bacteria | 19063 |
| 180 | Ga0070673_100012819 | 3300005364 | Bacteria | 5770 |
| 181 | Ga0070673_100043821 | 3300005364 | Bacteria | 3461 |
| 182 | Ga0070673_100105003 | 3300005364 | Bacteria | 2333 |
| 183 | Ga0070673_100155086 | 3300005364 | Bacteria | 1943 |
| 184 | Ga0070673_100209845 | 3300005364 | Bacteria | 1681 |
| 185 | Ga0070673_100400062 | 3300005364 | Bacteria | 1228 |
| 186 | Ga0070673_100421741 | 3300005364 | Bacteria | 1196 |
| 187 | Ga0070688_100011317 | 3300005365 | Bacteria | 4956 |
| 188 | Ga0070688_100023336 | 3300005365 | Bacteria | 3637 |
| 189 | Ga0070688_100086078 | 3300005365 | Bacteria | 2044 |
| 190 | Ga0070688_100114625 | 3300005365 | Bacteria | 1797 |
| 191 | Ga0070688_100179997 | 3300005365 | Unclassified | 1465 |
| 192 | Ga0070659_100003767 | 3300005366 | Bacteria | 10819 |
| 193 | Ga0070659_100014034 | 3300005366 | Bacteria | 5978 |
| 194 | Ga0070659_100020362 | 3300005366 | Bacteria | 5037 |
| 195 | Ga0070659_100029070 | 3300005366 | Bacteria | 4271 |
| 196 | Ga0070659_100029798 | 3300005366 | Bacteria | 4219 |
| 197 | Ga0070659_100030187 | 3300005366 | Bacteria | 4194 |
| 198 | Ga0070659_100050449 | 3300005366 | Bacteria | 3271 |
| 199 | Ga0070659_100358077 | 3300005366 | Bacteria | 1225 |
| 200 | Ga0070667_100000031 | 3300005367 | Bacteria | 177447 |
| 201 | Ga0070667_100002868 | 3300005367 | Bacteria | 14864 |
| 202 | Ga0070667_100006052 | 3300005367 | Bacteria | 10050 |
| 203 | Ga0070667_100008509 | 3300005367 | Bacteria | 8507 |
| 204 | Ga0070667_100044059 | 3300005367 | Bacteria | 3746 |
| 205 | Ga0070667_100064433 | 3300005367 | Bacteria | 3110 |
| 206 | Ga0070667_100154506 | 3300005367 | Bacteria | 2017 |
| 207 | Ga0070700_100033128 | 3300005441 | Bacteria | 3110 |
| 208 | Ga0070694_100266830 | 3300005444 | Bacteria | 1300 |
| 209 | Ga0070694_100373718 | 3300005444 | Bacteria | 1110 |
| 210 | Ga0070663_100119612 | 3300005455 | Bacteria | 1988 |
| 211 | Ga0070663_100129873 | 3300005455 | Unclassified | 1912 |
| 212 | Ga0070663_100144770 | 3300005455 | Bacteria | 1817 |
| 213 | Ga0070663_100197823 | 3300005455 | Bacteria | 1567 |
| 214 | Ga0070663_100302322 | 3300005455 | Bacteria | 1281 |
| 215 | Ga0070678_100035844 | 3300005456 | Bacteria | 3468 |
| 216 | Ga0070678_100050171 | 3300005456 | Bacteria | 3017 |
| 217 | Ga0070678_100060376 | 3300005456 | Bacteria | 2791 |
| 218 | Ga0070678_100121658 | 3300005456 | Unclassified | 2059 |
| 219 | Ga0070678_100232254 | 3300005456 | Bacteria | 1538 |
| 220 | Ga0070662_100002529 | 3300005457 | Bacteria | 11273 |
| 221 | Ga0070662_100005807 | 3300005457 | Bacteria | 7913 |
| 222 | Ga0070662_100012492 | 3300005457 | Bacteria | 5631 |
| 223 | Ga0070662_100018748 | 3300005457 | Bacteria | 4685 |
| 224 | Ga0070662_100105351 | 3300005457 | Bacteria | 2141 |
| 225 | Ga0070662_100310114 | 3300005457 | Bacteria | 1284 |
| 226 | Ga0070681_10058199 | 3300005458 | Bacteria | 3845 |
| 227 | Ga0070681_10096648 | 3300005458 | Bacteria | 2902 |
| 228 | Ga0070681_10154662 | 3300005458 | Bacteria | 2219 |
| 229 | Ga0070681_10228065 | 3300005458 | Bacteria | 1777 |
| 230 | Ga0068867_100003157 | 3300005459 | Bacteria | 11621 |
| 231 | Ga0068867_100006892 | 3300005459 | Bacteria | 8041 |
| 232 | Ga0068867_100015431 | 3300005459 | Bacteria | 5418 |
| 233 | Ga0068867_100016374 | 3300005459 | Bacteria | 5263 |
| 234 | Ga0068867_100023362 | 3300005459 | Bacteria | 4427 |
| 235 | Ga0068867_100028363 | 3300005459 | Archaea | 4030 |
| 236 | Ga0068867_100172854 | 3300005459 | Bacteria | 1712 |
| 237 | Ga0068867_100199724 | 3300005459 | Bacteria | 1600 |
| 238 | Ga0068867_100303340 | 3300005459 | Bacteria | 1317 |
| 239 | Ga0068867_100414964 | 3300005459 | Bacteria | 1139 |
| 240 | Ga0068867_100428912 | 3300005459 | Bacteria | 1122 |
| 241 | Ga0068867_100473155 | 3300005459 | Bacteria | 1072 |
| 242 | Ga0070685_10016450 | 3300005466 | Bacteria | 3941 |
| 243 | Ga0070685_10028206 | 3300005466 | Bacteria | 3110 |
| 244 | Ga0070685_10136608 | 3300005466 | Bacteria | 1539 |
| 245 | Ga0070685_10184022 | 3300005466 | Bacteria | 1347 |
| 246 | Ga0070685_10206964 | 3300005466 | Bacteria | 1278 |
| 247 | Ga0070698_100001074 | 3300005471 | Bacteria | 30038 |
| 248 | Ga0070698_100021867 | 3300005471 | Bacteria | 6698 |
| 249 | Ga0070699_100058158 | 3300005518 | Bacteria | 3349 |
| 250 | Ga0070679_100000065 | 3300005530 | Bacteria | 78829 |
| 251 | Ga0070679_100002882 | 3300005530 | Bacteria | 15627 |
| 252 | Ga0070679_100036718 | 3300005530 | Bacteria | 4863 |
| 253 | Ga0070679_100042591 | 3300005530 | Bacteria | 4522 |
| 254 | Ga0070679_100065722 | 3300005530 | Bacteria | 3615 |
| 255 | Ga0070679_100078001 | 3300005530 | Unclassified | 3302 |
| 256 | Ga0070679_100216120 | 3300005530 | Bacteria | 1879 |
| 257 | Ga0070684_100000105 | 3300005535 | Bacteria | 54272 |
| 258 | Ga0070684_100004644 | 3300005535 | Bacteria | 10480 |
| 259 | Ga0070684_100015175 | 3300005535 | Bacteria | 6265 |
| 260 | Ga0070684_100043075 | 3300005535 | Bacteria | 3898 |
| 261 | Ga0070684_100108475 | 3300005535 | Bacteria | 2487 |
| 262 | Ga0070684_100273147 | 3300005535 | Bacteria | 1548 |
| 263 | Ga0068853_100003177 | 3300005539 | Bacteria | 12555 |
| 264 | Ga0068853_100003898 | 3300005539 | Bacteria | 11435 |
| 265 | Ga0068853_100007950 | 3300005539 | Bacteria | 8505 |
| 266 | Ga0068853_100015462 | 3300005539 | Bacteria | 6270 |
| 267 | Ga0068853_100035465 | 3300005539 | Bacteria | 4237 |
| 268 | Ga0068853_100070895 | 3300005539 | Bacteria | 3034 |
| 269 | Ga0068853_100080921 | 3300005539 | Bacteria | 2843 |
| 270 | Ga0068853_100087381 | 3300005539 | Bacteria | 2736 |
| 271 | Ga0068853_100088826 | 3300005539 | Bacteria | 2714 |
| 272 | Ga0068853_100152453 | 3300005539 | Bacteria | 2081 |
| 273 | Ga0068853_100191692 | 3300005539 | Bacteria | 1857 |
| 274 | Ga0068853_100208714 | 3300005539 | Bacteria | 1780 |
| 275 | Ga0068853_100256843 | 3300005539 | Bacteria | 1605 |
| 276 | Ga0068853_100304439 | 3300005539 | Bacteria | 1474 |
| 277 | Ga0068853_100428591 | 3300005539 | Bacteria | 1241 |
| 278 | Ga0068853_100665724 | 3300005539 | Bacteria | 991 |
| 279 | Ga0070672_100000002 | 3300005543 | Bacteria | 159809 |
| 280 | Ga0070672_100083989 | 3300005543 | Bacteria | 2556 |
| 281 | Ga0070672_100085753 | 3300005543 | Bacteria | 2531 |
| 282 | Ga0070672_100086807 | 3300005543 | Bacteria | 2517 |
| 283 | Ga0070672_100087552 | 3300005543 | Bacteria | 2506 |
| 284 | Ga0070672_100109598 | 3300005543 | Bacteria | 2249 |
| 285 | Ga0070672_100156804 | 3300005543 | Bacteria | 1886 |
| 286 | Ga0070672_100212025 | 3300005543 | Bacteria | 1622 |
| 287 | Ga0070672_100342433 | 3300005543 | Unclassified | 1273 |
| 288 | Ga0070672_100610667 | 3300005543 | Bacteria | 950 |
| 289 | Ga0070686_100003465 | 3300005544 | Bacteria | 8649 |
| 290 | Ga0070686_100065937 | 3300005544 | Bacteria | 2353 |
| 291 | Ga0070686_100329803 | 3300005544 | Unclassified | 1140 |
| 292 | Ga0070665_100000014 | 3300005548 | Bacteria | 484881 |
| 293 | Ga0070665_100005140 | 3300005548 | Bacteria | 13552 |
| 294 | Ga0070665_100006640 | 3300005548 | Bacteria | 11761 |
| 295 | Ga0070665_100065618 | 3300005548 | Bacteria | 3641 |
| 296 | Ga0070665_100273570 | 3300005548 | Unclassified | 1691 |
| 297 | Ga0070704_100149618 | 3300005549 | Bacteria | 1834 |
| 298 | Ga0068855_100000145 | 3300005563 | Bacteria | 91452 |
| 299 | Ga0068855_100006230 | 3300005563 | Bacteria | 14539 |
| 300 | Ga0068855_100011315 | 3300005563 | Bacteria | 10775 |
| 301 | Ga0068855_100014337 | 3300005563 | Bacteria | 9544 |
| 302 | Ga0068855_100027736 | 3300005563 | Bacteria | 6776 |
| 303 | Ga0068855_100040477 | 3300005563 | Bacteria | 5531 |
| 304 | Ga0068855_100042967 | 3300005563 | Bacteria | 5355 |
| 305 | Ga0068855_100045242 | 3300005563 | Bacteria | 5205 |
| 306 | Ga0068855_100055060 | 3300005563 | Bacteria | 4673 |
| 307 | Ga0068855_100094589 | 3300005563 | Bacteria | 3445 |
| 308 | Ga0068855_100115606 | 3300005563 | Bacteria | 3075 |
| 309 | Ga0068855_100480018 | 3300005563 | Bacteria | 1353 |
| 310 | Ga0068855_100798562 | 3300005563 | Bacteria | 1003 |
| 311 | Ga0070664_100018131 | 3300005564 | Bacteria | 5778 |
| 312 | Ga0070664_100023801 | 3300005564 | Bacteria | 5059 |
| 313 | Ga0070664_100030215 | 3300005564 | Bacteria | 4520 |
| 314 | Ga0070664_100048984 | 3300005564 | Bacteria | 3572 |
| 315 | Ga0070664_100054281 | 3300005564 | Bacteria | 3399 |
| 316 | Ga0070664_100056052 | 3300005564 | Unclassified | 3348 |
| 317 | Ga0070664_100100457 | 3300005564 | Bacteria | 2515 |
| 318 | Ga0070664_100102850 | 3300005564 | Bacteria | 2486 |
| 319 | Ga0070664_100369083 | 3300005564 | Bacteria | 1308 |
| 320 | Ga0068857_100002762 | 3300005577 | Bacteria | 14423 |
| 321 | Ga0068857_100005990 | 3300005577 | Bacteria | 10383 |
| 322 | Ga0068857_100031692 | 3300005577 | Bacteria | 4673 |
| 323 | Ga0068857_100042049 | 3300005577 | Bacteria | 4053 |
| 324 | Ga0068857_100058032 | 3300005577 | Bacteria | 3436 |
| 325 | Ga0068857_100095977 | 3300005577 | Unclassified | 2657 |
| 326 | Ga0068857_100105944 | 3300005577 | Bacteria | 2525 |
| 327 | Ga0068857_100113488 | 3300005577 | Bacteria | 2436 |
| 328 | Ga0068857_100134867 | 3300005577 | Bacteria | 2229 |
| 329 | Ga0068857_100175180 | 3300005577 | Bacteria | 1951 |
| 330 | Ga0068857_100396788 | 3300005577 | Bacteria | 1283 |
| 331 | Ga0068854_100012054 | 3300005578 | Bacteria | 5651 |
| 332 | Ga0068854_100057238 | 3300005578 | Bacteria | 2812 |
| 333 | Ga0068854_100082132 | 3300005578 | Bacteria | 2382 |
| 334 | Ga0068854_100108321 | 3300005578 | Unclassified | 2092 |
| 335 | Ga0068854_100134408 | 3300005578 | Bacteria | 1892 |
| 336 | Ga0068854_100198184 | 3300005578 | Bacteria | 1577 |
| 337 | Ga0068854_100242548 | 3300005578 | Unclassified | 1436 |
| 338 | Ga0068854_100316913 | 3300005578 | Bacteria | 1266 |
| 339 | Ga0068856_100013815 | 3300005614 | Bacteria | 7807 |
| 340 | Ga0068856_100089008 | 3300005614 | Bacteria | 3069 |
| 341 | Ga0068856_100103576 | 3300005614 | Bacteria | 2839 |
| 342 | Ga0068856_100110381 | 3300005614 | Bacteria | 2747 |
| 343 | Ga0068856_100148652 | 3300005614 | Bacteria | 2351 |
| 344 | Ga0070702_100047398 | 3300005615 | Bacteria | 2441 |
| 345 | Ga0070702_100169858 | 3300005615 | Bacteria | 1417 |
| 346 | Ga0068852_100000460 | 3300005616 | Bacteria | 26906 |
| 347 | Ga0068852_100000633 | 3300005616 | Bacteria | 22982 |
| 348 | Ga0068852_100005237 | 3300005616 | Bacteria | 9250 |
| 349 | Ga0068852_100023821 | 3300005616 | Bacteria | 4936 |
| 350 | Ga0068852_100071128 | 3300005616 | Bacteria | 3054 |
| 351 | Ga0068852_100071686 | 3300005616 | Bacteria | 3043 |
| 352 | Ga0068852_100077426 | 3300005616 | Bacteria | 2940 |
| 353 | Ga0068852_100093553 | 3300005616 | Bacteria | 2694 |
| 354 | Ga0068852_100107484 | 3300005616 | Bacteria | 2531 |
| 355 | Ga0068852_100162450 | 3300005616 | Bacteria | 2087 |
| 356 | Ga0068852_100162995 | 3300005616 | Bacteria | 2083 |
| 357 | Ga0068852_100198257 | 3300005616 | Unclassified | 1899 |
| 358 | Ga0068852_100237693 | 3300005616 | Bacteria | 1739 |
| 359 | Ga0068852_100905361 | 3300005616 | Unclassified | 899 |
| 360 | Ga0068859_100000025 | 3300005617 | Bacteria | 191679 |
| 361 | Ga0068859_100000620 | 3300005617 | Bacteria | 35497 |
| 362 | Ga0068859_100014339 | 3300005617 | Bacteria | 7949 |
| 363 | Ga0068859_100024129 | 3300005617 | Bacteria | 6103 |
| 364 | Ga0068859_100034637 | 3300005617 | Bacteria | 5067 |
| 365 | Ga0068859_100054126 | 3300005617 | Bacteria | 4036 |
| 366 | Ga0068859_100079230 | 3300005617 | Bacteria | 3325 |
| 367 | Ga0068859_100117846 | 3300005617 | Bacteria | 2721 |
| 368 | Ga0068859_100274321 | 3300005617 | Bacteria | 1779 |
| 369 | Ga0068859_100426097 | 3300005617 | Unclassified | 1423 |
| 370 | Ga0068859_100460509 | 3300005617 | Unclassified | 1368 |
| 371 | Ga0068859_100509932 | 3300005617 | Bacteria | 1298 |
| 372 | Ga0068864_100013058 | 3300005618 | Bacteria | 6878 |
| 373 | Ga0068864_100015413 | 3300005618 | Bacteria | 6356 |
| 374 | Ga0068864_100079728 | 3300005618 | Bacteria | 2867 |
| 375 | Ga0068864_100084956 | 3300005618 | Bacteria | 2782 |
| 376 | Ga0068864_100086870 | 3300005618 | Bacteria | 2752 |
| 377 | Ga0068864_100153531 | 3300005618 | Bacteria | 2088 |
| 378 | Ga0068864_100191828 | 3300005618 | Bacteria | 1873 |
| 379 | Ga0068864_100294288 | 3300005618 | Unclassified | 1518 |
| 380 | Ga0068864_100743853 | 3300005618 | Unclassified | 961 |
| 381 | Ga0068866_10038324 | 3300005718 | Bacteria | 2359 |
| 382 | Ga0068861_100003363 | 3300005719 | Bacteria | 10599 |
| 383 | Ga0068861_100018392 | 3300005719 | Bacteria | 4979 |
| 384 | Ga0068861_100105925 | 3300005719 | Bacteria | 2246 |
| 385 | Ga0068861_100125876 | 3300005719 | Bacteria | 2073 |
| 386 | Ga0068861_100147400 | 3300005719 | Unclassified | 1927 |
| 387 | Ga0068861_100158400 | 3300005719 | Bacteria | 1865 |
| 388 | Ga0068861_100187976 | 3300005719 | Bacteria | 1724 |
| 389 | Ga0068861_100450583 | 3300005719 | Bacteria | 1153 |
| 390 | Ga0068861_100453952 | 3300005719 | Bacteria | 1149 |
| 391 | Ga0068851_10002711 | 3300005834 | Bacteria | 7805 |
| 392 | Ga0068851_10011257 | 3300005834 | Bacteria | 4192 |
| 393 | Ga0068851_10020857 | 3300005834 | Unclassified | 3177 |
| 394 | Ga0068851_10032956 | 3300005834 | Bacteria | 2579 |
| 395 | Ga0068870_10001746 | 3300005840 | Bacteria | 8904 |
| 396 | Ga0068870_10044115 | 3300005840 | Bacteria | 2328 |
| 397 | Ga0068870_10063064 | 3300005840 | Bacteria | 1998 |
| 398 | Ga0068870_10075756 | 3300005840 | Bacteria | 1846 |
| 399 | Ga0068870_10246494 | 3300005840 | Unclassified | 1106 |
| 400 | Ga0068863_100000828 | 3300005841 | Bacteria | 31036 |
| 401 | Ga0068863_100006381 | 3300005841 | Bacteria | 11566 |
| 402 | Ga0068863_100091628 | 3300005841 | Bacteria | 2883 |
| 403 | Ga0068863_100126528 | 3300005841 | Bacteria | 2438 |
| 404 | Ga0068863_100167737 | 3300005841 | Bacteria | 2105 |
| 405 | Ga0068863_100172052 | 3300005841 | Bacteria | 2078 |
| 406 | Ga0068863_100191952 | 3300005841 | Bacteria | 1963 |
| 407 | Ga0068863_100192948 | 3300005841 | Bacteria | 1958 |
| 408 | Ga0068863_100363649 | 3300005841 | Bacteria | 1411 |
| 409 | Ga0068863_100371395 | 3300005841 | Bacteria | 1396 |
| 410 | Ga0068863_100442018 | 3300005841 | Bacteria | 1275 |
| 411 | Ga0068858_100000083 | 3300005842 | Bacteria | 98991 |
| 412 | Ga0068858_100007865 | 3300005842 | Bacteria | 10276 |
| 413 | Ga0068858_100060801 | 3300005842 | Bacteria | 3492 |
| 414 | Ga0068858_100155548 | 3300005842 | Unclassified | 2151 |
| 415 | Ga0068858_100350304 | 3300005842 | Bacteria | 1414 |
| 416 | Ga0068860_100000394 | 3300005843 | Bacteria | 57127 |
| 417 | Ga0068860_100001434 | 3300005843 | Bacteria | 25816 |
| 418 | Ga0068860_100002803 | 3300005843 | Bacteria | 18140 |
| 419 | Ga0068860_100004639 | 3300005843 | Bacteria | 14035 |
| 420 | Ga0068860_100017100 | 3300005843 | Bacteria | 7070 |
| 421 | Ga0068860_100019703 | 3300005843 | Bacteria | 6541 |
| 422 | Ga0068860_100045115 | 3300005843 | Bacteria | 4202 |
| 423 | Ga0068860_100050964 | 3300005843 | Bacteria | 3940 |
| 424 | Ga0068860_100081217 | 3300005843 | Bacteria | 3083 |
| 425 | Ga0068860_100198969 | 3300005843 | Unclassified | 1941 |
| 426 | Ga0068860_100210570 | 3300005843 | Bacteria | 1886 |
| 427 | Ga0068860_100290179 | 3300005843 | Bacteria | 1600 |
| 428 | Ga0068860_100290977 | 3300005843 | Bacteria | 1598 |
| 429 | Ga0068862_100006063 | 3300005844 | Bacteria | 10066 |
| 430 | Ga0068862_100025061 | 3300005844 | Bacteria | 5007 |
| 431 | Ga0068862_100178592 | 3300005844 | Unclassified | 1904 |
| 432 | Ga0068862_100191067 | 3300005844 | Bacteria | 1842 |
| 433 | Ga0068862_100384352 | 3300005844 | Bacteria | 1310 |
| 434 | Ga0081455_10200441 | 3300005937 | Bacteria | 1495 |
| 435 | Ga0081540_1004387 | 3300005983 | Bacteria | 10781 |
| 436 | Ga0081539_10000120 | 3300005985 | Bacteria | 183566 |
| 437 | Ga0081539_10079698 | 3300005985 | Bacteria | 1725 |
| 438 | Ga0070716_100233976 | 3300006173 | Bacteria | 1242 |
| 439 | Ga0075366_10001639 | 3300006195 | Bacteria | 11231 |
| 440 | Ga0097621_100000359 | 3300006237 | Bacteria | 31567 |
| 441 | Ga0097621_100005579 | 3300006237 | Bacteria | 8871 |
| 442 | Ga0097621_100006732 | 3300006237 | Bacteria | 8164 |
| 443 | Ga0097621_100007074 | 3300006237 | Bacteria | 7997 |
| 444 | Ga0097621_100014116 | 3300006237 | Bacteria | 5971 |
| 445 | Ga0097621_100026798 | 3300006237 | Bacteria | 4526 |
| 446 | Ga0097621_100033358 | 3300006237 | Bacteria | 4099 |
| 447 | Ga0097621_100042230 | 3300006237 | Bacteria | 3673 |
| 448 | Ga0097621_100045409 | 3300006237 | Bacteria | 3549 |
| 449 | Ga0097621_100125632 | 3300006237 | Bacteria | 2179 |
| 450 | Ga0097621_100344847 | 3300006237 | Bacteria | 1323 |
| 451 | Ga0097621_100350049 | 3300006237 | Bacteria | 1314 |
| 452 | Ga0075370_10134258 | 3300006353 | Bacteria | 1445 |
| 453 | Ga0068871_100000201 | 3300006358 | Bacteria | 41079 |
| 454 | Ga0068871_100001122 | 3300006358 | Bacteria | 17960 |
| 455 | Ga0068871_100001167 | 3300006358 | Bacteria | 17651 |
| 456 | Ga0068871_100004905 | 3300006358 | Bacteria | 9345 |
| 457 | Ga0068871_100016233 | 3300006358 | Bacteria | 5600 |
| 458 | Ga0068871_100017179 | 3300006358 | Bacteria | 5469 |
| 459 | Ga0068871_100032661 | 3300006358 | Bacteria | 4113 |
| 460 | Ga0068871_100059335 | 3300006358 | Bacteria | 3117 |
| 461 | Ga0068871_100091360 | 3300006358 | Bacteria | 2537 |
| 462 | Ga0068871_100130796 | 3300006358 | Bacteria | 2128 |
| 463 | Ga0068871_100205334 | 3300006358 | Bacteria | 1703 |
| 464 | Ga0068871_100220007 | 3300006358 | Bacteria | 1645 |
| 465 | Ga0068871_100241784 | 3300006358 | Bacteria | 1569 |
| 466 | Ga0068871_100279066 | 3300006358 | Bacteria | 1461 |
| 467 | Ga0068871_100339180 | 3300006358 | Bacteria | 1327 |
| 468 | Ga0075428_100013338 | 3300006844 | Bacteria | 9143 |
| 469 | Ga0075428_100022436 | 3300006844 | Bacteria | 6990 |
| 470 | Ga0075428_100095842 | 3300006844 | Bacteria | 3235 |
| 471 | Ga0075428_100432096 | 3300006844 | Bacteria | 1411 |
| 472 | Ga0075430_100000960 | 3300006846 | Bacteria | 22735 |
| 473 | Ga0075430_100030207 | 3300006846 | Bacteria | 4601 |
| 474 | Ga0075431_100003991 | 3300006847 | Bacteria | 14378 |
| 475 | Ga0075431_100105960 | 3300006847 | Bacteria | 2900 |
| 476 | Ga0075431_100172339 | 3300006847 | Bacteria | 2223 |
| 477 | Ga0075433_10276765 | 3300006852 | Bacteria | 1487 |
| 478 | Ga0075429_100000723 | 3300006880 | Bacteria | 25874 |
| 479 | Ga0075429_100021817 | 3300006880 | Bacteria | 5551 |
| 480 | Ga0068865_100006537 | 3300006881 | Bacteria | 7123 |
| 481 | Ga0068865_100006991 | 3300006881 | Bacteria | 6922 |
| 482 | Ga0068865_100339307 | 3300006881 | Bacteria | 1214 |
| 483 | Ga0097620_100000025 | 3300006931 | Bacteria | 191679 |
| 484 | Ga0097620_100000620 | 3300006931 | Bacteria | 35497 |
| 485 | Ga0097620_100014339 | 3300006931 | Bacteria | 7949 |
| 486 | Ga0097620_100024129 | 3300006931 | Bacteria | 6103 |
| 487 | Ga0097620_100034637 | 3300006931 | Bacteria | 5067 |
| 488 | Ga0097620_100054126 | 3300006931 | Bacteria | 4036 |
| 489 | Ga0097620_100079229 | 3300006931 | Bacteria | 3325 |
| 490 | Ga0097620_100117848 | 3300006931 | Bacteria | 2721 |
| 491 | Ga0097620_100274313 | 3300006931 | Bacteria | 1779 |
| 492 | Ga0097620_100426142 | 3300006931 | Unclassified | 1423 |
| 493 | Ga0097620_100460531 | 3300006931 | Unclassified | 1368 |
| 494 | Ga0097620_100509905 | 3300006931 | Bacteria | 1298 |
| 495 | Ga0105244_10068242 | 3300009036 | Bacteria | 1777 |
| 496 | Ga0105240_10000736 | 3300009093 | Bacteria | 59883 |
| 497 | Ga0105240_10008191 | 3300009093 | Bacteria | 14980 |
| 498 | Ga0105240_10025004 | 3300009093 | Bacteria | 7860 |
| 499 | Ga0105240_10055887 | 3300009093 | Bacteria | 4941 |
| 500 | Ga0105240_10114513 | 3300009093 | Bacteria | 3257 |
| 501 | Ga0105240_10115744 | 3300009093 | Bacteria | 3236 |
| 502 | Ga0105240_10150908 | 3300009093 | Bacteria | 2768 |
| 503 | Ga0105240_10153175 | 3300009093 | Bacteria | 2744 |
| 504 | Ga0105240_10171124 | 3300009093 | Bacteria | 2573 |
| 505 | Ga0105240_10242673 | 3300009093 | Bacteria | 2088 |
| 506 | Ga0105240_10604195 | 3300009093 | Bacteria | 1207 |
| 507 | Ga0111539_10013194 | 3300009094 | Bacteria | 10332 |
| 508 | Ga0111539_10017894 | 3300009094 | Bacteria | 8778 |
| 509 | Ga0111539_10058363 | 3300009094 | Bacteria | 4579 |
| 510 | Ga0111539_10189035 | 3300009094 | Bacteria | 2404 |
| 511 | Ga0111539_10362812 | 3300009094 | Bacteria | 1686 |
| 512 | Ga0111539_10972321 | 3300009094 | Bacteria | 987 |
| 513 | Ga0105245_10082218 | 3300009098 | Bacteria | 2946 |
| 514 | Ga0105245_10159574 | 3300009098 | Bacteria | 2139 |
| 515 | Ga0105247_10005517 | 3300009101 | Bacteria | 7963 |
| 516 | Ga0105247_10006929 | 3300009101 | Bacteria | 6978 |
| 517 | Ga0105247_10046703 | 3300009101 | Bacteria | 2658 |
| 518 | Ga0105247_10074751 | 3300009101 | Bacteria | 2126 |
| 519 | Ga0114129_10005551 | 3300009147 | Bacteria | 17840 |
| 520 | Ga0114129_10041895 | 3300009147 | Bacteria | 6447 |
| 521 | Ga0114129_10065908 | 3300009147 | Bacteria | 5052 |
| 522 | Ga0114129_10337473 | 3300009147 | Bacteria | 2000 |
| 523 | Ga0105243_10000003 | 3300009148 | Bacteria | 712931 |
| 524 | Ga0105243_10235422 | 3300009148 | Bacteria | 1627 |
| 525 | Ga0105243_10268929 | 3300009148 | Bacteria | 1529 |
| 526 | Ga0105241_10000252 | 3300009174 | Bacteria | 40539 |
| 527 | Ga0105241_10001151 | 3300009174 | Bacteria | 20122 |
| 528 | Ga0105241_10002136 | 3300009174 | Bacteria | 14943 |
| 529 | Ga0105241_10189042 | 3300009174 | Bacteria | 1713 |
| 530 | Ga0105241_10333041 | 3300009174 | Bacteria | 1313 |
| 531 | Ga0105241_10385974 | 3300009174 | Bacteria | 1225 |
| 532 | Ga0105241_10507199 | 3300009174 | Unclassified | 1077 |
| 533 | Ga0105241_10644542 | 3300009174 | Bacteria | 961 |
| 534 | Ga0105242_10014635 | 3300009176 | Bacteria | 6073 |
| 535 | Ga0105242_10015096 | 3300009176 | Bacteria | 5994 |
| 536 | Ga0105242_10041366 | 3300009176 | Bacteria | 3717 |
| 537 | Ga0105242_10079922 | 3300009176 | Bacteria | 2732 |
| 538 | Ga0105242_10130708 | 3300009176 | Bacteria | 2167 |
| 539 | Ga0105242_10322900 | 3300009176 | Bacteria | 1416 |
| 540 | Ga0105242_10343582 | 3300009176 | Unclassified | 1376 |
| 541 | Ga0105248_10033685 | 3300009177 | Bacteria | 5724 |
| 542 | Ga0105248_10105872 | 3300009177 | Bacteria | 3171 |
| 543 | Ga0105248_10475104 | 3300009177 | Bacteria | 1409 |
| 544 | Ga0105248_10650473 | 3300009177 | Bacteria | 1189 |
| 545 | Ga0105237_10000120 | 3300009545 | Bacteria | 109953 |
| 546 | Ga0105237_10000191 | 3300009545 | Bacteria | 87065 |
| 547 | Ga0105237_10000650 | 3300009545 | Bacteria | 48489 |
| 548 | Ga0105237_10002013 | 3300009545 | Bacteria | 25878 |
| 549 | Ga0105237_10005067 | 3300009545 | Bacteria | 14969 |
| 550 | Ga0105237_10006188 | 3300009545 | Bacteria | 13363 |
| 551 | Ga0105237_10008039 | 3300009545 | Bacteria | 11472 |
| 552 | Ga0105237_10008044 | 3300009545 | Bacteria | 11467 |
| 553 | Ga0105237_10056852 | 3300009545 | Bacteria | 3915 |
| 554 | Ga0105237_10057424 | 3300009545 | Bacteria | 3895 |
| 555 | Ga0105237_10072842 | 3300009545 | Bacteria | 3429 |
| 556 | Ga0105237_10189673 | 3300009545 | Bacteria | 2056 |
| 557 | Ga0105237_10265166 | 3300009545 | Bacteria | 1721 |
| 558 | Ga0105237_10660497 | 3300009545 | Bacteria | 1052 |
| 559 | Ga0105238_10000488 | 3300009551 | Bacteria | 41712 |
| 560 | Ga0105238_10004065 | 3300009551 | Bacteria | 14503 |
| 561 | Ga0105238_10153283 | 3300009551 | Bacteria | 2279 |
| 562 | Ga0105238_10285597 | 3300009551 | Bacteria | 1632 |
| 563 | Ga0105238_10367911 | 3300009551 | Bacteria | 1428 |
| 564 | Ga0105249_10001096 | 3300009553 | Bacteria | 24070 |
| 565 | Ga0105249_10001117 | 3300009553 | Bacteria | 23873 |
| 566 | Ga0105249_10003110 | 3300009553 | Bacteria | 14341 |
| 567 | Ga0105249_10017168 | 3300009553 | Bacteria | 6425 |
| 568 | Ga0105249_10026113 | 3300009553 | Bacteria | 5261 |
| 569 | Ga0105249_10033107 | 3300009553 | Bacteria | 4679 |
| 570 | Ga0105249_10069957 | 3300009553 | Bacteria | 3239 |
| 571 | Ga0105249_10072653 | 3300009553 | Bacteria | 3181 |
| 572 | Ga0105249_10188257 | 3300009553 | Bacteria | 2013 |
| 573 | Ga0105249_10265924 | 3300009553 | Bacteria | 1706 |
| 574 | Ga0105249_10308745 | 3300009553 | Unclassified | 1589 |
| 575 | Ga0105249_10515747 | 3300009553 | Unclassified | 1242 |
| 576 | Ga0105249_10574319 | 3300009553 | Bacteria | 1180 |
| 577 | Ga0105249_10871748 | 3300009553 | Bacteria | 966 |
| 578 | Ga0105239_10000019 | 3300010375 | Bacteria | 273836 |
| 579 | Ga0105239_10001466 | 3300010375 | Bacteria | 31358 |
| 580 | Ga0105239_10006447 | 3300010375 | Bacteria | 13611 |
| 581 | Ga0105239_10006468 | 3300010375 | Bacteria | 13590 |
| 582 | Ga0105239_10009941 | 3300010375 | Bacteria | 10682 |
| 583 | Ga0105239_10012772 | 3300010375 | Bacteria | 9343 |
| 584 | Ga0105239_10013262 | 3300010375 | Bacteria | 9159 |
| 585 | Ga0105239_10020677 | 3300010375 | Bacteria | 7261 |
| 586 | Ga0105239_10036305 | 3300010375 | Bacteria | 5411 |
| 587 | Ga0105239_10097580 | 3300010375 | Bacteria | 3247 |
| 588 | Ga0105239_10145469 | 3300010375 | Bacteria | 2643 |
| 589 | Ga0105239_10175404 | 3300010375 | Bacteria | 2397 |
| 590 | Ga0105239_10207311 | 3300010375 | Bacteria | 2197 |
| 591 | Ga0105239_10272393 | 3300010375 | Bacteria | 1904 |
| 592 | Ga0105239_10500130 | 3300010375 | Bacteria | 1382 |
| 593 | Ga0105246_10010776 | 3300011119 | Bacteria | 5666 |
| 594 | Ga0105246_10044034 | 3300011119 | Bacteria | 3031 |
| 595 | Ga0105246_10093878 | 3300011119 | Bacteria | 2168 |
| 596 | Ga0105246_10119725 | 3300011119 | Bacteria | 1949 |
| 597 | Ga0105246_10273011 | 3300011119 | Bacteria | 1352 |
| 598 | Ga0157373_10001608 | 3300013100 | Bacteria | 17242 |
| 599 | Ga0157373_10002576 | 3300013100 | Bacteria | 13778 |
| 600 | Ga0157373_10006807 | 3300013100 | Bacteria | 8513 |
| 601 | Ga0157373_10024575 | 3300013100 | Unclassified | 4363 |
| 602 | Ga0157373_10064345 | 3300013100 | Bacteria | 2596 |
| 603 | Ga0157373_10070418 | 3300013100 | Bacteria | 2471 |
| 604 | Ga0157373_10070852 | 3300013100 | Bacteria | 2463 |
| 605 | Ga0157373_10128654 | 3300013100 | Bacteria | 1781 |
| 606 | Ga0157373_10230328 | 3300013100 | Unclassified | 1308 |
| 607 | Ga0157373_10346201 | 3300013100 | Bacteria | 1060 |
| 608 | Ga0157371_10000654 | 3300013102 | Bacteria | 41046 |
| 609 | Ga0157371_10001795 | 3300013102 | Bacteria | 21712 |
| 610 | Ga0157371_10002288 | 3300013102 | Bacteria | 18460 |
| 611 | Ga0157371_10002367 | 3300013102 | Bacteria | 18046 |
| 612 | Ga0157371_10011887 | 3300013102 | Bacteria | 6680 |
| 613 | Ga0157371_10012155 | 3300013102 | Bacteria | 6595 |
| 614 | Ga0157371_10022720 | 3300013102 | Bacteria | 4590 |
| 615 | Ga0157371_10024374 | 3300013102 | Bacteria | 4419 |
| 616 | Ga0157371_10024595 | 3300013102 | Bacteria | 4395 |
| 617 | Ga0157371_10026284 | 3300013102 | Bacteria | 4233 |
| 618 | Ga0157371_10031438 | 3300013102 | Bacteria | 3824 |
| 619 | Ga0157371_10032065 | 3300013102 | Bacteria | 3782 |
| 620 | Ga0157371_10044804 | 3300013102 | Bacteria | 3149 |
| 621 | Ga0157371_10058776 | 3300013102 | Bacteria | 2727 |
| 622 | Ga0157371_10073071 | 3300013102 | Bacteria | 2429 |
| 623 | Ga0157371_10079490 | 3300013102 | Bacteria | 2323 |
| 624 | Ga0157371_10149832 | 3300013102 | Bacteria | 1663 |
| 625 | Ga0157371_10194448 | 3300013102 | Bacteria | 1453 |
| 626 | Ga0157371_10276722 | 3300013102 | Bacteria | 1212 |
| 627 | Ga0157370_10000245 | 3300013104 | Bacteria | 69550 |
| 628 | Ga0157370_10003395 | 3300013104 | Bacteria | 18708 |
| 629 | Ga0157370_10006366 | 3300013104 | Bacteria | 13032 |
| 630 | Ga0157370_10007344 | 3300013104 | Bacteria | 12021 |
| 631 | Ga0157370_10024360 | 3300013104 | Bacteria | 5993 |
| 632 | Ga0157370_10025512 | 3300013104 | Bacteria | 5852 |
| 633 | Ga0157370_10035327 | 3300013104 | Bacteria | 4860 |
| 634 | Ga0157370_10040331 | 3300013104 | Bacteria | 4508 |
| 635 | Ga0157370_10044800 | 3300013104 | Bacteria | 4248 |
| 636 | Ga0157370_10070334 | 3300013104 | Bacteria | 3303 |
| 637 | Ga0157370_10194728 | 3300013104 | Bacteria | 1881 |
| 638 | Ga0157370_10433930 | 3300013104 | Bacteria | 1208 |
| 639 | Ga0157369_10036773 | 3300013105 | Bacteria | 5363 |
| 640 | Ga0157369_10039810 | 3300013105 | Bacteria | 5136 |
| 641 | Ga0157369_10072312 | 3300013105 | Unclassified | 3701 |
| 642 | Ga0157369_10080255 | 3300013105 | Bacteria | 3494 |
| 643 | Ga0157369_10119228 | 3300013105 | Bacteria | 2800 |
| 644 | Ga0157369_10132318 | 3300013105 | Bacteria | 2642 |
| 645 | Ga0157369_10161892 | 3300013105 | Bacteria | 2362 |
| 646 | Ga0157369_10194417 | 3300013105 | Bacteria | 2131 |
| 647 | Ga0157369_10208577 | 3300013105 | Bacteria | 2049 |
| 648 | Ga0157369_10407816 | 3300013105 | Bacteria | 1410 |
| 649 | Ga0157369_10608313 | 3300013105 | Unclassified | 1128 |
| 650 | Ga0157374_10000011 | 3300013296 | Bacteria | 466749 |
| 651 | Ga0157374_10000074 | 3300013296 | Bacteria | 99947 |
| 652 | Ga0157374_10009861 | 3300013296 | Bacteria | 8198 |
| 653 | Ga0157374_10072173 | 3300013296 | Bacteria | 3256 |
| 654 | Ga0157374_10090817 | 3300013296 | Bacteria | 2912 |
| 655 | Ga0157374_10180635 | 3300013296 | Bacteria | 2061 |
| 656 | Ga0157374_10216219 | 3300013296 | Bacteria | 1880 |
| 657 | Ga0157374_10263202 | 3300013296 | Unclassified | 1699 |
| 658 | Ga0157374_10281422 | 3300013296 | Bacteria | 1642 |
| 659 | Ga0157374_10330394 | 3300013296 | Bacteria | 1512 |
| 660 | Ga0157374_10348706 | 3300013296 | Bacteria | 1471 |
| 661 | Ga0157374_10364789 | 3300013296 | Bacteria | 1437 |
| 662 | Ga0157374_10707811 | 3300013296 | Bacteria | 1020 |
| 663 | Ga0157374_10758437 | 3300013296 | Bacteria | 985 |
| 664 | Ga0157374_10787728 | 3300013296 | Bacteria | 966 |
| 665 | Ga0157378_10001083 | 3300013297 | Bacteria | 24880 |
| 666 | Ga0157378_10003875 | 3300013297 | Bacteria | 13240 |
| 667 | Ga0157378_10007261 | 3300013297 | Bacteria | 9675 |
| 668 | Ga0157378_10021877 | 3300013297 | Bacteria | 5623 |
| 669 | Ga0157378_10032861 | 3300013297 | Bacteria | 4586 |
| 670 | Ga0157378_10034119 | 3300013297 | Bacteria | 4501 |
| 671 | Ga0157378_10035551 | 3300013297 | Bacteria | 4407 |
| 672 | Ga0157378_10084594 | 3300013297 | Unclassified | 2872 |
| 673 | Ga0157378_10112226 | 3300013297 | Bacteria | 2500 |
| 674 | Ga0157378_10154180 | 3300013297 | Bacteria | 2143 |
| 675 | Ga0157378_10270672 | 3300013297 | Bacteria | 1633 |
| 676 | Ga0163162_10000029 | 3300013306 | Bacteria | 168510 |
| 677 | Ga0163162_10000424 | 3300013306 | Bacteria | 38989 |
| 678 | Ga0163162_10000672 | 3300013306 | Bacteria | 31760 |
| 679 | Ga0163162_10001000 | 3300013306 | Bacteria | 26251 |
| 680 | Ga0163162_10006904 | 3300013306 | Bacteria | 11009 |
| 681 | Ga0163162_10008883 | 3300013306 | Bacteria | 9772 |
| 682 | Ga0163162_10010208 | 3300013306 | Bacteria | 9123 |
| 683 | Ga0163162_10018237 | 3300013306 | Bacteria | 6874 |
| 684 | Ga0163162_10024706 | 3300013306 | Bacteria | 5935 |
| 685 | Ga0163162_10026812 | 3300013306 | Bacteria | 5697 |
| 686 | Ga0163162_10028572 | 3300013306 | Bacteria | 5519 |
| 687 | Ga0163162_10050625 | 3300013306 | Bacteria | 4165 |
| 688 | Ga0163162_10067934 | 3300013306 | Bacteria | 3615 |
| 689 | Ga0163162_10218104 | 3300013306 | Bacteria | 2038 |
| 690 | Ga0163162_10236174 | 3300013306 | Bacteria | 1958 |
| 691 | Ga0163162_10292488 | 3300013306 | Bacteria | 1760 |
| 692 | Ga0163162_10298858 | 3300013306 | Bacteria | 1742 |
| 693 | Ga0163162_10371074 | 3300013306 | Bacteria | 1564 |
| 694 | Ga0163162_10421456 | 3300013306 | Unclassified | 1467 |
| 695 | Ga0163162_10531460 | 3300013306 | Bacteria | 1305 |
| 696 | Ga0157372_10000437 | 3300013307 | Bacteria | 45952 |
| 697 | Ga0157372_10001585 | 3300013307 | Bacteria | 24755 |
| 698 | Ga0157372_10012413 | 3300013307 | Bacteria | 9079 |
| 699 | Ga0157372_10016411 | 3300013307 | Bacteria | 7945 |
| 700 | Ga0157372_10056409 | 3300013307 | Bacteria | 4389 |
| 701 | Ga0157372_10060176 | 3300013307 | Bacteria | 4250 |
| 702 | Ga0157372_10063383 | 3300013307 | Bacteria | 4144 |
| 703 | Ga0157372_10109708 | 3300013307 | Bacteria | 3160 |
| 704 | Ga0157372_10130082 | 3300013307 | Bacteria | 2896 |
| 705 | Ga0157372_10136921 | 3300013307 | Unclassified | 2821 |
| 706 | Ga0157372_10147859 | 3300013307 | Bacteria | 2710 |
| 707 | Ga0157372_10174508 | 3300013307 | Bacteria | 2488 |
| 708 | Ga0157372_10182361 | 3300013307 | Bacteria | 2430 |
| 709 | Ga0157372_10201359 | 3300013307 | Bacteria | 2306 |
| 710 | Ga0157372_10220428 | 3300013307 | Bacteria | 2199 |
| 711 | Ga0157372_10245123 | 3300013307 | Bacteria | 2080 |
| 712 | Ga0157372_10264132 | 3300013307 | Unclassified | 1999 |
| 713 | Ga0157372_10319300 | 3300013307 | Bacteria | 1808 |
| 714 | Ga0157372_10416760 | 3300013307 | Bacteria | 1565 |
| 715 | Ga0157372_10422184 | 3300013307 | Bacteria | 1554 |
| 716 | Ga0157372_10554957 | 3300013307 | Unclassified | 1339 |
| 717 | Ga0157372_10662951 | 3300013307 | Bacteria | 1215 |
| 718 | Ga0157372_10760567 | 3300013307 | Bacteria | 1126 |
| 719 | Ga0157372_11030038 | 3300013307 | Bacteria | 953 |
| 720 | Ga0157375_10000042 | 3300013308 | Bacteria | 160008 |
| 721 | Ga0157375_10002200 | 3300013308 | Bacteria | 16851 |
| 722 | Ga0157375_10007437 | 3300013308 | Bacteria | 9585 |
| 723 | Ga0157375_10011363 | 3300013308 | Bacteria | 7860 |
| 724 | Ga0157375_10014906 | 3300013308 | Bacteria | 6949 |
| 725 | Ga0157375_10025790 | 3300013308 | Bacteria | 5468 |
| 726 | Ga0157375_10034205 | 3300013308 | Bacteria | 4839 |
| 727 | Ga0157375_10038344 | 3300013308 | Bacteria | 4601 |
| 728 | Ga0157375_10056879 | 3300013308 | Bacteria | 3864 |
| 729 | Ga0157375_10070453 | 3300013308 | Bacteria | 3506 |
| 730 | Ga0157375_10077650 | 3300013308 | Bacteria | 3351 |
| 731 | Ga0157375_10082250 | 3300013308 | Bacteria | 3261 |
| 732 | Ga0157375_10097218 | 3300013308 | Bacteria | 3018 |
| 733 | Ga0157375_10111190 | 3300013308 | Bacteria | 2838 |
| 734 | Ga0157375_10154445 | 3300013308 | Bacteria | 2433 |
| 735 | Ga0157375_10252055 | 3300013308 | Bacteria | 1926 |
| 736 | Ga0157375_10270982 | 3300013308 | Bacteria | 1860 |
| 737 | Ga0157375_10304199 | 3300013308 | Bacteria | 1758 |
| 738 | Ga0157375_10418166 | 3300013308 | Bacteria | 1507 |
| 739 | Ga0157375_10535583 | 3300013308 | Unclassified | 1334 |
| 740 | Ga0157375_10574349 | 3300013308 | Bacteria | 1288 |
| 741 | Ga0157375_10958960 | 3300013308 | Bacteria | 997 |
| 742 | Ga0163163_10000076 | 3300014325 | Bacteria | 108784 |
| 743 | Ga0163163_10000831 | 3300014325 | Bacteria | 26270 |
| 744 | Ga0163163_10033255 | 3300014325 | Bacteria | 4988 |
| 745 | Ga0163163_10053691 | 3300014325 | Bacteria | 3979 |
| 746 | Ga0163163_10130386 | 3300014325 | Bacteria | 2554 |
| 747 | Ga0163163_10132443 | 3300014325 | Bacteria | 2533 |
| 748 | Ga0163163_10369200 | 3300014325 | Unclassified | 1492 |
| 749 | Ga0163163_10393907 | 3300014325 | Bacteria | 1443 |
| 750 | Ga0163163_10636995 | 3300014325 | Bacteria | 1129 |
| 751 | Ga0163163_10907084 | 3300014325 | Bacteria | 945 |
| 752 | Ga0157380_10000002 | 3300014326 | Bacteria | 236273 |
| 753 | Ga0157380_10001454 | 3300014326 | Bacteria | 15501 |
| 754 | Ga0157380_10003690 | 3300014326 | Bacteria | 10535 |
| 755 | Ga0157380_10267766 | 3300014326 | Bacteria | 1556 |
| 756 | Ga0157380_10339410 | 3300014326 | Bacteria | 1401 |
| 757 | Ga0157380_10357059 | 3300014326 | Unclassified | 1370 |
| 758 | Ga0157380_10596903 | 3300014326 | Bacteria | 1092 |
| 759 | Ga0182008_10005441 | 3300014497 | Bacteria | 7248 |
| 760 | Ga0157377_10003347 | 3300014745 | Bacteria | 7252 |
| 761 | Ga0157377_10015347 | 3300014745 | Bacteria | 3917 |
| 762 | Ga0157377_10095577 | 3300014745 | Bacteria | 1761 |
| 763 | Ga0157377_10111841 | 3300014745 | Bacteria | 1643 |
| 764 | Ga0157377_10204534 | 3300014745 | Bacteria | 1255 |
| 765 | Ga0157379_10000016 | 3300014968 | Bacteria | 103230 |
| 766 | Ga0157379_10010412 | 3300014968 | Bacteria | 8103 |
| 767 | Ga0157379_10016392 | 3300014968 | Bacteria | 6517 |
| 768 | Ga0157379_10024947 | 3300014968 | Bacteria | 5307 |
| 769 | Ga0157379_10075002 | 3300014968 | Bacteria | 3028 |
| 770 | Ga0157379_10120063 | 3300014968 | Bacteria | 2364 |
| 771 | Ga0157379_10131879 | 3300014968 | Bacteria | 2249 |
| 772 | Ga0157379_10459960 | 3300014968 | Bacteria | 1176 |
| 773 | Ga0157376_10000558 | 3300014969 | Bacteria | 23999 |
| 774 | Ga0157376_10000938 | 3300014969 | Bacteria | 18935 |
| 775 | Ga0157376_10002924 | 3300014969 | Bacteria | 11719 |
| 776 | Ga0157376_10014629 | 3300014969 | Bacteria | 5895 |
| 777 | Ga0157376_10018081 | 3300014969 | Bacteria | 5393 |
| 778 | Ga0157376_10099827 | 3300014969 | Bacteria | 2533 |
| 779 | Ga0157376_10129355 | 3300014969 | Bacteria | 2250 |
| 780 | Ga0157376_10245852 | 3300014969 | Bacteria | 1669 |
| 781 | Ga0157376_10296198 | 3300014969 | Bacteria | 1529 |
| 782 | Ga0157376_10317430 | 3300014969 | Bacteria | 1480 |
| 783 | Ga0157376_10689700 | 3300014969 | Unclassified | 1025 |
| 784 | Ga0182006_1000893 | 3300015261 | Bacteria | 20006 |
| 785 | Ga0182006_1001377 | 3300015261 | Bacteria | 14795 |
| 786 | Ga0182005_1000017 | 3300015265 | Bacteria | 331828 |
| 787 | Ga0163161_10003336 | 3300017792 | Bacteria | 11258 |
| 788 | Ga0163161_10007628 | 3300017792 | Bacteria | 7485 |
| 789 | Ga0163161_10024679 | 3300017792 | Bacteria | 4250 |
| 790 | Ga0163161_10039783 | 3300017792 | Bacteria | 3377 |
| 791 | Ga0163161_10116336 | 3300017792 | Bacteria | 2004 |
| 792 | Ga0163161_10171946 | 3300017792 | Bacteria | 1657 |
| 793 | Ga0163161_10179539 | 3300017792 | Bacteria | 1622 |
| 794 | Ga0163161_10222332 | 3300017792 | Bacteria | 1463 |
| 795 | Ga0163161_10627263 | 3300017792 | Unclassified | 889 |
| 796 | Ga0206356_10730104 | 3300020070 | Unclassified | 948 |
| 797 | Ga0206355_1278720 | 3300020076 | Unclassified | 867 |
| 798 | Ga0206352_10162521 | 3300020078 | Bacteria | 1010 |
| 799 | Ga0206352_10618337 | 3300020078 | Bacteria | 908 |
| 800 | Ga0206352_11221074 | 3300020078 | Bacteria | 1173 |
| 801 | Ga0206354_10545400 | 3300020081 | Unclassified | 955 |
| 802 | Ga0213876_10006069 | 3300021384 | Bacteria | 6602 |
| 803 | Ga0213876_10036217 | 3300021384 | Bacteria | 2603 |
| 804 | Ga0224712_10043848 | 3300022467 | Bacteria | 1703 |
| 805 | Ga0224572_1019768 | 3300024225 | Bacteria | 1294 |
| 806 | Ga0209436_100091 | 3300025208 | Bacteria | 44391 |
| 807 | Ga0209436_100717 | 3300025208 | Bacteria | 13871 |
| 808 | Ga0209258_100029 | 3300025242 | Bacteria | 490648 |
| 809 | Ga0209646_1000031 | 3300025246 | Bacteria | 381260 |
| 810 | Ga0209026_1000019 | 3300025250 | Bacteria | 381260 |
| 811 | Ga0209148_1000194 | 3300025254 | Bacteria | 112740 |
| 812 | Ga0209129_1012807 | 3300025258 | Bacteria | 1891 |
| 813 | Ga0209673_1000666 | 3300025273 | Bacteria | 49900 |
| 814 | Ga0209130_1000333 | 3300025284 | Bacteria | 54192 |
| 815 | Ga0209758_1001097 | 3300025297 | Bacteria | 35040 |
| 816 | Ga0209758_1004546 | 3300025297 | Bacteria | 11460 |
| 817 | Ga0209050_1000216 | 3300025298 | Bacteria | 128896 |
| 818 | Ga0207426_1000024 | 3300025302 | Bacteria | 534075 |
| 819 | Ga0207426_1000059 | 3300025302 | Bacteria | 363842 |
| 820 | Ga0207426_1000666 | 3300025302 | Bacteria | 41827 |
| 821 | Ga0207426_1000691 | 3300025302 | Bacteria | 40521 |
| 822 | Ga0209051_1007049 | 3300025303 | Bacteria | 6218 |
| 823 | Ga0209257_1000004 | 3300025304 | Bacteria | 1678347 |
| 824 | Ga0209257_1003253 | 3300025304 | Bacteria | 14242 |
| 825 | Ga0207697_10049829 | 3300025315 | Unclassified | 1729 |
| 826 | Ga0207697_10051080 | 3300025315 | Bacteria | 1708 |
| 827 | Ga0207656_10000821 | 3300025321 | Bacteria | 10125 |
| 828 | Ga0207656_10015219 | 3300025321 | Bacteria | 2974 |
| 829 | Ga0207656_10022122 | 3300025321 | Bacteria | 2548 |
| 830 | Ga0207656_10027244 | 3300025321 | Bacteria | 2336 |
| 831 | Ga0207656_10040772 | 3300025321 | Bacteria | 1970 |
| 832 | Ga0207682_10010686 | 3300025893 | Bacteria | 3592 |
| 833 | Ga0207682_10022867 | 3300025893 | Bacteria | 2466 |
| 834 | Ga0207682_10083185 | 3300025893 | Bacteria | 1375 |
| 835 | Ga0207642_10105304 | 3300025899 | Bacteria | 1425 |
| 836 | Ga0207710_10001261 | 3300025900 | Bacteria | 12795 |
| 837 | Ga0207710_10036425 | 3300025900 | Bacteria | 2169 |
| 838 | Ga0207710_10100545 | 3300025900 | Unclassified | 1363 |
| 839 | Ga0207688_10012530 | 3300025901 | Bacteria | 4615 |
| 840 | Ga0207688_10028696 | 3300025901 | Bacteria | 3061 |
| 841 | Ga0207688_10214351 | 3300025901 | Bacteria | 1158 |
| 842 | Ga0207680_10000180 | 3300025903 | Bacteria | 30911 |
| 843 | Ga0207680_10004944 | 3300025903 | Bacteria | 6349 |
| 844 | Ga0207680_10006836 | 3300025903 | Bacteria | 5537 |
| 845 | Ga0207680_10012039 | 3300025903 | Bacteria | 4395 |
| 846 | Ga0207680_10024014 | 3300025903 | Bacteria | 3339 |
| 847 | Ga0207680_10060980 | 3300025903 | Bacteria | 2299 |
| 848 | Ga0207680_10153329 | 3300025903 | Unclassified | 1538 |
| 849 | Ga0207647_10000096 | 3300025904 | Bacteria | 67468 |
| 850 | Ga0207647_10001348 | 3300025904 | Bacteria | 18854 |
| 851 | Ga0207647_10009415 | 3300025904 | Bacteria | 6941 |
| 852 | Ga0207647_10067026 | 3300025904 | Unclassified | 2176 |
| 853 | Ga0207647_10125267 | 3300025904 | Bacteria | 1512 |
| 854 | Ga0207685_10052456 | 3300025905 | Unclassified | 1580 |
| 855 | Ga0207645_10002072 | 3300025907 | Bacteria | 16048 |
| 856 | Ga0207645_10002123 | 3300025907 | Bacteria | 15868 |
| 857 | Ga0207645_10058517 | 3300025907 | Unclassified | 2460 |
| 858 | Ga0207645_10076107 | 3300025907 | Bacteria | 2149 |
| 859 | Ga0207645_10110367 | 3300025907 | Bacteria | 1780 |
| 860 | Ga0207645_10111439 | 3300025907 | Bacteria | 1772 |
| 861 | Ga0207645_10138762 | 3300025907 | Bacteria | 1584 |
| 862 | Ga0207645_10152646 | 3300025907 | Bacteria | 1508 |
| 863 | Ga0207643_10006656 | 3300025908 | Bacteria | 6196 |
| 864 | Ga0207643_10027271 | 3300025908 | Bacteria | 3166 |
| 865 | Ga0207643_10076603 | 3300025908 | Bacteria | 1932 |
| 866 | Ga0207643_10082550 | 3300025908 | Bacteria | 1863 |
| 867 | Ga0207643_10250870 | 3300025908 | Unclassified | 1090 |
| 868 | Ga0207643_10285482 | 3300025908 | Bacteria | 1024 |
| 869 | Ga0207705_10031691 | 3300025909 | Bacteria | 3775 |
| 870 | Ga0207705_10033295 | 3300025909 | Bacteria | 3681 |
| 871 | Ga0207705_10042329 | 3300025909 | Bacteria | 3269 |
| 872 | Ga0207705_10069308 | 3300025909 | Unclassified | 2554 |
| 873 | Ga0207705_10131318 | 3300025909 | Bacteria | 1864 |
| 874 | Ga0207705_10159548 | 3300025909 | Unclassified | 1694 |
| 875 | Ga0207654_10000120 | 3300025911 | Bacteria | 50396 |
| 876 | Ga0207654_10010550 | 3300025911 | Bacteria | 4705 |
| 877 | Ga0207654_10019977 | 3300025911 | Bacteria | 3544 |
| 878 | Ga0207654_10092538 | 3300025911 | Bacteria | 1846 |
| 879 | Ga0207654_10482197 | 3300025911 | Bacteria | 873 |
| 880 | Ga0207707_10004370 | 3300025912 | Bacteria | 12497 |
| 881 | Ga0207707_10008847 | 3300025912 | Bacteria | 8745 |
| 882 | Ga0207707_10087100 | 3300025912 | Bacteria | 2729 |
| 883 | Ga0207707_10175527 | 3300025912 | Bacteria | 1872 |
| 884 | Ga0207707_10289080 | 3300025912 | Unclassified | 1418 |
| 885 | Ga0207695_10000010 | 3300025913 | Bacteria | 981919 |
| 886 | Ga0207695_10000212 | 3300025913 | Bacteria | 156450 |
| 887 | Ga0207695_10001109 | 3300025913 | Bacteria | 46822 |
| 888 | Ga0207695_10017475 | 3300025913 | Bacteria | 8347 |
| 889 | Ga0207695_10030002 | 3300025913 | Bacteria | 5996 |
| 890 | Ga0207695_10031859 | 3300025913 | Bacteria | 5776 |
| 891 | Ga0207695_10037303 | 3300025913 | Bacteria | 5245 |
| 892 | Ga0207695_10163964 | 3300025913 | Bacteria | 2152 |
| 893 | Ga0207695_10243718 | 3300025913 | Bacteria | 1698 |
| 894 | Ga0207695_10245236 | 3300025913 | Bacteria | 1692 |
| 895 | Ga0207695_10302182 | 3300025913 | Unclassified | 1491 |
| 896 | Ga0207695_10316749 | 3300025913 | Bacteria | 1450 |
| 897 | Ga0207695_10469246 | 3300025913 | Bacteria | 1141 |
| 898 | Ga0207671_10000340 | 3300025914 | Bacteria | 68615 |
| 899 | Ga0207671_10001357 | 3300025914 | Bacteria | 28586 |
| 900 | Ga0207671_10003261 | 3300025914 | Bacteria | 16318 |
| 901 | Ga0207671_10003705 | 3300025914 | Bacteria | 15062 |
| 902 | Ga0207671_10035342 | 3300025914 | Bacteria | 3710 |
| 903 | Ga0207671_10041351 | 3300025914 | Bacteria | 3411 |
| 904 | Ga0207671_10083739 | 3300025914 | Bacteria | 2395 |
| 905 | Ga0207671_10234818 | 3300025914 | Bacteria | 1439 |
| 906 | Ga0207671_10295940 | 3300025914 | Bacteria | 1278 |
| 907 | Ga0207660_10001477 | 3300025917 | Bacteria | 15821 |
| 908 | Ga0207660_10022771 | 3300025917 | Bacteria | 4223 |
| 909 | Ga0207660_10052122 | 3300025917 | Bacteria | 2912 |
| 910 | Ga0207660_10056415 | 3300025917 | Unclassified | 2810 |
| 911 | Ga0207660_10072413 | 3300025917 | Unclassified | 2509 |
| 912 | Ga0207660_10154475 | 3300025917 | Bacteria | 1766 |
| 913 | Ga0207660_10154493 | 3300025917 | Unclassified | 1766 |
| 914 | Ga0207662_10012235 | 3300025918 | Bacteria | 4776 |
| 915 | Ga0207662_10056131 | 3300025918 | Bacteria | 2351 |
| 916 | Ga0207662_10076848 | 3300025918 | Unclassified | 2030 |
| 917 | Ga0207662_10119226 | 3300025918 | Bacteria | 1653 |
| 918 | Ga0207657_10004066 | 3300025919 | Bacteria | 15521 |
| 919 | Ga0207657_10004391 | 3300025919 | Bacteria | 14923 |
| 920 | Ga0207657_10025198 | 3300025919 | Bacteria | 5489 |
| 921 | Ga0207657_10031882 | 3300025919 | Bacteria | 4767 |
| 922 | Ga0207657_10043993 | 3300025919 | Bacteria | 3929 |
| 923 | Ga0207657_10116687 | 3300025919 | Bacteria | 2199 |
| 924 | Ga0207657_10146883 | 3300025919 | Bacteria | 1923 |
| 925 | Ga0207657_10160518 | 3300025919 | Bacteria | 1826 |
| 926 | Ga0207657_10283212 | 3300025919 | Unclassified | 1316 |
| 927 | Ga0207649_10000517 | 3300025920 | Bacteria | 27099 |
| 928 | Ga0207649_10011163 | 3300025920 | Bacteria | 4946 |
| 929 | Ga0207649_10021552 | 3300025920 | Bacteria | 3711 |
| 930 | Ga0207649_10190033 | 3300025920 | Bacteria | 1444 |
| 931 | Ga0207652_10000013 | 3300025921 | Bacteria | 222247 |
| 932 | Ga0207652_10000329 | 3300025921 | Bacteria | 49068 |
| 933 | Ga0207652_10001523 | 3300025921 | Bacteria | 20448 |
| 934 | Ga0207652_10001591 | 3300025921 | Bacteria | 19987 |
| 935 | Ga0207652_10005883 | 3300025921 | Bacteria | 9926 |
| 936 | Ga0207652_10011840 | 3300025921 | Bacteria | 7036 |
| 937 | Ga0207652_10040022 | 3300025921 | Bacteria | 3980 |
| 938 | Ga0207652_10126827 | 3300025921 | Bacteria | 2274 |
| 939 | Ga0207652_10144618 | 3300025921 | Bacteria | 2127 |
| 940 | Ga0207646_10391372 | 3300025922 | Bacteria | 1256 |
| 941 | Ga0207681_10014560 | 3300025923 | Bacteria | 4891 |
| 942 | Ga0207681_10031756 | 3300025923 | Bacteria | 3451 |
| 943 | Ga0207681_10034216 | 3300025923 | Bacteria | 3339 |
| 944 | Ga0207681_10068321 | 3300025923 | Bacteria | 2468 |
| 945 | Ga0207681_10089268 | 3300025923 | Unclassified | 2197 |
| 946 | Ga0207681_10337437 | 3300025923 | Bacteria | 1203 |
| 947 | Ga0207694_10054999 | 3300025924 | Bacteria | 3089 |
| 948 | Ga0207694_10130131 | 3300025924 | Bacteria | 2017 |
| 949 | Ga0207650_10012150 | 3300025925 | Bacteria | 5935 |
| 950 | Ga0207650_10037753 | 3300025925 | Bacteria | 3522 |
| 951 | Ga0207650_10042335 | 3300025925 | Bacteria | 3341 |
| 952 | Ga0207650_10137968 | 3300025925 | Bacteria | 1915 |
| 953 | Ga0207650_10208311 | 3300025925 | Unclassified | 1569 |
| 954 | Ga0207650_10234174 | 3300025925 | Bacteria | 1482 |
| 955 | Ga0207650_10263301 | 3300025925 | Bacteria | 1399 |
| 956 | Ga0207650_10385229 | 3300025925 | Bacteria | 1158 |
| 957 | Ga0207650_10438730 | 3300025925 | Bacteria | 1085 |
| 958 | Ga0207659_10006103 | 3300025926 | Bacteria | 7360 |
| 959 | Ga0207659_10051718 | 3300025926 | Bacteria | 2923 |
| 960 | Ga0207659_10106616 | 3300025926 | Bacteria | 2122 |
| 961 | Ga0207659_10164864 | 3300025926 | Bacteria | 1743 |
| 962 | Ga0207659_10457943 | 3300025926 | Bacteria | 1075 |
| 963 | Ga0207687_10178243 | 3300025927 | Bacteria | 1644 |
| 964 | Ga0207700_10248404 | 3300025928 | Bacteria | 1519 |
| 965 | Ga0207644_10004756 | 3300025931 | Bacteria | 8827 |
| 966 | Ga0207644_10030460 | 3300025931 | Bacteria | 3753 |
| 967 | Ga0207644_10037828 | 3300025931 | Bacteria | 3397 |
| 968 | Ga0207644_10045455 | 3300025931 | Bacteria | 3124 |
| 969 | Ga0207644_10046314 | 3300025931 | Bacteria | 3098 |
| 970 | Ga0207644_10046902 | 3300025931 | Bacteria | 3081 |
| 971 | Ga0207644_10080543 | 3300025931 | Bacteria | 2405 |
| 972 | Ga0207644_10238286 | 3300025931 | Unclassified | 1448 |
| 973 | Ga0207644_10246214 | 3300025931 | Bacteria | 1425 |
| 974 | Ga0207644_10260345 | 3300025931 | Bacteria | 1387 |
| 975 | Ga0207690_10027492 | 3300025932 | Bacteria | 3595 |
| 976 | Ga0207690_10029618 | 3300025932 | Bacteria | 3483 |
| 977 | Ga0207690_10113531 | 3300025932 | Bacteria | 1955 |
| 978 | Ga0207690_10316554 | 3300025932 | Bacteria | 1225 |
| 979 | Ga0207706_10003226 | 3300025933 | Bacteria | 15653 |
| 980 | Ga0207706_10004361 | 3300025933 | Bacteria | 13293 |
| 981 | Ga0207706_10008919 | 3300025933 | Bacteria | 9232 |
| 982 | Ga0207706_10009576 | 3300025933 | Bacteria | 8893 |
| 983 | Ga0207706_10022581 | 3300025933 | Bacteria | 5647 |
| 984 | Ga0207706_10040076 | 3300025933 | Bacteria | 4151 |
| 985 | Ga0207686_10003596 | 3300025934 | Bacteria | 8305 |
| 986 | Ga0207686_10107892 | 3300025934 | Bacteria | 1872 |
| 987 | Ga0207686_10199244 | 3300025934 | Bacteria | 1433 |
| 988 | Ga0207686_10255952 | 3300025934 | Bacteria | 1281 |
| 989 | Ga0207686_10328042 | 3300025934 | Unclassified | 1146 |
| 990 | Ga0207709_10000008 | 3300025935 | Bacteria | 713099 |
| 991 | Ga0207709_10189099 | 3300025935 | Bacteria | 1461 |
| 992 | Ga0207670_10006176 | 3300025936 | Bacteria | 6628 |
| 993 | Ga0207670_10009418 | 3300025936 | Bacteria | 5574 |
| 994 | Ga0207670_10048455 | 3300025936 | Bacteria | 2836 |
| 995 | Ga0207670_10163858 | 3300025936 | Bacteria | 1662 |
| 996 | Ga0207670_10256603 | 3300025936 | Bacteria | 1353 |
| 997 | Ga0207670_10313974 | 3300025936 | Bacteria | 1231 |
| 998 | Ga0207669_10014263 | 3300025937 | Bacteria | 3978 |
| 999 | Ga0207669_10021719 | 3300025937 | Bacteria | 3394 |
| 1000 | Ga0207669_10127132 | 3300025937 | Archaea | 1744 |
| 1001 | Ga0207669_10201904 | 3300025937 | Unclassified | 1444 |
| 1002 | Ga0207704_10001247 | 3300025938 | Bacteria | 11358 |
| 1003 | Ga0207704_10234523 | 3300025938 | Bacteria | 1367 |
| 1004 | Ga0207704_10388213 | 3300025938 | Unclassified | 1098 |
| 1005 | Ga0207704_10539151 | 3300025938 | Bacteria | 946 |
| 1006 | Ga0207691_10000004 | 3300025940 | Bacteria | 168729 |
| 1007 | Ga0207691_10009229 | 3300025940 | Bacteria | 9468 |
| 1008 | Ga0207691_10026474 | 3300025940 | Bacteria | 5440 |
| 1009 | Ga0207691_10029257 | 3300025940 | Bacteria | 5153 |
| 1010 | Ga0207691_10049555 | 3300025940 | Bacteria | 3848 |
| 1011 | Ga0207691_10065330 | 3300025940 | Bacteria | 3294 |
| 1012 | Ga0207691_10069185 | 3300025940 | Bacteria | 3189 |
| 1013 | Ga0207691_10114385 | 3300025940 | Bacteria | 2397 |
| 1014 | Ga0207691_10199328 | 3300025940 | Bacteria | 1743 |
| 1015 | Ga0207691_10229000 | 3300025940 | Bacteria | 1610 |
| 1016 | Ga0207691_10254514 | 3300025940 | Bacteria | 1515 |
| 1017 | Ga0207689_10000208 | 3300025942 | Bacteria | 51706 |
| 1018 | Ga0207689_10002065 | 3300025942 | Bacteria | 18954 |
| 1019 | Ga0207689_10002750 | 3300025942 | Bacteria | 16259 |
| 1020 | Ga0207689_10004957 | 3300025942 | Bacteria | 11988 |
| 1021 | Ga0207689_10008548 | 3300025942 | Bacteria | 8924 |
| 1022 | Ga0207689_10012192 | 3300025942 | Bacteria | 7353 |
| 1023 | Ga0207689_10017732 | 3300025942 | Bacteria | 6015 |
| 1024 | Ga0207689_10023984 | 3300025942 | Bacteria | 5118 |
| 1025 | Ga0207689_10031339 | 3300025942 | Bacteria | 4427 |
| 1026 | Ga0207689_10037762 | 3300025942 | Bacteria | 4004 |
| 1027 | Ga0207689_10037955 | 3300025942 | Bacteria | 3992 |
| 1028 | Ga0207689_10041929 | 3300025942 | Bacteria | 3787 |
| 1029 | Ga0207689_10052250 | 3300025942 | Bacteria | 3368 |
| 1030 | Ga0207689_10117376 | 3300025942 | Bacteria | 2188 |
| 1031 | Ga0207689_10346052 | 3300025942 | Unclassified | 1235 |
| 1032 | Ga0207661_10030654 | 3300025944 | Bacteria | 4145 |
| 1033 | Ga0207661_10038330 | 3300025944 | Unclassified | 3756 |
| 1034 | Ga0207661_10047917 | 3300025944 | Unclassified | 3394 |
| 1035 | Ga0207661_10054036 | 3300025944 | Bacteria | 3216 |
| 1036 | Ga0207661_10097237 | 3300025944 | Bacteria | 2465 |
| 1037 | Ga0207661_10125868 | 3300025944 | Bacteria | 2188 |
| 1038 | Ga0207661_10226234 | 3300025944 | Bacteria | 1655 |
| 1039 | Ga0207661_10287084 | 3300025944 | Bacteria | 1472 |
| 1040 | Ga0207661_10287379 | 3300025944 | Bacteria | 1471 |
| 1041 | Ga0207661_10654646 | 3300025944 | Bacteria | 965 |
| 1042 | Ga0207679_10000091 | 3300025945 | Bacteria | 78725 |
| 1043 | Ga0207679_10003773 | 3300025945 | Bacteria | 9388 |
| 1044 | Ga0207679_10035549 | 3300025945 | Bacteria | 3526 |
| 1045 | Ga0207679_10094194 | 3300025945 | Bacteria | 2325 |
| 1046 | Ga0207679_10132061 | 3300025945 | Bacteria | 2005 |
| 1047 | Ga0207679_10135301 | 3300025945 | Bacteria | 1984 |
| 1048 | Ga0207679_10176163 | 3300025945 | Bacteria | 1765 |
| 1049 | Ga0207679_10199045 | 3300025945 | Bacteria | 1672 |
| 1050 | Ga0207679_10353138 | 3300025945 | Bacteria | 1282 |
| 1051 | Ga0207679_10502546 | 3300025945 | Bacteria | 1082 |
| 1052 | Ga0207679_10653436 | 3300025945 | Bacteria | 951 |
| 1053 | Ga0207667_10000414 | 3300025949 | Bacteria | 57815 |
| 1054 | Ga0207667_10000508 | 3300025949 | Bacteria | 51422 |
| 1055 | Ga0207667_10006924 | 3300025949 | Bacteria | 13699 |
| 1056 | Ga0207667_10008497 | 3300025949 | Bacteria | 12190 |
| 1057 | Ga0207667_10011491 | 3300025949 | Bacteria | 10284 |
| 1058 | Ga0207667_10013252 | 3300025949 | Bacteria | 9449 |
| 1059 | Ga0207667_10067790 | 3300025949 | Bacteria | 3717 |
| 1060 | Ga0207667_10070009 | 3300025949 | Bacteria | 3652 |
| 1061 | Ga0207667_10075899 | 3300025949 | Bacteria | 3489 |
| 1062 | Ga0207667_10084006 | 3300025949 | Bacteria | 3296 |
| 1063 | Ga0207667_10123760 | 3300025949 | Bacteria | 2664 |
| 1064 | Ga0207667_10249374 | 3300025949 | Bacteria | 1816 |
| 1065 | Ga0207651_10015536 | 3300025960 | Bacteria | 4428 |
| 1066 | Ga0207651_10031671 | 3300025960 | Bacteria | 3384 |
| 1067 | Ga0207651_10048643 | 3300025960 | Bacteria | 2868 |
| 1068 | Ga0207651_10050493 | 3300025960 | Bacteria | 2824 |
| 1069 | Ga0207651_10098087 | 3300025960 | Bacteria | 2166 |
| 1070 | Ga0207651_10108301 | 3300025960 | Bacteria | 2079 |
| 1071 | Ga0207651_10121969 | 3300025960 | Bacteria | 1978 |
| 1072 | Ga0207651_10158018 | 3300025960 | Bacteria | 1774 |
| 1073 | Ga0207651_10285988 | 3300025960 | Bacteria | 1365 |
| 1074 | Ga0207651_10423201 | 3300025960 | Unclassified | 1137 |
| 1075 | Ga0207651_10500797 | 3300025960 | Bacteria | 1050 |
| 1076 | Ga0207651_10599422 | 3300025960 | Unclassified | 963 |
| 1077 | Ga0207651_10645060 | 3300025960 | Bacteria | 929 |
| 1078 | Ga0207712_10000725 | 3300025961 | Bacteria | 25158 |
| 1079 | Ga0207712_10000915 | 3300025961 | Bacteria | 21389 |
| 1080 | Ga0207712_10005612 | 3300025961 | Bacteria | 7913 |
| 1081 | Ga0207712_10007205 | 3300025961 | Bacteria | 7015 |
| 1082 | Ga0207712_10053207 | 3300025961 | Bacteria | 2839 |
| 1083 | Ga0207712_10064039 | 3300025961 | Bacteria | 2619 |
| 1084 | Ga0207712_10083933 | 3300025961 | Bacteria | 2326 |
| 1085 | Ga0207712_10141097 | 3300025961 | Bacteria | 1849 |
| 1086 | Ga0207712_10166988 | 3300025961 | Bacteria | 1716 |
| 1087 | Ga0207712_10206883 | 3300025961 | Bacteria | 1560 |
| 1088 | Ga0207668_10004211 | 3300025972 | Bacteria | 8433 |
| 1089 | Ga0207668_10008780 | 3300025972 | Bacteria | 6037 |
| 1090 | Ga0207668_10013882 | 3300025972 | Bacteria | 4974 |
| 1091 | Ga0207668_10527619 | 3300025972 | Unclassified | 1020 |
| 1092 | Ga0207640_10013120 | 3300025981 | Bacteria | 4740 |
| 1093 | Ga0207640_10020133 | 3300025981 | Bacteria | 3957 |
| 1094 | Ga0207640_10043240 | 3300025981 | Bacteria | 2878 |
| 1095 | Ga0207640_10057300 | 3300025981 | Bacteria | 2562 |
| 1096 | Ga0207640_10082184 | 3300025981 | Bacteria | 2205 |
| 1097 | Ga0207640_10160000 | 3300025981 | Bacteria | 1665 |
| 1098 | Ga0207640_10241970 | 3300025981 | Bacteria | 1395 |
| 1099 | Ga0207658_10019946 | 3300025986 | Bacteria | 4639 |
| 1100 | Ga0207658_10024867 | 3300025986 | Bacteria | 4190 |
| 1101 | Ga0207658_10031625 | 3300025986 | Bacteria | 3760 |
| 1102 | Ga0207658_10069456 | 3300025986 | Bacteria | 2662 |
| 1103 | Ga0207658_10089053 | 3300025986 | Bacteria | 2388 |
| 1104 | Ga0207658_10177859 | 3300025986 | Bacteria | 1758 |
| 1105 | Ga0207658_10194211 | 3300025986 | Bacteria | 1690 |
| 1106 | Ga0207677_10003486 | 3300026023 | Bacteria | 8335 |
| 1107 | Ga0207677_10026032 | 3300026023 | Bacteria | 3661 |
| 1108 | Ga0207677_10062299 | 3300026023 | Bacteria | 2587 |
| 1109 | Ga0207677_10082947 | 3300026023 | Bacteria | 2306 |
| 1110 | Ga0207677_10087612 | 3300026023 | Bacteria | 2254 |
| 1111 | Ga0207677_10118424 | 3300026023 | Bacteria | 1987 |
| 1112 | Ga0207677_10127440 | 3300026023 | Unclassified | 1926 |
| 1113 | Ga0207677_10161634 | 3300026023 | Bacteria | 1741 |
| 1114 | Ga0207677_10313097 | 3300026023 | Bacteria | 1301 |
| 1115 | Ga0207703_10003536 | 3300026035 | Bacteria | 13074 |
| 1116 | Ga0207703_10006511 | 3300026035 | Bacteria | 9322 |
| 1117 | Ga0207703_10029439 | 3300026035 | Bacteria | 4333 |
| 1118 | Ga0207703_10089581 | 3300026035 | Bacteria | 2584 |
| 1119 | Ga0207703_10133639 | 3300026035 | Unclassified | 2146 |
| 1120 | Ga0207703_10141837 | 3300026035 | Bacteria | 2086 |
| 1121 | Ga0207703_10225077 | 3300026035 | Bacteria | 1679 |
| 1122 | Ga0207639_10004779 | 3300026041 | Bacteria | 9134 |
| 1123 | Ga0207639_10010084 | 3300026041 | Bacteria | 6532 |
| 1124 | Ga0207639_10087555 | 3300026041 | Bacteria | 2483 |
| 1125 | Ga0207639_10128106 | 3300026041 | Bacteria | 2097 |
| 1126 | Ga0207639_10131501 | 3300026041 | Unclassified | 2072 |
| 1127 | Ga0207639_10168730 | 3300026041 | Bacteria | 1851 |
| 1128 | Ga0207639_10209481 | 3300026041 | Bacteria | 1677 |
| 1129 | Ga0207639_10308863 | 3300026041 | Bacteria | 1400 |
| 1130 | Ga0207639_10329869 | 3300026041 | Bacteria | 1357 |
| 1131 | Ga0207639_10347079 | 3300026041 | Bacteria | 1325 |
| 1132 | Ga0207639_10775672 | 3300026041 | Bacteria | 892 |
| 1133 | Ga0207678_10009788 | 3300026067 | Bacteria | 8431 |
| 1134 | Ga0207678_10065525 | 3300026067 | Bacteria | 3119 |
| 1135 | Ga0207678_10123871 | 3300026067 | Unclassified | 2206 |
| 1136 | Ga0207678_10135563 | 3300026067 | Bacteria | 2100 |
| 1137 | Ga0207678_10174616 | 3300026067 | Bacteria | 1835 |
| 1138 | Ga0207708_10103813 | 3300026075 | Bacteria | 2202 |
| 1139 | Ga0207708_10184356 | 3300026075 | Bacteria | 1658 |
| 1140 | Ga0207708_10188419 | 3300026075 | Bacteria | 1641 |
| 1141 | Ga0207708_10277393 | 3300026075 | Unclassified | 1357 |
| 1142 | Ga0207702_10011609 | 3300026078 | Bacteria | 7341 |
| 1143 | Ga0207702_10027480 | 3300026078 | Bacteria | 4725 |
| 1144 | Ga0207702_10081623 | 3300026078 | Bacteria | 2808 |
| 1145 | Ga0207702_10103425 | 3300026078 | Bacteria | 2519 |
| 1146 | Ga0207641_10000132 | 3300026088 | Bacteria | 109247 |
| 1147 | Ga0207641_10002402 | 3300026088 | Bacteria | 17295 |
| 1148 | Ga0207641_10018263 | 3300026088 | Bacteria | 5748 |
| 1149 | Ga0207641_10046603 | 3300026088 | Bacteria | 3654 |
| 1150 | Ga0207641_10067826 | 3300026088 | Bacteria | 3057 |
| 1151 | Ga0207641_10092891 | 3300026088 | Bacteria | 2643 |
| 1152 | Ga0207641_10096335 | 3300026088 | Bacteria | 2599 |
| 1153 | Ga0207641_10125266 | 3300026088 | Bacteria | 2299 |
| 1154 | Ga0207641_10179079 | 3300026088 | Bacteria | 1940 |
| 1155 | Ga0207641_10215973 | 3300026088 | Bacteria | 1776 |
| 1156 | Ga0207641_10398965 | 3300026088 | Bacteria | 1320 |
| 1157 | Ga0207641_10513193 | 3300026088 | Bacteria | 1165 |
| 1158 | Ga0207648_10001340 | 3300026089 | Bacteria | 27318 |
| 1159 | Ga0207648_10003198 | 3300026089 | Bacteria | 17248 |
| 1160 | Ga0207648_10010220 | 3300026089 | Bacteria | 8922 |
| 1161 | Ga0207648_10020780 | 3300026089 | Bacteria | 5910 |
| 1162 | Ga0207648_10022209 | 3300026089 | Bacteria | 5700 |
| 1163 | Ga0207648_10026231 | 3300026089 | Bacteria | 5180 |
| 1164 | Ga0207648_10043815 | 3300026089 | Bacteria | 3928 |
| 1165 | Ga0207648_10067539 | 3300026089 | Bacteria | 3117 |
| 1166 | Ga0207648_10070428 | 3300026089 | Bacteria | 3049 |
| 1167 | Ga0207648_10142286 | 3300026089 | Unclassified | 2114 |
| 1168 | Ga0207648_10230280 | 3300026089 | Bacteria | 1648 |
| 1169 | Ga0207648_10247684 | 3300026089 | Bacteria | 1588 |
| 1170 | Ga0207648_10266074 | 3300026089 | Bacteria | 1531 |
| 1171 | Ga0207648_10294865 | 3300026089 | Bacteria | 1453 |
| 1172 | Ga0207648_10700413 | 3300026089 | Bacteria | 939 |
| 1173 | Ga0207676_10003232 | 3300026095 | Bacteria | 11615 |
| 1174 | Ga0207676_10016302 | 3300026095 | Bacteria | 5380 |
| 1175 | Ga0207676_10029182 | 3300026095 | Bacteria | 4128 |
| 1176 | Ga0207676_10058185 | 3300026095 | Bacteria | 3048 |
| 1177 | Ga0207676_10059215 | 3300026095 | Bacteria | 3024 |
| 1178 | Ga0207676_10062970 | 3300026095 | Bacteria | 2944 |
| 1179 | Ga0207676_10132951 | 3300026095 | Bacteria | 2118 |
| 1180 | Ga0207676_10164608 | 3300026095 | Bacteria | 1925 |
| 1181 | Ga0207676_10182900 | 3300026095 | Unclassified | 1837 |
| 1182 | Ga0207676_10187268 | 3300026095 | Bacteria | 1818 |
| 1183 | Ga0207676_10254050 | 3300026095 | Bacteria | 1584 |
| 1184 | Ga0207676_10678489 | 3300026095 | Bacteria | 996 |
| 1185 | Ga0207674_10011872 | 3300026116 | Bacteria | 9766 |
| 1186 | Ga0207674_10018362 | 3300026116 | Bacteria | 7604 |
| 1187 | Ga0207674_10027208 | 3300026116 | Bacteria | 6055 |
| 1188 | Ga0207674_10032221 | 3300026116 | Bacteria | 5499 |
| 1189 | Ga0207674_10039670 | 3300026116 | Bacteria | 4881 |
| 1190 | Ga0207674_10040843 | 3300026116 | Bacteria | 4802 |
| 1191 | Ga0207674_10068910 | 3300026116 | Bacteria | 3558 |
| 1192 | Ga0207674_10070001 | 3300026116 | Bacteria | 3527 |
| 1193 | Ga0207674_10092121 | 3300026116 | Bacteria | 3021 |
| 1194 | Ga0207674_10104554 | 3300026116 | Bacteria | 2810 |
| 1195 | Ga0207674_10111809 | 3300026116 | Bacteria | 2705 |
| 1196 | Ga0207674_10147852 | 3300026116 | Bacteria | 2308 |
| 1197 | Ga0207674_10193603 | 3300026116 | Bacteria | 1983 |
| 1198 | Ga0207674_10417419 | 3300026116 | Bacteria | 1297 |
| 1199 | Ga0207674_10716238 | 3300026116 | Bacteria | 966 |
| 1200 | Ga0207675_100000085 | 3300026118 | Bacteria | 73716 |
| 1201 | Ga0207675_100003521 | 3300026118 | Bacteria | 15283 |
| 1202 | Ga0207675_100054385 | 3300026118 | Bacteria | 3734 |
| 1203 | Ga0207675_100096318 | 3300026118 | Bacteria | 2785 |
| 1204 | Ga0207675_100098397 | 3300026118 | Unclassified | 2755 |
| 1205 | Ga0207675_100145018 | 3300026118 | Bacteria | 2257 |
| 1206 | Ga0207675_100338865 | 3300026118 | Bacteria | 1471 |
| 1207 | Ga0207683_10002163 | 3300026121 | Bacteria | 17263 |
| 1208 | Ga0207683_10028619 | 3300026121 | Bacteria | 4820 |
| 1209 | Ga0207683_10037799 | 3300026121 | Bacteria | 4205 |
| 1210 | Ga0207683_10155039 | 3300026121 | Unclassified | 2068 |
| 1211 | Ga0207683_10167727 | 3300026121 | Bacteria | 1987 |
| 1212 | Ga0207683_10175807 | 3300026121 | Bacteria | 1940 |
| 1213 | Ga0207683_10334120 | 3300026121 | Bacteria | 1389 |
| 1214 | Ga0207698_10000539 | 3300026142 | Bacteria | 21930 |
| 1215 | Ga0207698_10005810 | 3300026142 | Bacteria | 7661 |
| 1216 | Ga0207698_10065555 | 3300026142 | Bacteria | 2853 |
| 1217 | Ga0207698_10085534 | 3300026142 | Bacteria | 2561 |
| 1218 | Ga0207698_10142083 | 3300026142 | Bacteria | 2070 |
| 1219 | Ga0207698_10166166 | 3300026142 | Bacteria | 1937 |
| 1220 | Ga0207698_10273371 | 3300026142 | Bacteria | 1559 |
| 1221 | Ga0209995_1003651 | 3300027471 | Bacteria | 2454 |
| 1222 | Ga0209999_1015920 | 3300027543 | Bacteria | 1368 |
| 1223 | Ga0209974_10055495 | 3300027876 | Bacteria | 1336 |
| 1224 | Ga0207428_10091604 | 3300027907 | Bacteria | 2360 |
| 1225 | Ga0207428_10130501 | 3300027907 | Unclassified | 1923 |
| 1226 | Ga0207428_10234197 | 3300027907 | Bacteria | 1373 |
| 1227 | Ga0268266_10000068 | 3300028379 | Bacteria | 241100 |
| 1228 | Ga0268266_10016217 | 3300028379 | Bacteria | 6368 |
| 1229 | Ga0268266_10016350 | 3300028379 | Bacteria | 6343 |
| 1230 | Ga0268266_10052154 | 3300028379 | Bacteria | 3512 |
| 1231 | Ga0268266_10078828 | 3300028379 | Bacteria | 2867 |
| 1232 | Ga0268266_10120711 | 3300028379 | Bacteria | 2332 |
| 1233 | Ga0268265_10009330 | 3300028380 | Bacteria | 6631 |
| 1234 | Ga0268265_10059591 | 3300028380 | Bacteria | 2921 |
| 1235 | Ga0268265_10136797 | 3300028380 | Bacteria | 2045 |
| 1236 | Ga0268265_10145991 | 3300028380 | Unclassified | 1988 |
| 1237 | Ga0268265_10195756 | 3300028380 | Bacteria | 1749 |
| 1238 | Ga0268265_10213977 | 3300028380 | Bacteria | 1682 |
| 1239 | Ga0268265_10235146 | 3300028380 | Bacteria | 1613 |
| 1240 | Ga0268265_10283559 | 3300028380 | Unclassified | 1483 |
| 1241 | Ga0268265_10372619 | 3300028380 | Bacteria | 1311 |
| 1242 | Ga0268265_10437002 | 3300028380 | Bacteria | 1219 |
| 1243 | Ga0268264_10000559 | 3300028381 | Bacteria | 45910 |
| 1244 | Ga0268264_10001420 | 3300028381 | Bacteria | 22404 |
| 1245 | Ga0268264_10002198 | 3300028381 | Bacteria | 17332 |
| 1246 | Ga0268264_10006807 | 3300028381 | Bacteria | 9600 |
| 1247 | Ga0268264_10007210 | 3300028381 | Bacteria | 9313 |
| 1248 | Ga0268264_10008163 | 3300028381 | Bacteria | 8697 |
| 1249 | Ga0268264_10012189 | 3300028381 | Bacteria | 7074 |
| 1250 | Ga0268264_10013451 | 3300028381 | Bacteria | 6737 |
| 1251 | Ga0268264_10053216 | 3300028381 | Bacteria | 3377 |
| 1252 | Ga0268264_10068257 | 3300028381 | Bacteria | 3004 |
| 1253 | Ga0268264_10169826 | 3300028381 | Bacteria | 1971 |
| 1254 | Ga0268264_10669416 | 3300028381 | Bacteria | 1029 |
| 1255 | Ga0265336_10066527 | 3300028666 | Bacteria | 1078 |
| 1256 | Ga0307517_10000501 | 3300028786 | Bacteria | 67241 |
| 1257 | Ga0307517_10085025 | 3300028786 | Bacteria | 2655 |
| 1258 | Ga0307517_10276900 | 3300028786 | Bacteria | 960 |
| 1259 | Ga0307515_10000001 | 3300028794 | Bacteria | 4259510 |
| 1260 | Ga0307515_10000437 | 3300028794 | Bacteria | 100047 |
| 1261 | Ga0307515_10023091 | 3300028794 | Bacteria | 10925 |
| 1262 | Ga0265338_10014843 | 3300028800 | Bacteria | 8618 |
| 1263 | Ga0265338_10095177 | 3300028800 | Bacteria | 2448 |
| 1264 | Ga0265338_10116455 | 3300028800 | Unclassified | 2141 |
| 1265 | Ga0307511_10000211 | 3300030521 | Bacteria | 59246 |
| 1266 | Ga0316181_1161142 | 3300030744 | Bacteria | 3865 |
| 1267 | Ga0265327_10000022 | 3300031251 | Bacteria | 402724 |
| 1268 | Ga0265327_10000059 | 3300031251 | Bacteria | 236935 |
| 1269 | Ga0265327_10013331 | 3300031251 | Bacteria | 5466 |
| 1270 | Ga0265316_10007452 | 3300031344 | Bacteria | 10314 |
| 1271 | Ga0265316_10176104 | 3300031344 | Bacteria | 1594 |
| 1272 | Ga0265316_10196453 | 3300031344 | Bacteria | 1497 |
| 1273 | Ga0307513_10192745 | 3300031456 | Bacteria | 1888 |
| 1274 | Ga0307509_10038218 | 3300031507 | Bacteria | 5239 |
| 1275 | Ga0307509_10087838 | 3300031507 | Bacteria | 3193 |
| 1276 | Ga0307509_10107464 | 3300031507 | Bacteria | 2806 |
| 1277 | Ga0307509_10231339 | 3300031507 | Bacteria | 1651 |
| 1278 | Ga0307509_10278046 | 3300031507 | Bacteria | 1437 |
| 1279 | Ga0307509_10388701 | 3300031507 | Bacteria | 1106 |
| 1280 | Ga0307408_100000059 | 3300031548 | Bacteria | 134620 |
| 1281 | Ga0307408_100331112 | 3300031548 | Unclassified | 1286 |
| 1282 | Ga0307508_10259499 | 3300031616 | Bacteria | 1333 |
| 1283 | Ga0265314_10073766 | 3300031711 | Bacteria | 2275 |
| 1284 | Ga0265342_10124310 | 3300031712 | Unclassified | 1450 |
| 1285 | Ga0265342_10136102 | 3300031712 | Bacteria | 1373 |
| 1286 | Ga0316576_10005179 | 3300031727 | Bacteria | 7923 |
| 1287 | Ga0316576_10038211 | 3300031727 | Bacteria | 3441 |
| 1288 | Ga0316576_10040192 | 3300031727 | Bacteria | 3361 |
| 1289 | Ga0316576_10067908 | 3300031727 | Unclassified | 2625 |
| 1290 | Ga0316576_10245712 | 3300031727 | Bacteria | 1344 |
| 1291 | Ga0316578_10003406 | 3300031728 | Bacteria | 7264 |
| 1292 | Ga0316578_10047505 | 3300031728 | Bacteria | 2505 |
| 1293 | Ga0307516_10001546 | 3300031730 | Bacteria | 31635 |
| 1294 | Ga0307413_10061249 | 3300031824 | Bacteria | 2321 |
| 1295 | Ga0307410_10007574 | 3300031852 | Bacteria | 5955 |
| 1296 | Ga0307410_10119024 | 3300031852 | Bacteria | 1923 |
| 1297 | Ga0307407_10029975 | 3300031903 | Bacteria | 2929 |
| 1298 | Ga0307412_10111249 | 3300031911 | Bacteria | 1956 |
| 1299 | Ga0307412_10413382 | 3300031911 | Bacteria | 1102 |
| 1300 | Ga0307409_100079288 | 3300031995 | Unclassified | 2646 |
| 1301 | Ga0307416_100111904 | 3300032002 | Unclassified | 2408 |
| 1302 | Ga0307414_10000378 | 3300032004 | Bacteria | 24278 |
| 1303 | Ga0307414_10035600 | 3300032004 | Bacteria | 3315 |
| 1304 | Ga0307414_10044492 | 3300032004 | Bacteria | 3033 |
| 1305 | Ga0307414_10125985 | 3300032004 | Bacteria | 1979 |
| 1306 | Ga0307414_10219679 | 3300032004 | Bacteria | 1559 |
| 1307 | Ga0307414_10644040 | 3300032004 | Bacteria | 955 |
| 1308 | Ga0307411_10055229 | 3300032005 | Bacteria | 2612 |
| 1309 | Ga0307415_100004256 | 3300032126 | Bacteria | 7401 |
| 1310 | Ga0316585_10058918 | 3300032137 | Bacteria | 1238 |
| 1311 | Ga0316580_10009965 | 3300032139 | Bacteria | 2861 |
| 1312 | Ga0316593_10083191 | 3300032168 | Bacteria | 1119 |
| 1313 | Ga0307510_10001895 | 3300033180 | Bacteria | 23475 |
| 1314 | Ga0316592_1047437 | 3300033524 | Unclassified | 957 |
| 1315 | Ga0316588_1063203 | 3300033528 | Bacteria | 905 |
| 1316 | Ga0373952_0033816 | 3300035092 | Bacteria | 1149 |
| 1317 | Ga0373936_0137345 | 3300035113 | Bacteria | 1054 |
| 1318 | Ga0373953_0038655 | 3300035117 | Unclassified | 1889 |
| 1319 | Ga0373943_0197413 | 3300035170 | Bacteria | 1112 |
| 1320 | Ga0373955_0001094 | 3300035172 | Bacteria | 11502 |
| 1321 | Ga0316574_0075120 | 3300035398 | Bacteria | 2140 |
| 1322 | Ga0316574_0160134 | 3300035398 | Bacteria | 1450 |
| 1323 | Ga0316574_0224412 | 3300035398 | Bacteria | 1203 |
| 1324 | Ga0316574_0274059 | 3300035398 | Unclassified | 1076 |
| 1325 | Ga0373924_0065034 | 3300035410 | Bacteria | 1531 |
| 1326 | Ga0373935_0166107 | 3300035692 | Bacteria | 1507 |
| 1327 | Ga0373947_0081407 | 3300035725 | Bacteria | 2005 |
| 1328 | Ga0373937_0007007 | 3300036401 | Bacteria | 9730 |
| 1329 | Ga0373937_0168288 | 3300036401 | Bacteria | 2056 |
| 1330 | Ga0373937_0172615 | 3300036401 | Unclassified | 2029 |
| 1331 | Ga0316582_0047537 | 3300036647 | Bacteria | 2710 |
| 1332 | Ga0316582_0074881 | 3300036647 | Unclassified | 2199 |
| 1333 | Ga0316584_0014890 | 3300036712 | Bacteria | 5556 |
| 1334 | Ga0316584_0027770 | 3300036712 | Bacteria | 4167 |
| 1335 | Ga0316584_0068130 | 3300036712 | Bacteria | 2667 |
| 1336 | Ga0316584_0094881 | 3300036712 | Bacteria | 2233 |
| 1337 | Ga0316584_0129350 | 3300036712 | Bacteria | 1886 |
| 1338 | Ga0373925_0288928 | 3300037068 | Bacteria | 1322 |
| 1339 | Ga0395899_0001073 | 3300037312 | Bacteria | 24679 |
| 1340 | Ga0395899_0021239 | 3300037312 | Bacteria | 4924 |
| 1341 | Ga0395899_0031829 | 3300037312 | Bacteria | 3963 |
| 1342 | Ga0395899_0053320 | 3300037312 | Unclassified | 2994 |
| 1343 | Ga0395899_0065703 | 3300037312 | Unclassified | 2665 |
| 1344 | Ga0395899_0097778 | 3300037312 | Bacteria | 2121 |
| 1345 | Ga0395899_0237561 | 3300037312 | Bacteria | 1255 |
| 1346 | Ga0395900_0003278 | 3300037418 | Bacteria | 17515 |
| 1347 | Ga0395900_0016053 | 3300037418 | Bacteria | 7632 |
| 1348 | Ga0395900_0025169 | 3300037418 | Bacteria | 6093 |
| 1349 | Ga0395900_0032457 | 3300037418 | Bacteria | 5369 |
| 1350 | Ga0395900_0065738 | 3300037418 | Bacteria | 3725 |
| 1351 | Ga0395900_0102640 | 3300037418 | Unclassified | 2938 |
| 1352 | Ga0395900_0142379 | 3300037418 | Bacteria | 2454 |
| 1353 | Ga0395900_0337316 | 3300037418 | Bacteria | 1484 |
| 1354 | Ga0395898_0001727 | 3300037466 | Bacteria | 28894 |
| 1355 | Ga0395898_0026260 | 3300037466 | Bacteria | 5862 |
| 1356 | Ga0395898_0063589 | 3300037466 | Bacteria | 3580 |
| 1357 | Ga0395898_0177249 | 3300037466 | Bacteria | 2037 |
| 1358 | Ga0395898_0208036 | 3300037466 | Bacteria | 1867 |
| 1359 | Ga0395898_0714132 | 3300037466 | Unclassified | 944 |
| 1360 | Ga0395905_0003376 | 3300037471 | Bacteria | 17103 |
| 1361 | Ga0395905_0038471 | 3300037471 | Bacteria | 4489 |
| 1362 | Ga0395905_0115292 | 3300037471 | Bacteria | 2525 |
| 1363 | Ga0395905_0191312 | 3300037471 | Bacteria | 1919 |
| 1364 | Ga0395901_0089623 | 3300038443 | Bacteria | 3219 |
| 1365 | Ga0395901_0120806 | 3300038443 | Bacteria | 2753 |
| 1366 | Ga0395901_0127862 | 3300038443 | Bacteria | 2670 |
| 1367 | Ga0395901_0221683 | 3300038443 | Unclassified | 1976 |
| 1368 | Ga0395901_0749968 | 3300038443 | Bacteria | 969 |
| 1369 | Ga0400489_28951 | 3300039093 | Bacteria | 7710 |
| 1370 | Ga0436365_0166525 | 3300039437 | Bacteria | 1093 |
| 1371 | Ga0436365_0727468 | 3300039437 | Bacteria | 3501 |
| 1372 | Ga0436365_1175703 | 3300039437 | Bacteria | 9484 |
| 1373 | Ga0436365_1743396 | 3300039437 | Bacteria | 55864 |
| 1374 | Ga0439436_0031033 | 3300041404 | Bacteria | 1552 |
| 1375 | Ga0439438_029368 | 3300041405 | Bacteria | 1472 |
| 1376 | Ga0439439_0048096 | 3300041406 | Bacteria | 1115 |
| 1377 | Ga0439465_0026146 | 3300041413 | Bacteria | 1845 |
| 1378 | Ga0451793_0604856 | 3300041452 | Bacteria | 1058 |
| 1379 | Ga0451797_1447286 | 3300041453 | Bacteria | 1172 |
| 1380 | Ga0451835_0015060 | 3300041492 | Bacteria | 1317 |
| 1381 | Ga0451849_0809782 | 3300041505 | Bacteria | 951 |
| 1382 | Ga0451851_0868508 | 3300041507 | Bacteria | 1229 |
| 1383 | Ga0451853_0069397 | 3300041512 | Bacteria | 1422 |
| 1384 | Ga0439431_0002027 | 3300041997 | Bacteria | 4485 |
| 1385 | Ga0439431_0004812 | 3300041997 | Bacteria | 2974 |
| 1386 | Ga0439433_0020922 | 3300041999 | Bacteria | 1461 |
| 1387 | Ga0439441_004808 | 3300042001 | Bacteria | 2067 |
| 1388 | Ga0439442_003233 | 3300042002 | Bacteria | 3223 |
| 1389 | Ga0439445_0034710 | 3300042004 | Bacteria | 1323 |
| 1390 | Ga0439449_0001040 | 3300042007 | Bacteria | 10930 |
| 1391 | Ga0439449_0005471 | 3300042007 | Bacteria | 4865 |
| 1392 | Ga0439449_0010767 | 3300042007 | Bacteria | 3452 |
| 1393 | Ga0439449_0041803 | 3300042007 | Bacteria | 1704 |
| 1394 | Ga0439449_0044275 | 3300042007 | Bacteria | 1651 |
| 1395 | Ga0439452_018091 | 3300042010 | Bacteria | 1883 |
| 1396 | Ga0439454_013708 | 3300042011 | Bacteria | 1116 |
| 1397 | Ga0439454_019205 | 3300042011 | Bacteria | 992 |
| 1398 | Ga0439457_000130 | 3300042014 | Bacteria | 18863 |
| 1399 | Ga0439457_009773 | 3300042014 | Bacteria | 2222 |
| 1400 | Ga0439462_0001095 | 3300042015 | Bacteria | 5845 |
| 1401 | Ga0439462_0033328 | 3300042015 | Bacteria | 1366 |
| 1402 | Ga0450894_006088 | 3300042131 | Bacteria | 1561 |
| 1403 | Ga0450899_000791 | 3300042135 | Bacteria | 3600 |
| 1404 | Ga0451577_0000037 | 3300042876 | Bacteria | 360162 |
| 1405 | Ga0451577_0001531 | 3300042876 | Bacteria | 30353 |
| 1406 | Ga0451577_0004082 | 3300042876 | Bacteria | 15689 |
| 1407 | Ga0451577_0009193 | 3300042876 | Bacteria | 9535 |
| 1408 | Ga0451577_0010543 | 3300042876 | Bacteria | 8817 |
| 1409 | Ga0451577_0018249 | 3300042876 | Bacteria | 6466 |
| 1410 | Ga0451577_0024783 | 3300042876 | Bacteria | 5452 |
| 1411 | Ga0451577_0109197 | 3300042876 | Unclassified | 2474 |
| 1412 | Ga0451577_0118215 | 3300042876 | Bacteria | 2374 |
| 1413 | Ga0451577_0187779 | 3300042876 | Bacteria | 1864 |
| 1414 | Ga0451577_0235527 | 3300042876 | Bacteria | 1656 |
| 1415 | Ga0466969_0000356 | 3300044656 | Bacteria | 25182 |
| 1416 | Ga0466972_0000026 | 3300044658 | Bacteria | 184739 |
| 1417 | Ga0466972_0000047 | 3300044658 | Bacteria | 122901 |
| 1418 | Ga0466972_0001885 | 3300044658 | Bacteria | 10291 |
| 1419 | Ga0466972_0019450 | 3300044658 | Bacteria | 3395 |
| 1420 | Ga0466972_0127072 | 3300044658 | Bacteria | 1201 |
| 1421 | Ga0453683_0000021 | 3300044673 | Bacteria | 284502 |
| 1422 | Ga0453683_0000240 | 3300044673 | Bacteria | 72911 |
| 1423 | Ga0453683_0001491 | 3300044673 | Bacteria | 20041 |
| 1424 | Ga0453683_0002229 | 3300044673 | Bacteria | 15338 |
| 1425 | Ga0453683_0008430 | 3300044673 | Bacteria | 6912 |
| 1426 | Ga0453683_0033002 | 3300044673 | Bacteria | 3265 |
| 1427 | Ga0453683_0039515 | 3300044673 | Unclassified | 2965 |
| 1428 | Ga0453683_0050156 | 3300044673 | Bacteria | 2615 |
| 1429 | Ga0453683_0209059 | 3300044673 | Bacteria | 1239 |
| 1430 | Ga0466966_0000038 | 3300044684 | Bacteria | 97255 |
| 1431 | Ga0466964_0014026 | 3300044706 | Bacteria | 3045 |
| 1432 | Ga0453684_0000110 | 3300044712 | Bacteria | 360542 |
| 1433 | Ga0453684_0000388 | 3300044712 | Bacteria | 180685 |
| 1434 | Ga0453684_0001054 | 3300044712 | Bacteria | 87768 |
| 1435 | Ga0453684_0001255 | 3300044712 | Bacteria | 76451 |
| 1436 | Ga0453684_0005351 | 3300044712 | Bacteria | 25551 |
| 1437 | Ga0453684_0017818 | 3300044712 | Bacteria | 10958 |
| 1438 | Ga0453684_0021228 | 3300044712 | Bacteria | 9718 |
| 1439 | Ga0453684_0021303 | 3300044712 | Bacteria | 9694 |
| 1440 | Ga0453684_0022525 | 3300044712 | Bacteria | 9339 |
| 1441 | Ga0453684_0026037 | 3300044712 | Bacteria | 8467 |
| 1442 | Ga0453684_0030449 | 3300044712 | Bacteria | 7625 |
| 1443 | Ga0453684_0039262 | 3300044712 | Bacteria | 6454 |
| 1444 | Ga0453684_0048617 | 3300044712 | Bacteria | 5604 |
| 1445 | Ga0453684_0068800 | 3300044712 | Bacteria | 4493 |
| 1446 | Ga0453684_0087221 | 3300044712 | Bacteria | 3868 |
| 1447 | Ga0453684_0094490 | 3300044712 | Bacteria | 3678 |
| 1448 | Ga0453684_0168634 | 3300044712 | Unclassified | 2582 |
| 1449 | Ga0453684_0235565 | 3300044712 | Bacteria | 2110 |
| 1450 | Ga0453684_0260972 | 3300044712 | Bacteria | 1984 |
| 1451 | Ga0453684_0422449 | 3300044712 | Unclassified | 1489 |
| 1452 | Ga0453684_0456744 | 3300044712 | Bacteria | 1421 |
| 1453 | Ga0453684_0798628 | 3300044712 | Bacteria | 1018 |
| 1454 | Ga0466968_0086545 | 3300044735 | Bacteria | 1383 |
| 1455 | Ga0466970_0000091 | 3300044765 | Bacteria | 38259 |
| 1456 | Ga0466970_0171060 | 3300044765 | Bacteria | 1204 |
| 1457 | Ga0466957_0000329 | 3300044842 | Bacteria | 23093 |
| 1458 | Ga0466959_0000289 | 3300045049 | Bacteria | 30468 |
| 1459 | Ga0466959_0005399 | 3300045049 | Bacteria | 8747 |
| 1460 | Ga0451576_0000002 | 3300045051 | Bacteria | 1670975 |
| 1461 | Ga0451576_0000039 | 3300045051 | Bacteria | 360162 |
| 1462 | Ga0451576_0000093 | 3300045051 | Bacteria | 226300 |
| 1463 | Ga0451576_0000350 | 3300045051 | Bacteria | 110906 |
| 1464 | Ga0451576_0001015 | 3300045051 | Bacteria | 51898 |
| 1465 | Ga0451576_0001211 | 3300045051 | Bacteria | 46024 |
| 1466 | Ga0451576_0003588 | 3300045051 | Bacteria | 21102 |
| 1467 | Ga0451576_0013169 | 3300045051 | Bacteria | 9256 |
| 1468 | Ga0451576_0044859 | 3300045051 | Bacteria | 4658 |
| 1469 | Ga0451576_0116216 | 3300045051 | Bacteria | 2785 |
| 1470 | Ga0451576_0178710 | 3300045051 | Bacteria | 2216 |
| 1471 | Ga0495627_002297 | 3300046453 | Bacteria | 9430 |
| 1472 | Ga0495592_0143554 | 3300046454 | Bacteria | 1658 |
| 1473 | Ga0495638_0028342 | 3300046460 | Bacteria | 3617 |
| 1474 | Ga0495638_0161994 | 3300046460 | Bacteria | 1290 |
| 1475 | Ga0495653_0078765 | 3300046463 | Bacteria | 2443 |
| 1476 | Ga0495580_0106897 | 3300046472 | Bacteria | 1944 |
| 1477 | Ga0495639_0116009 | 3300046475 | Bacteria | 1274 |
| 1478 | Ga0495606_0005025 | 3300046507 | Bacteria | 12888 |
| 1479 | Ga0495608_0053922 | 3300046511 | Bacteria | 2659 |
| 1480 | Ga0495618_0049036 | 3300046514 | Bacteria | 2667 |
| 1481 | Ga0495628_0048897 | 3300046516 | Bacteria | 3350 |
| 1482 | Ga0495630_0157645 | 3300046517 | Bacteria | 1728 |
| 1483 | Ga0495632_0195841 | 3300046519 | Bacteria | 922 |
| 1484 | Ga0495648_0017761 | 3300046524 | Bacteria | 5072 |
| 1485 | Ga0495652_0134134 | 3300046529 | Bacteria | 1956 |
| 1486 | Ga0495640_0132656 | 3300046533 | Bacteria | 1611 |
| 1487 | Ga0495587_0053380 | 3300046536 | Bacteria | 2383 |
| 1488 | Ga0495587_0073734 | 3300046536 | Unclassified | 1983 |
| 1489 | Ga0495645_0070766 | 3300046543 | Unclassified | 2517 |
| 1490 | Ga0495633_0000036 | 3300046558 | Bacteria | 184999 |
| 1491 | Ga0495667_0089422 | 3300046559 | Bacteria | 1996 |
| 1492 | Ga0495668_0000068 | 3300046616 | Bacteria | 176297 |
| 1493 | Ga0495668_0000106 | 3300046616 | Bacteria | 133476 |
| 1494 | Ga0495634_0013744 | 3300046642 | Bacteria | 5847 |
| 1495 | Ga0495634_0083717 | 3300046642 | Unclassified | 2081 |
| 1496 | Ga0495611_0000174 | 3300046648 | Bacteria | 46643 |
| 1497 | Ga0495611_0047743 | 3300046648 | Bacteria | 1922 |
| 1498 | Ga0495625_0038687 | 3300046660 | Bacteria | 3490 |
| 1499 | Ga0495635_0013705 | 3300046663 | Bacteria | 5672 |
| 1500 | Ga0495588_0392984 | 3300046674 | Unclassified | 728 |
| 1501 | Ga0495657_0106852 | 3300046675 | Bacteria | 1777 |
| 1502 | Ga0495657_0204473 | 3300046675 | Bacteria | 1202 |
| 1503 | Ga0495646_0157611 | 3300046680 | Bacteria | 1259 |
| 1504 | Ga0495647_0021783 | 3300046681 | Unclassified | 2311 |
| 1505 | Ga0495658_0011809 | 3300046683 | Bacteria | 4404 |
| 1506 | Ga0495658_0128576 | 3300046683 | Bacteria | 1540 |
| 1507 | Ga0495613_0065169 | 3300046689 | Bacteria | 2663 |
| 1508 | Ga0495670_0154393 | 3300046691 | Bacteria | 1204 |
| 1509 | Ga0495670_0265877 | 3300046691 | Unclassified | 916 |
| 1510 | Ga0495649_0102771 | 3300046694 | Bacteria | 1518 |
| 1511 | Ga0495600_0039584 | 3300046809 | Bacteria | 3070 |
| 1512 | Ga0495636_0000038 | 3300047318 | Bacteria | 56537 |
| 1513 | Ga0495672_0063914 | 3300047320 | Unclassified | 2110 |
| 1514 | Ga0495687_000058 | 3300047443 | Bacteria | 185830 |
| 1515 | Ga0495684_0062975 | 3300047471 | Bacteria | 2821 |
| 1516 | Ga0495684_0097223 | 3300047471 | Unclassified | 2228 |
| 1517 | Ga0495684_0111325 | 3300047471 | Unclassified | 2066 |
| 1518 | Ga0495686_0000005 | 3300047472 | Bacteria | 827143 |
| 1519 | Ga0495686_0000230 | 3300047472 | Bacteria | 102747 |
| 1520 | Ga0495686_0271975 | 3300047472 | Bacteria | 945 |
| 1521 | Ga0495602_0099079 | 3300048088 | Unclassified | 2397 |
| 1522 | Ga0496101_0011163 | 3300048904 | Bacteria | 5952 |
| 1523 | Ga0496102_0259381 | 3300048905 | Bacteria | 1639 |
| 1524 | Ga0496104_0484008 | 3300048907 | Bacteria | 1149 |
| 1525 | Ga0496106_0409331 | 3300048909 | Bacteria | 1090 |
| 1526 | Ga0496108_0359942 | 3300048911 | Bacteria | 1270 |
| 1527 | Ga0496110_0074804 | 3300048913 | Bacteria | 3009 |
| 1528 | Ga0496110_0439464 | 3300048913 | Bacteria | 1189 |
| 1529 | Ga0496114_0015211 | 3300048917 | Bacteria | 6186 |
| 1530 | Ga0496114_0019038 | 3300048917 | Bacteria | 5562 |
| 1531 | Ga0496115_0017565 | 3300048918 | Bacteria | 5473 |
| 1532 | Ga0496115_0281067 | 3300048918 | Bacteria | 1366 |
| 1533 | Ga0496116_0021745 | 3300048919 | Bacteria | 4827 |
| 1534 | Ga0496117_0001774 | 3300048920 | Bacteria | 29604 |
| 1535 | Ga0496118_0137624 | 3300048921 | Bacteria | 1555 |
| 1536 | Ga0496121_0000082 | 3300048924 | Bacteria | 228557 |
| 1537 | Ga0496122_0000219 | 3300048925 | Bacteria | 127599 |
| 1538 | Ga0496122_0016515 | 3300048925 | Bacteria | 6976 |
| 1539 | Ga0496123_0005966 | 3300048926 | Bacteria | 11995 |
| 1540 | Ga0496123_0011727 | 3300048926 | Bacteria | 7558 |
| 1541 | Ga0496124_0041495 | 3300048927 | Bacteria | 3970 |
| 1542 | Ga0496125_0051846 | 3300048928 | Bacteria | 3380 |
| 1543 | Ga0501290_001851 | 3300049513 | Bacteria | 2799 |
| 1544 | Ga0501298_004841 | 3300049521 | Bacteria | 2141 |
| 1545 | Ga0501324_012441 | 3300049540 | Bacteria | 796 |
| 1546 | Ga0501031_0000435 | 3300049568 | Bacteria | 24029 |
| 1547 | Ga0501031_0017354 | 3300049568 | Bacteria | 4676 |
| 1548 | Ga0501032_0001734 | 3300049569 | Bacteria | 17248 |
| 1549 | Ga0501032_0007802 | 3300049569 | Bacteria | 7803 |
| 1550 | Ga0501032_0073737 | 3300049569 | Bacteria | 2274 |
| 1551 | Ga0501032_0248324 | 3300049569 | Bacteria | 1155 |
| 1552 | Ga0501033_0000754 | 3300049570 | Bacteria | 29801 |
| 1553 | Ga0501033_0096782 | 3300049570 | Bacteria | 2157 |
| 1554 | Ga0501033_0106578 | 3300049570 | Bacteria | 2042 |
| 1555 | Ga0501033_0171460 | 3300049570 | Bacteria | 1558 |
| 1556 | Ga0501033_0348477 | 3300049570 | Bacteria | 1038 |
| 1557 | Ga0501034_0000002 | 3300049571 | Bacteria | 565510 |
| 1558 | Ga0501034_0001948 | 3300049571 | Bacteria | 26154 |
| 1559 | Ga0501034_0046635 | 3300049571 | Bacteria | 4378 |
| 1560 | Ga0501034_0047492 | 3300049571 | Bacteria | 4334 |
| 1561 | Ga0501034_0072688 | 3300049571 | Bacteria | 3448 |
| 1562 | Ga0501034_0102588 | 3300049571 | Bacteria | 2854 |
| 1563 | Ga0501034_0337250 | 3300049571 | Bacteria | 1438 |
| 1564 | Ga0501036_0025033 | 3300049572 | Bacteria | 5033 |
| 1565 | Ga0501036_0045438 | 3300049572 | Bacteria | 3720 |
| 1566 | Ga0501036_0155380 | 3300049572 | Bacteria | 1929 |
| 1567 | Ga0501037_0002930 | 3300049573 | Bacteria | 12378 |
| 1568 | Ga0501037_0007495 | 3300049573 | Bacteria | 7987 |
| 1569 | Ga0501037_0078595 | 3300049573 | Bacteria | 2394 |
| 1570 | Ga0501037_0215846 | 3300049573 | Bacteria | 1351 |
| 1571 | Ga0501037_0340930 | 3300049573 | Bacteria | 1035 |
| 1572 | Ga0501038_0006197 | 3300049574 | Bacteria | 11063 |
| 1573 | Ga0501038_0012004 | 3300049574 | Bacteria | 7910 |
| 1574 | Ga0501038_0034793 | 3300049574 | Bacteria | 4427 |
| 1575 | Ga0501038_0039800 | 3300049574 | Bacteria | 4111 |
| 1576 | Ga0501039_0003820 | 3300049575 | Bacteria | 11310 |
| 1577 | Ga0501039_0068303 | 3300049575 | Bacteria | 2759 |
| 1578 | Ga0501039_0100695 | 3300049575 | Bacteria | 2255 |
| 1579 | Ga0501043_0001571 | 3300049579 | Bacteria | 19887 |
| 1580 | Ga0501043_0002152 | 3300049579 | Bacteria | 16797 |
| 1581 | Ga0501043_0016409 | 3300049579 | Bacteria | 5806 |
| 1582 | Ga0501043_0029619 | 3300049579 | Bacteria | 4301 |
| 1583 | Ga0501043_0366443 | 3300049579 | Bacteria | 1093 |
| 1584 | Ga0501046_0072232 | 3300049580 | Bacteria | 2680 |
| 1585 | Ga0501046_0080807 | 3300049580 | Bacteria | 2511 |
| 1586 | Ga0501046_0223099 | 3300049580 | Bacteria | 1395 |
| 1587 | Ga0501047_0021537 | 3300049581 | Bacteria | 6190 |
| 1588 | Ga0501047_0032041 | 3300049581 | Bacteria | 5072 |
| 1589 | Ga0501047_0039748 | 3300049581 | Bacteria | 4550 |
| 1590 | Ga0501047_0072629 | 3300049581 | Bacteria | 3312 |
| 1591 | Ga0501047_0126847 | 3300049581 | Bacteria | 2432 |
| 1592 | Ga0501047_0199260 | 3300049581 | Bacteria | 1863 |
| 1593 | Ga0501067_0074920 | 3300049583 | Bacteria | 1875 |
| 1594 | Ga0501070_0036506 | 3300049586 | Bacteria | 4104 |
| 1595 | Ga0501070_0051824 | 3300049586 | Bacteria | 3405 |
| 1596 | Ga0501070_0190358 | 3300049586 | Unclassified | 1687 |
| 1597 | Ga0501071_0246635 | 3300049587 | Bacteria | 1347 |
| 1598 | Ga0501073_0004984 | 3300049589 | Bacteria | 9965 |
| 1599 | Ga0501073_0005135 | 3300049589 | Bacteria | 9824 |
| 1600 | Ga0501073_0069343 | 3300049589 | Bacteria | 2457 |
| 1601 | Ga0501074_0034842 | 3300049590 | Bacteria | 3648 |
| 1602 | Ga0501076_0087934 | 3300049592 | Bacteria | 2498 |
| 1603 | Ga0501198_003127 | 3300049649 | Bacteria | 2251 |
| 1604 | Ga0501198_003403 | 3300049649 | Bacteria | 2171 |
| 1605 | Ga0501198_016548 | 3300049649 | Bacteria | 1141 |
| 1606 | Ga0501202_000230 | 3300049652 | Bacteria | 7373 |
| 1607 | Ga0501202_000719 | 3300049652 | Bacteria | 4943 |
| 1608 | Ga0501207_000054 | 3300049654 | Bacteria | 8472 |
| 1609 | Ga0501222_000635 | 3300049662 | Bacteria | 5147 |
| 1610 | Ga0501223_004113 | 3300049663 | Bacteria | 3135 |
| 1611 | Ga0501223_004178 | 3300049663 | Bacteria | 3112 |
| 1612 | Ga0501223_016295 | 3300049663 | Bacteria | 1469 |
| 1613 | Ga0501233_007500 | 3300049668 | Bacteria | 2076 |
| 1614 | Ga0501240_008770 | 3300049673 | Bacteria | 1306 |
| 1615 | Ga0501243_001431 | 3300049675 | Bacteria | 3417 |
| 1616 | Ga0501243_011494 | 3300049675 | Bacteria | 1389 |
| 1617 | Ga0501257_007423 | 3300049686 | Bacteria | 2449 |
| 1618 | Ga0501259_000787 | 3300049688 | Bacteria | 5188 |
| 1619 | Ga0501219_001361 | 3300049703 | Bacteria | 2449 |
| 1620 | Ga0501225_0010109 | 3300049705 | Bacteria | 2677 |
| 1621 | Ga0501225_0064693 | 3300049705 | Unclassified | 1033 |
| 1622 | Ga0501234_007548 | 3300049707 | Bacteria | 1701 |
| 1623 | Ga0501234_007928 | 3300049707 | Bacteria | 1660 |
| 1624 | Ga0501080_0065919 | 3300049742 | Bacteria | 3367 |
| 1625 | Ga0501080_0110411 | 3300049742 | Unclassified | 2549 |
| 1626 | Ga0501080_0309607 | 3300049742 | Bacteria | 1431 |
| 1627 | Ga0501083_0118291 | 3300049744 | Bacteria | 1738 |
| 1628 | Ga0501241_001338 | 3300049758 | Bacteria | 5088 |
| 1629 | Ga0501266_005465 | 3300049763 | Bacteria | 1580 |
| 1630 | Ga0501266_006710 | 3300049763 | Bacteria | 1433 |
| 1631 | Ga0501270_006462 | 3300049767 | Bacteria | 1409 |
| 1632 | Ga0501035_0001478 | 3300049822 | Bacteria | 24055 |
| 1633 | Ga0501035_0183406 | 3300049822 | Bacteria | 1802 |
| 1634 | Ga0501044_0001852 | 3300049823 | Bacteria | 24578 |
| 1635 | Ga0501044_0013806 | 3300049823 | Bacteria | 8729 |
| 1636 | Ga0501044_0020326 | 3300049823 | Bacteria | 7088 |
| 1637 | Ga0501044_0040239 | 3300049823 | Bacteria | 4872 |
| 1638 | Ga0501044_0044269 | 3300049823 | Bacteria | 4620 |
| 1639 | Ga0501044_0053294 | 3300049823 | Bacteria | 4162 |
| 1640 | Ga0501044_0097418 | 3300049823 | Bacteria | 2962 |
| 1641 | Ga0501044_0585917 | 3300049823 | Bacteria | 1009 |
| 1642 | Ga0501045_0000094 | 3300049824 | Bacteria | 43052 |
| 1643 | Ga0501212_000847 | 3300049851 | Bacteria | 3205 |
| 1644 | Ga0501284_00030 | 3300050005 | Bacteria | 71858 |
| 1645 | nmdc:mga0k408_53627_c1 | 3300050493 | Bacteria | 2337 |
| 1646 | nmdc:mga05p37_11521_c1 | 3300050507 | Bacteria | 10534 |
| 1647 | nmdc:mga05p37_288992_c1 | 3300050507 | Bacteria | 1952 |
| 1648 | nmdc:mga05p37_629646_c1 | 3300050507 | Bacteria | 1206 |
| 1649 | nmdc:mga09592_214990_c1 | 3300050508 | Bacteria | 1666 |
| 1650 | nmdc:mga09592_998_c1 | 3300050508 | Bacteria | 22420 |
| 1651 | nmdc:mga0qj67_14877_c1 | 3300050509 | Bacteria | 5886 |
| 1652 | nmdc:mga0qj67_81574_c1 | 3300050509 | Bacteria | 2593 |
| 1653 | nmdc:mga06r32_16383_c1 | 3300050510 | Bacteria | 6754 |
| 1654 | nmdc:mga06r32_26115_c1 | 3300050510 | Bacteria | 5441 |
| 1655 | nmdc:mga08y16_503402_c1 | 3300050511 | Unclassified | 1230 |
| 1656 | nmdc:mga08y16_5081_c1 | 3300050511 | Bacteria | 13754 |
| 1657 | nmdc:mga08y16_90318_c1 | 3300050511 | Bacteria | 3193 |
| 1658 | Ga0500578_0000469 | 3300053086 | Bacteria | 49263 |
| 1659 | Ga0500644_0000989 | 3300053088 | Bacteria | 8854 |
| 1660 | Ga0500644_0057861 | 3300053088 | Bacteria | 1354 |
| 1661 | Ga0500646_0001347 | 3300053090 | Bacteria | 6518 |
| 1662 | Ga0500646_0003386 | 3300053090 | Bacteria | 4093 |
| 1663 | Ga0500646_0019019 | 3300053090 | Bacteria | 1814 |
| 1664 | Ga0500646_0030687 | 3300053090 | Bacteria | 1476 |
| 1665 | Ga0500583_0001878 | 3300053092 | Bacteria | 6143 |
| 1666 | Ga0500583_0002554 | 3300053092 | Bacteria | 5501 |
| 1667 | Ga0500583_0002666 | 3300053092 | Bacteria | 5426 |
| 1668 | Ga0500651_0275971 | 3300053093 | Bacteria | 971 |
| 1669 | Ga0500641_0028234 | 3300053096 | Bacteria | 2190 |
| 1670 | Ga0500562_000005 | 3300053108 | Bacteria | 266746 |
| 1671 | Ga0500569_000112 | 3300053109 | Bacteria | 12591 |
| 1672 | Ga0500572_010463 | 3300053111 | Bacteria | 2220 |
| 1673 | Ga0500594_0005425 | 3300053118 | Bacteria | 2830 |
| 1674 | Ga0500594_0054252 | 3300053118 | Bacteria | 1138 |
| 1675 | Ga0500607_014340 | 3300053121 | Bacteria | 4597 |
| 1676 | Ga0500642_0003975 | 3300053130 | Bacteria | 4559 |
| 1677 | Ga0500642_0147061 | 3300053130 | Bacteria | 1106 |
| 1678 | Ga0500652_006434 | 3300053131 | Bacteria | 3781 |
| 1679 | Ga0500652_014818 | 3300053131 | Bacteria | 2798 |
| 1680 | Ga0500658_0010039 | 3300053134 | Bacteria | 3494 |
| 1681 | Ga0500559_0007923 | 3300053136 | Bacteria | 4685 |
| 1682 | Ga0500559_0042220 | 3300053136 | Bacteria | 1990 |
| 1683 | Ga0500568_0002982 | 3300053139 | Bacteria | 9682 |
| 1684 | Ga0500568_0005771 | 3300053139 | Bacteria | 6335 |
| 1685 | Ga0500568_0035240 | 3300053139 | Bacteria | 2043 |
| 1686 | Ga0500568_0047261 | 3300053139 | Bacteria | 1705 |
| 1687 | Ga0500573_0125007 | 3300053140 | Bacteria | 1429 |
| 1688 | Ga0500577_0000513 | 3300053142 | Bacteria | 9997 |
| 1689 | Ga0500588_0005647 | 3300053146 | Bacteria | 2790 |
| 1690 | Ga0500588_0051960 | 3300053146 | Bacteria | 1281 |
| 1691 | Ga0500589_029833 | 3300053147 | Bacteria | 2538 |
| 1692 | Ga0500589_112478 | 3300053147 | Bacteria | 1165 |
| 1693 | Ga0500590_010374 | 3300053148 | Bacteria | 4705 |
| 1694 | Ga0500616_0002078 | 3300053153 | Bacteria | 17543 |
| 1695 | Ga0500616_0005064 | 3300053153 | Bacteria | 9103 |
| 1696 | Ga0500616_0033232 | 3300053153 | Bacteria | 2816 |
| 1697 | Ga0500622_0000085 | 3300053156 | Bacteria | 100276 |
| 1698 | Ga0500622_0000310 | 3300053156 | Bacteria | 49726 |
| 1699 | Ga0500622_0001399 | 3300053156 | Bacteria | 19440 |
| 1700 | Ga0500622_0025537 | 3300053156 | Bacteria | 3121 |
| 1701 | Ga0500633_0004414 | 3300053160 | Bacteria | 3222 |
| 1702 | Ga0500639_024338 | 3300053163 | Bacteria | 3201 |
| 1703 | Ga0500636_0009636 | 3300053177 | Bacteria | 5620 |
| 1704 | Ga0500636_0150117 | 3300053177 | Bacteria | 1281 |
| 1705 | Ga0500611_000039 | 3300053727 | Bacteria | 68825 |
| 1706 | Ga0501084_0042886 | 3300054114 | Bacteria | 3785 |
| 1707 | Ga0500661_001058 | 3300055283 | Bacteria | 5191 |
| 1708 | Ga0500661_001926 | 3300055283 | Bacteria | 3917 |
| 1709 | Ga0587070_034955 | 3300059491 | Unclassified | 932 |
| 1710 | Ga0587077_002136 | 3300059493 | Bacteria | 2286 |
| 1711 | Ga0501082_0014532 | 3300060353 | Bacteria | 6778 |
| 1712 | 2722730875 | 2721755487 | Bacteria | 6357185 |
| 1713 | 2738725863 | 2738541278 | Bacteria | 9755573 |
| 1714 | 2738758988 | 2738541283 | Bacteria | 7222293 |
| 1715 | 2739303918 | 2738543023 | Bacteria | 6767879 |
| 1716 | 2819575200 | 2818991442 | Bacteria | 8318214 |
| 1717 | 2819589806 | 2818991444 | Bacteria | 6968812 |
| 1718 | 2819677181 | 2818991460 | Bacteria | 7595395 |
| 1719 | 2852630816 | 2852627209 | Bacteria | 5896285 |
| 1720 | 2881956751 | 2881955468 | Bacteria | 3545609 |
| 1721 | 2883070299 | 2883068021 | Bacteria | 6192739 |
| 1722 | 2890737697 | 2890737413 | Bacteria | 4269751 |
| 1723 | 2896320919 | 2896317667 | Bacteria | 4606601 |
| 1724 | 2896346265 | 2896344016 | Bacteria | 3811746 |
| 1725 | 2898716116 | 2898713307 | Bacteria | 4110805 |
| 1726 | 2904783590 | 2904780799 | Bacteria | 5840761 |
| 1727 | 2914762851 | 2914759650 | Bacteria | 4701441 |
| 1728 | 2919181452 | 2919177583 | Bacteria | 5641607 |
| 1729 | 2919188831 | 2919186247 | Bacteria | 6244071 |
| 1730 | 2929160008 | 2929154850 | Bacteria | 6753285 |
| 1731 | 2929239867 | 2929239360 | Bacteria | 7745570 |
| 1732 | 2929921507 | 2929921140 | Bacteria | 8649150 |
| 1733 | 2939667014 | 2939664404 | Bacteria | 6364494 |
| 1734 | 2945979780 | 2945977869 | Bacteria | 7777518 |
| 1735 | 2946014353 | 2946013367 | Bacteria | 7766675 |
| 1736 | 3003235277 | 3003233435 | Bacteria | 4458031 |
| 1737 | 8003152053 | 8003151029 | Bacteria | 8187759 |
| 1738 | 8055591225 | 8055588893 | Bacteria | 3619545 |
| 1739 | Ga0495672_0012690 | |||
| 1740 | SwRhRL2b_contig_779164 | |||
| 1741 | MBSR1b_contig_1275727 | |||
| 1742 | MBSR1b_contig_2933601 | |||
| 1743 | MBSR1b_contig_8348456 | |||
| 1744 | JGI24740J21852_10003140 | |||
| 1745 | JGI24740J21852_10018534 | |||
| 1746 | JGI24739J22299_10000259 | |||
| 1747 | JGI24744J21845_10004189 | |||
| 1748 | JGI24742J22300_10009021 | |||
| 1749 | JGI24751J29686_10018083 | |||
| 1750 | JGI25154J39366_1000006 | |||
| 1751 | JGI25406J46586_10002018 | |||
| 1752 | JGI25153J46596_10000485 | |||
| 1753 | JGI25153J46596_10019253 | |||
| 1754 | rootH2_10000092 | |||
| 1755 | rootH2_10000641 | |||
| 1756 | rootH2_10022930 | |||
| 1757 | rootH2_10115691 | |||
| 1758 | rootL2_10060108 | |||
| 1759 | rootL2_10202782 | |||
| 1760 | rootL2_10202783 | |||
| 1761 | rootL2_10292902 | |||
| 1762 | rootH1_10009438 | |||
| 1763 | rootH1_10018931 | |||
| 1764 | rootH1_10019793 | |||
| 1765 | rootH1_10060702 | |||
| 1766 | rootH1_10090089 | |||
| 1767 | rootH1_10108198 | |||
| 1768 | JGI25160J50197_1000629 | |||
| 1769 | JGI25160J50197_1004121 | |||
| 1770 | JGI25160J50197_1014342 | |||
| 1771 | Ga0055535_1005898 | |||
| 1772 | Ga0055542_1004965 | |||
| 1773 | Ga0055526_1029184 | |||
| 1774 | Ga0055528_1000076 | |||
| 1775 | Ga0055531_10000005 | |||
| 1776 | Ga0058862_12715360 | |||
| 1777 | Ga0065165_1000042 | |||
| 1778 | Ga0065165_1012716 | |||
| 1779 | Ga0065165_1019191 | |||
| 1780 | Ga0065714_10081301 | |||
| 1781 | Ga0065704_10070133 | |||
| 1782 | Ga0065704_10071523 | |||
| 1783 | Ga0065704_10093138 | |||
| 1784 | Ga0065704_10137437 | |||
| 1785 | Ga0065712_10012699 | |||
| 1786 | Ga0065712_10018752 | |||
| 1787 | Ga0065712_10073112 | |||
| 1788 | Ga0065715_10140579 | |||
| 1789 | Ga0065715_10166983 | |||
| 1790 | Ga0065715_10315304 | |||
| 1791 | Ga0070658_10000832 | |||
| 1792 | Ga0070658_10008928 | |||
| 1793 | Ga0070658_10033602 | |||
| 1794 | Ga0070658_10086590 | |||
| 1795 | Ga0070658_10342780 | |||
| 1796 | Ga0070676_10000006 | |||
| 1797 | Ga0070676_10247092 | |||
| 1798 | Ga0070683_100006473 | |||
| 1799 | Ga0070683_100052654 | |||
| 1800 | Ga0070683_100232863 | |||
| 1801 | Ga0070683_100248108 | |||
| 1802 | Ga0070683_100605071 | |||
| 1803 | Ga0070690_100004961 | |||
| 1804 | Ga0070690_100005168 | |||
| 1805 | Ga0070690_100204802 | |||
| 1806 | Ga0070670_100008348 | |||
| 1807 | Ga0070670_100011501 | |||
| 1808 | Ga0070670_100021427 | |||
| 1809 | Ga0070670_100021906 | |||
| 1810 | Ga0070670_100044163 | |||
| 1811 | Ga0070670_100244640 | |||
| 1812 | Ga0070670_100265922 | |||
| 1813 | Ga0070670_100712546 | |||
| 1814 | Ga0070677_10012650 | |||
| 1815 | Ga0070677_10023660 | |||
| 1816 | Ga0070677_10047438 | |||
| 1817 | Ga0070677_10056344 | |||
| 1818 | Ga0070677_10200642 | |||
| 1819 | Ga0068869_100002227 | |||
| 1820 | Ga0068869_100006663 | |||
| 1821 | Ga0068869_100010045 | |||
| 1822 | Ga0068869_100031106 | |||
| 1823 | Ga0068869_100036008 | |||
| 1824 | Ga0068869_100041025 | |||
| 1825 | Ga0068869_100046687 | |||
| 1826 | Ga0068869_100069011 | |||
| 1827 | Ga0068869_100092971 | |||
| 1828 | Ga0070666_10000227 | |||
| 1829 | Ga0070666_10000694 | |||
| 1830 | Ga0070666_10009099 | |||
| 1831 | Ga0070666_10012591 | |||
| 1832 | Ga0070666_10019390 | |||
| 1833 | Ga0070666_10044490 | |||
| 1834 | Ga0070666_10134194 | |||
| 1835 | Ga0070666_10160225 | |||
| 1836 | Ga0070680_100000268 | |||
| 1837 | Ga0070680_100004673 | |||
| 1838 | Ga0070680_100050043 | |||
| 1839 | Ga0070680_100069104 | |||
| 1840 | Ga0070680_100130284 | |||
| 1841 | Ga0070680_100130366 | |||
| 1842 | Ga0070680_100130693 | |||
| 1843 | Ga0070682_100000121 | |||
| 1844 | Ga0070682_100003830 | |||
| 1845 | Ga0070682_100016418 | |||
| 1846 | Ga0070682_100028182 | |||
| 1847 | Ga0070682_100033805 | |||
| 1848 | Ga0068868_100000022 | |||
| 1849 | Ga0068868_100003164 | |||
| 1850 | Ga0068868_100004764 | |||
| 1851 | Ga0068868_100021170 | |||
| 1852 | Ga0068868_100038511 | |||
| 1853 | Ga0068868_100057649 | |||
| 1854 | Ga0068868_100261025 | |||
| 1855 | Ga0068868_100273646 | |||
| 1856 | Ga0068868_100540206 | |||
| 1857 | Ga0070660_100000435 | |||
| 1858 | Ga0070660_100023136 | |||
| 1859 | Ga0070660_100023630 | |||
| 1860 | Ga0070660_100175755 | |||
| 1861 | Ga0070660_100252913 | |||
| 1862 | Ga0070660_100324455 | |||
| 1863 | Ga0070689_100004351 | |||
| 1864 | Ga0070689_100023419 | |||
| 1865 | Ga0070689_100110864 | |||
| 1866 | Ga0070689_100381993 | |||
| 1867 | Ga0070689_100535708 | |||
| 1868 | Ga0070691_10000271 | |||
| 1869 | Ga0070691_10006755 | |||
| 1870 | Ga0070687_100010030 | |||
| 1871 | Ga0070687_100151165 | |||
| 1872 | Ga0070687_100157484 | |||
| 1873 | Ga0070687_100247538 | |||
| 1874 | Ga0070661_100000111 | |||
| 1875 | Ga0070661_100025124 | |||
| 1876 | Ga0070661_100030269 | |||
| 1877 | Ga0070661_100228891 | |||
| 1878 | Ga0070661_100492981 | |||
| 1879 | Ga0070692_10163657 | |||
| 1880 | Ga0070668_100000016 | |||
| 1881 | Ga0070668_100004396 | |||
| 1882 | Ga0070668_100061602 | |||
| 1883 | Ga0070668_100079328 | |||
| 1884 | Ga0070668_100100036 | |||
| 1885 | Ga0070668_100421231 | |||
| 1886 | Ga0070669_100004867 | |||
| 1887 | Ga0070669_100041985 | |||
| 1888 | Ga0070669_100068518 | |||
| 1889 | Ga0070669_100343310 | |||
| 1890 | Ga0070669_100411759 | |||
| 1891 | Ga0070669_100491723 | |||
| 1892 | Ga0070675_100005753 | |||
| 1893 | Ga0070675_100006416 | |||
| 1894 | Ga0070675_100008108 | |||
| 1895 | Ga0070675_100036770 | |||
| 1896 | Ga0070675_100048759 | |||
| 1897 | Ga0070675_100071795 | |||
| 1898 | Ga0070675_100130672 | |||
| 1899 | Ga0070675_100178729 | |||
| 1900 | Ga0070675_100308475 | |||
| 1901 | Ga0070675_100400601 | |||
| 1902 | Ga0070671_100001071 | |||
| 1903 | Ga0070671_100016763 | |||
| 1904 | Ga0070671_100034912 | |||
| 1905 | Ga0070671_100063744 | |||
| 1906 | Ga0070671_100069870 | |||
| 1907 | Ga0070671_100216997 | |||
| 1908 | Ga0070671_100279246 | |||
| 1909 | Ga0070671_100282974 | |||
| 1910 | Ga0070674_100004177 | |||
| 1911 | Ga0070674_100008569 | |||
| 1912 | Ga0070674_100046488 | |||
| 1913 | Ga0070674_100073743 | |||
| 1914 | Ga0070674_100167388 | |||
| 1915 | Ga0070674_100241505 | |||
| 1916 | Ga0070674_100257282 | |||
| 1917 | Ga0070673_100000647 | |||
| 1918 | Ga0070673_100012819 | |||
| 1919 | Ga0070673_100043821 | |||
| 1920 | Ga0070673_100105003 | |||
| 1921 | Ga0070673_100155086 | |||
| 1922 | Ga0070673_100209845 | |||
| 1923 | Ga0070673_100400062 | |||
| 1924 | Ga0070673_100421741 | |||
| 1925 | Ga0070688_100011317 | |||
| 1926 | Ga0070688_100023336 | |||
| 1927 | Ga0070688_100086078 | |||
| 1928 | Ga0070688_100114625 | |||
| 1929 | Ga0070688_100179997 | |||
| 1930 | Ga0070659_100003767 | |||
| 1931 | Ga0070659_100014034 | |||
| 1932 | Ga0070659_100020362 | |||
| 1933 | Ga0070659_100029070 | |||
| 1934 | Ga0070659_100029798 | |||
| 1935 | Ga0070659_100030187 | |||
| 1936 | Ga0070659_100050449 | |||
| 1937 | Ga0070659_100358077 | |||
| 1938 | Ga0070667_100000031 | |||
| 1939 | Ga0070667_100002868 | |||
| 1940 | Ga0070667_100006052 | |||
| 1941 | Ga0070667_100008509 | |||
| 1942 | Ga0070667_100044059 | |||
| 1943 | Ga0070667_100064433 | |||
| 1944 | Ga0070667_100154506 | |||
| 1945 | Ga0070700_100033128 | |||
| 1946 | Ga0070694_100266830 | |||
| 1947 | Ga0070694_100373718 | |||
| 1948 | Ga0070663_100119612 | |||
| 1949 | Ga0070663_100129873 | |||
| 1950 | Ga0070663_100144770 | |||
| 1951 | Ga0070663_100197823 | |||
| 1952 | Ga0070663_100302322 | |||
| 1953 | Ga0070678_100035844 | |||
| 1954 | Ga0070678_100050171 | |||
| 1955 | Ga0070678_100060376 | |||
| 1956 | Ga0070678_100121658 | |||
| 1957 | Ga0070678_100232254 | |||
| 1958 | Ga0070662_100002529 | |||
| 1959 | Ga0070662_100005807 | |||
| 1960 | Ga0070662_100012492 | |||
| 1961 | Ga0070662_100018748 | |||
| 1962 | Ga0070662_100105351 | |||
| 1963 | Ga0070662_100310114 | |||
| 1964 | Ga0070681_10058199 | |||
| 1965 | Ga0070681_10096648 | |||
| 1966 | Ga0070681_10154662 | |||
| 1967 | Ga0070681_10228065 | |||
| 1968 | Ga0068867_100003157 | |||
| 1969 | Ga0068867_100006892 | |||
| 1970 | Ga0068867_100015431 | |||
| 1971 | Ga0068867_100016374 | |||
| 1972 | Ga0068867_100023362 | |||
| 1973 | Ga0068867_100028363 | |||
| 1974 | Ga0068867_100172854 | |||
| 1975 | Ga0068867_100199724 | |||
| 1976 | Ga0068867_100303340 | |||
| 1977 | Ga0068867_100414964 | |||
| 1978 | Ga0068867_100428912 | |||
| 1979 | Ga0068867_100473155 | |||
| 1980 | Ga0070685_10016450 | |||
| 1981 | Ga0070685_10028206 | |||
| 1982 | Ga0070685_10136608 | |||
| 1983 | Ga0070685_10184022 | |||
| 1984 | Ga0070685_10206964 | |||
| 1985 | Ga0070698_100001074 | |||
| 1986 | Ga0070698_100021867 | |||
| 1987 | Ga0070699_100058158 | |||
| 1988 | Ga0070679_100000065 | |||
| 1989 | Ga0070679_100002882 | |||
| 1990 | Ga0070679_100036718 | |||
| 1991 | Ga0070679_100042591 | |||
| 1992 | Ga0070679_100065722 | |||
| 1993 | Ga0070679_100078001 | |||
| 1994 | Ga0070679_100216120 | |||
| 1995 | Ga0070684_100000105 | |||
| 1996 | Ga0070684_100004644 | |||
| 1997 | Ga0070684_100015175 | |||
| 1998 | Ga0070684_100043075 | |||
| 1999 | Ga0070684_100108475 | |||
| 2000 | Ga0070684_100273147 | |||
| 2001 | Ga0068853_100003177 | |||
| 2002 | Ga0068853_100003898 | |||
| 2003 | Ga0068853_100007950 | |||
| 2004 | Ga0068853_100015462 | |||
| 2005 | Ga0068853_100035465 | |||
| 2006 | Ga0068853_100070895 | |||
| 2007 | Ga0068853_100080921 | |||
| 2008 | Ga0068853_100087381 | |||
| 2009 | Ga0068853_100088826 | |||
| 2010 | Ga0068853_100152453 | |||
| 2011 | Ga0068853_100191692 | |||
| 2012 | Ga0068853_100208714 | |||
| 2013 | Ga0068853_100256843 | |||
| 2014 | Ga0068853_100304439 | |||
| 2015 | Ga0068853_100428591 | |||
| 2016 | Ga0068853_100665724 | |||
| 2017 | Ga0070672_100000002 | |||
| 2018 | Ga0070672_100083989 | |||
| 2019 | Ga0070672_100085753 | |||
| 2020 | Ga0070672_100086807 | |||
| 2021 | Ga0070672_100087552 | |||
| 2022 | Ga0070672_100109598 | |||
| 2023 | Ga0070672_100156804 | |||
| 2024 | Ga0070672_100212025 | |||
| 2025 | Ga0070672_100342433 | |||
| 2026 | Ga0070672_100610667 | |||
| 2027 | Ga0070686_100003465 | |||
| 2028 | Ga0070686_100065937 | |||
| 2029 | Ga0070686_100329803 | |||
| 2030 | Ga0070665_100000014 | |||
| 2031 | Ga0070665_100005140 | |||
| 2032 | Ga0070665_100006640 | |||
| 2033 | Ga0070665_100065618 | |||
| 2034 | Ga0070665_100273570 | |||
| 2035 | Ga0070704_100149618 | |||
| 2036 | Ga0068855_100000145 | |||
| 2037 | Ga0068855_100006230 | |||
| 2038 | Ga0068855_100011315 | |||
| 2039 | Ga0068855_100014337 | |||
| 2040 | Ga0068855_100027736 | |||
| 2041 | Ga0068855_100040477 | |||
| 2042 | Ga0068855_100042967 | |||
| 2043 | Ga0068855_100045242 | |||
| 2044 | Ga0068855_100055060 | |||
| 2045 | Ga0068855_100094589 | |||
| 2046 | Ga0068855_100115606 | |||
| 2047 | Ga0068855_100480018 | |||
| 2048 | Ga0068855_100798562 | |||
| 2049 | Ga0070664_100018131 | |||
| 2050 | Ga0070664_100023801 | |||
| 2051 | Ga0070664_100030215 | |||
| 2052 | Ga0070664_100048984 | |||
| 2053 | Ga0070664_100054281 | |||
| 2054 | Ga0070664_100056052 | |||
| 2055 | Ga0070664_100100457 | |||
| 2056 | Ga0070664_100102850 | |||
| 2057 | Ga0070664_100369083 | |||
| 2058 | Ga0068857_100002762 | |||
| 2059 | Ga0068857_100005990 | |||
| 2060 | Ga0068857_100031692 | |||
| 2061 | Ga0068857_100042049 | |||
| 2062 | Ga0068857_100058032 | |||
| 2063 | Ga0068857_100095977 | |||
| 2064 | Ga0068857_100105944 | |||
| 2065 | Ga0068857_100113488 | |||
| 2066 | Ga0068857_100134867 | |||
| 2067 | Ga0068857_100175180 | |||
| 2068 | Ga0068857_100396788 | |||
| 2069 | Ga0068854_100012054 | |||
| 2070 | Ga0068854_100057238 | |||
| 2071 | Ga0068854_100082132 | |||
| 2072 | Ga0068854_100108321 | |||
| 2073 | Ga0068854_100134408 | |||
| 2074 | Ga0068854_100198184 | |||
| 2075 | Ga0068854_100242548 | |||
| 2076 | Ga0068854_100316913 | |||
| 2077 | Ga0068856_100013815 | |||
| 2078 | Ga0068856_100089008 | |||
| 2079 | Ga0068856_100103576 | |||
| 2080 | Ga0068856_100110381 | |||
| 2081 | Ga0068856_100148652 | |||
| 2082 | Ga0070702_100047398 | |||
| 2083 | Ga0070702_100169858 | |||
| 2084 | Ga0068852_100000460 | |||
| 2085 | Ga0068852_100000633 | |||
| 2086 | Ga0068852_100005237 | |||
| 2087 | Ga0068852_100023821 | |||
| 2088 | Ga0068852_100071128 | |||
| 2089 | Ga0068852_100071686 | |||
| 2090 | Ga0068852_100077426 | |||
| 2091 | Ga0068852_100093553 | |||
| 2092 | Ga0068852_100107484 | |||
| 2093 | Ga0068852_100162450 | |||
| 2094 | Ga0068852_100162995 | |||
| 2095 | Ga0068852_100198257 | |||
| 2096 | Ga0068852_100237693 | |||
| 2097 | Ga0068852_100905361 | |||
| 2098 | Ga0068859_100000025 | |||
| 2099 | Ga0068859_100000620 | |||
| 2100 | Ga0068859_100014339 | |||
| 2101 | Ga0068859_100024129 | |||
| 2102 | Ga0068859_100034637 | |||
| 2103 | Ga0068859_100054126 | |||
| 2104 | Ga0068859_100079230 | |||
| 2105 | Ga0068859_100117846 | |||
| 2106 | Ga0068859_100274321 | |||
| 2107 | Ga0068859_100426097 | |||
| 2108 | Ga0068859_100460509 | |||
| 2109 | Ga0068859_100509932 | |||
| 2110 | Ga0068864_100013058 | |||
| 2111 | Ga0068864_100015413 | |||
| 2112 | Ga0068864_100079728 | |||
| 2113 | Ga0068864_100084956 | |||
| 2114 | Ga0068864_100086870 | |||
| 2115 | Ga0068864_100153531 | |||
| 2116 | Ga0068864_100191828 | |||
| 2117 | Ga0068864_100294288 | |||
| 2118 | Ga0068864_100743853 | |||
| 2119 | Ga0068866_10038324 | |||
| 2120 | Ga0068861_100003363 | |||
| 2121 | Ga0068861_100018392 | |||
| 2122 | Ga0068861_100105925 | |||
| 2123 | Ga0068861_100125876 | |||
| 2124 | Ga0068861_100147400 | |||
| 2125 | Ga0068861_100158400 | |||
| 2126 | Ga0068861_100187976 | |||
| 2127 | Ga0068861_100450583 | |||
| 2128 | Ga0068861_100453952 | |||
| 2129 | Ga0068851_10002711 | |||
| 2130 | Ga0068851_10011257 | |||
| 2131 | Ga0068851_10020857 | |||
| 2132 | Ga0068851_10032956 | |||
| 2133 | Ga0068870_10001746 | |||
| 2134 | Ga0068870_10044115 | |||
| 2135 | Ga0068870_10063064 | |||
| 2136 | Ga0068870_10075756 | |||
| 2137 | Ga0068870_10246494 | |||
| 2138 | Ga0068863_100000828 | |||
| 2139 | Ga0068863_100006381 | |||
| 2140 | Ga0068863_100091628 | |||
| 2141 | Ga0068863_100126528 | |||
| 2142 | Ga0068863_100167737 | |||
| 2143 | Ga0068863_100172052 | |||
| 2144 | Ga0068863_100191952 | |||
| 2145 | Ga0068863_100192948 | |||
| 2146 | Ga0068863_100363649 | |||
| 2147 | Ga0068863_100371395 | |||
| 2148 | Ga0068863_100442018 | |||
| 2149 | Ga0068858_100000083 | |||
| 2150 | Ga0068858_100007865 | |||
| 2151 | Ga0068858_100060801 | |||
| 2152 | Ga0068858_100155548 | |||
| 2153 | Ga0068858_100350304 | |||
| 2154 | Ga0068860_100000394 | |||
| 2155 | Ga0068860_100001434 | |||
| 2156 | Ga0068860_100002803 | |||
| 2157 | Ga0068860_100004639 | |||
| 2158 | Ga0068860_100017100 | |||
| 2159 | Ga0068860_100019703 | |||
| 2160 | Ga0068860_100045115 | |||
| 2161 | Ga0068860_100050964 | |||
| 2162 | Ga0068860_100081217 | |||
| 2163 | Ga0068860_100198969 | |||
| 2164 | Ga0068860_100210570 | |||
| 2165 | Ga0068860_100290179 | |||
| 2166 | Ga0068860_100290977 | |||
| 2167 | Ga0068862_100006063 | |||
| 2168 | Ga0068862_100025061 | |||
| 2169 | Ga0068862_100178592 | |||
| 2170 | Ga0068862_100191067 | |||
| 2171 | Ga0068862_100384352 | |||
| 2172 | Ga0081455_10200441 | |||
| 2173 | Ga0081540_1004387 | |||
| 2174 | Ga0081539_10000120 | |||
| 2175 | Ga0081539_10079698 | |||
| 2176 | Ga0070716_100233976 | |||
| 2177 | Ga0075366_10001639 | |||
| 2178 | Ga0097621_100000359 | |||
| 2179 | Ga0097621_100005579 | |||
| 2180 | Ga0097621_100006732 | |||
| 2181 | Ga0097621_100007074 | |||
| 2182 | Ga0097621_100014116 | |||
| 2183 | Ga0097621_100026798 | |||
| 2184 | Ga0097621_100033358 | |||
| 2185 | Ga0097621_100042230 | |||
| 2186 | Ga0097621_100045409 | |||
| 2187 | Ga0097621_100125632 | |||
| 2188 | Ga0097621_100344847 | |||
| 2189 | Ga0097621_100350049 | |||
| 2190 | Ga0075370_10134258 | |||
| 2191 | Ga0068871_100000201 | |||
| 2192 | Ga0068871_100001122 | |||
| 2193 | Ga0068871_100001167 | |||
| 2194 | Ga0068871_100004905 | |||
| 2195 | Ga0068871_100016233 | |||
| 2196 | Ga0068871_100017179 | |||
| 2197 | Ga0068871_100032661 | |||
| 2198 | Ga0068871_100059335 | |||
| 2199 | Ga0068871_100091360 | |||
| 2200 | Ga0068871_100130796 | |||
| 2201 | Ga0068871_100205334 | |||
| 2202 | Ga0068871_100220007 | |||
| 2203 | Ga0068871_100241784 | |||
| 2204 | Ga0068871_100279066 | |||
| 2205 | Ga0068871_100339180 | |||
| 2206 | Ga0075428_100013338 | |||
| 2207 | Ga0075428_100022436 | |||
| 2208 | Ga0075428_100095842 | |||
| 2209 | Ga0075428_100432096 | |||
| 2210 | Ga0075430_100000960 | |||
| 2211 | Ga0075430_100030207 | |||
| 2212 | Ga0075431_100003991 | |||
| 2213 | Ga0075431_100105960 | |||
| 2214 | Ga0075431_100172339 | |||
| 2215 | Ga0075433_10276765 | |||
| 2216 | Ga0075429_100000723 | |||
| 2217 | Ga0075429_100021817 | |||
| 2218 | Ga0068865_100006537 | |||
| 2219 | Ga0068865_100006991 | |||
| 2220 | Ga0068865_100339307 | |||
| 2221 | Ga0097620_100000025 | |||
| 2222 | Ga0097620_100000620 | |||
| 2223 | Ga0097620_100014339 | |||
| 2224 | Ga0097620_100024129 | |||
| 2225 | Ga0097620_100034637 | |||
| 2226 | Ga0097620_100054126 | |||
| 2227 | Ga0097620_100079229 | |||
| 2228 | Ga0097620_100117848 | |||
| 2229 | Ga0097620_100274313 | |||
| 2230 | Ga0097620_100426142 | |||
| 2231 | Ga0097620_100460531 | |||
| 2232 | Ga0097620_100509905 | |||
| 2233 | Ga0105244_10068242 | |||
| 2234 | Ga0105240_10000736 | |||
| 2235 | Ga0105240_10008191 | |||
| 2236 | Ga0105240_10025004 | |||
| 2237 | Ga0105240_10055887 | |||
| 2238 | Ga0105240_10114513 | |||
| 2239 | Ga0105240_10115744 | |||
| 2240 | Ga0105240_10150908 | |||
| 2241 | Ga0105240_10153175 | |||
| 2242 | Ga0105240_10171124 | |||
| 2243 | Ga0105240_10242673 | |||
| 2244 | Ga0105240_10604195 | |||
| 2245 | Ga0111539_10013194 | |||
| 2246 | Ga0111539_10017894 | |||
| 2247 | Ga0111539_10058363 | |||
| 2248 | Ga0111539_10189035 | |||
| 2249 | Ga0111539_10362812 | |||
| 2250 | Ga0111539_10972321 | |||
| 2251 | Ga0105245_10082218 | |||
| 2252 | Ga0105245_10159574 | |||
| 2253 | Ga0105247_10005517 | |||
| 2254 | Ga0105247_10006929 | |||
| 2255 | Ga0105247_10046703 | |||
| 2256 | Ga0105247_10074751 | |||
| 2257 | Ga0114129_10005551 | |||
| 2258 | Ga0114129_10041895 | |||
| 2259 | Ga0114129_10065908 | |||
| 2260 | Ga0114129_10337473 | |||
| 2261 | Ga0105243_10000003 | |||
| 2262 | Ga0105243_10235422 | |||
| 2263 | Ga0105243_10268929 | |||
| 2264 | Ga0105241_10000252 | |||
| 2265 | Ga0105241_10001151 | |||
| 2266 | Ga0105241_10002136 | |||
| 2267 | Ga0105241_10189042 | |||
| 2268 | Ga0105241_10333041 | |||
| 2269 | Ga0105241_10385974 | |||
| 2270 | Ga0105241_10507199 | |||
| 2271 | Ga0105241_10644542 | |||
| 2272 | Ga0105242_10014635 | |||
| 2273 | Ga0105242_10015096 | |||
| 2274 | Ga0105242_10041366 | |||
| 2275 | Ga0105242_10079922 | |||
| 2276 | Ga0105242_10130708 | |||
| 2277 | Ga0105242_10322900 | |||
| 2278 | Ga0105242_10343582 | |||
| 2279 | Ga0105248_10033685 | |||
| 2280 | Ga0105248_10105872 | |||
| 2281 | Ga0105248_10475104 | |||
| 2282 | Ga0105248_10650473 | |||
| 2283 | Ga0105237_10000120 | |||
| 2284 | Ga0105237_10000191 | |||
| 2285 | Ga0105237_10000650 | |||
| 2286 | Ga0105237_10002013 | |||
| 2287 | Ga0105237_10005067 | |||
| 2288 | Ga0105237_10006188 | |||
| 2289 | Ga0105237_10008039 | |||
| 2290 | Ga0105237_10008044 | |||
| 2291 | Ga0105237_10056852 | |||
| 2292 | Ga0105237_10057424 | |||
| 2293 | Ga0105237_10072842 | |||
| 2294 | Ga0105237_10189673 | |||
| 2295 | Ga0105237_10265166 | |||
| 2296 | Ga0105237_10660497 | |||
| 2297 | Ga0105238_10000488 | |||
| 2298 | Ga0105238_10004065 | |||
| 2299 | Ga0105238_10153283 | |||
| 2300 | Ga0105238_10285597 | |||
| 2301 | Ga0105238_10367911 | |||
| 2302 | Ga0105249_10001096 | |||
| 2303 | Ga0105249_10001117 | |||
| 2304 | Ga0105249_10003110 | |||
| 2305 | Ga0105249_10017168 | |||
| 2306 | Ga0105249_10026113 | |||
| 2307 | Ga0105249_10033107 | |||
| 2308 | Ga0105249_10069957 | |||
| 2309 | Ga0105249_10072653 | |||
| 2310 | Ga0105249_10188257 | |||
| 2311 | Ga0105249_10265924 | |||
| 2312 | Ga0105249_10308745 | |||
| 2313 | Ga0105249_10515747 | |||
| 2314 | Ga0105249_10574319 | |||
| 2315 | Ga0105249_10871748 | |||
| 2316 | Ga0105239_10000019 | |||
| 2317 | Ga0105239_10001466 | |||
| 2318 | Ga0105239_10006447 | |||
| 2319 | Ga0105239_10006468 | |||
| 2320 | Ga0105239_10009941 | |||
| 2321 | Ga0105239_10012772 | |||
| 2322 | Ga0105239_10013262 | |||
| 2323 | Ga0105239_10020677 | |||
| 2324 | Ga0105239_10036305 | |||
| 2325 | Ga0105239_10097580 | |||
| 2326 | Ga0105239_10145469 | |||
| 2327 | Ga0105239_10175404 | |||
| 2328 | Ga0105239_10207311 | |||
| 2329 | Ga0105239_10272393 | |||
| 2330 | Ga0105239_10500130 | |||
| 2331 | Ga0105246_10010776 | |||
| 2332 | Ga0105246_10044034 | |||
| 2333 | Ga0105246_10093878 | |||
| 2334 | Ga0105246_10119725 | |||
| 2335 | Ga0105246_10273011 | |||
| 2336 | Ga0157373_10001608 | |||
| 2337 | Ga0157373_10002576 | |||
| 2338 | Ga0157373_10006807 | |||
| 2339 | Ga0157373_10024575 | |||
| 2340 | Ga0157373_10064345 | |||
| 2341 | Ga0157373_10070418 | |||
| 2342 | Ga0157373_10070852 | |||
| 2343 | Ga0157373_10128654 | |||
| 2344 | Ga0157373_10230328 | |||
| 2345 | Ga0157373_10346201 | |||
| 2346 | Ga0157371_10000654 | |||
| 2347 | Ga0157371_10001795 | |||
| 2348 | Ga0157371_10002288 | |||
| 2349 | Ga0157371_10002367 | |||
| 2350 | Ga0157371_10011887 | |||
| 2351 | Ga0157371_10012155 | |||
| 2352 | Ga0157371_10022720 | |||
| 2353 | Ga0157371_10024374 | |||
| 2354 | Ga0157371_10024595 | |||
| 2355 | Ga0157371_10026284 | |||
| 2356 | Ga0157371_10031438 | |||
| 2357 | Ga0157371_10032065 | |||
| 2358 | Ga0157371_10044804 | |||
| 2359 | Ga0157371_10058776 | |||
| 2360 | Ga0157371_10073071 | |||
| 2361 | Ga0157371_10079490 | |||
| 2362 | Ga0157371_10149832 | |||
| 2363 | Ga0157371_10194448 | |||
| 2364 | Ga0157371_10276722 | |||
| 2365 | Ga0157370_10000245 | |||
| 2366 | Ga0157370_10003395 | |||
| 2367 | Ga0157370_10006366 | |||
| 2368 | Ga0157370_10007344 | |||
| 2369 | Ga0157370_10024360 | |||
| 2370 | Ga0157370_10025512 | |||
| 2371 | Ga0157370_10035327 | |||
| 2372 | Ga0157370_10040331 | |||
| 2373 | Ga0157370_10044800 | |||
| 2374 | Ga0157370_10070334 | |||
| 2375 | Ga0157370_10194728 | |||
| 2376 | Ga0157370_10433930 | |||
| 2377 | Ga0157369_10036773 | |||
| 2378 | Ga0157369_10039810 | |||
| 2379 | Ga0157369_10072312 | |||
| 2380 | Ga0157369_10080255 | |||
| 2381 | Ga0157369_10119228 | |||
| 2382 | Ga0157369_10132318 | |||
| 2383 | Ga0157369_10161892 | |||
| 2384 | Ga0157369_10194417 | |||
| 2385 | Ga0157369_10208577 | |||
| 2386 | Ga0157369_10407816 | |||
| 2387 | Ga0157369_10608313 | |||
| 2388 | Ga0157374_10000011 | |||
| 2389 | Ga0157374_10000074 | |||
| 2390 | Ga0157374_10009861 | |||
| 2391 | Ga0157374_10072173 | |||
| 2392 | Ga0157374_10090817 | |||
| 2393 | Ga0157374_10180635 | |||
| 2394 | Ga0157374_10216219 | |||
| 2395 | Ga0157374_10263202 | |||
| 2396 | Ga0157374_10281422 | |||
| 2397 | Ga0157374_10330394 | |||
| 2398 | Ga0157374_10348706 | |||
| 2399 | Ga0157374_10364789 | |||
| 2400 | Ga0157374_10707811 | |||
| 2401 | Ga0157374_10758437 | |||
| 2402 | Ga0157374_10787728 | |||
| 2403 | Ga0157378_10001083 | |||
| 2404 | Ga0157378_10003875 | |||
| 2405 | Ga0157378_10007261 | |||
| 2406 | Ga0157378_10021877 | |||
| 2407 | Ga0157378_10032861 | |||
| 2408 | Ga0157378_10034119 | |||
| 2409 | Ga0157378_10035551 | |||
| 2410 | Ga0157378_10084594 | |||
| 2411 | Ga0157378_10112226 | |||
| 2412 | Ga0157378_10154180 | |||
| 2413 | Ga0157378_10270672 | |||
| 2414 | Ga0163162_10000029 | |||
| 2415 | Ga0163162_10000424 | |||
| 2416 | Ga0163162_10000672 | |||
| 2417 | Ga0163162_10001000 | |||
| 2418 | Ga0163162_10006904 | |||
| 2419 | Ga0163162_10008883 | |||
| 2420 | Ga0163162_10010208 | |||
| 2421 | Ga0163162_10018237 | |||
| 2422 | Ga0163162_10024706 | |||
| 2423 | Ga0163162_10026812 | |||
| 2424 | Ga0163162_10028572 | |||
| 2425 | Ga0163162_10050625 | |||
| 2426 | Ga0163162_10067934 | |||
| 2427 | Ga0163162_10218104 | |||
| 2428 | Ga0163162_10236174 | |||
| 2429 | Ga0163162_10292488 | |||
| 2430 | Ga0163162_10298858 | |||
| 2431 | Ga0163162_10371074 | |||
| 2432 | Ga0163162_10421456 | |||
| 2433 | Ga0163162_10531460 | |||
| 2434 | Ga0157372_10000437 | |||
| 2435 | Ga0157372_10001585 | |||
| 2436 | Ga0157372_10012413 | |||
| 2437 | Ga0157372_10016411 | |||
| 2438 | Ga0157372_10056409 | |||
| 2439 | Ga0157372_10060176 | |||
| 2440 | Ga0157372_10063383 | |||
| 2441 | Ga0157372_10109708 | |||
| 2442 | Ga0157372_10130082 | |||
| 2443 | Ga0157372_10136921 | |||
| 2444 | Ga0157372_10147859 | |||
| 2445 | Ga0157372_10174508 | |||
| 2446 | Ga0157372_10182361 | |||
| 2447 | Ga0157372_10201359 | |||
| 2448 | Ga0157372_10220428 | |||
| 2449 | Ga0157372_10245123 | |||
| 2450 | Ga0157372_10264132 | |||
| 2451 | Ga0157372_10319300 | |||
| 2452 | Ga0157372_10416760 | |||
| 2453 | Ga0157372_10422184 | |||
| 2454 | Ga0157372_10554957 | |||
| 2455 | Ga0157372_10662951 | |||
| 2456 | Ga0157372_10760567 | |||
| 2457 | Ga0157372_11030038 | |||
| 2458 | Ga0157375_10000042 | |||
| 2459 | Ga0157375_10002200 | |||
| 2460 | Ga0157375_10007437 | |||
| 2461 | Ga0157375_10011363 | |||
| 2462 | Ga0157375_10014906 | |||
| 2463 | Ga0157375_10025790 | |||
| 2464 | Ga0157375_10034205 | |||
| 2465 | Ga0157375_10038344 | |||
| 2466 | Ga0157375_10056879 | |||
| 2467 | Ga0157375_10070453 | |||
| 2468 | Ga0157375_10077650 | |||
| 2469 | Ga0157375_10082250 | |||
| 2470 | Ga0157375_10097218 | |||
| 2471 | Ga0157375_10111190 | |||
| 2472 | Ga0157375_10154445 | |||
| 2473 | Ga0157375_10252055 | |||
| 2474 | Ga0157375_10270982 | |||
| 2475 | Ga0157375_10304199 | |||
| 2476 | Ga0157375_10418166 | |||
| 2477 | Ga0157375_10535583 | |||
| 2478 | Ga0157375_10574349 | |||
| 2479 | Ga0157375_10958960 | |||
| 2480 | Ga0163163_10000076 | |||
| 2481 | Ga0163163_10000831 | |||
| 2482 | Ga0163163_10033255 | |||
| 2483 | Ga0163163_10053691 | |||
| 2484 | Ga0163163_10130386 | |||
| 2485 | Ga0163163_10132443 | |||
| 2486 | Ga0163163_10369200 | |||
| 2487 | Ga0163163_10393907 | |||
| 2488 | Ga0163163_10636995 | |||
| 2489 | Ga0163163_10907084 | |||
| 2490 | Ga0157380_10000002 | |||
| 2491 | Ga0157380_10001454 | |||
| 2492 | Ga0157380_10003690 | |||
| 2493 | Ga0157380_10267766 | |||
| 2494 | Ga0157380_10339410 | |||
| 2495 | Ga0157380_10357059 | |||
| 2496 | Ga0157380_10596903 | |||
| 2497 | Ga0182008_10005441 | |||
| 2498 | Ga0157377_10003347 | |||
| 2499 | Ga0157377_10015347 | |||
| 2500 | Ga0157377_10095577 | |||
| 2501 | Ga0157377_10111841 | |||
| 2502 | Ga0157377_10204534 | |||
| 2503 | Ga0157379_10000016 | |||
| 2504 | Ga0157379_10010412 | |||
| 2505 | Ga0157379_10016392 | |||
| 2506 | Ga0157379_10024947 | |||
| 2507 | Ga0157379_10075002 | |||
| 2508 | Ga0157379_10120063 | |||
| 2509 | Ga0157379_10131879 | |||
| 2510 | Ga0157379_10459960 | |||
| 2511 | Ga0157376_10000558 | |||
| 2512 | Ga0157376_10000938 | |||
| 2513 | Ga0157376_10002924 | |||
| 2514 | Ga0157376_10014629 | |||
| 2515 | Ga0157376_10018081 | |||
| 2516 | Ga0157376_10099827 | |||
| 2517 | Ga0157376_10129355 | |||
| 2518 | Ga0157376_10245852 | |||
| 2519 | Ga0157376_10296198 | |||
| 2520 | Ga0157376_10317430 | |||
| 2521 | Ga0157376_10689700 | |||
| 2522 | Ga0182006_1000893 | |||
| 2523 | Ga0182006_1001377 | |||
| 2524 | Ga0182005_1000017 | |||
| 2525 | Ga0163161_10003336 | |||
| 2526 | Ga0163161_10007628 | |||
| 2527 | Ga0163161_10024679 | |||
| 2528 | Ga0163161_10039783 | |||
| 2529 | Ga0163161_10116336 | |||
| 2530 | Ga0163161_10171946 | |||
| 2531 | Ga0163161_10179539 | |||
| 2532 | Ga0163161_10222332 | |||
| 2533 | Ga0163161_10627263 | |||
| 2534 | Ga0206356_10730104 | |||
| 2535 | Ga0206355_1278720 | |||
| 2536 | Ga0206352_10162521 | |||
| 2537 | Ga0206352_10618337 | |||
| 2538 | Ga0206352_11221074 | |||
| 2539 | Ga0206354_10545400 | |||
| 2540 | Ga0213876_10006069 | |||
| 2541 | Ga0213876_10036217 | |||
| 2542 | Ga0224712_10043848 | |||
| 2543 | Ga0224572_1019768 | |||
| 2544 | Ga0209436_100091 | |||
| 2545 | Ga0209436_100717 | |||
| 2546 | Ga0209258_100029 | |||
| 2547 | Ga0209646_1000031 | |||
| 2548 | Ga0209026_1000019 | |||
| 2549 | Ga0209148_1000194 | |||
| 2550 | Ga0209129_1012807 | |||
| 2551 | Ga0209673_1000666 | |||
| 2552 | Ga0209130_1000333 | |||
| 2553 | Ga0209758_1001097 | |||
| 2554 | Ga0209758_1004546 | |||
| 2555 | Ga0209050_1000216 | |||
| 2556 | Ga0207426_1000024 | |||
| 2557 | Ga0207426_1000059 | |||
| 2558 | Ga0207426_1000666 | |||
| 2559 | Ga0207426_1000691 | |||
| 2560 | Ga0209051_1007049 | |||
| 2561 | Ga0209257_1000004 | |||
| 2562 | Ga0209257_1003253 | |||
| 2563 | Ga0207697_10049829 | |||
| 2564 | Ga0207697_10051080 | |||
| 2565 | Ga0207656_10000821 | |||
| 2566 | Ga0207656_10015219 | |||
| 2567 | Ga0207656_10022122 | |||
| 2568 | Ga0207656_10027244 | |||
| 2569 | Ga0207656_10040772 | |||
| 2570 | Ga0207682_10010686 | |||
| 2571 | Ga0207682_10022867 | |||
| 2572 | Ga0207682_10083185 | |||
| 2573 | Ga0207642_10105304 | |||
| 2574 | Ga0207710_10001261 | |||
| 2575 | Ga0207710_10036425 | |||
| 2576 | Ga0207710_10100545 | |||
| 2577 | Ga0207688_10012530 | |||
| 2578 | Ga0207688_10028696 | |||
| 2579 | Ga0207688_10214351 | |||
| 2580 | Ga0207680_10000180 | |||
| 2581 | Ga0207680_10004944 | |||
| 2582 | Ga0207680_10006836 | |||
| 2583 | Ga0207680_10012039 | |||
| 2584 | Ga0207680_10024014 | |||
| 2585 | Ga0207680_10060980 | |||
| 2586 | Ga0207680_10153329 | |||
| 2587 | Ga0207647_10000096 | |||
| 2588 | Ga0207647_10001348 | |||
| 2589 | Ga0207647_10009415 | |||
| 2590 | Ga0207647_10067026 | |||
| 2591 | Ga0207647_10125267 | |||
| 2592 | Ga0207685_10052456 | |||
| 2593 | Ga0207645_10002072 | |||
| 2594 | Ga0207645_10002123 | |||
| 2595 | Ga0207645_10058517 | |||
| 2596 | Ga0207645_10076107 | |||
| 2597 | Ga0207645_10110367 | |||
| 2598 | Ga0207645_10111439 | |||
| 2599 | Ga0207645_10138762 | |||
| 2600 | Ga0207645_10152646 | |||
| 2601 | Ga0207643_10006656 | |||
| 2602 | Ga0207643_10027271 | |||
| 2603 | Ga0207643_10076603 | |||
| 2604 | Ga0207643_10082550 | |||
| 2605 | Ga0207643_10250870 | |||
| 2606 | Ga0207643_10285482 | |||
| 2607 | Ga0207705_10031691 | |||
| 2608 | Ga0207705_10033295 | |||
| 2609 | Ga0207705_10042329 | |||
| 2610 | Ga0207705_10069308 | |||
| 2611 | Ga0207705_10131318 | |||
| 2612 | Ga0207705_10159548 | |||
| 2613 | Ga0207654_10000120 | |||
| 2614 | Ga0207654_10010550 | |||
| 2615 | Ga0207654_10019977 | |||
| 2616 | Ga0207654_10092538 | |||
| 2617 | Ga0207654_10482197 | |||
| 2618 | Ga0207707_10004370 | |||
| 2619 | Ga0207707_10008847 | |||
| 2620 | Ga0207707_10087100 | |||
| 2621 | Ga0207707_10175527 | |||
| 2622 | Ga0207707_10289080 | |||
| 2623 | Ga0207695_10000010 | |||
| 2624 | Ga0207695_10000212 | |||
| 2625 | Ga0207695_10001109 | |||
| 2626 | Ga0207695_10017475 | |||
| 2627 | Ga0207695_10030002 | |||
| 2628 | Ga0207695_10031859 | |||
| 2629 | Ga0207695_10037303 | |||
| 2630 | Ga0207695_10163964 | |||
| 2631 | Ga0207695_10243718 | |||
| 2632 | Ga0207695_10245236 | |||
| 2633 | Ga0207695_10302182 | |||
| 2634 | Ga0207695_10316749 | |||
| 2635 | Ga0207695_10469246 | |||
| 2636 | Ga0207671_10000340 | |||
| 2637 | Ga0207671_10001357 | |||
| 2638 | Ga0207671_10003261 | |||
| 2639 | Ga0207671_10003705 | |||
| 2640 | Ga0207671_10035342 | |||
| 2641 | Ga0207671_10041351 | |||
| 2642 | Ga0207671_10083739 | |||
| 2643 | Ga0207671_10234818 | |||
| 2644 | Ga0207671_10295940 | |||
| 2645 | Ga0207660_10001477 | |||
| 2646 | Ga0207660_10022771 | |||
| 2647 | Ga0207660_10052122 | |||
| 2648 | Ga0207660_10056415 | |||
| 2649 | Ga0207660_10072413 | |||
| 2650 | Ga0207660_10154475 | |||
| 2651 | Ga0207660_10154493 | |||
| 2652 | Ga0207662_10012235 | |||
| 2653 | Ga0207662_10056131 | |||
| 2654 | Ga0207662_10076848 | |||
| 2655 | Ga0207662_10119226 | |||
| 2656 | Ga0207657_10004066 | |||
| 2657 | Ga0207657_10004391 | |||
| 2658 | Ga0207657_10025198 | |||
| 2659 | Ga0207657_10031882 | |||
| 2660 | Ga0207657_10043993 | |||
| 2661 | Ga0207657_10116687 | |||
| 2662 | Ga0207657_10146883 | |||
| 2663 | Ga0207657_10160518 | |||
| 2664 | Ga0207657_10283212 | |||
| 2665 | Ga0207649_10000517 | |||
| 2666 | Ga0207649_10011163 | |||
| 2667 | Ga0207649_10021552 | |||
| 2668 | Ga0207649_10190033 | |||
| 2669 | Ga0207652_10000013 | |||
| 2670 | Ga0207652_10000329 | |||
| 2671 | Ga0207652_10001523 | |||
| 2672 | Ga0207652_10001591 | |||
| 2673 | Ga0207652_10005883 | |||
| 2674 | Ga0207652_10011840 | |||
| 2675 | Ga0207652_10040022 | |||
| 2676 | Ga0207652_10126827 | |||
| 2677 | Ga0207652_10144618 | |||
| 2678 | Ga0207646_10391372 | |||
| 2679 | Ga0207681_10014560 | |||
| 2680 | Ga0207681_10031756 | |||
| 2681 | Ga0207681_10034216 | |||
| 2682 | Ga0207681_10068321 | |||
| 2683 | Ga0207681_10089268 | |||
| 2684 | Ga0207681_10337437 | |||
| 2685 | Ga0207694_10054999 | |||
| 2686 | Ga0207694_10130131 | |||
| 2687 | Ga0207650_10012150 | |||
| 2688 | Ga0207650_10037753 | |||
| 2689 | Ga0207650_10042335 | |||
| 2690 | Ga0207650_10137968 | |||
| 2691 | Ga0207650_10208311 | |||
| 2692 | Ga0207650_10234174 | |||
| 2693 | Ga0207650_10263301 | |||
| 2694 | Ga0207650_10385229 | |||
| 2695 | Ga0207650_10438730 | |||
| 2696 | Ga0207659_10006103 | |||
| 2697 | Ga0207659_10051718 | |||
| 2698 | Ga0207659_10106616 | |||
| 2699 | Ga0207659_10164864 | |||
| 2700 | Ga0207659_10457943 | |||
| 2701 | Ga0207687_10178243 | |||
| 2702 | Ga0207700_10248404 | |||
| 2703 | Ga0207644_10004756 | |||
| 2704 | Ga0207644_10030460 | |||
| 2705 | Ga0207644_10037828 | |||
| 2706 | Ga0207644_10045455 | |||
| 2707 | Ga0207644_10046314 | |||
| 2708 | Ga0207644_10046902 | |||
| 2709 | Ga0207644_10080543 | |||
| 2710 | Ga0207644_10238286 | |||
| 2711 | Ga0207644_10246214 | |||
| 2712 | Ga0207644_10260345 | |||
| 2713 | Ga0207690_10027492 | |||
| 2714 | Ga0207690_10029618 | |||
| 2715 | Ga0207690_10113531 | |||
| 2716 | Ga0207690_10316554 | |||
| 2717 | Ga0207706_10003226 | |||
| 2718 | Ga0207706_10004361 | |||
| 2719 | Ga0207706_10008919 | |||
| 2720 | Ga0207706_10009576 | |||
| 2721 | Ga0207706_10022581 | |||
| 2722 | Ga0207706_10040076 | |||
| 2723 | Ga0207686_10003596 | |||
| 2724 | Ga0207686_10107892 | |||
| 2725 | Ga0207686_10199244 | |||
| 2726 | Ga0207686_10255952 | |||
| 2727 | Ga0207686_10328042 | |||
| 2728 | Ga0207709_10000008 | |||
| 2729 | Ga0207709_10189099 | |||
| 2730 | Ga0207670_10006176 | |||
| 2731 | Ga0207670_10009418 | |||
| 2732 | Ga0207670_10048455 | |||
| 2733 | Ga0207670_10163858 | |||
| 2734 | Ga0207670_10256603 | |||
| 2735 | Ga0207670_10313974 | |||
| 2736 | Ga0207669_10014263 | |||
| 2737 | Ga0207669_10021719 | |||
| 2738 | Ga0207669_10127132 | |||
| 2739 | Ga0207669_10201904 | |||
| 2740 | Ga0207704_10001247 | |||
| 2741 | Ga0207704_10234523 | |||
| 2742 | Ga0207704_10388213 | |||
| 2743 | Ga0207704_10539151 | |||
| 2744 | Ga0207691_10000004 | |||
| 2745 | Ga0207691_10009229 | |||
| 2746 | Ga0207691_10026474 | |||
| 2747 | Ga0207691_10029257 | |||
| 2748 | Ga0207691_10049555 | |||
| 2749 | Ga0207691_10065330 | |||
| 2750 | Ga0207691_10069185 | |||
| 2751 | Ga0207691_10114385 | |||
| 2752 | Ga0207691_10199328 | |||
| 2753 | Ga0207691_10229000 | |||
| 2754 | Ga0207691_10254514 | |||
| 2755 | Ga0207689_10000208 | |||
| 2756 | Ga0207689_10002065 | |||
| 2757 | Ga0207689_10002750 | |||
| 2758 | Ga0207689_10004957 | |||
| 2759 | Ga0207689_10008548 | |||
| 2760 | Ga0207689_10012192 | |||
| 2761 | Ga0207689_10017732 | |||
| 2762 | Ga0207689_10023984 | |||
| 2763 | Ga0207689_10031339 | |||
| 2764 | Ga0207689_10037762 | |||
| 2765 | Ga0207689_10037955 | |||
| 2766 | Ga0207689_10041929 | |||
| 2767 | Ga0207689_10052250 | |||
| 2768 | Ga0207689_10117376 | |||
| 2769 | Ga0207689_10346052 | |||
| 2770 | Ga0207661_10030654 | |||
| 2771 | Ga0207661_10038330 | |||
| 2772 | Ga0207661_10047917 | |||
| 2773 | Ga0207661_10054036 | |||
| 2774 | Ga0207661_10097237 | |||
| 2775 | Ga0207661_10125868 | |||
| 2776 | Ga0207661_10226234 | |||
| 2777 | Ga0207661_10287084 | |||
| 2778 | Ga0207661_10287379 | |||
| 2779 | Ga0207661_10654646 | |||
| 2780 | Ga0207679_10000091 | |||
| 2781 | Ga0207679_10003773 | |||
| 2782 | Ga0207679_10035549 | |||
| 2783 | Ga0207679_10094194 | |||
| 2784 | Ga0207679_10132061 | |||
| 2785 | Ga0207679_10135301 | |||
| 2786 | Ga0207679_10176163 | |||
| 2787 | Ga0207679_10199045 | |||
| 2788 | Ga0207679_10353138 | |||
| 2789 | Ga0207679_10502546 | |||
| 2790 | Ga0207679_10653436 | |||
| 2791 | Ga0207667_10000414 | |||
| 2792 | Ga0207667_10000508 | |||
| 2793 | Ga0207667_10006924 | |||
| 2794 | Ga0207667_10008497 | |||
| 2795 | Ga0207667_10011491 | |||
| 2796 | Ga0207667_10013252 | |||
| 2797 | Ga0207667_10067790 | |||
| 2798 | Ga0207667_10070009 | |||
| 2799 | Ga0207667_10075899 | |||
| 2800 | Ga0207667_10084006 | |||
| 2801 | Ga0207667_10123760 | |||
| 2802 | Ga0207667_10249374 | |||
| 2803 | Ga0207651_10015536 | |||
| 2804 | Ga0207651_10031671 | |||
| 2805 | Ga0207651_10048643 | |||
| 2806 | Ga0207651_10050493 | |||
| 2807 | Ga0207651_10098087 | |||
| 2808 | Ga0207651_10108301 | |||
| 2809 | Ga0207651_10121969 | |||
| 2810 | Ga0207651_10158018 | |||
| 2811 | Ga0207651_10285988 | |||
| 2812 | Ga0207651_10423201 | |||
| 2813 | Ga0207651_10500797 | |||
| 2814 | Ga0207651_10599422 | |||
| 2815 | Ga0207651_10645060 | |||
| 2816 | Ga0207712_10000725 | |||
| 2817 | Ga0207712_10000915 | |||
| 2818 | Ga0207712_10005612 | |||
| 2819 | Ga0207712_10007205 | |||
| 2820 | Ga0207712_10053207 | |||
| 2821 | Ga0207712_10064039 | |||
| 2822 | Ga0207712_10083933 | |||
| 2823 | Ga0207712_10141097 | |||
| 2824 | Ga0207712_10166988 | |||
| 2825 | Ga0207712_10206883 | |||
| 2826 | Ga0207668_10004211 | |||
| 2827 | Ga0207668_10008780 | |||
| 2828 | Ga0207668_10013882 | |||
| 2829 | Ga0207668_10527619 | |||
| 2830 | Ga0207640_10013120 | |||
| 2831 | Ga0207640_10020133 | |||
| 2832 | Ga0207640_10043240 | |||
| 2833 | Ga0207640_10057300 | |||
| 2834 | Ga0207640_10082184 | |||
| 2835 | Ga0207640_10160000 | |||
| 2836 | Ga0207640_10241970 | |||
| 2837 | Ga0207658_10019946 | |||
| 2838 | Ga0207658_10024867 | |||
| 2839 | Ga0207658_10031625 | |||
| 2840 | Ga0207658_10069456 | |||
| 2841 | Ga0207658_10089053 | |||
| 2842 | Ga0207658_10177859 | |||
| 2843 | Ga0207658_10194211 | |||
| 2844 | Ga0207677_10003486 | |||
| 2845 | Ga0207677_10026032 | |||
| 2846 | Ga0207677_10062299 | |||
| 2847 | Ga0207677_10082947 | |||
| 2848 | Ga0207677_10087612 | |||
| 2849 | Ga0207677_10118424 | |||
| 2850 | Ga0207677_10127440 | |||
| 2851 | Ga0207677_10161634 | |||
| 2852 | Ga0207677_10313097 | |||
| 2853 | Ga0207703_10003536 | |||
| 2854 | Ga0207703_10006511 | |||
| 2855 | Ga0207703_10029439 | |||
| 2856 | Ga0207703_10089581 | |||
| 2857 | Ga0207703_10133639 | |||
| 2858 | Ga0207703_10141837 | |||
| 2859 | Ga0207703_10225077 | |||
| 2860 | Ga0207639_10004779 | |||
| 2861 | Ga0207639_10010084 | |||
| 2862 | Ga0207639_10087555 | |||
| 2863 | Ga0207639_10128106 | |||
| 2864 | Ga0207639_10131501 | |||
| 2865 | Ga0207639_10168730 | |||
| 2866 | Ga0207639_10209481 | |||
| 2867 | Ga0207639_10308863 | |||
| 2868 | Ga0207639_10329869 | |||
| 2869 | Ga0207639_10347079 | |||
| 2870 | Ga0207639_10775672 | |||
| 2871 | Ga0207678_10009788 | |||
| 2872 | Ga0207678_10065525 | |||
| 2873 | Ga0207678_10123871 | |||
| 2874 | Ga0207678_10135563 | |||
| 2875 | Ga0207678_10174616 | |||
| 2876 | Ga0207708_10103813 | |||
| 2877 | Ga0207708_10184356 | |||
| 2878 | Ga0207708_10188419 | |||
| 2879 | Ga0207708_10277393 | |||
| 2880 | Ga0207702_10011609 | |||
| 2881 | Ga0207702_10027480 | |||
| 2882 | Ga0207702_10081623 | |||
| 2883 | Ga0207702_10103425 | |||
| 2884 | Ga0207641_10000132 | |||
| 2885 | Ga0207641_10002402 | |||
| 2886 | Ga0207641_10018263 | |||
| 2887 | Ga0207641_10046603 | |||
| 2888 | Ga0207641_10067826 | |||
| 2889 | Ga0207641_10092891 | |||
| 2890 | Ga0207641_10096335 | |||
| 2891 | Ga0207641_10125266 | |||
| 2892 | Ga0207641_10179079 | |||
| 2893 | Ga0207641_10215973 | |||
| 2894 | Ga0207641_10398965 | |||
| 2895 | Ga0207641_10513193 | |||
| 2896 | Ga0207648_10001340 | |||
| 2897 | Ga0207648_10003198 | |||
| 2898 | Ga0207648_10010220 | |||
| 2899 | Ga0207648_10020780 | |||
| 2900 | Ga0207648_10022209 | |||
| 2901 | Ga0207648_10026231 | |||
| 2902 | Ga0207648_10043815 | |||
| 2903 | Ga0207648_10067539 | |||
| 2904 | Ga0207648_10070428 | |||
| 2905 | Ga0207648_10142286 | |||
| 2906 | Ga0207648_10230280 | |||
| 2907 | Ga0207648_10247684 | |||
| 2908 | Ga0207648_10266074 | |||
| 2909 | Ga0207648_10294865 | |||
| 2910 | Ga0207648_10700413 | |||
| 2911 | Ga0207676_10003232 | |||
| 2912 | Ga0207676_10016302 | |||
| 2913 | Ga0207676_10029182 | |||
| 2914 | Ga0207676_10058185 | |||
| 2915 | Ga0207676_10059215 | |||
| 2916 | Ga0207676_10062970 | |||
| 2917 | Ga0207676_10132951 | |||
| 2918 | Ga0207676_10164608 | |||
| 2919 | Ga0207676_10182900 | |||
| 2920 | Ga0207676_10187268 | |||
| 2921 | Ga0207676_10254050 | |||
| 2922 | Ga0207676_10678489 | |||
| 2923 | Ga0207674_10011872 | |||
| 2924 | Ga0207674_10018362 | |||
| 2925 | Ga0207674_10027208 | |||
| 2926 | Ga0207674_10032221 | |||
| 2927 | Ga0207674_10039670 | |||
| 2928 | Ga0207674_10040843 | |||
| 2929 | Ga0207674_10068910 | |||
| 2930 | Ga0207674_10070001 | |||
| 2931 | Ga0207674_10092121 | |||
| 2932 | Ga0207674_10104554 | |||
| 2933 | Ga0207674_10111809 | |||
| 2934 | Ga0207674_10147852 | |||
| 2935 | Ga0207674_10193603 | |||
| 2936 | Ga0207674_10417419 | |||
| 2937 | Ga0207674_10716238 | |||
| 2938 | Ga0207675_100000085 | |||
| 2939 | Ga0207675_100003521 | |||
| 2940 | Ga0207675_100054385 | |||
| 2941 | Ga0207675_100096318 | |||
| 2942 | Ga0207675_100098397 | |||
| 2943 | Ga0207675_100145018 | |||
| 2944 | Ga0207675_100338865 | |||
| 2945 | Ga0207683_10002163 | |||
| 2946 | Ga0207683_10028619 | |||
| 2947 | Ga0207683_10037799 | |||
| 2948 | Ga0207683_10155039 | |||
| 2949 | Ga0207683_10167727 | |||
| 2950 | Ga0207683_10175807 | |||
| 2951 | Ga0207683_10334120 | |||
| 2952 | Ga0207698_10000539 | |||
| 2953 | Ga0207698_10005810 | |||
| 2954 | Ga0207698_10065555 | |||
| 2955 | Ga0207698_10085534 | |||
| 2956 | Ga0207698_10142083 | |||
| 2957 | Ga0207698_10166166 | |||
| 2958 | Ga0207698_10273371 | |||
| 2959 | Ga0209995_1003651 | |||
| 2960 | Ga0209999_1015920 | |||
| 2961 | Ga0209974_10055495 | |||
| 2962 | Ga0207428_10091604 | |||
| 2963 | Ga0207428_10130501 | |||
| 2964 | Ga0207428_10234197 | |||
| 2965 | Ga0268266_10000068 | |||
| 2966 | Ga0268266_10016217 | |||
| 2967 | Ga0268266_10016350 | |||
| 2968 | Ga0268266_10052154 | |||
| 2969 | Ga0268266_10078828 | |||
| 2970 | Ga0268266_10120711 | |||
| 2971 | Ga0268265_10009330 | |||
| 2972 | Ga0268265_10059591 | |||
| 2973 | Ga0268265_10136797 | |||
| 2974 | Ga0268265_10145991 | |||
| 2975 | Ga0268265_10195756 | |||
| 2976 | Ga0268265_10213977 | |||
| 2977 | Ga0268265_10235146 | |||
| 2978 | Ga0268265_10283559 | |||
| 2979 | Ga0268265_10372619 | |||
| 2980 | Ga0268265_10437002 | |||
| 2981 | Ga0268264_10000559 | |||
| 2982 | Ga0268264_10001420 | |||
| 2983 | Ga0268264_10002198 | |||
| 2984 | Ga0268264_10006807 | |||
| 2985 | Ga0268264_10007210 | |||
| 2986 | Ga0268264_10008163 | |||
| 2987 | Ga0268264_10012189 | |||
| 2988 | Ga0268264_10013451 | |||
| 2989 | Ga0268264_10053216 | |||
| 2990 | Ga0268264_10068257 | |||
| 2991 | Ga0268264_10169826 | |||
| 2992 | Ga0268264_10669416 | |||
| 2993 | Ga0265336_10066527 | |||
| 2994 | Ga0307517_10000501 | |||
| 2995 | Ga0307517_10085025 | |||
| 2996 | Ga0307517_10276900 | |||
| 2997 | Ga0307515_10000001 | |||
| 2998 | Ga0307515_10000437 | |||
| 2999 | Ga0307515_10023091 | |||
| 3000 | Ga0265338_10014843 | |||
| 3001 | Ga0265338_10095177 | |||
| 3002 | Ga0265338_10116455 | |||
| 3003 | Ga0307511_10000211 | |||
| 3004 | Ga0316181_1161142 | |||
| 3005 | Ga0265327_10000022 | |||
| 3006 | Ga0265327_10000059 | |||
| 3007 | Ga0265327_10013331 | |||
| 3008 | Ga0265316_10007452 | |||
| 3009 | Ga0265316_10176104 | |||
| 3010 | Ga0265316_10196453 | |||
| 3011 | Ga0307513_10192745 | |||
| 3012 | Ga0307509_10038218 | |||
| 3013 | Ga0307509_10087838 | |||
| 3014 | Ga0307509_10107464 | |||
| 3015 | Ga0307509_10231339 | |||
| 3016 | Ga0307509_10278046 | |||
| 3017 | Ga0307509_10388701 | |||
| 3018 | Ga0307408_100000059 | |||
| 3019 | Ga0307408_100331112 | |||
| 3020 | Ga0307508_10259499 | |||
| 3021 | Ga0265314_10073766 | |||
| 3022 | Ga0265342_10124310 | |||
| 3023 | Ga0265342_10136102 | |||
| 3024 | Ga0316576_10005179 | |||
| 3025 | Ga0316576_10038211 | |||
| 3026 | Ga0316576_10040192 | |||
| 3027 | Ga0316576_10067908 | |||
| 3028 | Ga0316576_10245712 | |||
| 3029 | Ga0316578_10003406 | |||
| 3030 | Ga0316578_10047505 | |||
| 3031 | Ga0307516_10001546 | |||
| 3032 | Ga0307413_10061249 | |||
| 3033 | Ga0307410_10007574 | |||
| 3034 | Ga0307410_10119024 | |||
| 3035 | Ga0307407_10029975 | |||
| 3036 | Ga0307412_10111249 | |||
| 3037 | Ga0307412_10413382 | |||
| 3038 | Ga0307409_100079288 | |||
| 3039 | Ga0307416_100111904 | |||
| 3040 | Ga0307414_10000378 | |||
| 3041 | Ga0307414_10035600 | |||
| 3042 | Ga0307414_10044492 | |||
| 3043 | Ga0307414_10125985 | |||
| 3044 | Ga0307414_10219679 | |||
| 3045 | Ga0307414_10644040 | |||
| 3046 | Ga0307411_10055229 | |||
| 3047 | Ga0307415_100004256 | |||
| 3048 | Ga0316585_10058918 | |||
| 3049 | Ga0316580_10009965 | |||
| 3050 | Ga0316593_10083191 | |||
| 3051 | Ga0307510_10001895 | |||
| 3052 | Ga0316592_1047437 | |||
| 3053 | Ga0316588_1063203 | |||
| 3054 | Ga0373952_0033816 | |||
| 3055 | Ga0373936_0137345 | |||
| 3056 | Ga0373953_0038655 | |||
| 3057 | Ga0373943_0197413 | |||
| 3058 | Ga0373955_0001094 | |||
| 3059 | Ga0316574_0075120 | |||
| 3060 | Ga0316574_0160134 | |||
| 3061 | Ga0316574_0224412 | |||
| 3062 | Ga0316574_0274059 | |||
| 3063 | Ga0373924_0065034 | |||
| 3064 | Ga0373935_0166107 | |||
| 3065 | Ga0373947_0081407 | |||
| 3066 | Ga0373937_0007007 | |||
| 3067 | Ga0373937_0168288 | |||
| 3068 | Ga0373937_0172615 | |||
| 3069 | Ga0316582_0047537 | |||
| 3070 | Ga0316582_0074881 | |||
| 3071 | Ga0316584_0014890 | |||
| 3072 | Ga0316584_0027770 | |||
| 3073 | Ga0316584_0068130 | |||
| 3074 | Ga0316584_0094881 | |||
| 3075 | Ga0316584_0129350 | |||
| 3076 | Ga0373925_0288928 | |||
| 3077 | Ga0395899_0001073 | |||
| 3078 | Ga0395899_0021239 | |||
| 3079 | Ga0395899_0031829 | |||
| 3080 | Ga0395899_0053320 | |||
| 3081 | Ga0395899_0065703 | |||
| 3082 | Ga0395899_0097778 | |||
| 3083 | Ga0395899_0237561 | |||
| 3084 | Ga0395900_0003278 | |||
| 3085 | Ga0395900_0016053 | |||
| 3086 | Ga0395900_0025169 | |||
| 3087 | Ga0395900_0032457 | |||
| 3088 | Ga0395900_0065738 | |||
| 3089 | Ga0395900_0102640 | |||
| 3090 | Ga0395900_0142379 | |||
| 3091 | Ga0395900_0337316 | |||
| 3092 | Ga0395898_0001727 | |||
| 3093 | Ga0395898_0026260 | |||
| 3094 | Ga0395898_0063589 | |||
| 3095 | Ga0395898_0177249 | |||
| 3096 | Ga0395898_0208036 | |||
| 3097 | Ga0395898_0714132 | |||
| 3098 | Ga0395905_0003376 | |||
| 3099 | Ga0395905_0038471 | |||
| 3100 | Ga0395905_0115292 | |||
| 3101 | Ga0395905_0191312 | |||
| 3102 | Ga0395901_0089623 | |||
| 3103 | Ga0395901_0120806 | |||
| 3104 | Ga0395901_0127862 | |||
| 3105 | Ga0395901_0221683 | |||
| 3106 | Ga0395901_0749968 | |||
| 3107 | Ga0400489_28951 | |||
| 3108 | Ga0436365_0166525 | |||
| 3109 | Ga0436365_0727468 | |||
| 3110 | Ga0436365_1175703 | |||
| 3111 | Ga0436365_1743396 | |||
| 3112 | Ga0439436_0031033 | |||
| 3113 | Ga0439438_029368 | |||
| 3114 | Ga0439439_0048096 | |||
| 3115 | Ga0439465_0026146 | |||
| 3116 | Ga0451793_0604856 | |||
| 3117 | Ga0451797_1447286 | |||
| 3118 | Ga0451835_0015060 | |||
| 3119 | Ga0451849_0809782 | |||
| 3120 | Ga0451851_0868508 | |||
| 3121 | Ga0451853_0069397 | |||
| 3122 | Ga0439431_0002027 | |||
| 3123 | Ga0439431_0004812 | |||
| 3124 | Ga0439433_0020922 | |||
| 3125 | Ga0439441_004808 | |||
| 3126 | Ga0439442_003233 | |||
| 3127 | Ga0439445_0034710 | |||
| 3128 | Ga0439449_0001040 | |||
| 3129 | Ga0439449_0005471 | |||
| 3130 | Ga0439449_0010767 | |||
| 3131 | Ga0439449_0041803 | |||
| 3132 | Ga0439449_0044275 | |||
| 3133 | Ga0439452_018091 | |||
| 3134 | Ga0439454_013708 | |||
| 3135 | Ga0439454_019205 | |||
| 3136 | Ga0439457_000130 | |||
| 3137 | Ga0439457_009773 | |||
| 3138 | Ga0439462_0001095 | |||
| 3139 | Ga0439462_0033328 | |||
| 3140 | Ga0450894_006088 | |||
| 3141 | Ga0450899_000791 | |||
| 3142 | Ga0451577_0000037 | |||
| 3143 | Ga0451577_0001531 | |||
| 3144 | Ga0451577_0004082 | |||
| 3145 | Ga0451577_0009193 | |||
| 3146 | Ga0451577_0010543 | |||
| 3147 | Ga0451577_0018249 | |||
| 3148 | Ga0451577_0024783 | |||
| 3149 | Ga0451577_0109197 | |||
| 3150 | Ga0451577_0118215 | |||
| 3151 | Ga0451577_0187779 | |||
| 3152 | Ga0451577_0235527 | |||
| 3153 | Ga0466969_0000356 | |||
| 3154 | Ga0466972_0000026 | |||
| 3155 | Ga0466972_0000047 | |||
| 3156 | Ga0466972_0001885 | |||
| 3157 | Ga0466972_0019450 | |||
| 3158 | Ga0466972_0127072 | |||
| 3159 | Ga0453683_0000021 | |||
| 3160 | Ga0453683_0000240 | |||
| 3161 | Ga0453683_0001491 | |||
| 3162 | Ga0453683_0002229 | |||
| 3163 | Ga0453683_0008430 | |||
| 3164 | Ga0453683_0033002 | |||
| 3165 | Ga0453683_0039515 | |||
| 3166 | Ga0453683_0050156 | |||
| 3167 | Ga0453683_0209059 | |||
| 3168 | Ga0466966_0000038 | |||
| 3169 | Ga0466964_0014026 | |||
| 3170 | Ga0453684_0000110 | |||
| 3171 | Ga0453684_0000388 | |||
| 3172 | Ga0453684_0001054 | |||
| 3173 | Ga0453684_0001255 | |||
| 3174 | Ga0453684_0005351 | |||
| 3175 | Ga0453684_0017818 | |||
| 3176 | Ga0453684_0021228 | |||
| 3177 | Ga0453684_0021303 | |||
| 3178 | Ga0453684_0022525 | |||
| 3179 | Ga0453684_0026037 | |||
| 3180 | Ga0453684_0030449 | |||
| 3181 | Ga0453684_0039262 | |||
| 3182 | Ga0453684_0048617 | |||
| 3183 | Ga0453684_0068800 | |||
| 3184 | Ga0453684_0087221 | |||
| 3185 | Ga0453684_0094490 | |||
| 3186 | Ga0453684_0168634 | |||
| 3187 | Ga0453684_0235565 | |||
| 3188 | Ga0453684_0260972 | |||
| 3189 | Ga0453684_0422449 | |||
| 3190 | Ga0453684_0456744 | |||
| 3191 | Ga0453684_0798628 | |||
| 3192 | Ga0466968_0086545 | |||
| 3193 | Ga0466970_0000091 | |||
| 3194 | Ga0466970_0171060 | |||
| 3195 | Ga0466957_0000329 | |||
| 3196 | Ga0466959_0000289 | |||
| 3197 | Ga0466959_0005399 | |||
| 3198 | Ga0451576_0000002 | |||
| 3199 | Ga0451576_0000039 | |||
| 3200 | Ga0451576_0000093 | |||
| 3201 | Ga0451576_0000350 | |||
| 3202 | Ga0451576_0001015 | |||
| 3203 | Ga0451576_0001211 | |||
| 3204 | Ga0451576_0003588 | |||
| 3205 | Ga0451576_0013169 | |||
| 3206 | Ga0451576_0044859 | |||
| 3207 | Ga0451576_0116216 | |||
| 3208 | Ga0451576_0178710 | |||
| 3209 | Ga0495627_002297 | |||
| 3210 | Ga0495592_0143554 | |||
| 3211 | Ga0495638_0028342 | |||
| 3212 | Ga0495638_0161994 | |||
| 3213 | Ga0495653_0078765 | |||
| 3214 | Ga0495580_0106897 | |||
| 3215 | Ga0495639_0116009 | |||
| 3216 | Ga0495606_0005025 | |||
| 3217 | Ga0495608_0053922 | |||
| 3218 | Ga0495618_0049036 | |||
| 3219 | Ga0495628_0048897 | |||
| 3220 | Ga0495630_0157645 | |||
| 3221 | Ga0495632_0195841 | |||
| 3222 | Ga0495648_0017761 | |||
| 3223 | Ga0495652_0134134 | |||
| 3224 | Ga0495640_0132656 | |||
| 3225 | Ga0495587_0053380 | |||
| 3226 | Ga0495587_0073734 | |||
| 3227 | Ga0495645_0070766 | |||
| 3228 | Ga0495633_0000036 | |||
| 3229 | Ga0495667_0089422 | |||
| 3230 | Ga0495668_0000068 | |||
| 3231 | Ga0495668_0000106 | |||
| 3232 | Ga0495634_0013744 | |||
| 3233 | Ga0495634_0083717 | |||
| 3234 | Ga0495611_0000174 | |||
| 3235 | Ga0495611_0047743 | |||
| 3236 | Ga0495625_0038687 | |||
| 3237 | Ga0495635_0013705 | |||
| 3238 | Ga0495588_0392984 | |||
| 3239 | Ga0495657_0106852 | |||
| 3240 | Ga0495657_0204473 | |||
| 3241 | Ga0495646_0157611 | |||
| 3242 | Ga0495647_0021783 | |||
| 3243 | Ga0495658_0011809 | |||
| 3244 | Ga0495658_0128576 | |||
| 3245 | Ga0495613_0065169 | |||
| 3246 | Ga0495670_0154393 | |||
| 3247 | Ga0495670_0265877 | |||
| 3248 | Ga0495649_0102771 | |||
| 3249 | Ga0495600_0039584 | |||
| 3250 | Ga0495636_0000038 | |||
| 3251 | Ga0495672_0063914 | |||
| 3252 | Ga0495687_000058 | |||
| 3253 | Ga0495684_0062975 | |||
| 3254 | Ga0495684_0097223 | |||
| 3255 | Ga0495684_0111325 | |||
| 3256 | Ga0495686_0000005 | |||
| 3257 | Ga0495686_0000230 | |||
| 3258 | Ga0495686_0271975 | |||
| 3259 | Ga0495602_0099079 | |||
| 3260 | Ga0496101_0011163 | |||
| 3261 | Ga0496102_0259381 | |||
| 3262 | Ga0496104_0484008 | |||
| 3263 | Ga0496106_0409331 | |||
| 3264 | Ga0496108_0359942 | |||
| 3265 | Ga0496110_0074804 | |||
| 3266 | Ga0496110_0439464 | |||
| 3267 | Ga0496114_0015211 | |||
| 3268 | Ga0496114_0019038 | |||
| 3269 | Ga0496115_0017565 | |||
| 3270 | Ga0496115_0281067 | |||
| 3271 | Ga0496116_0021745 | |||
| 3272 | Ga0496117_0001774 | |||
| 3273 | Ga0496118_0137624 | |||
| 3274 | Ga0496121_0000082 | |||
| 3275 | Ga0496122_0000219 | |||
| 3276 | Ga0496122_0016515 | |||
| 3277 | Ga0496123_0005966 | |||
| 3278 | Ga0496123_0011727 | |||
| 3279 | Ga0496124_0041495 | |||
| 3280 | Ga0496125_0051846 | |||
| 3281 | Ga0501290_001851 | |||
| 3282 | Ga0501298_004841 | |||
| 3283 | Ga0501324_012441 | |||
| 3284 | Ga0501031_0000435 | |||
| 3285 | Ga0501031_0017354 | |||
| 3286 | Ga0501032_0001734 | |||
| 3287 | Ga0501032_0007802 | |||
| 3288 | Ga0501032_0073737 | |||
| 3289 | Ga0501032_0248324 | |||
| 3290 | Ga0501033_0000754 | |||
| 3291 | Ga0501033_0096782 | |||
| 3292 | Ga0501033_0106578 | |||
| 3293 | Ga0501033_0171460 | |||
| 3294 | Ga0501033_0348477 | |||
| 3295 | Ga0501034_0000002 | |||
| 3296 | Ga0501034_0001948 | |||
| 3297 | Ga0501034_0046635 | |||
| 3298 | Ga0501034_0047492 | |||
| 3299 | Ga0501034_0072688 | |||
| 3300 | Ga0501034_0102588 | |||
| 3301 | Ga0501034_0337250 | |||
| 3302 | Ga0501036_0025033 | |||
| 3303 | Ga0501036_0045438 | |||
| 3304 | Ga0501036_0155380 | |||
| 3305 | Ga0501037_0002930 | |||
| 3306 | Ga0501037_0007495 | |||
| 3307 | Ga0501037_0078595 | |||
| 3308 | Ga0501037_0215846 | |||
| 3309 | Ga0501037_0340930 | |||
| 3310 | Ga0501038_0006197 | |||
| 3311 | Ga0501038_0012004 | |||
| 3312 | Ga0501038_0034793 | |||
| 3313 | Ga0501038_0039800 | |||
| 3314 | Ga0501039_0003820 | |||
| 3315 | Ga0501039_0068303 | |||
| 3316 | Ga0501039_0100695 | |||
| 3317 | Ga0501043_0001571 | |||
| 3318 | Ga0501043_0002152 | |||
| 3319 | Ga0501043_0016409 | |||
| 3320 | Ga0501043_0029619 | |||
| 3321 | Ga0501043_0366443 | |||
| 3322 | Ga0501046_0072232 | |||
| 3323 | Ga0501046_0080807 | |||
| 3324 | Ga0501046_0223099 | |||
| 3325 | Ga0501047_0021537 | |||
| 3326 | Ga0501047_0032041 | |||
| 3327 | Ga0501047_0039748 | |||
| 3328 | Ga0501047_0072629 | |||
| 3329 | Ga0501047_0126847 | |||
| 3330 | Ga0501047_0199260 | |||
| 3331 | Ga0501067_0074920 | |||
| 3332 | Ga0501070_0036506 | |||
| 3333 | Ga0501070_0051824 | |||
| 3334 | Ga0501070_0190358 | |||
| 3335 | Ga0501071_0246635 | |||
| 3336 | Ga0501073_0004984 | |||
| 3337 | Ga0501073_0005135 | |||
| 3338 | Ga0501073_0069343 | |||
| 3339 | Ga0501074_0034842 | |||
| 3340 | Ga0501076_0087934 | |||
| 3341 | Ga0501198_003127 | |||
| 3342 | Ga0501198_003403 | |||
| 3343 | Ga0501198_016548 | |||
| 3344 | Ga0501202_000230 | |||
| 3345 | Ga0501202_000719 | |||
| 3346 | Ga0501207_000054 | |||
| 3347 | Ga0501222_000635 | |||
| 3348 | Ga0501223_004113 | |||
| 3349 | Ga0501223_004178 | |||
| 3350 | Ga0501223_016295 | |||
| 3351 | Ga0501233_007500 | |||
| 3352 | Ga0501240_008770 | |||
| 3353 | Ga0501243_001431 | |||
| 3354 | Ga0501243_011494 | |||
| 3355 | Ga0501257_007423 | |||
| 3356 | Ga0501259_000787 | |||
| 3357 | Ga0501219_001361 | |||
| 3358 | Ga0501225_0010109 | |||
| 3359 | Ga0501225_0064693 | |||
| 3360 | Ga0501234_007548 | |||
| 3361 | Ga0501234_007928 | |||
| 3362 | Ga0501080_0065919 | |||
| 3363 | Ga0501080_0110411 | |||
| 3364 | Ga0501080_0309607 | |||
| 3365 | Ga0501083_0118291 | |||
| 3366 | Ga0501241_001338 | |||
| 3367 | Ga0501266_005465 | |||
| 3368 | Ga0501266_006710 | |||
| 3369 | Ga0501270_006462 | |||
| 3370 | Ga0501035_0001478 | |||
| 3371 | Ga0501035_0183406 | |||
| 3372 | Ga0501044_0001852 | |||
| 3373 | Ga0501044_0013806 | |||
| 3374 | Ga0501044_0020326 | |||
| 3375 | Ga0501044_0040239 | |||
| 3376 | Ga0501044_0044269 | |||
| 3377 | Ga0501044_0053294 | |||
| 3378 | Ga0501044_0097418 | |||
| 3379 | Ga0501044_0585917 | |||
| 3380 | Ga0501045_0000094 | |||
| 3381 | Ga0501212_000847 | |||
| 3382 | Ga0501284_00030 | |||
| 3383 | nmdc:mga0k408_53627_c1 | |||
| 3384 | nmdc:mga05p37_11521_c1 | |||
| 3385 | nmdc:mga05p37_288992_c1 | |||
| 3386 | nmdc:mga05p37_629646_c1 | |||
| 3387 | nmdc:mga09592_214990_c1 | |||
| 3388 | nmdc:mga09592_998_c1 | |||
| 3389 | nmdc:mga0qj67_14877_c1 | |||
| 3390 | nmdc:mga0qj67_81574_c1 | |||
| 3391 | nmdc:mga06r32_16383_c1 | |||
| 3392 | nmdc:mga06r32_26115_c1 | |||
| 3393 | nmdc:mga08y16_503402_c1 | |||
| 3394 | nmdc:mga08y16_5081_c1 | |||
| 3395 | nmdc:mga08y16_90318_c1 | |||
| 3396 | Ga0500578_0000469 | |||
| 3397 | Ga0500644_0000989 | |||
| 3398 | Ga0500644_0057861 | |||
| 3399 | Ga0500646_0001347 | |||
| 3400 | Ga0500646_0003386 | |||
| 3401 | Ga0500646_0019019 | |||
| 3402 | Ga0500646_0030687 | |||
| 3403 | Ga0500583_0001878 | |||
| 3404 | Ga0500583_0002554 | |||
| 3405 | Ga0500583_0002666 | |||
| 3406 | Ga0500651_0275971 | |||
| 3407 | Ga0500641_0028234 | |||
| 3408 | Ga0500562_000005 | |||
| 3409 | Ga0500569_000112 | |||
| 3410 | Ga0500572_010463 | |||
| 3411 | Ga0500594_0005425 | |||
| 3412 | Ga0500594_0054252 | |||
| 3413 | Ga0500607_014340 | |||
| 3414 | Ga0500642_0003975 | |||
| 3415 | Ga0500642_0147061 | |||
| 3416 | Ga0500652_006434 | |||
| 3417 | Ga0500652_014818 | |||
| 3418 | Ga0500658_0010039 | |||
| 3419 | Ga0500559_0007923 | |||
| 3420 | Ga0500559_0042220 | |||
| 3421 | Ga0500568_0002982 | |||
| 3422 | Ga0500568_0005771 | |||
| 3423 | Ga0500568_0035240 | |||
| 3424 | Ga0500568_0047261 | |||
| 3425 | Ga0500573_0125007 | |||
| 3426 | Ga0500577_0000513 | |||
| 3427 | Ga0500588_0005647 | |||
| 3428 | Ga0500588_0051960 | |||
| 3429 | Ga0500589_029833 | |||
| 3430 | Ga0500589_112478 | |||
| 3431 | Ga0500590_010374 | |||
| 3432 | Ga0500616_0002078 | |||
| 3433 | Ga0500616_0005064 | |||
| 3434 | Ga0500616_0033232 | |||
| 3435 | Ga0500622_0000085 | |||
| 3436 | Ga0500622_0000310 | |||
| 3437 | Ga0500622_0001399 | |||
| 3438 | Ga0500622_0025537 | |||
| 3439 | Ga0500633_0004414 | |||
| 3440 | Ga0500639_024338 | |||
| 3441 | Ga0500636_0009636 | |||
| 3442 | Ga0500636_0150117 | |||
| 3443 | Ga0500611_000039 | |||
| 3444 | Ga0501084_0042886 | |||
| 3445 | Ga0500661_001058 | |||
| 3446 | Ga0500661_001926 | |||
| 3447 | Ga0587070_034955 | |||
| 3448 | Ga0587077_002136 | |||
| 3449 | Ga0501082_0014532 | |||
| 3450 | 2722730875 | |||
| 3451 | 2738725863 | |||
| 3452 | 2738758988 | |||
| 3453 | 2739303918 | |||
| 3454 | 2819575200 | |||
| 3455 | 2819589806 | |||
| 3456 | 2819677181 | |||
| 3457 | 2852630816 | |||
| 3458 | 2881956751 | |||
| 3459 | 2883070299 | |||
| 3460 | 2890737697 | |||
| 3461 | 2896320919 | |||
| 3462 | 2896346265 | |||
| 3463 | 2898716116 | |||
| 3464 | 2904783590 | |||
| 3465 | 2914762851 | |||
| 3466 | 2919181452 | |||
| 3467 | 2919188831 | |||
| 3468 | 2929160008 | |||
| 3469 | 2929239867 | |||
| 3470 | 2929921507 | |||
| 3471 | 2939667014 | |||
| 3472 | 2945979780 | |||
| 3473 | 2946014353 | |||
| 3474 | 3003235277 | |||
| 3475 | 8003152053 | |||
| 3476 | 8055591225 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1jr2-assembly2.cif.gz_B | structure of uroporphyrinogen iii synthase | 0.7552 | 21 | 262 |
| 3mw8-assembly1.cif.gz_A | crystal structure of an uroporphyrinogen-iii synthase (sama_3255) from shewanella amazonensis sb2b at 1.65 a resolution | 0.7349 | 20 | 261 |
| 3mw8-assembly1.cif.gz_A | crystal structure of an uroporphyrinogen-iii synthase (sama_3255) from shewanella amazonensis sb2b at 1.65 a resolution | 0.7242 | 20 | 261 |
| 3p9z-assembly1.cif.gz_A | crystal structure of uroporphyrinogen-iii synthetase from helicobacter pylori 26695 | 0.7133 | 19 | 263 |
| 1jr2-assembly2.cif.gz_B | structure of uroporphyrinogen iii synthase | 0.7062 | 21 | 262 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FXR2_34_131_3.40.50.10090 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.8125 | 73 | 169 | 3.40.50.10090 |
| af_P09126_40_162_3.40.50.10090 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.7668 | 60 | 178 | 3.40.50.10090 |
| af_K7KSX4_205_293_3.40.50.10090 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.7394 | 185 | 263 | 3.40.50.10090 |
| af_Q58401_1_122_3.40.50.10090 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.7352 | 21 | 149 | 3.40.50.10090 |
| af_Q800W7_38_174_3.40.50.10090 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.7293 | 56 | 186 | 3.40.50.10090 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3D3PAE3-F1-model_v4 | Uroporphyrinogen-III synthase | 0.9903 | 50 | 128 |
GO:0004852
GO:0033014 |
| AF-A0A3D5J4A4-F1-model_v4 | Uroporphyrinogen-III synthase | 0.9739 | 201 | 266 |
GO:0004852
GO:0033014 |
| AF-A0A7V6NEM9-F1-model_v4 | Uroporphyrinogen-III synthase | 0.9692 | 196 | 264 |
GO:0004852
GO:0033014 |
| AF-A0A2E9T838-F1-model_v4 | Uroporphyrinogen-III synthase | 0.9625 | 191 | 266 |
GO:0004852
GO:0033014 |
| AF-A0A1Q4FG51-F1-model_v4 | Uroporphyrinogen-III synthase | 0.9595 | 19 | 264 |
GO:0004852
GO:0005829 GO:0006780 |