F495541
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1739 | 696 | 1477 | 331 |
Family's Representative Sequence
| Representative Sequence | 3300059426|Ga0590077_006114|Ga0590077_006114_123_1310 |
| Length | 395 |
| Sequence | MSRAAALTVRRARGRGQELPQYRIYLALGARQATQGAPSAGFSTSSIVFIGAALTALFVLPRGTRPMRVAFFNTHRFDREFFDAANAACDHQLHYIDARLTRQTSALAQGYPAVCAFVNDQLDSAVLNDLHSGGTRMIALRSAGFNHVDLSKARQLGFTVSRVPAYSPHAVAEHTVALILTLNRKIHRAYARVREGNFALDGLLGFDLHGRTVGVVGTGKIGTLVARMLIGFGCRVVAFDTRLNRECEAMGVGYVTLDALWAQSDIVTLHTPLTDQTRHIVNAAAIGRMKPGVMIINTGRGALVDTAALIDGFKSGRIGYLGLDVYEEEEALFFQDLSSDVIQDDVFARLLTFPNVIVTAHQAFFTRDALRAISETTLHNLSAFEQGKRSGNELW |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 3 | 2511231006 | Pseudomonas sp. GM17 | Isolate | Nodule |
| 4 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 5 | 2511231008 | Pseudomonas sp. GM21 | Isolate | Nodule |
| 6 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 7 | 2511231011 | Pseudomonas sp. GM30 | Isolate | Nodule |
| 8 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 9 | 2511231014 | Pseudomonas sp. GM48 | Isolate | Nodule |
| 10 | 2511231015 | Pseudomonas sp. GM49 | Isolate | Nodule |
| 11 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 12 | 2511231017 | Pseudomonas sp. GM55 | Isolate | Nodule |
| 13 | 2511231018 | Pseudomonas sp. GM60 | Isolate | Nodule |
| 14 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 15 | 2511231020 | Pseudomonas sp. GM74 | Isolate | Nodule |
| 16 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 17 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 18 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 19 | 2511231024 | Pseudomonas sp. GM84 | Isolate | Nodule |
| 20 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 21 | 2511231156 | Pseudomonas ogarae F113 | Isolate | Rhizosphere |
| 22 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 23 | 2515154088 | Salinispora arenicola CNT800 | Isolate | Rhizosphere |
| 24 | 2515154129 | Salinispora pacifica CNS103 | Isolate | Rhizosphere |
| 25 | 2515154137 | Salinispora arenicola CNX482 | Isolate | Rhizosphere |
| 26 | 2515154202 | Salinispora pacifica CNT084 | Isolate | Rhizosphere |
| 27 | 2515154203 | Salinispora arenicola CNR921 | Isolate | Rhizosphere |
| 28 | 2554235132 | Pseudomonas aeruginosa PGPR2 | Isolate | Unclassified |
| 29 | 2554235231 | Pseudomonas putida MTCC 5279 | Isolate | Unclassified |
| 30 | 2554235341 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 31 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 32 | 2596583598 | Ralstonia sp. UNCCL144 | Isolate | Unclassified |
| 33 | 2597489887 | Pseudomonas chlororaphis aureofaciens 30-84 | Isolate | Rhizosphere |
| 34 | 2597489888 | Pseudomonas fluorescens SS101 | Isolate | Rhizosphere |
| 35 | 2597489889 | Pseudomonas synxantha BG33R | Isolate | Rhizosphere |
| 36 | 2599185160 | Pseudomonas sp. NFPP25 | Isolate | Rhizoplane |
| 37 | 2599185161 | Pseudomonas sp. NFPP09 | Isolate | Rhizoplane |
| 38 | 2599185162 | Pseudomonas sp. NFPP10 | Isolate | Rhizoplane |
| 39 | 2599185163 | Pseudomonas sp. NFPP12 | Isolate | Rhizoplane |
| 40 | 2599185164 | Pseudomonas sp. NFPP13 | Isolate | Rhizoplane |
| 41 | 2599185165 | Pseudomonas sp. NFPP18 | Isolate | Rhizoplane |
| 42 | 2599185166 | Pseudomonas sp. NFPP08 | Isolate | Rhizoplane |
| 43 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 44 | 2599185168 | Pseudomonas sp. NFPP05 | Isolate | Rhizoplane |
| 45 | 2599185178 | Ralstonia sp. NFACC01 | Isolate | Rhizoplane |
| 46 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 47 | 2599185181 | Pseudomonas sp. NFPP17 | Isolate | Rhizoplane |
| 48 | 2599185182 | Pseudomonas sp. NFPP19 | Isolate | Rhizoplane |
| 49 | 2599185185 | Pseudomonas sp. NFPP07 | Isolate | Rhizoplane |
| 50 | 2599185186 | Pseudomonas sp. NFPP15 | Isolate | Rhizoplane |
| 51 | 2599185188 | Pseudomonas sp. NFACC45 | Isolate | Rhizoplane |
| 52 | 2599185189 | Pseudomonas sp. NFPP02 | Isolate | Rhizoplane |
| 53 | 2599185190 | Pseudomonas sp. NFPP04 | Isolate | Rhizoplane |
| 54 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 55 | 2599185212 | Pseudomonas sp. NFACC15-1 | Isolate | Rhizoplane |
| 56 | 2599185248 | Pseudomonas sp. NFACC08-1 | Isolate | Rhizoplane |
| 57 | 2599185257 | Pseudomonas sp. NFACC41-3 | Isolate | Rhizoplane |
| 58 | 2599185288 | Pseudomonas sp. NFACC25 | Isolate | Rhizoplane |
| 59 | 2599185289 | Pseudomonas sp. NFACC51 | Isolate | Rhizoplane |
| 60 | 2599185290 | Pseudomonas sp. NFPP11 | Isolate | Rhizoplane |
| 61 | 2599185291 | Pseudomonas sp. NFACC48-1 | Isolate | Rhizoplane |
| 62 | 2599185300 | Pseudomonas sp. NFACC39-1 | Isolate | Rhizoplane |
| 63 | 2599185302 | Pseudomonas sp. NFACC43 | Isolate | Rhizoplane |
| 64 | 2599185303 | Pseudomonas sp. NFACC42-2 | Isolate | Rhizoplane |
| 65 | 2599185304 | Pseudomonas sp. NFACC47-1 | Isolate | Rhizoplane |
| 66 | 2599185305 | Pseudomonas sp. NFACC07-1 | Isolate | Rhizoplane |
| 67 | 2599185306 | Pseudomonas sp. NFACC16-2 | Isolate | Rhizoplane |
| 68 | 2599185307 | Pseudomonas sp. NFACC02 | Isolate | Rhizoplane |
| 69 | 2599185308 | Pseudomonas sp. NFACC17-2 | Isolate | Rhizoplane |
| 70 | 2599185309 | Pseudomonas sp. NFACC49-2 | Isolate | Rhizoplane |
| 71 | 2599185310 | Pseudomonas sp. NFACC09-4 | Isolate | Rhizoplane |
| 72 | 2599185311 | Pseudomonas sp. NFACC04-2 | Isolate | Rhizoplane |
| 73 | 2599185312 | Pseudomonas sp. NFACC32-1 | Isolate | Rhizoplane |
| 74 | 2599185313 | Pseudomonas sp. NFACC05-1 | Isolate | Rhizoplane |
| 75 | 2599185314 | Pseudomonas sp. NFACC23-1 | Isolate | Rhizoplane |
| 76 | 2599185315 | Pseudomonas sp. NFACC44-2 | Isolate | Rhizoplane |
| 77 | 2599185316 | Pseudomonas sp. NFACC52 | Isolate | Rhizoplane |
| 78 | 2599185317 | Pseudomonas sp. NFACC06-1 | Isolate | Rhizoplane |
| 79 | 2599185318 | Pseudomonas sp. NFACC13-1 | Isolate | Rhizoplane |
| 80 | 2599185319 | Pseudomonas sp. NFACC24-1 | Isolate | Rhizoplane |
| 81 | 2599185320 | Pseudomonas sp. NFACC36 | Isolate | Rhizoplane |
| 82 | 2599185321 | Pseudomonas sp. NFACC54 | Isolate | Rhizoplane |
| 83 | 2599185322 | Pseudomonas sp. NFACC14 | Isolate | Rhizoplane |
| 84 | 2599185323 | Pseudomonas sp. NFACC37-1 | Isolate | Rhizoplane |
| 85 | 2599185324 | Pseudomonas sp. NFACC46-3 | Isolate | Rhizoplane |
| 86 | 2599185325 | Pseudomonas sp. NFACC56-3 | Isolate | Rhizoplane |
| 87 | 2599185356 | Pseudomonas sp. NFPP14 | Isolate | Rhizoplane |
| 88 | 2600254930 | Pseudomonas sp. NFIX10 | Isolate | Rhizoplane |
| 89 | 2600254931 | Pseudomonas sp. NFIX28 | Isolate | Rhizoplane |
| 90 | 2600254954 | Pseudomonas sp. NFACC19-2 | Isolate | Rhizoplane |
| 91 | 2600255283 | Pseudomonas sp. NFR16 | Isolate | Rhizoplane |
| 92 | 2600255296 | Pseudomonas sp. NFR02 | Isolate | Rhizoplane |
| 93 | 2600255313 | Pseudomonas sp. NFPP16 | Isolate | Rhizoplane |
| 94 | 2600255318 | Pseudomonas putida NFIX47 | Isolate | Rhizoplane |
| 95 | 2600255389 | Pseudomonas sp. NFPP33 | Isolate | Rhizoplane |
| 96 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 97 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 98 | 2606217733 | Pseudomonas aeruginosa NFHH01 | Isolate | Rhizoplane |
| 99 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 100 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 101 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 102 | 2643221565 | Pseudomonas sp. Root562 | Isolate | Unclassified |
| 103 | 2643221571 | Pseudomonas sp. Root569 | Isolate | Unclassified |
| 104 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 105 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 106 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 107 | 2643221650 | Pseudomonas sp. Root401 | Isolate | Unclassified |
| 108 | 2643221713 | Pseudomonas sp. Root9 | Isolate | Unclassified |
| 109 | 2651869719 | Genome Sequence of Pseudomonas fluorescens UM270 | Isolate | Rhizosphere |
| 110 | 2667528170 | Pseudomonas sp. NFACC50-1 | Isolate | Rhizoplane |
| 111 | 2667528171 | Pseudomonas sp. NFPP22 | Isolate | Rhizoplane |
| 112 | 2667528176 | Pseudomonas sp. NFACC11-2 | Isolate | Rhizoplane |
| 113 | 2671180172 | Pseudomonas sp. NFIX51 | Isolate | Rhizoplane |
| 114 | 2675903420 | Pseudomonas fluorescens Ps006 | Isolate | Unclassified |
| 115 | 2675903515 | Pseudomonas thivervalensis DSM 13194 | Isolate | Unclassified |
| 116 | 2713897148 | Pseudomonas fluorescens SF39a | Isolate | Rhizosphere |
| 117 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 118 | 2718217725 | Pseudomonas fluorescens CREA-C16 | Isolate | Rhizosphere |
| 119 | 2721755607 | Pseudomonas fluorescens Pt14 | Isolate | Rhizosphere |
| 120 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 121 | 2738541271 | Pseudomonas sp. GV021 | Isolate | Unclassified |
| 122 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 123 | 2738541294 | Pseudomonas sp. GV087 | Isolate | Unclassified |
| 124 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 125 | 2738541309 | Pseudomonas sp. GV047 | Isolate | Unclassified |
| 126 | 2738543004 | Pseudomonas sp. GV085 | Isolate | Unclassified |
| 127 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 128 | 2738543016 | Pseudomonas sp. GV012 | Isolate | Unclassified |
| 129 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 130 | 2740892503 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 131 | 2744054620 | Pseudomonas thivervalensis LMG 21626 | Isolate | Unclassified |
| 132 | 2765235841 | Pseudomonas putida AA7 | Isolate | Unclassified |
| 133 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 134 | 2773857673 | Pseudomonas sp. 443 | Isolate | Unclassified |
| 135 | 2784132063 | Pseudomonas sp. 424 | Isolate | Unclassified |
| 136 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 137 | 2786546517 | Verrucomicrobia bacterium LW23 | Isolate | Rhizoplane |
| 138 | 2791355137 | Paraburkholderia piptadeniae STM7183 | Isolate | Unclassified |
| 139 | 2791355520 | Pseudomonas sp. s211(2017) | Isolate | Unclassified |
| 140 | 2806310737 | Pseudomonas mosselii BS011 | Isolate | Unclassified |
| 141 | 2806310745 | Pseudomonas mosselii PtA1 | Isolate | Unclassified |
| 142 | 2808606361 | Pseudomonas sp. SJZ075 | Isolate | Rhizosphere |
| 143 | 2808606373 | Pseudomonas sp. SLBN-2 | Isolate | Unclassified |
| 144 | 2808606376 | Pseudomonas sp. SJZ074 | Isolate | Rhizosphere |
| 145 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 146 | 2808606378 | Pseudomonas sp. SJZ078 | Isolate | Rhizosphere |
| 147 | 2808606380 | Pseudomonas sp. SJZ085 | Isolate | Rhizosphere |
| 148 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 149 | 2808606382 | Pseudomonas sp. SJZ080 | Isolate | Rhizosphere |
| 150 | 2808606383 | Pseudomonas sp. SJZ124 | Isolate | Rhizosphere |
| 151 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 152 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 153 | 2808606389 | Pseudomonas sp. SJZ101 | Isolate | Rhizosphere |
| 154 | 2808606445 | Pseudomonas sp. SJZ131 | Isolate | Rhizosphere |
| 155 | 2811994881 | Pseudomonas sp. SLBN-26 | Isolate | Unclassified |
| 156 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 157 | 2818991438 | Novosphingobium barchaimii 1192 | Isolate | Unclassified |
| 158 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 159 | 2818991464 | Pseudomonas protegens 3295 | Isolate | Rhizosphere |
| 160 | 2825651385 | Pseudomonas brassicacearum L13-6-12 | Isolate | Rhizosphere |
| 161 | 2826581358 | Pseudomonas viridiflava CDRTc14 | Isolate | Unclassified |
| 162 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 163 | 2842815866 | Pseudomonas sp. R-72210 | Isolate | Unclassified |
| 164 | 2842826826 | Pseudomonas sp. R-72172 | Isolate | Unclassified |
| 165 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 166 | 2842837860 | Pseudomonas sp. R-72102 | Isolate | Unclassified |
| 167 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 168 | 2842849001 | Pseudomonas sp. R-72008 | Isolate | Unclassified |
| 169 | 2842854478 | Pseudomonas sp. R-71998 | Isolate | Unclassified |
| 170 | 2844665904 | Pseudomonas protegens H1F10C | Isolate | Unclassified |
| 171 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 172 | 2852657418 | Pseudomonas sp. JAI115 | Isolate | Rhizosphere |
| 173 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 174 | 2854681122 | Luteovulum sphaeroides SCJ | Isolate | Unclassified |
| 175 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 176 | 2860867994 | Pseudomonas sp. R1-43-08 | Isolate | Rhizosphere |
| 177 | 2878029506 | Pseudomonas fluorescens DR397 | Isolate | Rhizosphere |
| 178 | 2880230671 | Pseudomonas fluorescens LBUM677 | Isolate | Unclassified |
| 179 | 2881101125 | Ramlibacter rhizophilus CCTCC AB2015357 | Isolate | Rhizosphere |
| 180 | 2883087390 | Paraburkholderia guartelaensis CNPSo 3008 | Isolate | Unclassified |
| 181 | 2885266251 | Ralstonia sp. SET104 | Isolate | Nodule |
| 182 | 2900577576 | Ralstonia sp. TCR112 | Isolate | Rhizosphere |
| 183 | 2904518522 | Pseudomonas fluorescens 4488 | Isolate | Rhizosphere |
| 184 | 2904550169 | Stutzerimonas stutzeri 1099 | Isolate | Rhizosphere |
| 185 | 2904615490 | Paraburkholderia franconis CNPSo 3157 | Isolate | Unclassified |
| 186 | 2908446538 | Pseudomonas sp. R76 | Isolate | Rhizosphere |
| 187 | 2910245624 | Adhaeribacter radiodurans KUDC8001 | Isolate | Rhizosphere |
| 188 | 2912963787 | Pseudomonas sp. R32 | Isolate | Rhizosphere |
| 189 | 2913036834 | Pseudomonas viciae 11K1 | Isolate | Rhizosphere |
| 190 | 2917070673 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 191 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 192 | 2919155634 | Pseudomonas fulva 1992 | Isolate | Unclassified |
| 193 | 2919385768 | Pseudomonas sp. 2957 | Isolate | Unclassified |
| 194 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 195 | 2919481497 | Pseudomonas brassicacearum 3432 | Isolate | Unclassified |
| 196 | 2919487758 | Pseudomonas koreensis 3441 | Isolate | Unclassified |
| 197 | 2919501602 | Pseudomonas alcaliphila 3512 | Isolate | Unclassified |
| 198 | 2919697872 | Pseudomonas frederiksbergensis 4169 | Isolate | Unclassified |
| 199 | 2923153595 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 200 | 2923519811 | Pseudomonas otitidis SLBN-103 | Isolate | Rhizosphere |
| 201 | 2923586266 | Pseudomonas fluorescens 1550 | Isolate | Rhizosphere |
| 202 | 2926063275 | Pseudomonas sp. 3400 | Isolate | Unclassified |
| 203 | 2928058823 | Ralstonia sp. 1138 | Isolate | Unclassified |
| 204 | 2929144301 | Pseudomonas sp. R-71838 Hybrid assembly | Isolate | Unclassified |
| 205 | 2929189879 | Pseudomonas sp. R-71842 Hybrid assembly | Isolate | Unclassified |
| 206 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 207 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 208 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 209 | 2935353572 | Pseudomonas protegens TECH19 | Isolate | Unclassified |
| 210 | 2939636861 | Pseudomonas sp. 2725 | Isolate | Rhizosphere |
| 211 | 2939651529 | Pseudomonas sp. 2835 | Isolate | Rhizosphere |
| 212 | 2945928738 | Pseudomonas cedrina W1I11 | Isolate | Rhizosphere |
| 213 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 214 | 2946006987 | Pseudomonas sp. W3I7 | Isolate | Rhizosphere |
| 215 | 2946027586 | Pseudomonas sp. W4I3 | Isolate | Rhizosphere |
| 216 | 2947233263 | Pseudomonas synxantha W2I4 | Isolate | Rhizosphere |
| 217 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 218 | 2974289157 | Pseudomonas fluorescens SORGH_AS 191 | Isolate | Unclassified |
| 219 | 2984286254 | Pseudomonas chlororaphis aurantiaca JD37 | Isolate | Rhizosphere |
| 220 | 2988728565 | Pseudomonas corrugata RM1-1-4 | Isolate | Rhizosphere |
| 221 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 222 | 3007395558 | Pseudomonas chlororaphis PCL1601 | Isolate | Rhizosphere |
| 223 | 3007419365 | Pseudomonas vanderleydeniana RW8P3 | Isolate | Unclassified |
| 224 | 3007511990 | Pseudomonas fluorescens G20-18 | Isolate | Rhizosphere |
| 225 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 226 | 3007619802 | Pseudomonas sp. PB120 | Isolate | Unclassified |
| 227 | 3007718800 | Pseudomonas fluorescens BW11P2 | Isolate | Rhizosphere |
| 228 | 3007803356 | Pseudomonas sp. CM27 | Isolate | Unclassified |
| 229 | 3007855910 | Pseudomonas khorasanensis SWRI153 | Isolate | Rhizosphere |
| 230 | 3007861166 | Pseudomonas hamedanensis SWRI65 | Isolate | Rhizosphere |
| 231 | 3007866637 | Pseudomonas marvdashtae SWRI102 | Isolate | Rhizosphere |
| 232 | 3007872151 | Pseudomonas sp. SWRI51 | Isolate | Rhizosphere |
| 233 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 234 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 235 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 236 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 237 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 238 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 239 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 240 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 241 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 242 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 243 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 244 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 245 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 246 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 247 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 248 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 249 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 250 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 251 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 252 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 253 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 254 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 255 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 256 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 257 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 258 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 259 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 260 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 261 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 262 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 263 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 264 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 265 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 266 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 267 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 268 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 269 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 270 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 271 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 272 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 273 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 274 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 275 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 276 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 277 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 278 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 279 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 280 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 281 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 282 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 283 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 284 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 285 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 286 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 287 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 288 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 289 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 290 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 291 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 292 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 293 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 294 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 295 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 296 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 297 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 298 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 299 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 300 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 301 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 302 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 303 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 304 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 305 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 306 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 307 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 308 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 309 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 310 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 311 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 312 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 313 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 314 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 315 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 316 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 317 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 318 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 319 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 320 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 321 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 322 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 323 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 324 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 325 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 326 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 327 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 328 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 329 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 330 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 331 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 332 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 333 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 334 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 335 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 336 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 337 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 338 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 339 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 340 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 341 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 342 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 343 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 344 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 345 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 346 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 347 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 348 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 349 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 350 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 351 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 352 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 353 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 354 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 355 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 356 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 357 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 358 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 359 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 360 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 361 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 362 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 363 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 364 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 365 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 366 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 367 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 368 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 369 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 370 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 371 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 372 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 373 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 374 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 375 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 376 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 377 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 378 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 379 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 380 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 381 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 382 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 383 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 384 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 385 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 386 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 387 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 388 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 389 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 390 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 391 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 392 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 393 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 394 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 395 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 396 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 397 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 398 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 399 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 400 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 401 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 402 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 403 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 404 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 405 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 406 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 407 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 408 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 409 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 410 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 411 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 412 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 413 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 414 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 415 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 416 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 417 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 418 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 419 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 420 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 421 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 422 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 423 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 424 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 425 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 426 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 427 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 428 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 429 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 430 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 431 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 432 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 433 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 434 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 435 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 436 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 437 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 438 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 439 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 440 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 441 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 442 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 443 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 444 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 445 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 446 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 447 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 448 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 449 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 450 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 451 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 452 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 453 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 454 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 455 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 456 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 457 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 458 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 459 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 460 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 461 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 462 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 463 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 464 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 465 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 466 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 467 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 468 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 469 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 470 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 471 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 472 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 473 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 474 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 475 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 476 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 477 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 478 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 479 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 480 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 481 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 482 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 483 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 484 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 485 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 486 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 487 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 488 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 489 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 490 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 491 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 492 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 493 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 494 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 495 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 496 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 497 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 498 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 499 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 500 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 501 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 502 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 503 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 504 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 505 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 506 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 507 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 508 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 509 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 510 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 511 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 512 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 513 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 514 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 515 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 516 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 517 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 518 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 519 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 520 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 521 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 522 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 523 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 524 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 525 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 526 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 527 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 528 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 529 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 530 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 531 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 532 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 533 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 534 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 535 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 536 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 537 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 538 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 539 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 540 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 541 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 542 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 543 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 544 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 545 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 546 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 547 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 548 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 549 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 550 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 551 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 552 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 553 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 554 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 555 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 556 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 557 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 558 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 559 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 560 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 561 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 562 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 563 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 564 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 565 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 566 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 567 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 568 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 569 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 570 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 571 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 572 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 573 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 574 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 575 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 576 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 577 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 578 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 579 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 580 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 581 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 582 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 583 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 584 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 585 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 586 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 587 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 588 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 589 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 590 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 591 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 592 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 593 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 594 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 595 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 596 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 597 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 598 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 599 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 600 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 601 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 602 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 603 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 604 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 605 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 606 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 607 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 608 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 609 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 610 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 611 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 612 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 613 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 614 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 615 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 616 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 617 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 618 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 619 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 620 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 621 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 622 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 623 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 624 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 625 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 626 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 627 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 628 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 629 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 630 | 3300049777 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control | Metagenome | Rhizosphere |
| 631 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 632 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 633 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 634 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 635 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 636 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 637 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 638 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 639 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 640 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 641 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 642 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 643 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 644 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 645 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 646 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 647 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 648 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 649 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 650 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 651 | 3300053135 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere | Metagenome | Endosphere |
| 652 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 653 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 654 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 655 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 656 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 657 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 658 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 659 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 660 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 661 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 662 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 663 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 664 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 665 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 666 | 637000220 | Pseudomonas protegens Pf-5 | Isolate | Rhizoplane |
| 667 | 640427133 | Stutzerimonas stutzeri A1501 | Isolate | Rhizosphere |
| 668 | 651053060 | Stutzerimonas stutzeri CMT.A.9 | Isolate | Rhizosphere |
| 669 | 8011350971 | Pseudomonas sp. 30_B | Isolate | Rhizosphere |
| 670 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 671 | 8019769354 | Pseudomonas sp. MSSRFD41 | Isolate | Rhizosphere |
| 672 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 673 | 8029995093 | Pseudomonas atacamensis SM1 | Isolate | Rhizosphere |
| 674 | 8034962539 | Pseudomonas sediminis PI11 | Isolate | Rhizosphere |
| 675 | 8039098773 | Burkholderia multivorans MSMB612WGS | Isolate | Unclassified |
| 676 | 8052494512 | Pseudomonas putida LD6 | Isolate | Unclassified |
| 677 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 678 | 8054347763 | Pseudomonas carnis NWU Be30 | Isolate | Unclassified |
| 679 | 8054503363 | Pseudomonas sivasensis BsEB-1 | Isolate | Unclassified |
| 680 | 8054929484 | Pseudomonas vlassakiae RW4S1 | Isolate | Rhizosphere |
| 681 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
| 682 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 683 | 8055878733 | Pseudomonas palmensis BBB001 | Isolate | Rhizosphere |
| 684 | 8056115690 | Pseudomonas muyukensis COW39 | Isolate | Rhizosphere |
| 685 | 8056120720 | Pseudomonas maumuensis COW77 | Isolate | Rhizosphere |
| 686 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
| 687 | 8056137416 | Pseudomonas fakonensis COW40 | Isolate | Rhizosphere |
| 688 | 8056143049 | Pseudomonas alvandae SWRI17 | Isolate | Rhizosphere |
| 689 | 8056148874 | Pseudomonas khavaziana SWRI124 | Isolate | Rhizosphere |
| 690 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
| 691 | 8056161164 | Pseudomonas azadiae SWRI103 | Isolate | Rhizosphere |
| 692 | 8056166840 | Pseudomonas triticicola SWRI88 | Isolate | Rhizosphere |
| 693 | 8056172158 | Pseudomonas ekonensis COR58 | Isolate | Rhizosphere |
| 694 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
| 695 | 8056569372 | Pseudomonas serboccidentalis IT-P374 | Isolate | Rhizosphere |
| 696 | 8057798959 | Pseudomonas piscis BW16M1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 84.7 |
| Metatranscriptomes | 0.23 |
| Isolates | 15.07 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.33 |
| Nodule | 1.73 |
| Rhizoplane | 4.77 |
| Rhizosphere | 76.65 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.52 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS2a_Contig_120 | 2124908027 | Bacteria | 35090 |
| 2 | JGI24741J21665_1000701 | 3300001915 | Bacteria | 10112 |
| 3 | JGI24740J21852_10001102 | 3300001979 | Bacteria | 12202 |
| 4 | JGI24740J21852_10003569 | 3300001979 | Bacteria | 6808 |
| 5 | JGI24737J22298_10005913 | 3300001990 | Bacteria | 4211 |
| 6 | JGI25156J39149_1002620 | 3300002705 | Bacteria | 6325 |
| 7 | JGI25156J39149_1005280 | 3300002705 | Bacteria | 3769 |
| 8 | JGI25156J39149_1012602 | 3300002705 | Bacteria | 1847 |
| 9 | JGI25162J39368_1000190 | 3300002737 | Bacteria | 64314 |
| 10 | JGI25162J39368_1000250 | 3300002737 | Bacteria | 53289 |
| 11 | JGI25154J39366_1001045 | 3300002738 | Bacteria | 11037 |
| 12 | JGI25163J39215_1000539 | 3300002771 | Bacteria | 11095 |
| 13 | JGI25163J39215_1000541 | 3300002771 | Bacteria | 11080 |
| 14 | JGI25164J39214_1000157 | 3300002772 | Bacteria | 64314 |
| 15 | JGI25164J39214_1000192 | 3300002772 | Bacteria | 53289 |
| 16 | JGI25165J46597_1000284 | 3300003214 | Bacteria | 64314 |
| 17 | JGI25165J46597_1000346 | 3300003214 | Bacteria | 53289 |
| 18 | rootH1_10014100 | 3300003316 | Bacteria | 3229 |
| 19 | rootH2_10152216 | 3300003320 | Bacteria | 7206 |
| 20 | rootL2_10329293 | 3300003322 | Bacteria | 1578 |
| 21 | rootH1_10165822 | 3300003323 | Bacteria | 5403 |
| 22 | Ga0006562J51391_1015087 | 3300003578 | Bacteria | 1353 |
| 23 | Ga0006562J51391_1060129 | 3300003578 | Bacteria | 3320 |
| 24 | Ga0055538_1000088 | 3300003751 | Bacteria | 78763 |
| 25 | Ga0055538_1001920 | 3300003751 | Bacteria | 3440 |
| 26 | Ga0055538_1002774 | 3300003751 | Bacteria | 2426 |
| 27 | Ga0055539_1000073 | 3300003752 | Bacteria | 131094 |
| 28 | Ga0055539_1000132 | 3300003752 | Bacteria | 78763 |
| 29 | Ga0055533_1000135 | 3300003756 | Bacteria | 78763 |
| 30 | Ga0055533_1002700 | 3300003756 | Bacteria | 3911 |
| 31 | Ga0055533_1004145 | 3300003756 | Bacteria | 2698 |
| 32 | Ga0055532_1000090 | 3300003758 | Bacteria | 104391 |
| 33 | Ga0055532_1000359 | 3300003758 | Bacteria | 24174 |
| 34 | Ga0055532_1001166 | 3300003758 | Bacteria | 7949 |
| 35 | Ga0055532_1002123 | 3300003758 | Bacteria | 4489 |
| 36 | Ga0055525_1000243 | 3300003759 | Bacteria | 55208 |
| 37 | Ga0055525_1000387 | 3300003759 | Bacteria | 28280 |
| 38 | Ga0055535_1000085 | 3300003761 | Bacteria | 104391 |
| 39 | Ga0055542_1000847 | 3300003762 | Bacteria | 21499 |
| 40 | Ga0055529_1000134 | 3300003763 | Bacteria | 104391 |
| 41 | Ga0055536_1000342 | 3300003781 | Bacteria | 34528 |
| 42 | Ga0055536_1002461 | 3300003781 | Bacteria | 10397 |
| 43 | Ga0055530_10000472 | 3300003791 | Bacteria | 35044 |
| 44 | Ga0055530_10000512 | 3300003791 | Bacteria | 33785 |
| 45 | Ga0055530_10016313 | 3300003791 | Bacteria | 2379 |
| 46 | Ga0055540_1000424 | 3300003792 | Bacteria | 33785 |
| 47 | Ga0055540_1001540 | 3300003792 | Bacteria | 13537 |
| 48 | Ga0055541_1000087 | 3300003841 | Bacteria | 78763 |
| 49 | Ga0055541_1004035 | 3300003841 | Bacteria | 2702 |
| 50 | Ga0065165_1017045 | 3300005262 | Bacteria | 2693 |
| 51 | Ga0065714_10000330 | 3300005288 | Bacteria | 5628 |
| 52 | Ga0065714_10002659 | 3300005288 | Bacteria | 13479 |
| 53 | Ga0065714_10033331 | 3300005288 | Bacteria | 1679 |
| 54 | Ga0065714_10065003 | 3300005288 | Bacteria | 14170 |
| 55 | Ga0065714_10096482 | 3300005288 | Bacteria | 1759 |
| 56 | Ga0065714_10119427 | 3300005288 | Bacteria | 1365 |
| 57 | Ga0065704_10003082 | 3300005289 | Bacteria | 4544 |
| 58 | Ga0065704_10008505 | 3300005289 | Bacteria | 2596 |
| 59 | Ga0065704_10108857 | 3300005289 | Bacteria | 2018 |
| 60 | Ga0065712_10004185 | 3300005290 | Bacteria | 5871 |
| 61 | Ga0065712_10070057 | 3300005290 | Bacteria | 6369 |
| 62 | Ga0065712_10171865 | 3300005290 | Bacteria | 1239 |
| 63 | Ga0065707_10087248 | 3300005295 | Bacteria | 5102 |
| 64 | Ga0065707_10091487 | 3300005295 | Bacteria | 3937 |
| 65 | Ga0070670_100001253 | 3300005331 | Bacteria | 20205 |
| 66 | Ga0070670_100026572 | 3300005331 | Bacteria | 4980 |
| 67 | Ga0070670_100119614 | 3300005331 | Bacteria | 2272 |
| 68 | Ga0070670_100127861 | 3300005331 | Bacteria | 2193 |
| 69 | Ga0070670_100287106 | 3300005331 | Bacteria | 1437 |
| 70 | Ga0070682_100088602 | 3300005337 | Bacteria | 2020 |
| 71 | Ga0070660_100099732 | 3300005339 | Bacteria | 2300 |
| 72 | Ga0070661_100000141 | 3300005344 | Bacteria | 58825 |
| 73 | Ga0070668_100389909 | 3300005347 | Bacteria | 1187 |
| 74 | Ga0070669_100001868 | 3300005353 | Bacteria | 15166 |
| 75 | Ga0070669_100006352 | 3300005353 | Bacteria | 8518 |
| 76 | Ga0070669_100274188 | 3300005353 | Bacteria | 1350 |
| 77 | Ga0070675_100318334 | 3300005354 | Bacteria | 1374 |
| 78 | Ga0070671_100007902 | 3300005355 | Bacteria | 8505 |
| 79 | Ga0070673_100177332 | 3300005364 | Bacteria | 1822 |
| 80 | Ga0070688_100072700 | 3300005365 | Bacteria | 2204 |
| 81 | Ga0070659_100001430 | 3300005366 | Bacteria | 17218 |
| 82 | Ga0070659_100101107 | 3300005366 | Bacteria | 2320 |
| 83 | Ga0070667_100014111 | 3300005367 | Bacteria | 6602 |
| 84 | Ga0070667_100428467 | 3300005367 | Bacteria | 1207 |
| 85 | Ga0070708_100013258 | 3300005445 | Bacteria | 6743 |
| 86 | Ga0070663_100000034 | 3300005455 | Bacteria | 68516 |
| 87 | Ga0070663_100025939 | 3300005455 | Bacteria | 3963 |
| 88 | Ga0070678_100038117 | 3300005456 | Bacteria | 3381 |
| 89 | Ga0070662_100007020 | 3300005457 | Bacteria | 7285 |
| 90 | Ga0070662_100007171 | 3300005457 | Bacteria | 7220 |
| 91 | Ga0070662_100319169 | 3300005457 | Bacteria | 1266 |
| 92 | Ga0068867_100012998 | 3300005459 | Bacteria | 5891 |
| 93 | Ga0070685_10080532 | 3300005466 | Bacteria | 1951 |
| 94 | Ga0070706_100129499 | 3300005467 | Bacteria | 2354 |
| 95 | Ga0070706_100300993 | 3300005467 | Bacteria | 1496 |
| 96 | Ga0070707_100013239 | 3300005468 | Bacteria | 7713 |
| 97 | Ga0070699_100378174 | 3300005518 | Bacteria | 1278 |
| 98 | Ga0068853_100043664 | 3300005539 | Bacteria | 3835 |
| 99 | Ga0070665_100062105 | 3300005548 | Bacteria | 3746 |
| 100 | Ga0070665_100098295 | 3300005548 | Bacteria | 2931 |
| 101 | Ga0070665_100098943 | 3300005548 | Bacteria | 2921 |
| 102 | Ga0070665_100336128 | 3300005548 | Bacteria | 1515 |
| 103 | Ga0068855_100000854 | 3300005563 | Bacteria | 37817 |
| 104 | Ga0068855_100002275 | 3300005563 | Bacteria | 23730 |
| 105 | Ga0070664_100000057 | 3300005564 | Bacteria | 68516 |
| 106 | Ga0070664_100101171 | 3300005564 | Bacteria | 2506 |
| 107 | Ga0070664_100425382 | 3300005564 | Bacteria | 1217 |
| 108 | Ga0068857_100009494 | 3300005577 | Bacteria | 8449 |
| 109 | Ga0068857_100033795 | 3300005577 | Bacteria | 4522 |
| 110 | Ga0068854_100000299 | 3300005578 | Bacteria | 32817 |
| 111 | Ga0068854_100128126 | 3300005578 | Bacteria | 1935 |
| 112 | Ga0068854_100399414 | 3300005578 | Bacteria | 1137 |
| 113 | Ga0068856_100000811 | 3300005614 | Bacteria | 33756 |
| 114 | Ga0068856_100014486 | 3300005614 | Bacteria | 7616 |
| 115 | Ga0068856_100469407 | 3300005614 | Bacteria | 1279 |
| 116 | Ga0068852_100265346 | 3300005616 | Bacteria | 1650 |
| 117 | Ga0068859_100000075 | 3300005617 | Bacteria | 91974 |
| 118 | Ga0068859_100255294 | 3300005617 | Bacteria | 1844 |
| 119 | Ga0068864_100570329 | 3300005618 | Bacteria | 1096 |
| 120 | Ga0068861_100004019 | 3300005719 | Bacteria | 9848 |
| 121 | Ga0068861_100061495 | 3300005719 | Bacteria | 2882 |
| 122 | Ga0068861_100289953 | 3300005719 | Bacteria | 1413 |
| 123 | Ga0068861_100563130 | 3300005719 | Bacteria | 1040 |
| 124 | Ga0068851_10000311 | 3300005834 | Bacteria | 22013 |
| 125 | Ga0068863_100007182 | 3300005841 | Bacteria | 10931 |
| 126 | Ga0068863_100019292 | 3300005841 | Bacteria | 6522 |
| 127 | Ga0068863_100020109 | 3300005841 | Bacteria | 6386 |
| 128 | Ga0068858_100009576 | 3300005842 | Bacteria | 9240 |
| 129 | Ga0068858_100102602 | 3300005842 | Bacteria | 2668 |
| 130 | Ga0068860_100000206 | 3300005843 | Bacteria | 93792 |
| 131 | Ga0068860_100026522 | 3300005843 | Bacteria | 5584 |
| 132 | Ga0068862_100071025 | 3300005844 | Bacteria | 3006 |
| 133 | Ga0068862_100101611 | 3300005844 | Bacteria | 2515 |
| 134 | Ga0081455_10006895 | 3300005937 | Bacteria | 12088 |
| 135 | Ga0081540_1065174 | 3300005983 | Bacteria | 1714 |
| 136 | Ga0070717_10000029 | 3300006028 | Bacteria | 143008 |
| 137 | Ga0070717_10249014 | 3300006028 | Bacteria | 1569 |
| 138 | Ga0070717_10407657 | 3300006028 | Bacteria | 1222 |
| 139 | Ga0075368_10005176 | 3300006042 | Bacteria | 4473 |
| 140 | Ga0075364_10042831 | 3300006051 | Bacteria | 2942 |
| 141 | Ga0075364_10075777 | 3300006051 | Bacteria | 2220 |
| 142 | Ga0075364_10104320 | 3300006051 | Bacteria | 1888 |
| 143 | Ga0075364_10105228 | 3300006051 | Bacteria | 1880 |
| 144 | Ga0075432_10005608 | 3300006058 | Bacteria | 4274 |
| 145 | Ga0075432_10012010 | 3300006058 | Bacteria | 2942 |
| 146 | Ga0075432_10023055 | 3300006058 | Bacteria | 2132 |
| 147 | Ga0075432_10024079 | 3300006058 | Bacteria | 2085 |
| 148 | Ga0075432_10083102 | 3300006058 | Bacteria | 1163 |
| 149 | Ga0075362_10047569 | 3300006177 | Bacteria | 1911 |
| 150 | Ga0075367_10036141 | 3300006178 | Bacteria | 2862 |
| 151 | Ga0075366_10032757 | 3300006195 | Bacteria | 3060 |
| 152 | Ga0097621_100228652 | 3300006237 | Bacteria | 1623 |
| 153 | Ga0075370_10031952 | 3300006353 | Bacteria | 2940 |
| 154 | Ga0075428_100002850 | 3300006844 | Bacteria | 18866 |
| 155 | Ga0075428_100011312 | 3300006844 | Bacteria | 9929 |
| 156 | Ga0075428_100160216 | 3300006844 | Bacteria | 2443 |
| 157 | Ga0075428_100495260 | 3300006844 | Bacteria | 1308 |
| 158 | Ga0075430_100000819 | 3300006846 | Bacteria | 24262 |
| 159 | Ga0075431_100073385 | 3300006847 | Bacteria | 3530 |
| 160 | Ga0075431_100080061 | 3300006847 | Unclassified | 3372 |
| 161 | Ga0075431_100198160 | 3300006847 | Bacteria | 2055 |
| 162 | Ga0075433_10003532 | 3300006852 | Bacteria | 12068 |
| 163 | Ga0075434_100002217 | 3300006871 | Bacteria | 16951 |
| 164 | Ga0075434_100199650 | 3300006871 | Bacteria | 2020 |
| 165 | Ga0075429_100000374 | 3300006880 | Bacteria | 32944 |
| 166 | Ga0075429_100042776 | 3300006880 | Bacteria | 3942 |
| 167 | Ga0075429_100128534 | 3300006880 | Unclassified | 2216 |
| 168 | Ga0075436_100101739 | 3300006914 | Bacteria | 2001 |
| 169 | Ga0075436_100172035 | 3300006914 | Bacteria | 1529 |
| 170 | Ga0075436_100319643 | 3300006914 | Bacteria | 1115 |
| 171 | Ga0097620_100000075 | 3300006931 | Bacteria | 91974 |
| 172 | Ga0097620_100255271 | 3300006931 | Bacteria | 1844 |
| 173 | Ga0099823_1003401 | 3300006944 | Bacteria | 15050 |
| 174 | Ga0079104_1000374 | 3300006946 | Bacteria | 52789 |
| 175 | Ga0079104_1000659 | 3300006946 | Bacteria | 32892 |
| 176 | Ga0079104_1005684 | 3300006946 | Bacteria | 4917 |
| 177 | Ga0105251_10000336 | 3300009011 | Bacteria | 47055 |
| 178 | Ga0105251_10000879 | 3300009011 | Bacteria | 26931 |
| 179 | Ga0105251_10001202 | 3300009011 | Bacteria | 22386 |
| 180 | Ga0105251_10001712 | 3300009011 | Bacteria | 18364 |
| 181 | Ga0105251_10002150 | 3300009011 | Bacteria | 15835 |
| 182 | Ga0105251_10005549 | 3300009011 | Bacteria | 8209 |
| 183 | Ga0105251_10007195 | 3300009011 | Bacteria | 6912 |
| 184 | Ga0105251_10052124 | 3300009011 | Bacteria | 1949 |
| 185 | Ga0105251_10103416 | 3300009011 | Bacteria | 1301 |
| 186 | Ga0105251_10106632 | 3300009011 | Bacteria | 1279 |
| 187 | Ga0105244_10002288 | 3300009036 | Bacteria | 14546 |
| 188 | Ga0105244_10005469 | 3300009036 | Bacteria | 8442 |
| 189 | Ga0105244_10006237 | 3300009036 | Bacteria | 7769 |
| 190 | Ga0105244_10006263 | 3300009036 | Bacteria | 7747 |
| 191 | Ga0105244_10058728 | 3300009036 | Bacteria | 1940 |
| 192 | Ga0105244_10073413 | 3300009036 | Bacteria | 1703 |
| 193 | Ga0105244_10080174 | 3300009036 | Bacteria | 1617 |
| 194 | Ga0105244_10097605 | 3300009036 | Bacteria | 1440 |
| 195 | Ga0105250_10000152 | 3300009092 | Bacteria | 59872 |
| 196 | Ga0105250_10000566 | 3300009092 | Bacteria | 24655 |
| 197 | Ga0105250_10001634 | 3300009092 | Bacteria | 11952 |
| 198 | Ga0105250_10009340 | 3300009092 | Bacteria | 4135 |
| 199 | Ga0105250_10012096 | 3300009092 | Bacteria | 3572 |
| 200 | Ga0105250_10018885 | 3300009092 | Bacteria | 2788 |
| 201 | Ga0105250_10019617 | 3300009092 | Bacteria | 2734 |
| 202 | Ga0105250_10021230 | 3300009092 | Bacteria | 2622 |
| 203 | Ga0105240_10023229 | 3300009093 | Bacteria | 8209 |
| 204 | Ga0105240_10194299 | 3300009093 | Bacteria | 2384 |
| 205 | Ga0111539_10012498 | 3300009094 | Bacteria | 10640 |
| 206 | Ga0114129_10001645 | 3300009147 | Bacteria | 30363 |
| 207 | Ga0114129_10068759 | 3300009147 | Bacteria | 4938 |
| 208 | Ga0114129_10082926 | 3300009147 | Bacteria | 4454 |
| 209 | Ga0114129_10183636 | 3300009147 | Bacteria | 2844 |
| 210 | Ga0114129_10273643 | 3300009147 | Bacteria | 2258 |
| 211 | Ga0114129_10577780 | 3300009147 | Bacteria | 1459 |
| 212 | Ga0105243_10000321 | 3300009148 | Bacteria | 52717 |
| 213 | Ga0105243_10000885 | 3300009148 | Bacteria | 28194 |
| 214 | Ga0105243_10025570 | 3300009148 | Bacteria | 4513 |
| 215 | Ga0105243_10039642 | 3300009148 | Bacteria | 3673 |
| 216 | Ga0105243_10071214 | 3300009148 | Bacteria | 2810 |
| 217 | Ga0105243_10110707 | 3300009148 | Bacteria | 2297 |
| 218 | Ga0105242_10382587 | 3300009176 | Bacteria | 1309 |
| 219 | Ga0105248_10007246 | 3300009177 | Bacteria | 12168 |
| 220 | Ga0105248_10107584 | 3300009177 | Bacteria | 3144 |
| 221 | Ga0105238_10191741 | 3300009551 | Bacteria | 2020 |
| 222 | Ga0105249_10022415 | 3300009553 | Bacteria | 5656 |
| 223 | Ga0105249_10130012 | 3300009553 | Bacteria | 2403 |
| 224 | Ga0105246_10000476 | 3300011119 | Bacteria | 21621 |
| 225 | Ga0105246_10000524 | 3300011119 | Bacteria | 20960 |
| 226 | Ga0105246_10038366 | 3300011119 | Bacteria | 3220 |
| 227 | Ga0105246_10041030 | 3300011119 | Bacteria | 3127 |
| 228 | Ga0105246_10066146 | 3300011119 | Bacteria | 2530 |
| 229 | Ga0157345_1000203 | 3300012498 | Bacteria | 9118 |
| 230 | Ga0157373_10002399 | 3300013100 | Bacteria | 14227 |
| 231 | Ga0157373_10005087 | 3300013100 | Bacteria | 9883 |
| 232 | Ga0157373_10005895 | 3300013100 | Bacteria | 9167 |
| 233 | Ga0157373_10009158 | 3300013100 | Bacteria | 7320 |
| 234 | Ga0157373_10011643 | 3300013100 | Bacteria | 6462 |
| 235 | Ga0157373_10015891 | 3300013100 | Bacteria | 5494 |
| 236 | Ga0157373_10042835 | 3300013100 | Bacteria | 3235 |
| 237 | Ga0157373_10071925 | 3300013100 | Bacteria | 2442 |
| 238 | Ga0157371_10000323 | 3300013102 | Bacteria | 61980 |
| 239 | Ga0157371_10001092 | 3300013102 | Bacteria | 29401 |
| 240 | Ga0157371_10001258 | 3300013102 | Bacteria | 26748 |
| 241 | Ga0157371_10074350 | 3300013102 | Bacteria | 2407 |
| 242 | Ga0157370_10000038 | 3300013104 | Bacteria | 135182 |
| 243 | Ga0157370_10056190 | 3300013104 | Bacteria | 3746 |
| 244 | Ga0157370_10176684 | 3300013104 | Bacteria | 1985 |
| 245 | Ga0157370_10182491 | 3300013104 | Bacteria | 1950 |
| 246 | Ga0157369_10008841 | 3300013105 | Bacteria | 11536 |
| 247 | Ga0157369_10021204 | 3300013105 | Bacteria | 7264 |
| 248 | Ga0157369_10055398 | 3300013105 | Bacteria | 4280 |
| 249 | Ga0157369_10139563 | 3300013105 | Bacteria | 2565 |
| 250 | Ga0157369_10419654 | 3300013105 | Bacteria | 1387 |
| 251 | Ga0157374_10000045 | 3300013296 | Bacteria | 143116 |
| 252 | Ga0157374_10095271 | 3300013296 | Bacteria | 2846 |
| 253 | Ga0163162_10000820 | 3300013306 | Bacteria | 28876 |
| 254 | Ga0163162_10482275 | 3300013306 | Bacteria | 1371 |
| 255 | Ga0157372_10000663 | 3300013307 | Bacteria | 37808 |
| 256 | Ga0157372_10002748 | 3300013307 | Bacteria | 19019 |
| 257 | Ga0157372_10007130 | 3300013307 | Bacteria | 11900 |
| 258 | Ga0157372_10024456 | 3300013307 | Bacteria | 6561 |
| 259 | Ga0157375_10074741 | 3300013308 | Bacteria | 3411 |
| 260 | Ga0163163_10028117 | 3300014325 | Bacteria | 5396 |
| 261 | Ga0163163_10031095 | 3300014325 | Bacteria | 5150 |
| 262 | Ga0182008_10000483 | 3300014497 | Bacteria | 30249 |
| 263 | Ga0182008_10001727 | 3300014497 | Bacteria | 14338 |
| 264 | Ga0182008_10002512 | 3300014497 | Bacteria | 11447 |
| 265 | Ga0182008_10004519 | 3300014497 | Bacteria | 8117 |
| 266 | Ga0182008_10016035 | 3300014497 | Bacteria | 3900 |
| 267 | Ga0182008_10023541 | 3300014497 | Bacteria | 3143 |
| 268 | Ga0182008_10034108 | 3300014497 | Bacteria | 2552 |
| 269 | Ga0182008_10048881 | 3300014497 | Bacteria | 2100 |
| 270 | Ga0157379_10000104 | 3300014968 | Bacteria | 57987 |
| 271 | Ga0157376_10000309 | 3300014969 | Bacteria | 32560 |
| 272 | Ga0182006_1001817 | 3300015261 | Bacteria | 12279 |
| 273 | Ga0182006_1004331 | 3300015261 | Bacteria | 7022 |
| 274 | Ga0182006_1004638 | 3300015261 | Bacteria | 6734 |
| 275 | Ga0182006_1014999 | 3300015261 | Bacteria | 3329 |
| 276 | Ga0182006_1015539 | 3300015261 | Bacteria | 3263 |
| 277 | Ga0182007_10002175 | 3300015262 | Bacteria | 9940 |
| 278 | Ga0182007_10011984 | 3300015262 | Bacteria | 3350 |
| 279 | Ga0182007_10018272 | 3300015262 | Bacteria | 2543 |
| 280 | Ga0182005_1001689 | 3300015265 | Bacteria | 8545 |
| 281 | Ga0182005_1008708 | 3300015265 | Bacteria | 2980 |
| 282 | Ga0182005_1011469 | 3300015265 | Bacteria | 2524 |
| 283 | Ga0182005_1011882 | 3300015265 | Bacteria | 2470 |
| 284 | Ga0182005_1029400 | 3300015265 | Bacteria | 1499 |
| 285 | Ga0163161_10005444 | 3300017792 | Bacteria | 8839 |
| 286 | Ga0163161_10013673 | 3300017792 | Bacteria | 5651 |
| 287 | Ga0163161_10014430 | 3300017792 | Bacteria | 5500 |
| 288 | Ga0163161_10043460 | 3300017792 | Bacteria | 3235 |
| 289 | Ga0163161_10061444 | 3300017792 | Bacteria | 2735 |
| 290 | Ga0163161_10061766 | 3300017792 | Bacteria | 2728 |
| 291 | Ga0163161_10085930 | 3300017792 | Bacteria | 2321 |
| 292 | Ga0163161_10111901 | 3300017792 | Bacteria | 2042 |
| 293 | Ga0163161_10212972 | 3300017792 | Bacteria | 1493 |
| 294 | Ga0206351_10707377 | 3300020077 | Bacteria | 1268 |
| 295 | Ga0154015_1546600 | 3300020610 | Bacteria | 6538 |
| 296 | Ga0209435_101037 | 3300025206 | Bacteria | 3942 |
| 297 | Ga0209760_100028 | 3300025207 | Bacteria | 153020 |
| 298 | Ga0209760_100095 | 3300025207 | Bacteria | 68193 |
| 299 | Ga0209784_100006 | 3300025224 | Bacteria | 930704 |
| 300 | Ga0209784_100108 | 3300025224 | Bacteria | 94409 |
| 301 | Ga0209784_100126 | 3300025224 | Bacteria | 78815 |
| 302 | Ga0209784_100846 | 3300025224 | Bacteria | 6784 |
| 303 | Ga0209566_100002 | 3300025225 | Bacteria | 2614868 |
| 304 | Ga0209566_100152 | 3300025225 | Bacteria | 78864 |
| 305 | Ga0209566_100602 | 3300025225 | Bacteria | 22518 |
| 306 | Ga0209566_103317 | 3300025225 | Bacteria | 2521 |
| 307 | Ga0209674_100097 | 3300025226 | Bacteria | 167285 |
| 308 | Ga0209674_100168 | 3300025226 | Bacteria | 84107 |
| 309 | Ga0209674_100177 | 3300025226 | Bacteria | 78864 |
| 310 | Ga0209674_101230 | 3300025226 | Bacteria | 7288 |
| 311 | Ga0209147_100018 | 3300025229 | Bacteria | 515719 |
| 312 | Ga0209147_100179 | 3300025229 | Bacteria | 78864 |
| 313 | Ga0209563_100041 | 3300025230 | Bacteria | 407467 |
| 314 | Ga0209563_100142 | 3300025230 | Bacteria | 78864 |
| 315 | Ga0209563_101244 | 3300025230 | Bacteria | 6998 |
| 316 | Ga0209563_104405 | 3300025230 | Bacteria | 2698 |
| 317 | Ga0207427_100007 | 3300025231 | Bacteria | 746220 |
| 318 | Ga0207427_100008 | 3300025231 | Bacteria | 740731 |
| 319 | Ga0209437_100006 | 3300025233 | Bacteria | 1042724 |
| 320 | Ga0209437_100014 | 3300025233 | Bacteria | 740714 |
| 321 | Ga0209258_100028 | 3300025242 | Bacteria | 515719 |
| 322 | Ga0209258_100366 | 3300025242 | Bacteria | 59744 |
| 323 | Ga0209646_1000153 | 3300025246 | Bacteria | 96707 |
| 324 | Ga0209646_1000465 | 3300025246 | Bacteria | 20531 |
| 325 | Ga0209677_100007 | 3300025253 | Bacteria | 1021332 |
| 326 | Ga0209677_100125 | 3300025253 | Bacteria | 78864 |
| 327 | Ga0209148_1000297 | 3300025254 | Bacteria | 72735 |
| 328 | Ga0209759_1002551 | 3300025256 | Bacteria | 7905 |
| 329 | Ga0209759_1002829 | 3300025256 | Bacteria | 7322 |
| 330 | Ga0209759_1007185 | 3300025256 | Bacteria | 3620 |
| 331 | Ga0209233_1000008 | 3300025261 | Bacteria | 1356712 |
| 332 | Ga0209233_1000086 | 3300025261 | Bacteria | 331687 |
| 333 | Ga0209455_1000107 | 3300025272 | Bacteria | 195136 |
| 334 | Ga0209673_1000070 | 3300025273 | Bacteria | 241592 |
| 335 | Ga0209675_1010978 | 3300025291 | Bacteria | 3042 |
| 336 | Ga0209676_1000006 | 3300025292 | Bacteria | 1039588 |
| 337 | Ga0209676_1000109 | 3300025292 | Bacteria | 217531 |
| 338 | Ga0209676_1000973 | 3300025292 | Bacteria | 34485 |
| 339 | Ga0209676_1006254 | 3300025292 | Bacteria | 5928 |
| 340 | Ga0209676_1007011 | 3300025292 | Bacteria | 5413 |
| 341 | Ga0209050_1000070 | 3300025298 | Bacteria | 296366 |
| 342 | Ga0209050_1000279 | 3300025298 | Bacteria | 109034 |
| 343 | Ga0209050_1000399 | 3300025298 | Bacteria | 81236 |
| 344 | Ga0209050_1001030 | 3300025298 | Bacteria | 34683 |
| 345 | Ga0209051_1000086 | 3300025303 | Bacteria | 183550 |
| 346 | Ga0209051_1000106 | 3300025303 | Bacteria | 159222 |
| 347 | Ga0209051_1020153 | 3300025303 | Bacteria | 2883 |
| 348 | Ga0209257_1017856 | 3300025304 | Bacteria | 2768 |
| 349 | Ga0207656_10000423 | 3300025321 | Bacteria | 14235 |
| 350 | Ga0207696_1000044 | 3300025711 | Bacteria | 300953 |
| 351 | Ga0207696_1000090 | 3300025711 | Bacteria | 188474 |
| 352 | Ga0207696_1000130 | 3300025711 | Bacteria | 133107 |
| 353 | Ga0207696_1000144 | 3300025711 | Bacteria | 122345 |
| 354 | Ga0207696_1002572 | 3300025711 | Bacteria | 8820 |
| 355 | Ga0207696_1006573 | 3300025711 | Bacteria | 4668 |
| 356 | Ga0207696_1008004 | 3300025711 | Bacteria | 4086 |
| 357 | Ga0207696_1008761 | 3300025711 | Bacteria | 3833 |
| 358 | Ga0207655_1000113 | 3300025728 | Bacteria | 167376 |
| 359 | Ga0207655_1001166 | 3300025728 | Bacteria | 25539 |
| 360 | Ga0207655_1003265 | 3300025728 | Bacteria | 12167 |
| 361 | Ga0207655_1004652 | 3300025728 | Bacteria | 9630 |
| 362 | Ga0207655_1006377 | 3300025728 | Bacteria | 7832 |
| 363 | Ga0207655_1006442 | 3300025728 | Bacteria | 7777 |
| 364 | Ga0207655_1007851 | 3300025728 | Bacteria | 6865 |
| 365 | Ga0207655_1013598 | 3300025728 | Bacteria | 4660 |
| 366 | Ga0207655_1023439 | 3300025728 | Bacteria | 3062 |
| 367 | Ga0207655_1044493 | 3300025728 | Bacteria | 1865 |
| 368 | Ga0207655_1044533 | 3300025728 | Bacteria | 1863 |
| 369 | Ga0207655_1050415 | 3300025728 | Bacteria | 1692 |
| 370 | Ga0207655_1052506 | 3300025728 | Bacteria | 1639 |
| 371 | Ga0207713_1000013 | 3300025735 | Bacteria | 475751 |
| 372 | Ga0207713_1000074 | 3300025735 | Bacteria | 181376 |
| 373 | Ga0207713_1000442 | 3300025735 | Bacteria | 43616 |
| 374 | Ga0207713_1000520 | 3300025735 | Bacteria | 38760 |
| 375 | Ga0207713_1000877 | 3300025735 | Bacteria | 27523 |
| 376 | Ga0207713_1001968 | 3300025735 | Bacteria | 15492 |
| 377 | Ga0207713_1003597 | 3300025735 | Bacteria | 10454 |
| 378 | Ga0207713_1004351 | 3300025735 | Bacteria | 9209 |
| 379 | Ga0207713_1004461 | 3300025735 | Bacteria | 9069 |
| 380 | Ga0207713_1004479 | 3300025735 | Bacteria | 9052 |
| 381 | Ga0207713_1004774 | 3300025735 | Bacteria | 8713 |
| 382 | Ga0207713_1005720 | 3300025735 | Bacteria | 7710 |
| 383 | Ga0207713_1006089 | 3300025735 | Bacteria | 7430 |
| 384 | Ga0207713_1006195 | 3300025735 | Bacteria | 7333 |
| 385 | Ga0207713_1008133 | 3300025735 | Bacteria | 6081 |
| 386 | Ga0207682_10030553 | 3300025893 | Bacteria | 2158 |
| 387 | Ga0207684_10092749 | 3300025910 | Bacteria | 2574 |
| 388 | Ga0207684_10245410 | 3300025910 | Bacteria | 1545 |
| 389 | Ga0207695_10009088 | 3300025913 | Bacteria | 12340 |
| 390 | Ga0207695_10148904 | 3300025913 | Bacteria | 2281 |
| 391 | Ga0207657_10023036 | 3300025919 | Bacteria | 5809 |
| 392 | Ga0207657_10112754 | 3300025919 | Bacteria | 2244 |
| 393 | Ga0207649_10000111 | 3300025920 | Bacteria | 68568 |
| 394 | Ga0207646_10069491 | 3300025922 | Bacteria | 3145 |
| 395 | Ga0207681_10008837 | 3300025923 | Bacteria | 6156 |
| 396 | Ga0207681_10014938 | 3300025923 | Bacteria | 4836 |
| 397 | Ga0207694_10127649 | 3300025924 | Bacteria | 2036 |
| 398 | Ga0207650_10000266 | 3300025925 | Bacteria | 55293 |
| 399 | Ga0207650_10000428 | 3300025925 | Bacteria | 36810 |
| 400 | Ga0207650_10196909 | 3300025925 | Bacteria | 1612 |
| 401 | Ga0207700_10053947 | 3300025928 | Bacteria | 3015 |
| 402 | Ga0207644_10005170 | 3300025931 | Bacteria | 8520 |
| 403 | Ga0207644_10177770 | 3300025931 | Bacteria | 1666 |
| 404 | Ga0207690_10001080 | 3300025932 | Bacteria | 17433 |
| 405 | Ga0207706_10006074 | 3300025933 | Bacteria | 11224 |
| 406 | Ga0207706_10041506 | 3300025933 | Bacteria | 4079 |
| 407 | Ga0207706_10283240 | 3300025933 | Bacteria | 1445 |
| 408 | Ga0207709_10000013 | 3300025935 | Bacteria | 531977 |
| 409 | Ga0207709_10001932 | 3300025935 | Bacteria | 13617 |
| 410 | Ga0207709_10013065 | 3300025935 | Bacteria | 4577 |
| 411 | Ga0207709_10027350 | 3300025935 | Bacteria | 3285 |
| 412 | Ga0207691_10088412 | 3300025940 | Bacteria | 2779 |
| 413 | Ga0207711_10013500 | 3300025941 | Bacteria | 6781 |
| 414 | Ga0207689_10162701 | 3300025942 | Bacteria | 1839 |
| 415 | Ga0207679_10000105 | 3300025945 | Bacteria | 68561 |
| 416 | Ga0207667_10006177 | 3300025949 | Bacteria | 14544 |
| 417 | Ga0207667_10026197 | 3300025949 | Bacteria | 6374 |
| 418 | Ga0207651_10177345 | 3300025960 | Bacteria | 1687 |
| 419 | Ga0207640_10000154 | 3300025981 | Bacteria | 49637 |
| 420 | Ga0207640_10356480 | 3300025981 | Bacteria | 1177 |
| 421 | Ga0207658_10225297 | 3300025986 | Bacteria | 1579 |
| 422 | Ga0207658_10233507 | 3300025986 | Bacteria | 1554 |
| 423 | Ga0207703_10002028 | 3300026035 | Bacteria | 17886 |
| 424 | Ga0207703_10018255 | 3300026035 | Bacteria | 5477 |
| 425 | Ga0207703_10080423 | 3300026035 | Bacteria | 2714 |
| 426 | Ga0207703_10505908 | 3300026035 | Bacteria | 1134 |
| 427 | Ga0207678_10000106 | 3300026067 | Bacteria | 68474 |
| 428 | Ga0207678_10102399 | 3300026067 | Bacteria | 2445 |
| 429 | Ga0207702_10000135 | 3300026078 | Bacteria | 88092 |
| 430 | Ga0207702_10058448 | 3300026078 | Bacteria | 3282 |
| 431 | Ga0207641_10017280 | 3300026088 | Bacteria | 5906 |
| 432 | Ga0207641_10021949 | 3300026088 | Bacteria | 5249 |
| 433 | Ga0207648_10021724 | 3300026089 | Bacteria | 5767 |
| 434 | Ga0207676_10336171 | 3300026095 | Bacteria | 1391 |
| 435 | Ga0207674_10003401 | 3300026116 | Bacteria | 19514 |
| 436 | Ga0207674_10151286 | 3300026116 | Bacteria | 2278 |
| 437 | Ga0207674_10296281 | 3300026116 | Bacteria | 1566 |
| 438 | Ga0207674_10555863 | 3300026116 | Bacteria | 1109 |
| 439 | Ga0207675_100002359 | 3300026118 | Bacteria | 18688 |
| 440 | Ga0207675_100088645 | 3300026118 | Bacteria | 2906 |
| 441 | Ga0207675_100114842 | 3300026118 | Bacteria | 2543 |
| 442 | Ga0207683_10424200 | 3300026121 | Bacteria | 1225 |
| 443 | Ga0209281_1000010 | 3300027111 | Bacteria | 726106 |
| 444 | Ga0209281_1000363 | 3300027111 | Bacteria | 74009 |
| 445 | Ga0209281_1005767 | 3300027111 | Bacteria | 3353 |
| 446 | Ga0209281_1006162 | 3300027111 | Bacteria | 3175 |
| 447 | Ga0209389_1000031 | 3300027296 | Bacteria | 138036 |
| 448 | Ga0209371_1000348 | 3300027312 | Bacteria | 50540 |
| 449 | Ga0207428_10017008 | 3300027907 | Bacteria | 6248 |
| 450 | Ga0207428_10018636 | 3300027907 | Bacteria | 5926 |
| 451 | Ga0207428_10022914 | 3300027907 | Bacteria | 5262 |
| 452 | Ga0207428_10064191 | 3300027907 | Bacteria | 2900 |
| 453 | Ga0207428_10123984 | 3300027907 | Bacteria | 1979 |
| 454 | Ga0207428_10152155 | 3300027907 | Bacteria | 1761 |
| 455 | Ga0268266_10040702 | 3300028379 | Bacteria | 3962 |
| 456 | Ga0268266_10048574 | 3300028379 | Bacteria | 3638 |
| 457 | Ga0268266_10265494 | 3300028379 | Bacteria | 1592 |
| 458 | Ga0268264_10000341 | 3300028381 | Bacteria | 71848 |
| 459 | Ga0265318_10000033 | 3300028577 | Bacteria | 143214 |
| 460 | Ga0268256_1000134 | 3300030500 | Bacteria | 102725 |
| 461 | Ga0307511_10024878 | 3300030521 | Bacteria | 5534 |
| 462 | Ga0307511_10165360 | 3300030521 | Bacteria | 1230 |
| 463 | Ga0314311_1063254 | 3300030733 | Bacteria | 1788 |
| 464 | Ga0316178_1042235 | 3300030735 | Bacteria | 22208 |
| 465 | Ga0316183_1100530 | 3300030742 | Bacteria | 3328 |
| 466 | Ga0316182_1369220 | 3300030745 | Bacteria | 1165 |
| 467 | Ga0265330_10000029 | 3300031235 | Bacteria | 138185 |
| 468 | Ga0265332_10004299 | 3300031238 | Bacteria | 6720 |
| 469 | Ga0265328_10016457 | 3300031239 | Bacteria | 2876 |
| 470 | Ga0265320_10000062 | 3300031240 | Bacteria | 99515 |
| 471 | Ga0265339_10037067 | 3300031249 | Bacteria | 2726 |
| 472 | Ga0265331_10000079 | 3300031250 | Bacteria | 138758 |
| 473 | Ga0265316_10019120 | 3300031344 | Bacteria | 5866 |
| 474 | Ga0265316_10057920 | 3300031344 | Bacteria | 3020 |
| 475 | Ga0307408_100000258 | 3300031548 | Bacteria | 54032 |
| 476 | Ga0307408_100005919 | 3300031548 | Bacteria | 8145 |
| 477 | Ga0307408_100006681 | 3300031548 | Bacteria | 7649 |
| 478 | Ga0307408_100009169 | 3300031548 | Bacteria | 6522 |
| 479 | Ga0307408_100024887 | 3300031548 | Bacteria | 4093 |
| 480 | Ga0307408_100048945 | 3300031548 | Bacteria | 3034 |
| 481 | Ga0307408_100144913 | 3300031548 | Bacteria | 1868 |
| 482 | Ga0307408_100177630 | 3300031548 | Bacteria | 1705 |
| 483 | Ga0307408_100220735 | 3300031548 | Bacteria | 1546 |
| 484 | Ga0265313_10000344 | 3300031595 | Bacteria | 50468 |
| 485 | Ga0265314_10000138 | 3300031711 | Bacteria | 109255 |
| 486 | Ga0316576_10016093 | 3300031727 | Bacteria | 5042 |
| 487 | Ga0316576_10095886 | 3300031727 | Bacteria | 2213 |
| 488 | Ga0316576_10271767 | 3300031727 | Bacteria | 1270 |
| 489 | Ga0307405_10001021 | 3300031731 | Bacteria | 11333 |
| 490 | Ga0307405_10002099 | 3300031731 | Bacteria | 8682 |
| 491 | Ga0307405_10032339 | 3300031731 | Bacteria | 3091 |
| 492 | Ga0307405_10211108 | 3300031731 | Bacteria | 1417 |
| 493 | Ga0316577_10012767 | 3300031733 | Bacteria | 4581 |
| 494 | Ga0307413_10002828 | 3300031824 | Bacteria | 7153 |
| 495 | Ga0307413_10057066 | 3300031824 | Bacteria | 2385 |
| 496 | Ga0307410_10007569 | 3300031852 | Bacteria | 5955 |
| 497 | Ga0307406_10141122 | 3300031901 | Bacteria | 1705 |
| 498 | Ga0307407_10015054 | 3300031903 | Bacteria | 3807 |
| 499 | Ga0307407_10027783 | 3300031903 | Bacteria | 3016 |
| 500 | Ga0307407_10038255 | 3300031903 | Bacteria | 2657 |
| 501 | Ga0307412_10002264 | 3300031911 | Bacteria | 10660 |
| 502 | Ga0307412_10005050 | 3300031911 | Bacteria | 7378 |
| 503 | Ga0307412_10017511 | 3300031911 | Bacteria | 4289 |
| 504 | Ga0307412_10017840 | 3300031911 | Bacteria | 4255 |
| 505 | Ga0307412_10022573 | 3300031911 | Bacteria | 3859 |
| 506 | Ga0307412_10111948 | 3300031911 | Bacteria | 1950 |
| 507 | Ga0307412_10135198 | 3300031911 | Bacteria | 1797 |
| 508 | Ga0307412_10175422 | 3300031911 | Bacteria | 1606 |
| 509 | Ga0307409_100001842 | 3300031995 | Bacteria | 10780 |
| 510 | Ga0307409_100090062 | 3300031995 | Bacteria | 2510 |
| 511 | Ga0307409_100231795 | 3300031995 | Bacteria | 1674 |
| 512 | Ga0307409_100362701 | 3300031995 | Bacteria | 1371 |
| 513 | Ga0307409_100387460 | 3300031995 | Bacteria | 1331 |
| 514 | Ga0307416_100004045 | 3300032002 | Bacteria | 8762 |
| 515 | Ga0307416_100071689 | 3300032002 | Bacteria | 2879 |
| 516 | Ga0307416_100246747 | 3300032002 | Bacteria | 1735 |
| 517 | Ga0307414_10130885 | 3300032004 | Bacteria | 1947 |
| 518 | Ga0307414_10161927 | 3300032004 | Bacteria | 1778 |
| 519 | Ga0307414_10263482 | 3300032004 | Bacteria | 1439 |
| 520 | Ga0307414_10293656 | 3300032004 | Bacteria | 1371 |
| 521 | Ga0307411_10001241 | 3300032005 | Bacteria | 10157 |
| 522 | Ga0307411_10028369 | 3300032005 | Bacteria | 3402 |
| 523 | Ga0307411_10080620 | 3300032005 | Bacteria | 2238 |
| 524 | Ga0307411_10082852 | 3300032005 | Bacteria | 2213 |
| 525 | Ga0307411_10170724 | 3300032005 | Bacteria | 1639 |
| 526 | Ga0307411_10316373 | 3300032005 | Bacteria | 1259 |
| 527 | Ga0307415_100005809 | 3300032126 | Bacteria | 6593 |
| 528 | Ga0307415_100027497 | 3300032126 | Bacteria | 3604 |
| 529 | Ga0316583_10071149 | 3300032133 | Bacteria | 1217 |
| 530 | Ga0307510_10013692 | 3300033180 | Bacteria | 9614 |
| 531 | Ga0316582_0105580 | 3300036647 | Bacteria | 1870 |
| 532 | Ga0316582_0153412 | 3300036647 | Bacteria | 1558 |
| 533 | Ga0316584_0026279 | 3300036712 | Bacteria | 4278 |
| 534 | Ga0316584_0154947 | 3300036712 | Bacteria | 1704 |
| 535 | Ga0316584_0192025 | 3300036712 | Bacteria | 1509 |
| 536 | Ga0395899_0208222 | 3300037312 | Unclassified | 1360 |
| 537 | Ga0395900_0014044 | 3300037418 | Bacteria | 8178 |
| 538 | Ga0395900_0055459 | 3300037418 | Bacteria | 4081 |
| 539 | Ga0395900_0069418 | 3300037418 | Unclassified | 3622 |
| 540 | Ga0395905_0000013 | 3300037471 | Bacteria | 400797 |
| 541 | Ga0395905_0000189 | 3300037471 | Bacteria | 97970 |
| 542 | Ga0395905_0000250 | 3300037471 | Bacteria | 80488 |
| 543 | Ga0395905_0003678 | 3300037471 | Bacteria | 16248 |
| 544 | Ga0395905_0009396 | 3300037471 | Bacteria | 9560 |
| 545 | Ga0395905_0010241 | 3300037471 | Bacteria | 9136 |
| 546 | Ga0395905_0033055 | 3300037471 | Bacteria | 4863 |
| 547 | Ga0395905_0061804 | 3300037471 | Bacteria | 3504 |
| 548 | Ga0395905_0321207 | 3300037471 | Bacteria | 1438 |
| 549 | Ga0395905_0451643 | 3300037471 | Unclassified | 1183 |
| 550 | Ga0316581_0029471 | 3300037588 | Bacteria | 1649 |
| 551 | Ga0395901_0359629 | 3300038443 | Bacteria | 1501 |
| 552 | Ga0436361_0061781 | 3300039447 | Bacteria | 2146 |
| 553 | Ga0439436_0000467 | 3300041404 | Bacteria | 10400 |
| 554 | Ga0439438_000199 | 3300041405 | Bacteria | 27351 |
| 555 | Ga0439438_001081 | 3300041405 | Bacteria | 12185 |
| 556 | Ga0439438_002280 | 3300041405 | Bacteria | 8223 |
| 557 | Ga0439438_003350 | 3300041405 | Bacteria | 6502 |
| 558 | Ga0439438_006671 | 3300041405 | Bacteria | 4037 |
| 559 | Ga0439438_007036 | 3300041405 | Bacteria | 3889 |
| 560 | Ga0439438_008145 | 3300041405 | Bacteria | 3506 |
| 561 | Ga0439438_009641 | 3300041405 | Bacteria | 3112 |
| 562 | Ga0439438_012124 | 3300041405 | Bacteria | 2655 |
| 563 | Ga0439438_017553 | 3300041405 | Bacteria | 2056 |
| 564 | Ga0439438_018179 | 3300041405 | Bacteria | 2007 |
| 565 | Ga0439438_018413 | 3300041405 | Bacteria | 1990 |
| 566 | Ga0439438_039559 | 3300041405 | Bacteria | 1228 |
| 567 | Ga0439438_040394 | 3300041405 | Bacteria | 1212 |
| 568 | Ga0439447_000861 | 3300041407 | Bacteria | 11143 |
| 569 | Ga0439447_002028 | 3300041407 | Bacteria | 7442 |
| 570 | Ga0439447_004405 | 3300041407 | Bacteria | 4852 |
| 571 | Ga0439447_005735 | 3300041407 | Bacteria | 4106 |
| 572 | Ga0439447_017548 | 3300041407 | Bacteria | 1947 |
| 573 | Ga0439447_030845 | 3300041407 | Bacteria | 1348 |
| 574 | Ga0439466_0000524 | 3300041411 | Bacteria | 14461 |
| 575 | Ga0439466_0000576 | 3300041411 | Bacteria | 13787 |
| 576 | Ga0439466_0003528 | 3300041411 | Bacteria | 6052 |
| 577 | Ga0439466_0004846 | 3300041411 | Bacteria | 5174 |
| 578 | Ga0439466_0009355 | 3300041411 | Bacteria | 3661 |
| 579 | Ga0439466_0009827 | 3300041411 | Bacteria | 3564 |
| 580 | Ga0439466_0011451 | 3300041411 | Bacteria | 3282 |
| 581 | Ga0439466_0012467 | 3300041411 | Bacteria | 3130 |
| 582 | Ga0439466_0021798 | 3300041411 | Bacteria | 2266 |
| 583 | Ga0439466_0024369 | 3300041411 | Bacteria | 2121 |
| 584 | Ga0439465_0016595 | 3300041413 | Bacteria | 2297 |
| 585 | Ga0439432_000453 | 3300042006 | Bacteria | 15287 |
| 586 | Ga0439432_002611 | 3300042006 | Bacteria | 6775 |
| 587 | Ga0439432_003737 | 3300042006 | Bacteria | 5624 |
| 588 | Ga0439432_003969 | 3300042006 | Bacteria | 5438 |
| 589 | Ga0439432_004712 | 3300042006 | Bacteria | 4966 |
| 590 | Ga0439432_013859 | 3300042006 | Bacteria | 2734 |
| 591 | Ga0439432_062703 | 3300042006 | Bacteria | 1143 |
| 592 | Ga0439432_064698 | 3300042006 | Bacteria | 1122 |
| 593 | Ga0439451_004554 | 3300042009 | Bacteria | 2821 |
| 594 | Ga0439451_006133 | 3300042009 | Bacteria | 2457 |
| 595 | Ga0439451_013115 | 3300042009 | Bacteria | 1674 |
| 596 | Ga0439451_013262 | 3300042009 | Bacteria | 1666 |
| 597 | Ga0439452_000385 | 3300042010 | Bacteria | 26357 |
| 598 | Ga0439452_000387 | 3300042010 | Bacteria | 26315 |
| 599 | Ga0439452_000902 | 3300042010 | Bacteria | 13558 |
| 600 | Ga0439452_001617 | 3300042010 | Bacteria | 8904 |
| 601 | Ga0439452_003120 | 3300042010 | Bacteria | 5877 |
| 602 | Ga0439452_013230 | 3300042010 | Bacteria | 2321 |
| 603 | Ga0439452_023243 | 3300042010 | Bacteria | 1596 |
| 604 | Ga0439452_024936 | 3300042010 | Bacteria | 1522 |
| 605 | Ga0439456_000112 | 3300042013 | Bacteria | 25773 |
| 606 | Ga0439456_001877 | 3300042013 | Bacteria | 4235 |
| 607 | Ga0439456_006368 | 3300042013 | Bacteria | 2408 |
| 608 | Ga0439456_012493 | 3300042013 | Bacteria | 1760 |
| 609 | Ga0439456_026847 | 3300042013 | Bacteria | 1225 |
| 610 | Ga0439456_028937 | 3300042013 | Bacteria | 1183 |
| 611 | Ga0439463_003967 | 3300042016 | Bacteria | 3727 |
| 612 | Ga0439463_005916 | 3300042016 | Bacteria | 3038 |
| 613 | Ga0439463_006484 | 3300042016 | Bacteria | 2900 |
| 614 | Ga0439463_024219 | 3300042016 | Bacteria | 1521 |
| 615 | Ga0439463_042289 | 3300042016 | Bacteria | 1158 |
| 616 | Ga0450911_000164 | 3300042115 | Bacteria | 26562 |
| 617 | Ga0450911_001185 | 3300042115 | Bacteria | 6364 |
| 618 | Ga0450911_002661 | 3300042115 | Bacteria | 3414 |
| 619 | Ga0450911_004135 | 3300042115 | Bacteria | 2422 |
| 620 | Ga0450911_004457 | 3300042115 | Bacteria | 2293 |
| 621 | Ga0450920_001490 | 3300042122 | Bacteria | 3879 |
| 622 | Ga0450922_000524 | 3300042124 | Bacteria | 4069 |
| 623 | Ga0450922_001234 | 3300042124 | Bacteria | 2532 |
| 624 | Ga0450890_000208 | 3300042127 | Bacteria | 8856 |
| 625 | Ga0450900_000339 | 3300042136 | Bacteria | 3458 |
| 626 | Ga0450900_005342 | 3300042136 | Bacteria | 1514 |
| 627 | Ga0450902_002208 | 3300042137 | Bacteria | 2743 |
| 628 | Ga0450902_018125 | 3300042137 | Bacteria | 1152 |
| 629 | Ga0450903_002755 | 3300042138 | Bacteria | 3097 |
| 630 | Ga0450903_005900 | 3300042138 | Bacteria | 2044 |
| 631 | Ga0450903_009029 | 3300042138 | Bacteria | 1628 |
| 632 | Ga0450904_001639 | 3300042139 | Bacteria | 3009 |
| 633 | Ga0450904_002044 | 3300042139 | Bacteria | 2539 |
| 634 | Ga0450905_000699 | 3300042142 | Bacteria | 4108 |
| 635 | Ga0450906_005166 | 3300042145 | Bacteria | 2702 |
| 636 | Ga0450907_000150 | 3300042146 | Bacteria | 26657 |
| 637 | Ga0450907_000551 | 3300042146 | Bacteria | 10185 |
| 638 | Ga0450907_001002 | 3300042146 | Bacteria | 6648 |
| 639 | Ga0450910_001623 | 3300042147 | Bacteria | 2870 |
| 640 | Ga0439446_0016919 | 3300042156 | Bacteria | 2034 |
| 641 | Ga0450909_010176 | 3300042185 | Bacteria | 1373 |
| 642 | Ga0439434_0001826 | 3300042435 | Bacteria | 6189 |
| 643 | Ga0439434_0005186 | 3300042435 | Bacteria | 3810 |
| 644 | Ga0439434_0014027 | 3300042435 | Bacteria | 2383 |
| 645 | Ga0439459_0000454 | 3300042438 | Bacteria | 5301 |
| 646 | Ga0439460_0017274 | 3300042461 | Bacteria | 1931 |
| 647 | Ga0450916_003223 | 3300042530 | Bacteria | 1780 |
| 648 | Ga0450918_003211 | 3300042531 | Bacteria | 3048 |
| 649 | Ga0450918_010522 | 3300042531 | Bacteria | 1614 |
| 650 | Ga0450901_000917 | 3300042533 | Bacteria | 3447 |
| 651 | Ga0451577_0000067 | 3300042876 | Bacteria | 250981 |
| 652 | Ga0451577_0163721 | 3300042876 | Bacteria | 2004 |
| 653 | Ga0439440_0006923 | 3300042993 | Bacteria | 2294 |
| 654 | Ga0453683_0003872 | 3300044673 | Bacteria | 10853 |
| 655 | Ga0453684_0000113 | 3300044712 | Bacteria | 359598 |
| 656 | Ga0453684_0000215 | 3300044712 | Bacteria | 250981 |
| 657 | Ga0453684_0014848 | 3300044712 | Bacteria | 12394 |
| 658 | Ga0453684_0022287 | 3300044712 | Bacteria | 9406 |
| 659 | Ga0453684_0093289 | 3300044712 | Bacteria | 3709 |
| 660 | Ga0466960_0014489 | 3300044901 | Bacteria | 3376 |
| 661 | Ga0451576_0000245 | 3300045051 | Bacteria | 133069 |
| 662 | Ga0451576_0001823 | 3300045051 | Bacteria | 34651 |
| 663 | Ga0451576_0004166 | 3300045051 | Bacteria | 19034 |
| 664 | Ga0451576_0260476 | 3300045051 | Bacteria | 1813 |
| 665 | Ga0466958_0228103 | 3300045836 | Bacteria | 1189 |
| 666 | Ga0466967_0455576 | 3300045976 | Unclassified | 1251 |
| 667 | Ga0495617_000491 | 3300046452 | Bacteria | 20909 |
| 668 | Ga0495617_001369 | 3300046452 | Bacteria | 10766 |
| 669 | Ga0495617_004672 | 3300046452 | Bacteria | 4953 |
| 670 | Ga0495617_007572 | 3300046452 | Bacteria | 3764 |
| 671 | Ga0495617_008183 | 3300046452 | Bacteria | 3611 |
| 672 | Ga0495617_010219 | 3300046452 | Bacteria | 3214 |
| 673 | Ga0495617_018006 | 3300046452 | Bacteria | 2388 |
| 674 | Ga0495617_018952 | 3300046452 | Bacteria | 2328 |
| 675 | Ga0495617_020715 | 3300046452 | Bacteria | 2222 |
| 676 | Ga0495617_021143 | 3300046452 | Bacteria | 2198 |
| 677 | Ga0495617_032926 | 3300046452 | Bacteria | 1740 |
| 678 | Ga0495617_043083 | 3300046452 | Bacteria | 1507 |
| 679 | Ga0495627_000130 | 3300046453 | Bacteria | 91090 |
| 680 | Ga0495627_000678 | 3300046453 | Bacteria | 26223 |
| 681 | Ga0495627_000738 | 3300046453 | Bacteria | 24598 |
| 682 | Ga0495627_012248 | 3300046453 | Bacteria | 3050 |
| 683 | Ga0495627_029220 | 3300046453 | Bacteria | 1755 |
| 684 | Ga0495627_032885 | 3300046453 | Bacteria | 1629 |
| 685 | Ga0495603_0001173 | 3300046455 | Bacteria | 15276 |
| 686 | Ga0495603_0074338 | 3300046455 | Bacteria | 1995 |
| 687 | Ga0495603_0133081 | 3300046455 | Bacteria | 1447 |
| 688 | Ga0495590_0001655 | 3300046457 | Bacteria | 9500 |
| 689 | Ga0495590_0002014 | 3300046457 | Bacteria | 8544 |
| 690 | Ga0495590_0002963 | 3300046457 | Bacteria | 6972 |
| 691 | Ga0495590_0003189 | 3300046457 | Bacteria | 6706 |
| 692 | Ga0495591_000583 | 3300046458 | Bacteria | 27745 |
| 693 | Ga0495591_000606 | 3300046458 | Bacteria | 27134 |
| 694 | Ga0495591_001733 | 3300046458 | Bacteria | 12997 |
| 695 | Ga0495591_001825 | 3300046458 | Bacteria | 12583 |
| 696 | Ga0495591_003562 | 3300046458 | Bacteria | 7954 |
| 697 | Ga0495591_004519 | 3300046458 | Bacteria | 6761 |
| 698 | Ga0495591_007562 | 3300046458 | Bacteria | 4597 |
| 699 | Ga0495591_010643 | 3300046458 | Bacteria | 3546 |
| 700 | Ga0495591_012722 | 3300046458 | Bacteria | 3116 |
| 701 | Ga0495591_013535 | 3300046458 | Bacteria | 2974 |
| 702 | Ga0495591_017861 | 3300046458 | Bacteria | 2422 |
| 703 | Ga0495591_020522 | 3300046458 | Bacteria | 2180 |
| 704 | Ga0495591_021474 | 3300046458 | Bacteria | 2105 |
| 705 | Ga0495591_044538 | 3300046458 | Bacteria | 1242 |
| 706 | Ga0495638_0002845 | 3300046460 | Bacteria | 13866 |
| 707 | Ga0495638_0009767 | 3300046460 | Bacteria | 6701 |
| 708 | Ga0495638_0013005 | 3300046460 | Bacteria | 5683 |
| 709 | Ga0495638_0022694 | 3300046460 | Bacteria | 4116 |
| 710 | Ga0495638_0035693 | 3300046460 | Bacteria | 3168 |
| 711 | Ga0495638_0038187 | 3300046460 | Bacteria | 3053 |
| 712 | Ga0495638_0041879 | 3300046460 | Bacteria | 2894 |
| 713 | Ga0495638_0043307 | 3300046460 | Bacteria | 2840 |
| 714 | Ga0495638_0043309 | 3300046460 | Bacteria | 2840 |
| 715 | Ga0495638_0043740 | 3300046460 | Bacteria | 2824 |
| 716 | Ga0495638_0058258 | 3300046460 | Bacteria | 2394 |
| 717 | Ga0495638_0077827 | 3300046460 | Bacteria | 2018 |
| 718 | Ga0495638_0123636 | 3300046460 | Bacteria | 1526 |
| 719 | Ga0495638_0183243 | 3300046460 | Bacteria | 1193 |
| 720 | Ga0495651_0019804 | 3300046462 | Bacteria | 5217 |
| 721 | Ga0495653_0006683 | 3300046463 | Bacteria | 9463 |
| 722 | Ga0495653_0137672 | 3300046463 | Bacteria | 1720 |
| 723 | Ga0495650_0001905 | 3300046471 | Bacteria | 18505 |
| 724 | Ga0495650_0006424 | 3300046471 | Bacteria | 7326 |
| 725 | Ga0495650_0007388 | 3300046471 | Bacteria | 6611 |
| 726 | Ga0495650_0007821 | 3300046471 | Bacteria | 6357 |
| 727 | Ga0495650_0008168 | 3300046471 | Bacteria | 6157 |
| 728 | Ga0495650_0008917 | 3300046471 | Bacteria | 5775 |
| 729 | Ga0495650_0009537 | 3300046471 | Bacteria | 5511 |
| 730 | Ga0495650_0022495 | 3300046471 | Bacteria | 3022 |
| 731 | Ga0495650_0025963 | 3300046471 | Bacteria | 2734 |
| 732 | Ga0495650_0041584 | 3300046471 | Bacteria | 1964 |
| 733 | Ga0495650_0061277 | 3300046471 | Bacteria | 1507 |
| 734 | Ga0495650_0061278 | 3300046471 | Bacteria | 1507 |
| 735 | Ga0495582_0023355 | 3300046473 | Bacteria | 3383 |
| 736 | Ga0495605_0000125 | 3300046474 | Bacteria | 101414 |
| 737 | Ga0495605_0000149 | 3300046474 | Bacteria | 90748 |
| 738 | Ga0495605_0000155 | 3300046474 | Bacteria | 88662 |
| 739 | Ga0495605_0002655 | 3300046474 | Bacteria | 10944 |
| 740 | Ga0495605_0012717 | 3300046474 | Bacteria | 4661 |
| 741 | Ga0495605_0016129 | 3300046474 | Bacteria | 4048 |
| 742 | Ga0495605_0020040 | 3300046474 | Bacteria | 3558 |
| 743 | Ga0495605_0029467 | 3300046474 | Bacteria | 2823 |
| 744 | Ga0495605_0030530 | 3300046474 | Bacteria | 2761 |
| 745 | Ga0495605_0035701 | 3300046474 | Bacteria | 2511 |
| 746 | Ga0495605_0037191 | 3300046474 | Bacteria | 2450 |
| 747 | Ga0495605_0038840 | 3300046474 | Bacteria | 2386 |
| 748 | Ga0495605_0053038 | 3300046474 | Bacteria | 1968 |
| 749 | Ga0495605_0067400 | 3300046474 | Bacteria | 1698 |
| 750 | Ga0495605_0090915 | 3300046474 | Bacteria | 1414 |
| 751 | Ga0495639_0001007 | 3300046475 | Bacteria | 12725 |
| 752 | Ga0495639_0022411 | 3300046475 | Bacteria | 2770 |
| 753 | Ga0495664_0067807 | 3300046477 | Bacteria | 2129 |
| 754 | Ga0495584_0003136 | 3300046491 | Bacteria | 9183 |
| 755 | Ga0495584_0003623 | 3300046491 | Bacteria | 8423 |
| 756 | Ga0495584_0005124 | 3300046491 | Bacteria | 6958 |
| 757 | Ga0495584_0018462 | 3300046491 | Bacteria | 3544 |
| 758 | Ga0495584_0022348 | 3300046491 | Bacteria | 3209 |
| 759 | Ga0495584_0023593 | 3300046491 | Bacteria | 3118 |
| 760 | Ga0495584_0029759 | 3300046491 | Bacteria | 2767 |
| 761 | Ga0495584_0030919 | 3300046491 | Bacteria | 2710 |
| 762 | Ga0495584_0033432 | 3300046491 | Bacteria | 2601 |
| 763 | Ga0495584_0040369 | 3300046491 | Bacteria | 2356 |
| 764 | Ga0495584_0040836 | 3300046491 | Bacteria | 2342 |
| 765 | Ga0495584_0047168 | 3300046491 | Bacteria | 2172 |
| 766 | Ga0495584_0121403 | 3300046491 | Bacteria | 1323 |
| 767 | Ga0495585_0003321 | 3300046492 | Bacteria | 10921 |
| 768 | Ga0495585_0011254 | 3300046492 | Bacteria | 5299 |
| 769 | Ga0495585_0017321 | 3300046492 | Bacteria | 4164 |
| 770 | Ga0495585_0021336 | 3300046492 | Bacteria | 3719 |
| 771 | Ga0495585_0026516 | 3300046492 | Bacteria | 3310 |
| 772 | Ga0495585_0030156 | 3300046492 | Bacteria | 3085 |
| 773 | Ga0495585_0036338 | 3300046492 | Bacteria | 2779 |
| 774 | Ga0495585_0050344 | 3300046492 | Bacteria | 2311 |
| 775 | Ga0495585_0054711 | 3300046492 | Bacteria | 2206 |
| 776 | Ga0495585_0063137 | 3300046492 | Bacteria | 2033 |
| 777 | Ga0495585_0090819 | 3300046492 | Bacteria | 1645 |
| 778 | Ga0495594_0000599 | 3300046499 | Bacteria | 18568 |
| 779 | Ga0495594_0031316 | 3300046499 | Bacteria | 2883 |
| 780 | Ga0495594_0061306 | 3300046499 | Bacteria | 2081 |
| 781 | Ga0495594_0067401 | 3300046499 | Bacteria | 1986 |
| 782 | Ga0495596_0000417 | 3300046500 | Bacteria | 27188 |
| 783 | Ga0495596_0016124 | 3300046500 | Bacteria | 3110 |
| 784 | Ga0495607_0000444 | 3300046501 | Bacteria | 41557 |
| 785 | Ga0495607_0001590 | 3300046501 | Bacteria | 19757 |
| 786 | Ga0495607_0003552 | 3300046501 | Bacteria | 11873 |
| 787 | Ga0495607_0004594 | 3300046501 | Bacteria | 10115 |
| 788 | Ga0495607_0005901 | 3300046501 | Bacteria | 8690 |
| 789 | Ga0495607_0007213 | 3300046501 | Bacteria | 7715 |
| 790 | Ga0495607_0007419 | 3300046501 | Bacteria | 7591 |
| 791 | Ga0495607_0008794 | 3300046501 | Bacteria | 6874 |
| 792 | Ga0495607_0012159 | 3300046501 | Bacteria | 5691 |
| 793 | Ga0495607_0014044 | 3300046501 | Bacteria | 5227 |
| 794 | Ga0495607_0018033 | 3300046501 | Bacteria | 4512 |
| 795 | Ga0495607_0020946 | 3300046501 | Bacteria | 4120 |
| 796 | Ga0495607_0024678 | 3300046501 | Bacteria | 3744 |
| 797 | Ga0495607_0037807 | 3300046501 | Bacteria | 2896 |
| 798 | Ga0495607_0060716 | 3300046501 | Bacteria | 2151 |
| 799 | Ga0495607_0123140 | 3300046501 | Bacteria | 1358 |
| 800 | Ga0495607_0168276 | 3300046501 | Bacteria | 1108 |
| 801 | Ga0495583_0000196 | 3300046506 | Bacteria | 101268 |
| 802 | Ga0495583_0001312 | 3300046506 | Bacteria | 25860 |
| 803 | Ga0495583_0001496 | 3300046506 | Bacteria | 23334 |
| 804 | Ga0495583_0002113 | 3300046506 | Bacteria | 17845 |
| 805 | Ga0495583_0002387 | 3300046506 | Bacteria | 16185 |
| 806 | Ga0495583_0003690 | 3300046506 | Bacteria | 11397 |
| 807 | Ga0495583_0006007 | 3300046506 | Bacteria | 8051 |
| 808 | Ga0495583_0016076 | 3300046506 | Bacteria | 4039 |
| 809 | Ga0495583_0018232 | 3300046506 | Bacteria | 3698 |
| 810 | Ga0495583_0021576 | 3300046506 | Bacteria | 3309 |
| 811 | Ga0495583_0039104 | 3300046506 | Bacteria | 2237 |
| 812 | Ga0495583_0044448 | 3300046506 | Bacteria | 2061 |
| 813 | Ga0495606_0000812 | 3300046507 | Bacteria | 47489 |
| 814 | Ga0495606_0004170 | 3300046507 | Bacteria | 14649 |
| 815 | Ga0495606_0004874 | 3300046507 | Bacteria | 13150 |
| 816 | Ga0495606_0005485 | 3300046507 | Bacteria | 12139 |
| 817 | Ga0495606_0012469 | 3300046507 | Bacteria | 6810 |
| 818 | Ga0495606_0012961 | 3300046507 | Bacteria | 6634 |
| 819 | Ga0495606_0019626 | 3300046507 | Bacteria | 5018 |
| 820 | Ga0495606_0035305 | 3300046507 | Bacteria | 3418 |
| 821 | Ga0495606_0038139 | 3300046507 | Bacteria | 3253 |
| 822 | Ga0495606_0050495 | 3300046507 | Bacteria | 2720 |
| 823 | Ga0495606_0071879 | 3300046507 | Bacteria | 2176 |
| 824 | Ga0495606_0084158 | 3300046507 | Bacteria | 1971 |
| 825 | Ga0495606_0132984 | 3300046507 | Bacteria | 1477 |
| 826 | Ga0495610_0002150 | 3300046512 | Bacteria | 16757 |
| 827 | Ga0495610_0004952 | 3300046512 | Bacteria | 9651 |
| 828 | Ga0495610_0005624 | 3300046512 | Bacteria | 8846 |
| 829 | Ga0495610_0006156 | 3300046512 | Bacteria | 8346 |
| 830 | Ga0495610_0012671 | 3300046512 | Bacteria | 5055 |
| 831 | Ga0495610_0017516 | 3300046512 | Bacteria | 4081 |
| 832 | Ga0495610_0018794 | 3300046512 | Bacteria | 3886 |
| 833 | Ga0495610_0050580 | 3300046512 | Bacteria | 2028 |
| 834 | Ga0495616_0000846 | 3300046513 | Bacteria | 22348 |
| 835 | Ga0495616_0002466 | 3300046513 | Bacteria | 12266 |
| 836 | Ga0495616_0006003 | 3300046513 | Bacteria | 7403 |
| 837 | Ga0495616_0015840 | 3300046513 | Bacteria | 4182 |
| 838 | Ga0495616_0017760 | 3300046513 | Bacteria | 3919 |
| 839 | Ga0495616_0022980 | 3300046513 | Bacteria | 3360 |
| 840 | Ga0495616_0025846 | 3300046513 | Bacteria | 3132 |
| 841 | Ga0495616_0035429 | 3300046513 | Bacteria | 2583 |
| 842 | Ga0495616_0046285 | 3300046513 | Bacteria | 2196 |
| 843 | Ga0495616_0070726 | 3300046513 | Bacteria | 1688 |
| 844 | Ga0495616_0094665 | 3300046513 | Bacteria | 1409 |
| 845 | Ga0495616_0134480 | 3300046513 | Bacteria | 1130 |
| 846 | Ga0495620_0000003 | 3300046515 | Bacteria | 345923 |
| 847 | Ga0495620_0000055 | 3300046515 | Bacteria | 99544 |
| 848 | Ga0495620_0000426 | 3300046515 | Bacteria | 28068 |
| 849 | Ga0495620_0002668 | 3300046515 | Bacteria | 10306 |
| 850 | Ga0495620_0016779 | 3300046515 | Bacteria | 3665 |
| 851 | Ga0495620_0016857 | 3300046515 | Bacteria | 3654 |
| 852 | Ga0495620_0018067 | 3300046515 | Bacteria | 3498 |
| 853 | Ga0495620_0024440 | 3300046515 | Bacteria | 2873 |
| 854 | Ga0495620_0027962 | 3300046515 | Bacteria | 2629 |
| 855 | Ga0495620_0028903 | 3300046515 | Bacteria | 2571 |
| 856 | Ga0495620_0030977 | 3300046515 | Bacteria | 2455 |
| 857 | Ga0495620_0031372 | 3300046515 | Bacteria | 2435 |
| 858 | Ga0495620_0035367 | 3300046515 | Bacteria | 2246 |
| 859 | Ga0495628_0124647 | 3300046516 | Bacteria | 1974 |
| 860 | Ga0495630_0059672 | 3300046517 | Bacteria | 2862 |
| 861 | Ga0495630_0106308 | 3300046517 | Bacteria | 2125 |
| 862 | Ga0495631_0000403 | 3300046518 | Bacteria | 29813 |
| 863 | Ga0495631_0002343 | 3300046518 | Bacteria | 10784 |
| 864 | Ga0495631_0003513 | 3300046518 | Bacteria | 8569 |
| 865 | Ga0495631_0010248 | 3300046518 | Bacteria | 4646 |
| 866 | Ga0495631_0014028 | 3300046518 | Bacteria | 3873 |
| 867 | Ga0495631_0045743 | 3300046518 | Bacteria | 1926 |
| 868 | Ga0495631_0050644 | 3300046518 | Bacteria | 1816 |
| 869 | Ga0495631_0075043 | 3300046518 | Bacteria | 1459 |
| 870 | Ga0495631_0087283 | 3300046518 | Bacteria | 1343 |
| 871 | Ga0495631_0094122 | 3300046518 | Bacteria | 1289 |
| 872 | Ga0495632_0001013 | 3300046519 | Bacteria | 24362 |
| 873 | Ga0495632_0001944 | 3300046519 | Bacteria | 16500 |
| 874 | Ga0495632_0003227 | 3300046519 | Bacteria | 11710 |
| 875 | Ga0495632_0003468 | 3300046519 | Bacteria | 11153 |
| 876 | Ga0495632_0003740 | 3300046519 | Bacteria | 10650 |
| 877 | Ga0495632_0008801 | 3300046519 | Bacteria | 6149 |
| 878 | Ga0495632_0013378 | 3300046519 | Bacteria | 4684 |
| 879 | Ga0495632_0016468 | 3300046519 | Bacteria | 4110 |
| 880 | Ga0495632_0022411 | 3300046519 | Bacteria | 3385 |
| 881 | Ga0495632_0024132 | 3300046519 | Bacteria | 3236 |
| 882 | Ga0495632_0027803 | 3300046519 | Bacteria | 2957 |
| 883 | Ga0495632_0028525 | 3300046519 | Bacteria | 2912 |
| 884 | Ga0495632_0038253 | 3300046519 | Bacteria | 2430 |
| 885 | Ga0495632_0041297 | 3300046519 | Bacteria | 2318 |
| 886 | Ga0495632_0043909 | 3300046519 | Bacteria | 2232 |
| 887 | Ga0495632_0081253 | 3300046519 | Bacteria | 1545 |
| 888 | Ga0495632_0089788 | 3300046519 | Bacteria | 1458 |
| 889 | Ga0495632_0094292 | 3300046519 | Bacteria | 1415 |
| 890 | Ga0495632_0144821 | 3300046519 | Bacteria | 1100 |
| 891 | Ga0495637_0000204 | 3300046520 | Bacteria | 46396 |
| 892 | Ga0495637_0000844 | 3300046520 | Bacteria | 20216 |
| 893 | Ga0495637_0002882 | 3300046520 | Bacteria | 9319 |
| 894 | Ga0495637_0003063 | 3300046520 | Bacteria | 8925 |
| 895 | Ga0495637_0003572 | 3300046520 | Bacteria | 8242 |
| 896 | Ga0495637_0003788 | 3300046520 | Bacteria | 7959 |
| 897 | Ga0495637_0011675 | 3300046520 | Bacteria | 4216 |
| 898 | Ga0495637_0014418 | 3300046520 | Bacteria | 3729 |
| 899 | Ga0495637_0017782 | 3300046520 | Bacteria | 3305 |
| 900 | Ga0495637_0024226 | 3300046520 | Bacteria | 2746 |
| 901 | Ga0495637_0025297 | 3300046520 | Bacteria | 2675 |
| 902 | Ga0495637_0028927 | 3300046520 | Bacteria | 2470 |
| 903 | Ga0495637_0035448 | 3300046520 | Bacteria | 2178 |
| 904 | Ga0495637_0035484 | 3300046520 | Bacteria | 2177 |
| 905 | Ga0495637_0044726 | 3300046520 | Bacteria | 1883 |
| 906 | Ga0495637_0053178 | 3300046520 | Bacteria | 1686 |
| 907 | Ga0495643_0000319 | 3300046522 | Bacteria | 66471 |
| 908 | Ga0495643_0005885 | 3300046522 | Bacteria | 8199 |
| 909 | Ga0495643_0006752 | 3300046522 | Bacteria | 7505 |
| 910 | Ga0495643_0006925 | 3300046522 | Bacteria | 7374 |
| 911 | Ga0495643_0008963 | 3300046522 | Bacteria | 6285 |
| 912 | Ga0495643_0009349 | 3300046522 | Bacteria | 6095 |
| 913 | Ga0495643_0043071 | 3300046522 | Bacteria | 2457 |
| 914 | Ga0495643_0045252 | 3300046522 | Bacteria | 2389 |
| 915 | Ga0495643_0052074 | 3300046522 | Bacteria | 2199 |
| 916 | Ga0495643_0071467 | 3300046522 | Bacteria | 1821 |
| 917 | Ga0495644_0000931 | 3300046523 | Bacteria | 12158 |
| 918 | Ga0495644_0004035 | 3300046523 | Bacteria | 5776 |
| 919 | Ga0495644_0007984 | 3300046523 | Bacteria | 4071 |
| 920 | Ga0495644_0021435 | 3300046523 | Bacteria | 2465 |
| 921 | Ga0495644_0037358 | 3300046523 | Bacteria | 1832 |
| 922 | Ga0495644_0053304 | 3300046523 | Bacteria | 1519 |
| 923 | Ga0495644_0061190 | 3300046523 | Bacteria | 1415 |
| 924 | Ga0495648_0002744 | 3300046524 | Bacteria | 15903 |
| 925 | Ga0495648_0003294 | 3300046524 | Bacteria | 14266 |
| 926 | Ga0495648_0006599 | 3300046524 | Bacteria | 9428 |
| 927 | Ga0495648_0006625 | 3300046524 | Bacteria | 9391 |
| 928 | Ga0495648_0010717 | 3300046524 | Bacteria | 6961 |
| 929 | Ga0495648_0012418 | 3300046524 | Bacteria | 6356 |
| 930 | Ga0495648_0013998 | 3300046524 | Bacteria | 5900 |
| 931 | Ga0495648_0018685 | 3300046524 | Bacteria | 4896 |
| 932 | Ga0495648_0019694 | 3300046524 | Bacteria | 4732 |
| 933 | Ga0495648_0024066 | 3300046524 | Bacteria | 4156 |
| 934 | Ga0495648_0028466 | 3300046524 | Bacteria | 3721 |
| 935 | Ga0495648_0036735 | 3300046524 | Bacteria | 3155 |
| 936 | Ga0495648_0041162 | 3300046524 | Bacteria | 2921 |
| 937 | Ga0495648_0058881 | 3300046524 | Bacteria | 2294 |
| 938 | Ga0495648_0060300 | 3300046524 | Bacteria | 2258 |
| 939 | Ga0495648_0064793 | 3300046524 | Bacteria | 2151 |
| 940 | Ga0495648_0076387 | 3300046524 | Bacteria | 1923 |
| 941 | Ga0495648_0091035 | 3300046524 | Bacteria | 1707 |
| 942 | Ga0495648_0099124 | 3300046524 | Bacteria | 1613 |
| 943 | Ga0495648_0103052 | 3300046524 | Bacteria | 1570 |
| 944 | Ga0495666_0014798 | 3300046526 | Bacteria | 3882 |
| 945 | Ga0495642_0000324 | 3300046528 | Bacteria | 26064 |
| 946 | Ga0495642_0003106 | 3300046528 | Bacteria | 6591 |
| 947 | Ga0495642_0008500 | 3300046528 | Bacteria | 3927 |
| 948 | Ga0495654_0001040 | 3300046530 | Bacteria | 20303 |
| 949 | Ga0495654_0002193 | 3300046530 | Bacteria | 12663 |
| 950 | Ga0495654_0002384 | 3300046530 | Bacteria | 12121 |
| 951 | Ga0495654_0005540 | 3300046530 | Bacteria | 7316 |
| 952 | Ga0495654_0006257 | 3300046530 | Bacteria | 6779 |
| 953 | Ga0495654_0011815 | 3300046530 | Bacteria | 4714 |
| 954 | Ga0495654_0012813 | 3300046530 | Bacteria | 4497 |
| 955 | Ga0495654_0013376 | 3300046530 | Bacteria | 4392 |
| 956 | Ga0495654_0014747 | 3300046530 | Bacteria | 4155 |
| 957 | Ga0495654_0022694 | 3300046530 | Bacteria | 3255 |
| 958 | Ga0495654_0023244 | 3300046530 | Bacteria | 3211 |
| 959 | Ga0495654_0024300 | 3300046530 | Bacteria | 3132 |
| 960 | Ga0495654_0033992 | 3300046530 | Bacteria | 2576 |
| 961 | Ga0495654_0037775 | 3300046530 | Bacteria | 2418 |
| 962 | Ga0495654_0038555 | 3300046530 | Bacteria | 2389 |
| 963 | Ga0495654_0046495 | 3300046530 | Bacteria | 2137 |
| 964 | Ga0495654_0048135 | 3300046530 | Bacteria | 2093 |
| 965 | Ga0495654_0058316 | 3300046530 | Bacteria | 1863 |
| 966 | Ga0495654_0097278 | 3300046530 | Bacteria | 1359 |
| 967 | Ga0495586_0035029 | 3300046535 | Bacteria | 2696 |
| 968 | Ga0495587_0001552 | 3300046536 | Bacteria | 15274 |
| 969 | Ga0495587_0040276 | 3300046536 | Bacteria | 2793 |
| 970 | Ga0495609_0000087 | 3300046538 | Bacteria | 110204 |
| 971 | Ga0495609_0000141 | 3300046538 | Bacteria | 75953 |
| 972 | Ga0495609_0000412 | 3300046538 | Bacteria | 35828 |
| 973 | Ga0495609_0002027 | 3300046538 | Bacteria | 12787 |
| 974 | Ga0495609_0014786 | 3300046538 | Bacteria | 3663 |
| 975 | Ga0495609_0031227 | 3300046538 | Bacteria | 2422 |
| 976 | Ga0495609_0034887 | 3300046538 | Bacteria | 2279 |
| 977 | Ga0495609_0076195 | 3300046538 | Bacteria | 1470 |
| 978 | Ga0495597_0000097 | 3300046542 | Bacteria | 78347 |
| 979 | Ga0495597_0001638 | 3300046542 | Bacteria | 15663 |
| 980 | Ga0495597_0005980 | 3300046542 | Bacteria | 6348 |
| 981 | Ga0495597_0009054 | 3300046542 | Bacteria | 4945 |
| 982 | Ga0495597_0014297 | 3300046542 | Bacteria | 3781 |
| 983 | Ga0495597_0014532 | 3300046542 | Bacteria | 3745 |
| 984 | Ga0495597_0022179 | 3300046542 | Bacteria | 2947 |
| 985 | Ga0495597_0028619 | 3300046542 | Bacteria | 2549 |
| 986 | Ga0495597_0031562 | 3300046542 | Bacteria | 2409 |
| 987 | Ga0495597_0037741 | 3300046542 | Bacteria | 2169 |
| 988 | Ga0495597_0041823 | 3300046542 | Bacteria | 2045 |
| 989 | Ga0495597_0053787 | 3300046542 | Bacteria | 1769 |
| 990 | Ga0495597_0058525 | 3300046542 | Bacteria | 1684 |
| 991 | Ga0495597_0080423 | 3300046542 | Bacteria | 1394 |
| 992 | Ga0495645_0057903 | 3300046543 | Bacteria | 2812 |
| 993 | Ga0495622_0001580 | 3300046557 | Bacteria | 11264 |
| 994 | Ga0495622_0001672 | 3300046557 | Bacteria | 10975 |
| 995 | Ga0495622_0002250 | 3300046557 | Bacteria | 9392 |
| 996 | Ga0495622_0020630 | 3300046557 | Bacteria | 3069 |
| 997 | Ga0495633_0000134 | 3300046558 | Bacteria | 98658 |
| 998 | Ga0495633_0006724 | 3300046558 | Bacteria | 6768 |
| 999 | Ga0495633_0011897 | 3300046558 | Bacteria | 4660 |
| 1000 | Ga0495656_0002042 | 3300046615 | Bacteria | 6650 |
| 1001 | Ga0495668_0003191 | 3300046616 | Bacteria | 12557 |
| 1002 | Ga0495668_0003494 | 3300046616 | Bacteria | 11721 |
| 1003 | Ga0495668_0042934 | 3300046616 | Bacteria | 2515 |
| 1004 | Ga0495668_0044303 | 3300046616 | Bacteria | 2473 |
| 1005 | Ga0495668_0046545 | 3300046616 | Bacteria | 2409 |
| 1006 | Ga0495634_0004253 | 3300046642 | Bacteria | 11290 |
| 1007 | Ga0495634_0062713 | 3300046642 | Bacteria | 2468 |
| 1008 | Ga0495611_0000518 | 3300046648 | Bacteria | 22917 |
| 1009 | Ga0495611_0001167 | 3300046648 | Bacteria | 13700 |
| 1010 | Ga0495611_0002390 | 3300046648 | Bacteria | 8637 |
| 1011 | Ga0495611_0034414 | 3300046648 | Bacteria | 2239 |
| 1012 | Ga0495611_0042599 | 3300046648 | Bacteria | 2027 |
| 1013 | Ga0495611_0053707 | 3300046648 | Bacteria | 1819 |
| 1014 | Ga0495625_0000145 | 3300046660 | Bacteria | 108480 |
| 1015 | Ga0495625_0008796 | 3300046660 | Bacteria | 8550 |
| 1016 | Ga0495625_0010198 | 3300046660 | Bacteria | 7797 |
| 1017 | Ga0495625_0020848 | 3300046660 | Bacteria | 5053 |
| 1018 | Ga0495625_0022935 | 3300046660 | Bacteria | 4775 |
| 1019 | Ga0495625_0031393 | 3300046660 | Bacteria | 3952 |
| 1020 | Ga0495625_0052272 | 3300046660 | Bacteria | 2926 |
| 1021 | Ga0495625_0055240 | 3300046660 | Bacteria | 2832 |
| 1022 | Ga0495625_0108718 | 3300046660 | Bacteria | 1897 |
| 1023 | Ga0495625_0139380 | 3300046660 | Bacteria | 1637 |
| 1024 | Ga0495625_0206656 | 3300046660 | Bacteria | 1293 |
| 1025 | Ga0495635_0017140 | 3300046663 | Bacteria | 5058 |
| 1026 | Ga0495635_0017323 | 3300046663 | Bacteria | 5033 |
| 1027 | Ga0495659_0000880 | 3300046664 | Bacteria | 10670 |
| 1028 | Ga0495659_0014805 | 3300046664 | Bacteria | 2558 |
| 1029 | Ga0495659_0041933 | 3300046664 | Bacteria | 1636 |
| 1030 | Ga0495661_0000193 | 3300046665 | Bacteria | 70300 |
| 1031 | Ga0495661_0000332 | 3300046665 | Bacteria | 51357 |
| 1032 | Ga0495661_0000434 | 3300046665 | Bacteria | 44139 |
| 1033 | Ga0495661_0000961 | 3300046665 | Bacteria | 26164 |
| 1034 | Ga0495661_0009351 | 3300046665 | Bacteria | 6728 |
| 1035 | Ga0495661_0018326 | 3300046665 | Bacteria | 4607 |
| 1036 | Ga0495661_0020927 | 3300046665 | Bacteria | 4266 |
| 1037 | Ga0495661_0035857 | 3300046665 | Bacteria | 3109 |
| 1038 | Ga0495661_0038010 | 3300046665 | Bacteria | 3002 |
| 1039 | Ga0495661_0049579 | 3300046665 | Bacteria | 2545 |
| 1040 | Ga0495661_0050211 | 3300046665 | Bacteria | 2526 |
| 1041 | Ga0495661_0050909 | 3300046665 | Bacteria | 2504 |
| 1042 | Ga0495661_0057437 | 3300046665 | Bacteria | 2323 |
| 1043 | Ga0495588_0013970 | 3300046674 | Bacteria | 3835 |
| 1044 | Ga0495588_0014483 | 3300046674 | Bacteria | 3775 |
| 1045 | Ga0495623_0005516 | 3300046679 | Bacteria | 8262 |
| 1046 | Ga0495623_0021429 | 3300046679 | Bacteria | 4172 |
| 1047 | Ga0495646_0010680 | 3300046680 | Bacteria | 5834 |
| 1048 | Ga0495646_0016771 | 3300046680 | Bacteria | 4651 |
| 1049 | Ga0495646_0079342 | 3300046680 | Bacteria | 1916 |
| 1050 | Ga0495669_0006925 | 3300046684 | Bacteria | 4749 |
| 1051 | Ga0495613_0061386 | 3300046689 | Bacteria | 2752 |
| 1052 | Ga0495613_0124318 | 3300046689 | Bacteria | 1851 |
| 1053 | Ga0495613_0125086 | 3300046689 | Bacteria | 1844 |
| 1054 | Ga0495624_0004697 | 3300046690 | Bacteria | 9945 |
| 1055 | Ga0495670_0001238 | 3300046691 | Bacteria | 12451 |
| 1056 | Ga0495670_0002916 | 3300046691 | Bacteria | 8428 |
| 1057 | Ga0495670_0003785 | 3300046691 | Bacteria | 7435 |
| 1058 | Ga0495670_0016065 | 3300046691 | Bacteria | 3679 |
| 1059 | Ga0495670_0016658 | 3300046691 | Bacteria | 3614 |
| 1060 | Ga0495670_0028083 | 3300046691 | Bacteria | 2788 |
| 1061 | Ga0495670_0036366 | 3300046691 | Bacteria | 2453 |
| 1062 | Ga0495670_0049170 | 3300046691 | Bacteria | 2109 |
| 1063 | Ga0495670_0139802 | 3300046691 | Bacteria | 1266 |
| 1064 | Ga0495670_0148032 | 3300046691 | Bacteria | 1230 |
| 1065 | Ga0495671_0003100 | 3300046692 | Bacteria | 10333 |
| 1066 | Ga0495671_0004392 | 3300046692 | Bacteria | 8442 |
| 1067 | Ga0495671_0007792 | 3300046692 | Bacteria | 6064 |
| 1068 | Ga0495671_0012860 | 3300046692 | Bacteria | 4555 |
| 1069 | Ga0495671_0019690 | 3300046692 | Bacteria | 3562 |
| 1070 | Ga0495671_0022847 | 3300046692 | Bacteria | 3271 |
| 1071 | Ga0495671_0029469 | 3300046692 | Bacteria | 2818 |
| 1072 | Ga0495671_0033590 | 3300046692 | Bacteria | 2612 |
| 1073 | Ga0495671_0046790 | 3300046692 | Bacteria | 2162 |
| 1074 | Ga0495671_0070407 | 3300046692 | Bacteria | 1718 |
| 1075 | Ga0495671_0086623 | 3300046692 | Bacteria | 1534 |
| 1076 | Ga0495671_0117081 | 3300046692 | Bacteria | 1300 |
| 1077 | Ga0495671_0148663 | 3300046692 | Bacteria | 1140 |
| 1078 | Ga0495671_0148669 | 3300046692 | Bacteria | 1140 |
| 1079 | Ga0495649_0002318 | 3300046694 | Bacteria | 13492 |
| 1080 | Ga0495649_0006225 | 3300046694 | Bacteria | 7442 |
| 1081 | Ga0495649_0023398 | 3300046694 | Bacteria | 3452 |
| 1082 | Ga0495649_0024703 | 3300046694 | Bacteria | 3350 |
| 1083 | Ga0495649_0029524 | 3300046694 | Bacteria | 3032 |
| 1084 | Ga0495649_0032639 | 3300046694 | Bacteria | 2867 |
| 1085 | Ga0495649_0044463 | 3300046694 | Bacteria | 2424 |
| 1086 | Ga0495649_0079465 | 3300046694 | Bacteria | 1754 |
| 1087 | Ga0495649_0099761 | 3300046694 | Bacteria | 1544 |
| 1088 | Ga0495649_0128680 | 3300046694 | Bacteria | 1336 |
| 1089 | Ga0495589_0000447 | 3300046794 | Bacteria | 30382 |
| 1090 | Ga0495589_0000771 | 3300046794 | Bacteria | 20448 |
| 1091 | Ga0495589_0001962 | 3300046794 | Bacteria | 11644 |
| 1092 | Ga0495589_0004203 | 3300046794 | Bacteria | 7702 |
| 1093 | Ga0495589_0009641 | 3300046794 | Bacteria | 5020 |
| 1094 | Ga0495589_0011083 | 3300046794 | Bacteria | 4677 |
| 1095 | Ga0495589_0016468 | 3300046794 | Bacteria | 3800 |
| 1096 | Ga0495589_0026703 | 3300046794 | Bacteria | 2924 |
| 1097 | Ga0495589_0030092 | 3300046794 | Bacteria | 2735 |
| 1098 | Ga0495589_0052246 | 3300046794 | Bacteria | 2019 |
| 1099 | Ga0495589_0061380 | 3300046794 | Bacteria | 1845 |
| 1100 | Ga0495600_0038024 | 3300046809 | Bacteria | 3130 |
| 1101 | Ga0495600_0079784 | 3300046809 | Bacteria | 2136 |
| 1102 | Ga0495660_0002230 | 3300046810 | Bacteria | 12466 |
| 1103 | Ga0495660_0005722 | 3300046810 | Bacteria | 7422 |
| 1104 | Ga0495660_0006186 | 3300046810 | Bacteria | 7105 |
| 1105 | Ga0495660_0006552 | 3300046810 | Bacteria | 6878 |
| 1106 | Ga0495660_0007890 | 3300046810 | Bacteria | 6249 |
| 1107 | Ga0495660_0012026 | 3300046810 | Bacteria | 5019 |
| 1108 | Ga0495660_0017076 | 3300046810 | Bacteria | 4179 |
| 1109 | Ga0495660_0024783 | 3300046810 | Bacteria | 3414 |
| 1110 | Ga0495660_0031821 | 3300046810 | Bacteria | 2964 |
| 1111 | Ga0495660_0034262 | 3300046810 | Bacteria | 2842 |
| 1112 | Ga0495660_0051114 | 3300046810 | Bacteria | 2249 |
| 1113 | Ga0495660_0055197 | 3300046810 | Bacteria | 2151 |
| 1114 | Ga0495660_0077244 | 3300046810 | Bacteria | 1752 |
| 1115 | Ga0495660_0094427 | 3300046810 | Bacteria | 1549 |
| 1116 | Ga0495660_0125275 | 3300046810 | Bacteria | 1294 |
| 1117 | Ga0495581_0034967 | 3300047315 | Bacteria | 2907 |
| 1118 | Ga0495581_0065403 | 3300047315 | Bacteria | 2102 |
| 1119 | Ga0495604_0001553 | 3300047317 | Bacteria | 18920 |
| 1120 | Ga0495604_0015101 | 3300047317 | Bacteria | 6161 |
| 1121 | Ga0495604_0039934 | 3300047317 | Bacteria | 3686 |
| 1122 | Ga0495604_0154785 | 3300047317 | Bacteria | 1625 |
| 1123 | Ga0495636_0020991 | 3300047318 | Bacteria | 2634 |
| 1124 | Ga0495636_0113760 | 3300047318 | Bacteria | 1192 |
| 1125 | Ga0495674_0006015 | 3300047319 | Bacteria | 11653 |
| 1126 | Ga0495674_0018109 | 3300047319 | Bacteria | 6557 |
| 1127 | Ga0495672_0001160 | 3300047320 | Bacteria | 26644 |
| 1128 | Ga0495672_0003146 | 3300047320 | Bacteria | 14369 |
| 1129 | Ga0495672_0004514 | 3300047320 | Bacteria | 11361 |
| 1130 | Ga0495672_0005570 | 3300047320 | Bacteria | 9956 |
| 1131 | Ga0495672_0008825 | 3300047320 | Bacteria | 7380 |
| 1132 | Ga0495672_0009039 | 3300047320 | Bacteria | 7264 |
| 1133 | Ga0495672_0010698 | 3300047320 | Bacteria | 6514 |
| 1134 | Ga0495672_0016503 | 3300047320 | Bacteria | 4972 |
| 1135 | Ga0495672_0019211 | 3300047320 | Bacteria | 4513 |
| 1136 | Ga0495672_0025656 | 3300047320 | Bacteria | 3767 |
| 1137 | Ga0495672_0026505 | 3300047320 | Bacteria | 3698 |
| 1138 | Ga0495672_0032346 | 3300047320 | Bacteria | 3256 |
| 1139 | Ga0495672_0045302 | 3300047320 | Bacteria | 2632 |
| 1140 | Ga0495672_0045814 | 3300047320 | Bacteria | 2613 |
| 1141 | Ga0495672_0058990 | 3300047320 | Bacteria | 2222 |
| 1142 | Ga0495672_0114778 | 3300047320 | Bacteria | 1440 |
| 1143 | Ga0495672_0139855 | 3300047320 | Bacteria | 1265 |
| 1144 | Ga0495676_0000198 | 3300047321 | Bacteria | 47538 |
| 1145 | Ga0495676_0013241 | 3300047321 | Bacteria | 7416 |
| 1146 | Ga0495676_0013298 | 3300047321 | Bacteria | 7397 |
| 1147 | Ga0495680_0003997 | 3300047322 | Bacteria | 14242 |
| 1148 | Ga0495680_0026023 | 3300047322 | Bacteria | 4831 |
| 1149 | Ga0495680_0073182 | 3300047322 | Bacteria | 2605 |
| 1150 | Ga0495680_0135828 | 3300047322 | Bacteria | 1803 |
| 1151 | Ga0495683_0000095 | 3300047323 | Bacteria | 89824 |
| 1152 | Ga0495683_0000518 | 3300047323 | Bacteria | 29629 |
| 1153 | Ga0495683_0005438 | 3300047323 | Bacteria | 7068 |
| 1154 | Ga0495683_0010889 | 3300047323 | Bacteria | 4795 |
| 1155 | Ga0495683_0022912 | 3300047323 | Bacteria | 3211 |
| 1156 | Ga0495683_0035744 | 3300047323 | Bacteria | 2525 |
| 1157 | Ga0495683_0045918 | 3300047323 | Bacteria | 2193 |
| 1158 | Ga0495683_0057272 | 3300047323 | Bacteria | 1937 |
| 1159 | Ga0495683_0069118 | 3300047323 | Bacteria | 1736 |
| 1160 | Ga0495683_0096408 | 3300047323 | Bacteria | 1427 |
| 1161 | Ga0495687_000169 | 3300047443 | Bacteria | 97243 |
| 1162 | Ga0495687_003637 | 3300047443 | Bacteria | 11002 |
| 1163 | Ga0495687_007816 | 3300047443 | Bacteria | 6225 |
| 1164 | Ga0495687_014114 | 3300047443 | Bacteria | 4129 |
| 1165 | Ga0495677_0008145 | 3300047445 | Bacteria | 3891 |
| 1166 | Ga0495679_000511 | 3300047446 | Bacteria | 27627 |
| 1167 | Ga0495679_001251 | 3300047446 | Bacteria | 15040 |
| 1168 | Ga0495679_004466 | 3300047446 | Bacteria | 6438 |
| 1169 | Ga0495679_008541 | 3300047446 | Bacteria | 4155 |
| 1170 | Ga0495679_012912 | 3300047446 | Bacteria | 3158 |
| 1171 | Ga0495679_018784 | 3300047446 | Bacteria | 2444 |
| 1172 | Ga0495679_029101 | 3300047446 | Bacteria | 1804 |
| 1173 | Ga0495679_034807 | 3300047446 | Bacteria | 1600 |
| 1174 | Ga0495679_050817 | 3300047446 | Bacteria | 1245 |
| 1175 | Ga0495685_058451 | 3300047447 | Bacteria | 1301 |
| 1176 | Ga0495673_0000790 | 3300047469 | Bacteria | 29784 |
| 1177 | Ga0495673_0000979 | 3300047469 | Bacteria | 25628 |
| 1178 | Ga0495673_0001198 | 3300047469 | Bacteria | 21631 |
| 1179 | Ga0495673_0001573 | 3300047469 | Bacteria | 17895 |
| 1180 | Ga0495673_0001605 | 3300047469 | Bacteria | 17595 |
| 1181 | Ga0495673_0001783 | 3300047469 | Bacteria | 16344 |
| 1182 | Ga0495673_0002737 | 3300047469 | Bacteria | 12081 |
| 1183 | Ga0495673_0005607 | 3300047469 | Bacteria | 7553 |
| 1184 | Ga0495673_0009482 | 3300047469 | Bacteria | 5388 |
| 1185 | Ga0495673_0016016 | 3300047469 | Bacteria | 3846 |
| 1186 | Ga0495673_0020049 | 3300047469 | Bacteria | 3335 |
| 1187 | Ga0495673_0022149 | 3300047469 | Bacteria | 3119 |
| 1188 | Ga0495673_0024116 | 3300047469 | Bacteria | 2946 |
| 1189 | Ga0495673_0024832 | 3300047469 | Bacteria | 2887 |
| 1190 | Ga0495673_0026259 | 3300047469 | Bacteria | 2786 |
| 1191 | Ga0495673_0038270 | 3300047469 | Bacteria | 2183 |
| 1192 | Ga0495673_0040801 | 3300047469 | Bacteria | 2093 |
| 1193 | Ga0495673_0042517 | 3300047469 | Bacteria | 2039 |
| 1194 | Ga0495673_0049216 | 3300047469 | Bacteria | 1855 |
| 1195 | Ga0495673_0054301 | 3300047469 | Bacteria | 1742 |
| 1196 | Ga0495673_0062620 | 3300047469 | Bacteria | 1588 |
| 1197 | Ga0495673_0064290 | 3300047469 | Bacteria | 1561 |
| 1198 | Ga0495673_0069974 | 3300047469 | Bacteria | 1479 |
| 1199 | Ga0495673_0072252 | 3300047469 | Bacteria | 1448 |
| 1200 | Ga0495681_0000096 | 3300047470 | Bacteria | 76473 |
| 1201 | Ga0495681_0001286 | 3300047470 | Bacteria | 19000 |
| 1202 | Ga0495681_0003091 | 3300047470 | Bacteria | 11668 |
| 1203 | Ga0495681_0003471 | 3300047470 | Bacteria | 10960 |
| 1204 | Ga0495681_0005125 | 3300047470 | Bacteria | 8831 |
| 1205 | Ga0495681_0006191 | 3300047470 | Bacteria | 7892 |
| 1206 | Ga0495681_0012187 | 3300047470 | Bacteria | 5066 |
| 1207 | Ga0495681_0012740 | 3300047470 | Bacteria | 4922 |
| 1208 | Ga0495681_0013863 | 3300047470 | Bacteria | 4658 |
| 1209 | Ga0495681_0015876 | 3300047470 | Bacteria | 4249 |
| 1210 | Ga0495681_0019702 | 3300047470 | Bacteria | 3675 |
| 1211 | Ga0495681_0020155 | 3300047470 | Bacteria | 3622 |
| 1212 | Ga0495681_0027964 | 3300047470 | Bacteria | 2909 |
| 1213 | Ga0495681_0041036 | 3300047470 | Bacteria | 2249 |
| 1214 | Ga0495681_0045766 | 3300047470 | Bacteria | 2091 |
| 1215 | Ga0495681_0059365 | 3300047470 | Bacteria | 1769 |
| 1216 | Ga0495681_0101705 | 3300047470 | Bacteria | 1255 |
| 1217 | Ga0495684_0063127 | 3300047471 | Bacteria | 2817 |
| 1218 | Ga0495684_0241063 | 3300047471 | Bacteria | 1319 |
| 1219 | Ga0495686_0000002 | 3300047472 | Bacteria | 1050777 |
| 1220 | Ga0495686_0013800 | 3300047472 | Bacteria | 5597 |
| 1221 | Ga0495686_0016524 | 3300047472 | Bacteria | 5003 |
| 1222 | Ga0495686_0046404 | 3300047472 | Bacteria | 2746 |
| 1223 | Ga0495686_0046757 | 3300047472 | Bacteria | 2734 |
| 1224 | Ga0495593_0005650 | 3300047673 | Bacteria | 7382 |
| 1225 | Ga0495593_0053131 | 3300047673 | Bacteria | 2138 |
| 1226 | Ga0495593_0056236 | 3300047673 | Bacteria | 2069 |
| 1227 | Ga0495593_0147256 | 3300047673 | Bacteria | 1191 |
| 1228 | Ga0495602_0027272 | 3300048088 | Bacteria | 5491 |
| 1229 | Ga0495626_0000372 | 3300048091 | Bacteria | 46880 |
| 1230 | Ga0495626_0000869 | 3300048091 | Bacteria | 26839 |
| 1231 | Ga0495626_0001573 | 3300048091 | Bacteria | 17887 |
| 1232 | Ga0495626_0002679 | 3300048091 | Bacteria | 12038 |
| 1233 | Ga0495626_0003121 | 3300048091 | Bacteria | 10849 |
| 1234 | Ga0495626_0003172 | 3300048091 | Bacteria | 10710 |
| 1235 | Ga0495626_0005316 | 3300048091 | Bacteria | 7589 |
| 1236 | Ga0495626_0005972 | 3300048091 | Bacteria | 7005 |
| 1237 | Ga0495626_0008011 | 3300048091 | Bacteria | 5836 |
| 1238 | Ga0495626_0009785 | 3300048091 | Bacteria | 5160 |
| 1239 | Ga0495626_0016847 | 3300048091 | Bacteria | 3703 |
| 1240 | Ga0495626_0018036 | 3300048091 | Bacteria | 3554 |
| 1241 | Ga0495626_0036071 | 3300048091 | Bacteria | 2357 |
| 1242 | Ga0495626_0039664 | 3300048091 | Bacteria | 2227 |
| 1243 | Ga0495626_0080728 | 3300048091 | Bacteria | 1445 |
| 1244 | Ga0496102_0003755 | 3300048905 | Bacteria | 12838 |
| 1245 | Ga0496103_0008439 | 3300048906 | Bacteria | 6119 |
| 1246 | Ga0496106_0000067 | 3300048909 | Bacteria | 83475 |
| 1247 | Ga0496106_0158213 | 3300048909 | Bacteria | 1790 |
| 1248 | Ga0496109_0000208 | 3300048912 | Bacteria | 57821 |
| 1249 | Ga0496110_0062813 | 3300048913 | Bacteria | 3281 |
| 1250 | Ga0496110_0115517 | 3300048913 | Bacteria | 2416 |
| 1251 | Ga0496110_0237594 | 3300048913 | Bacteria | 1658 |
| 1252 | Ga0496112_0066333 | 3300048915 | Bacteria | 3561 |
| 1253 | Ga0496112_0551740 | 3300048915 | Bacteria | 1086 |
| 1254 | Ga0496114_0055653 | 3300048917 | Bacteria | 3300 |
| 1255 | Ga0496114_0366907 | 3300048917 | Bacteria | 1274 |
| 1256 | Ga0496115_0137956 | 3300048918 | Unclassified | 2011 |
| 1257 | Ga0496115_0182534 | 3300048918 | Bacteria | 1734 |
| 1258 | Ga0496116_0000017 | 3300048919 | Bacteria | 554463 |
| 1259 | Ga0496116_0000825 | 3300048919 | Bacteria | 39115 |
| 1260 | Ga0496116_0003367 | 3300048919 | Bacteria | 15867 |
| 1261 | Ga0496116_0039119 | 3300048919 | Bacteria | 3282 |
| 1262 | Ga0496116_0050155 | 3300048919 | Bacteria | 2783 |
| 1263 | Ga0496116_0051786 | 3300048919 | Unclassified | 2724 |
| 1264 | Ga0496117_0001387 | 3300048920 | Bacteria | 35141 |
| 1265 | Ga0496117_0014011 | 3300048920 | Bacteria | 6939 |
| 1266 | Ga0496117_0016798 | 3300048920 | Bacteria | 6150 |
| 1267 | Ga0496117_0022003 | 3300048920 | Bacteria | 5128 |
| 1268 | Ga0496117_0029470 | 3300048920 | Bacteria | 4230 |
| 1269 | Ga0496117_0029800 | 3300048920 | Bacteria | 4200 |
| 1270 | Ga0496117_0031689 | 3300048920 | Bacteria | 4031 |
| 1271 | Ga0496117_0050688 | 3300048920 | Bacteria | 2942 |
| 1272 | Ga0496117_0055024 | 3300048920 | Bacteria | 2783 |
| 1273 | Ga0496117_0072491 | 3300048920 | Bacteria | 2302 |
| 1274 | Ga0496117_0085127 | 3300048920 | Bacteria | 2060 |
| 1275 | Ga0496117_0128412 | 3300048920 | Bacteria | 1542 |
| 1276 | Ga0496118_0006011 | 3300048921 | Bacteria | 13528 |
| 1277 | Ga0496118_0009157 | 3300048921 | Bacteria | 10063 |
| 1278 | Ga0496118_0011347 | 3300048921 | Bacteria | 8709 |
| 1279 | Ga0496118_0022862 | 3300048921 | Bacteria | 5451 |
| 1280 | Ga0496118_0031243 | 3300048921 | Bacteria | 4420 |
| 1281 | Ga0496118_0031721 | 3300048921 | Bacteria | 4373 |
| 1282 | Ga0496118_0035603 | 3300048921 | Bacteria | 4038 |
| 1283 | Ga0496118_0044214 | 3300048921 | Bacteria | 3490 |
| 1284 | Ga0496118_0079811 | 3300048921 | Bacteria | 2306 |
| 1285 | Ga0496118_0197131 | 3300048921 | Bacteria | 1197 |
| 1286 | Ga0496119_0000380 | 3300048922 | Bacteria | 61208 |
| 1287 | Ga0496119_0042611 | 3300048922 | Bacteria | 2876 |
| 1288 | Ga0496120_0008249 | 3300048923 | Bacteria | 7610 |
| 1289 | Ga0496120_0023099 | 3300048923 | Bacteria | 3897 |
| 1290 | Ga0496120_0047569 | 3300048923 | Bacteria | 2472 |
| 1291 | Ga0496121_0001836 | 3300048924 | Bacteria | 34258 |
| 1292 | Ga0496121_0003161 | 3300048924 | Bacteria | 23741 |
| 1293 | Ga0496121_0003439 | 3300048924 | Bacteria | 22622 |
| 1294 | Ga0496121_0004616 | 3300048924 | Bacteria | 18345 |
| 1295 | Ga0496121_0026975 | 3300048924 | Bacteria | 5390 |
| 1296 | Ga0496121_0086691 | 3300048924 | Bacteria | 2460 |
| 1297 | Ga0496121_0157583 | 3300048924 | Bacteria | 1664 |
| 1298 | Ga0496121_0270359 | 3300048924 | Bacteria | 1168 |
| 1299 | Ga0496122_0002009 | 3300048925 | Bacteria | 30251 |
| 1300 | Ga0496122_0002967 | 3300048925 | Bacteria | 23120 |
| 1301 | Ga0496122_0004867 | 3300048925 | Bacteria | 16328 |
| 1302 | Ga0496122_0008737 | 3300048925 | Bacteria | 10844 |
| 1303 | Ga0496122_0053631 | 3300048925 | Bacteria | 3037 |
| 1304 | Ga0496122_0056226 | 3300048925 | Bacteria | 2935 |
| 1305 | Ga0496122_0058893 | 3300048925 | Bacteria | 2839 |
| 1306 | Ga0496122_0063427 | 3300048925 | Bacteria | 2697 |
| 1307 | Ga0496122_0159896 | 3300048925 | Bacteria | 1375 |
| 1308 | Ga0496122_0190426 | 3300048925 | Bacteria | 1212 |
| 1309 | Ga0496123_0001758 | 3300048926 | Bacteria | 28593 |
| 1310 | Ga0496123_0001969 | 3300048926 | Bacteria | 26631 |
| 1311 | Ga0496123_0003732 | 3300048926 | Bacteria | 16728 |
| 1312 | Ga0496123_0012283 | 3300048926 | Bacteria | 7319 |
| 1313 | Ga0496123_0044446 | 3300048926 | Bacteria | 3037 |
| 1314 | Ga0496123_0049534 | 3300048926 | Bacteria | 2815 |
| 1315 | Ga0496123_0050228 | 3300048926 | Bacteria | 2788 |
| 1316 | Ga0496123_0059156 | 3300048926 | Bacteria | 2480 |
| 1317 | Ga0496123_0080406 | 3300048926 | Bacteria | 1986 |
| 1318 | Ga0496124_0000355 | 3300048927 | Bacteria | 83748 |
| 1319 | Ga0496124_0001964 | 3300048927 | Bacteria | 28105 |
| 1320 | Ga0496124_0002197 | 3300048927 | Bacteria | 26029 |
| 1321 | Ga0496124_0008144 | 3300048927 | Bacteria | 11003 |
| 1322 | Ga0496124_0009954 | 3300048927 | Bacteria | 9713 |
| 1323 | Ga0496124_0010733 | 3300048927 | Bacteria | 9235 |
| 1324 | Ga0496124_0011212 | 3300048927 | Bacteria | 8985 |
| 1325 | Ga0496124_0016387 | 3300048927 | Bacteria | 7049 |
| 1326 | Ga0496124_0036358 | 3300048927 | Bacteria | 4297 |
| 1327 | Ga0496124_0040666 | 3300048927 | Bacteria | 4020 |
| 1328 | Ga0496124_0048703 | 3300048927 | Bacteria | 3619 |
| 1329 | Ga0496124_0077880 | 3300048927 | Bacteria | 2733 |
| 1330 | Ga0496124_0088457 | 3300048927 | Bacteria | 2531 |
| 1331 | Ga0496125_0001708 | 3300048928 | Bacteria | 30582 |
| 1332 | Ga0496125_0002601 | 3300048928 | Bacteria | 23166 |
| 1333 | Ga0496125_0004067 | 3300048928 | Bacteria | 17128 |
| 1334 | Ga0496125_0006782 | 3300048928 | Bacteria | 12294 |
| 1335 | Ga0496125_0015978 | 3300048928 | Bacteria | 7229 |
| 1336 | Ga0496125_0024970 | 3300048928 | Bacteria | 5483 |
| 1337 | Ga0496125_0033279 | 3300048928 | Bacteria | 4564 |
| 1338 | Ga0496125_0040604 | 3300048928 | Bacteria | 3988 |
| 1339 | Ga0496125_0057762 | 3300048928 | Bacteria | 3139 |
| 1340 | Ga0496125_0166633 | 3300048928 | Bacteria | 1487 |
| 1341 | Ga0496125_0260320 | 3300048928 | Bacteria | 1087 |
| 1342 | Ga0496126_0002106 | 3300048929 | Bacteria | 27865 |
| 1343 | Ga0496126_0047436 | 3300048929 | Bacteria | 3933 |
| 1344 | Ga0496126_0077271 | 3300048929 | Bacteria | 2952 |
| 1345 | Ga0496126_0125613 | 3300048929 | Bacteria | 2220 |
| 1346 | Ga0496126_0149185 | 3300048929 | Bacteria | 2005 |
| 1347 | Ga0495678_000108 | 3300049459 | Bacteria | 99839 |
| 1348 | Ga0495678_000840 | 3300049459 | Bacteria | 27428 |
| 1349 | Ga0495678_002964 | 3300049459 | Bacteria | 10830 |
| 1350 | Ga0495678_003513 | 3300049459 | Bacteria | 9642 |
| 1351 | Ga0495678_004960 | 3300049459 | Bacteria | 7502 |
| 1352 | Ga0495678_006048 | 3300049459 | Bacteria | 6518 |
| 1353 | Ga0495678_007749 | 3300049459 | Bacteria | 5531 |
| 1354 | Ga0495678_014005 | 3300049459 | Bacteria | 3742 |
| 1355 | Ga0495678_015411 | 3300049459 | Bacteria | 3517 |
| 1356 | Ga0495678_016012 | 3300049459 | Bacteria | 3441 |
| 1357 | Ga0495678_016355 | 3300049459 | Bacteria | 3394 |
| 1358 | Ga0495678_021085 | 3300049459 | Bacteria | 2874 |
| 1359 | Ga0495678_024087 | 3300049459 | Bacteria | 2634 |
| 1360 | Ga0495678_027380 | 3300049459 | Bacteria | 2418 |
| 1361 | Ga0495678_031546 | 3300049459 | Bacteria | 2208 |
| 1362 | Ga0495678_040676 | 3300049459 | Bacteria | 1866 |
| 1363 | Ga0495678_041608 | 3300049459 | Bacteria | 1837 |
| 1364 | Ga0495678_053268 | 3300049459 | Bacteria | 1554 |
| 1365 | Ga0495678_058387 | 3300049459 | Bacteria | 1458 |
| 1366 | Ga0495682_0000455 | 3300049460 | Bacteria | 28192 |
| 1367 | Ga0495682_0009522 | 3300049460 | Bacteria | 3790 |
| 1368 | Ga0495682_0011582 | 3300049460 | Bacteria | 3392 |
| 1369 | Ga0495682_0012034 | 3300049460 | Bacteria | 3324 |
| 1370 | Ga0495682_0014986 | 3300049460 | Bacteria | 2937 |
| 1371 | Ga0501292_000011 | 3300049515 | Bacteria | 72009 |
| 1372 | Ga0501294_000347 | 3300049517 | Bacteria | 5611 |
| 1373 | Ga0501300_000069 | 3300049523 | Bacteria | 15019 |
| 1374 | Ga0501032_0023811 | 3300049569 | Bacteria | 4228 |
| 1375 | Ga0501034_0000692 | 3300049571 | Bacteria | 51206 |
| 1376 | Ga0501034_0019196 | 3300049571 | Bacteria | 6999 |
| 1377 | Ga0501038_0230651 | 3300049574 | Bacteria | 1474 |
| 1378 | Ga0501039_0025552 | 3300049575 | Bacteria | 4539 |
| 1379 | Ga0501039_0163216 | 3300049575 | Bacteria | 1752 |
| 1380 | Ga0501040_0025008 | 3300049576 | Bacteria | 4012 |
| 1381 | Ga0501040_0249286 | 3300049576 | Bacteria | 1266 |
| 1382 | Ga0501041_0051034 | 3300049577 | Bacteria | 2521 |
| 1383 | Ga0501041_0095854 | 3300049577 | Bacteria | 1834 |
| 1384 | Ga0501041_0103644 | 3300049577 | Bacteria | 1762 |
| 1385 | Ga0501069_0014497 | 3300049585 | Bacteria | 4215 |
| 1386 | Ga0501070_0000091 | 3300049586 | Bacteria | 77270 |
| 1387 | Ga0501071_0014830 | 3300049587 | Bacteria | 5338 |
| 1388 | Ga0501071_0042435 | 3300049587 | Bacteria | 3260 |
| 1389 | Ga0501072_0007631 | 3300049588 | Bacteria | 8212 |
| 1390 | Ga0501072_0158680 | 3300049588 | Bacteria | 1804 |
| 1391 | Ga0501073_0003905 | 3300049589 | Bacteria | 11195 |
| 1392 | Ga0501073_0051276 | 3300049589 | Bacteria | 2890 |
| 1393 | Ga0501074_0036433 | 3300049590 | Bacteria | 3563 |
| 1394 | Ga0501075_0004498 | 3300049591 | Bacteria | 9443 |
| 1395 | Ga0501075_0018737 | 3300049591 | Bacteria | 5015 |
| 1396 | Ga0501075_0147628 | 3300049591 | Bacteria | 1792 |
| 1397 | Ga0501076_0008884 | 3300049592 | Bacteria | 7391 |
| 1398 | Ga0501076_0082546 | 3300049592 | Bacteria | 2580 |
| 1399 | Ga0501077_0053264 | 3300049593 | Bacteria | 2569 |
| 1400 | Ga0501202_001132 | 3300049652 | Bacteria | 4165 |
| 1401 | Ga0501222_001390 | 3300049662 | Bacteria | 3383 |
| 1402 | Ga0501222_005762 | 3300049662 | Bacteria | 1667 |
| 1403 | Ga0501223_000035 | 3300049663 | Bacteria | 48008 |
| 1404 | Ga0501223_000477 | 3300049663 | Bacteria | 9652 |
| 1405 | Ga0501224_000029 | 3300049664 | Bacteria | 48059 |
| 1406 | Ga0501233_003337 | 3300049668 | Bacteria | 2882 |
| 1407 | Ga0501235_004886 | 3300049669 | Bacteria | 2904 |
| 1408 | Ga0501257_000060 | 3300049686 | Bacteria | 30706 |
| 1409 | Ga0501259_000102 | 3300049688 | Bacteria | 12304 |
| 1410 | Ga0501261_000002 | 3300049690 | Bacteria | 117168 |
| 1411 | Ga0501225_0000026 | 3300049705 | Bacteria | 48959 |
| 1412 | Ga0501225_0015943 | 3300049705 | Bacteria | 2088 |
| 1413 | Ga0501245_000127 | 3300049708 | Bacteria | 7800 |
| 1414 | Ga0501079_0182006 | 3300049741 | Bacteria | 1640 |
| 1415 | Ga0501080_0020366 | 3300049742 | Bacteria | 6138 |
| 1416 | Ga0501080_0147150 | 3300049742 | Bacteria | 2178 |
| 1417 | Ga0501080_0282518 | 3300049742 | Bacteria | 1509 |
| 1418 | Ga0501081_0037087 | 3300049743 | Bacteria | 3326 |
| 1419 | Ga0501083_0012467 | 3300049744 | Bacteria | 5945 |
| 1420 | Ga0501083_0050417 | 3300049744 | Bacteria | 2801 |
| 1421 | Ga0501083_0163911 | 3300049744 | Bacteria | 1453 |
| 1422 | Ga0501279_000002 | 3300049775 | Bacteria | 205937 |
| 1423 | Ga0501280_000039 | 3300049776 | Bacteria | 38634 |
| 1424 | Ga0501281_00158 | 3300049777 | Bacteria | 7930 |
| 1425 | Ga0501283_000479 | 3300049779 | Bacteria | 5256 |
| 1426 | Ga0501045_0031062 | 3300049824 | Bacteria | 3868 |
| 1427 | Ga0501045_0044099 | 3300049824 | Bacteria | 3248 |
| 1428 | Ga0501226_000028 | 3300049853 | Bacteria | 88553 |
| 1429 | Ga0501226_000052 | 3300049853 | Bacteria | 44514 |
| 1430 | nmdc:mga03683_13495_c1 | 3300050489 | Bacteria | 3008 |
| 1431 | nmdc:mga00v17_139627_c1 | 3300050491 | Bacteria | 1553 |
| 1432 | nmdc:mga00v17_184678_c1 | 3300050491 | Bacteria | 1346 |
| 1433 | nmdc:mga00v17_40492_c1 | 3300050491 | Bacteria | 1894 |
| 1434 | nmdc:mga0k408_15227_c1 | 3300050493 | Bacteria | 4250 |
| 1435 | nmdc:mga0k408_5132_c1 | 3300050493 | Bacteria | 6936 |
| 1436 | nmdc:mga07m45_45373_c1 | 3300050496 | Bacteria | 2468 |
| 1437 | nmdc:mga05p37_237288_c1 | 3300050507 | Bacteria | 2194 |
| 1438 | nmdc:mga05p37_24331_c1 | 3300050507 | Bacteria | 4863 |
| 1439 | nmdc:mga05p37_396262_c1 | 3300050507 | Bacteria | 1613 |
| 1440 | nmdc:mga05p37_5093_c1 | 3300050507 | Bacteria | 15413 |
| 1441 | nmdc:mga05p37_9838_c1 | 3300050507 | Bacteria | 11350 |
| 1442 | nmdc:mga09592_1064_c1 | 3300050508 | Bacteria | 21795 |
| 1443 | nmdc:mga09592_50901_c1 | 3300050508 | Bacteria | 3493 |
| 1444 | nmdc:mga0qj67_601_c1 | 3300050509 | Bacteria | 24570 |
| 1445 | nmdc:mga06r32_3624_c1 | 3300050510 | Bacteria | 13783 |
| 1446 | nmdc:mga08y16_51094_c1 | 3300050511 | Bacteria | 4325 |
| 1447 | nmdc:mga0n895_254514_c1 | 3300050512 | Bacteria | 1782 |
| 1448 | nmdc:mga0n895_35166_c1 | 3300050512 | Bacteria | 4828 |
| 1449 | nmdc:mga0rr50_39121_c1 | 3300050513 | Bacteria | 2673 |
| 1450 | nmdc:mga0a205_2369_c1 | 3300050515 | Bacteria | 16612 |
| 1451 | Ga0495619_0026580 | 3300053085 | Bacteria | 3724 |
| 1452 | Ga0500572_002588 | 3300053111 | Bacteria | 4300 |
| 1453 | Ga0500592_000011 | 3300053116 | Bacteria | 73738 |
| 1454 | Ga0500608_000587 | 3300053122 | Bacteria | 13374 |
| 1455 | Ga0500618_000316 | 3300053125 | Bacteria | 35628 |
| 1456 | Ga0500659_0006736 | 3300053135 | Bacteria | 6374 |
| 1457 | Ga0500568_0051705 | 3300053139 | Bacteria | 1616 |
| 1458 | Ga0500573_0006921 | 3300053140 | Bacteria | 6158 |
| 1459 | Ga0500616_0001324 | 3300053153 | Bacteria | 24390 |
| 1460 | Ga0500622_0103814 | 3300053156 | Bacteria | 1396 |
| 1461 | Ga0500627_0000050 | 3300053158 | Bacteria | 56420 |
| 1462 | Ga0500634_0037027 | 3300053161 | Bacteria | 2655 |
| 1463 | Ga0500599_012595 | 3300053736 | Bacteria | 1137 |
| 1464 | Ga0501084_0010475 | 3300054114 | Bacteria | 7663 |
| 1465 | Ga0590071_000163 | 3300059421 | Bacteria | 19124 |
| 1466 | Ga0590074_001576 | 3300059423 | Bacteria | 3703 |
| 1467 | Ga0590075_000814 | 3300059424 | Bacteria | 8188 |
| 1468 | Ga0590075_002455 | 3300059424 | Bacteria | 4436 |
| 1469 | Ga0590075_022142 | 3300059424 | Bacteria | 1589 |
| 1470 | Ga0590077_000265 | 3300059426 | Bacteria | 14856 |
| 1471 | Ga0590077_000589 | 3300059426 | Bacteria | 9989 |
| 1472 | Ga0590077_006114 | 3300059426 | Bacteria | 2470 |
| 1473 | Ga0501082_0011509 | 3300060353 | Bacteria | 7616 |
| 1474 | Ga0501082_0020038 | 3300060353 | Bacteria | 5763 |
| 1475 | Ga0501082_0042202 | 3300060353 | Bacteria | 3933 |
| 1476 | Ga0501082_0073461 | 3300060353 | Bacteria | 2946 |
| 1477 | Ga0530510_0363122 | 3300061734 | Bacteria | 1089 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300045836 | Ga0466958_0228103 | Ga0466958_0228103_29_832 | 265 |
| 2 | 3300036647 | Ga0316582_0105580 | Ga0316582_0105580_58_933 | 289 |
| 3 | 3300006880 | Ga0075429_100128534 | Ga0075429_1001285343 | 296 |
| 4 | 3300027907 | Ga0207428_10017008 | Ga0207428_100170082 | 296 |
| 5 | 3300038443 | Ga0395901_0359629 | Ga0395901_0359629_445_1404 | 310 |
| 6 | 3300045051 | Ga0451576_0260476 | Ga0451576_0260476_388_1413 | 310 |
| 7 | 3300009147 | Ga0114129_10577780 | Ga0114129_105777802 | 311 |
| 8 | 3300050507 | nmdc:mga05p37_237288_c1 | nmdc:mga05p37_237288_c1_220_1230 | 311 |
| 9 | 3300005355 | Ga0070671_100007902 | Ga0070671_1000079023 | 312 |
| 10 | 3300005367 | Ga0070667_100014111 | Ga0070667_1000141116 | 312 |
| 11 | 3300005548 | Ga0070665_100098295 | Ga0070665_1000982953 | 312 |
| 12 | 3300005841 | Ga0068863_100007182 | Ga0068863_1000071828 | 312 |
| 13 | 3300014968 | Ga0157379_10000104 | Ga0157379_1000010436 | 312 |
| 14 | 3300025931 | Ga0207644_10005170 | Ga0207644_100051703 | 312 |
| 15 | 3300025986 | Ga0207658_10225297 | Ga0207658_102252972 | 312 |
| 16 | 3300026088 | Ga0207641_10021949 | Ga0207641_100219494 | 312 |
| 17 | 3300044712 | Ga0453684_0000113 | Ga0453684_0000113_40610_41635 | 313 |
| 18 | 3300049744 | Ga0501083_0050417 | Ga0501083_0050417_21_983 | 313 |
| 19 | 3300042876 | Ga0451577_0000067 | Ga0451577_0000067_144725_145771 | 314 |
| 20 | 3300044673 | Ga0453683_0003872 | Ga0453683_0003872_3417_4463 | 314 |
| 21 | 3300044712 | Ga0453684_0000215 | Ga0453684_0000215_105211_106257 | 314 |
| 22 | 3300045051 | Ga0451576_0001823 | Ga0451576_0001823_25745_26791 | 314 |
| 23 | 3300042530 | Ga0450916_003223 | Ga0450916_003223_471_1466 | 316 |
| 24 | 3300049853 | Ga0501226_000028 | Ga0501226_000028_76907_77902 | 316 |
| 25 | 3300003320 | rootH2_10152216 | rootH2_101522163 | 317 |
| 26 | 3300003323 | rootH1_10165822 | rootH1_101658223 | 317 |
| 27 | 3300048909 | Ga0496106_0000067 | Ga0496106_0000067_52413_53420 | 317 |
| 28 | 3300048919 | Ga0496116_0050155 | Ga0496116_0050155_706_1710 | 317 |
| 29 | 3300048920 | Ga0496117_0072491 | Ga0496117_0072491_669_1673 | 317 |
| 30 | 3300048921 | Ga0496118_0044214 | Ga0496118_0044214_1299_2303 | 317 |
| 31 | 3300048924 | Ga0496121_0004616 | Ga0496121_0004616_7515_8522 | 317 |
| 32 | 3300041405 | Ga0439438_039559 | Ga0439438_039559_17_1036 | 318 |
| 33 | 3300044712 | Ga0453684_0014848 | Ga0453684_0014848_363_1358 | 318 |
| 34 | 3300042013 | Ga0439456_028937 | Ga0439456_028937_153_1145 | 319 |
| 35 | 3300046492 | Ga0495585_0017321 | Ga0495585_0017321_2064_3053 | 319 |
| 36 | 3300047443 | Ga0495687_000169 | Ga0495687_000169_37009_38034 | 319 |
| 37 | 3300003316 | rootH1_10014100 | rootH1_100141004 | 320 |
| 38 | 3300046460 | Ga0495638_0009767 | Ga0495638_0009767_5554_6546 | 320 |
| 39 | 3300046530 | Ga0495654_0024300 | Ga0495654_0024300_1138_2130 | 320 |
| 40 | 3300005617 | Ga0068859_100000075 | Ga0068859_10000007527 | 321 |
| 41 | 3300005842 | Ga0068858_100102602 | Ga0068858_1001026022 | 321 |
| 42 | 3300006931 | Ga0097620_100000075 | Ga0097620_10000007527 | 321 |
| 43 | 3300009177 | Ga0105248_10007246 | Ga0105248_100072465 | 321 |
| 44 | 3300014325 | Ga0163163_10031095 | Ga0163163_100310954 | 321 |
| 45 | 3300025941 | Ga0207711_10013500 | Ga0207711_100135004 | 321 |
| 46 | 3300026035 | Ga0207703_10002028 | Ga0207703_1000202812 | 321 |
| 47 | 3300042006 | Ga0439432_064698 | Ga0439432_064698_100_1065 | 321 |
| 48 | 3300042013 | Ga0439456_001877 | Ga0439456_001877_1333_2322 | 322 |
| 49 | 3300037471 | Ga0395905_0000013 | Ga0395905_0000013_261322_262302 | 323 |
| 50 | 3300041405 | Ga0439438_002280 | Ga0439438_002280_6601_7590 | 323 |
| 51 | 3300041411 | Ga0439466_0000524 | Ga0439466_0000524_6793_7782 | 323 |
| 52 | 3300041413 | Ga0439465_0016595 | Ga0439465_0016595_435_1424 | 323 |
| 53 | 3300042006 | Ga0439432_002611 | Ga0439432_002611_4219_5208 | 323 |
| 54 | 3300042016 | Ga0439463_042289 | Ga0439463_042289_26_1015 | 323 |
| 55 | 3300042115 | Ga0450911_001185 | Ga0450911_001185_4834_5823 | 323 |
| 56 | 3300042124 | Ga0450922_001234 | Ga0450922_001234_813_1802 | 323 |
| 57 | 3300042127 | Ga0450890_000208 | Ga0450890_000208_6795_7784 | 323 |
| 58 | 3300042146 | Ga0450907_001002 | Ga0450907_001002_4092_5081 | 323 |
| 59 | 3300042147 | Ga0450910_001623 | Ga0450910_001623_679_1668 | 323 |
| 60 | 3300042435 | Ga0439434_0014027 | Ga0439434_0014027_850_1839 | 323 |
| 61 | 3300042438 | Ga0439459_0000454 | Ga0439459_0000454_3651_4646 | 323 |
| 62 | 3300042461 | Ga0439460_0017274 | Ga0439460_0017274_799_1788 | 323 |
| 63 | 3300042531 | Ga0450918_003211 | Ga0450918_003211_1397_2386 | 323 |
| 64 | 3300049686 | Ga0501257_000060 | Ga0501257_000060_17604_18599 | 323 |
| 65 | 3300053153 | Ga0500616_0001324 | Ga0500616_0001324_8033_9034 | 323 |
| 66 | 3300053736 | Ga0500599_012595 | Ga0500599_012595_91_1092 | 323 |
| 67 | iso_pu_bacteria | 2599185307 | 2599972877 | 323 |
| 68 | iso_pu_bacteria | 2600255283 | 2601625520 | 323 |
| 69 | iso_pu_bacteria | 2811994881 | 2812371084 | 323 |
| 70 | iso_pu_bacteria | 2923519811 | 2923525191 | 323 |
| 71 | 3300046463 | Ga0495653_0137672 | Ga0495653_0137672_105_1175 | 324 |
| 72 | 3300046679 | Ga0495623_0021429 | Ga0495623_0021429_639_1709 | 324 |
| 73 | 3300046689 | Ga0495613_0124318 | Ga0495613_0124318_649_1719 | 324 |
| 74 | 3300047317 | Ga0495604_0001553 | Ga0495604_0001553_13787_14857 | 324 |
| 75 | 3300047322 | Ga0495680_0003997 | Ga0495680_0003997_9127_10197 | 324 |
| 76 | iso_pu_bacteria | 2515154088 | 2515497002 | 324 |
| 77 | iso_pu_bacteria | 2515154129 | 2515720115 | 324 |
| 78 | iso_pu_bacteria | 2515154137 | 2515758805 | 324 |
| 79 | iso_pu_bacteria | 2515154202 | 2516084894 | 324 |
| 80 | iso_pu_bacteria | 2515154203 | 2516088304 | 324 |
| 81 | iso_pu_bacteria | 2738541271 | 2738689167 | 324 |
| 82 | iso_pu_bacteria | 2738543016 | 2739264554 | 324 |
| 83 | iso_pu_bacteria | 2854681122 | 2854683139 | 324 |
| 84 | iso_pu_bacteria | 2881101125 | 2881103792 | 324 |
| 85 | iso_pu_bacteria | 2910245624 | 2910249661 | 324 |
| 86 | 3300001990 | JGI24737J22298_10005913 | JGI24737J22298_100059132 | 325 |
| 87 | 3300005366 | Ga0070659_100101107 | Ga0070659_1001011072 | 325 |
| 88 | 3300005455 | Ga0070663_100025939 | Ga0070663_1000259391 | 325 |
| 89 | 3300005467 | Ga0070706_100129499 | Ga0070706_1001294991 | 325 |
| 90 | 3300005563 | Ga0068855_100000854 | Ga0068855_10000085433 | 325 |
| 91 | 3300005614 | Ga0068856_100469407 | Ga0068856_1004694071 | 325 |
| 92 | 3300009094 | Ga0111539_10012498 | Ga0111539_100124989 | 325 |
| 93 | 3300009147 | Ga0114129_10273643 | Ga0114129_102736433 | 325 |
| 94 | 3300013102 | Ga0157371_10074350 | Ga0157371_100743502 | 325 |
| 95 | 3300013296 | Ga0157374_10095271 | Ga0157374_100952712 | 325 |
| 96 | 3300025910 | Ga0207684_10245410 | Ga0207684_102454101 | 325 |
| 97 | 3300025919 | Ga0207657_10023036 | Ga0207657_100230365 | 325 |
| 98 | 3300025922 | Ga0207646_10069491 | Ga0207646_100694912 | 325 |
| 99 | 3300025949 | Ga0207667_10026197 | Ga0207667_100261978 | 325 |
| 100 | 3300037471 | Ga0395905_0000189 | Ga0395905_0000189_35547_36542 | 325 |
| 101 | 3300047318 | Ga0495636_0020991 | Ga0495636_0020991_14_994 | 325 |
| 102 | 3300048918 | Ga0496115_0137956 | Ga0496115_0137956_325_1305 | 325 |
| 103 | 3300050511 | nmdc:mga08y16_51094_c1 | nmdc:mga08y16_51094_c1_555_1553 | 325 |
| 104 | 3300050512 | nmdc:mga0n895_35166_c1 | nmdc:mga0n895_35166_c1_1320_2318 | 325 |
| 105 | 3300050515 | nmdc:mga0a205_2369_c1 | nmdc:mga0a205_2369_c1_4598_5596 | 325 |
| 106 | iso_pu_bacteria | 2511231004 | 2511254684 | 325 |
| 107 | iso_pu_bacteria | 2511231006 | 2511266561 | 325 |
| 108 | iso_pu_bacteria | 2511231007 | 2511271497 | 325 |
| 109 | iso_pu_bacteria | 2511231008 | 2511278713 | 325 |
| 110 | iso_pu_bacteria | 2511231010 | 2511291739 | 325 |
| 111 | iso_pu_bacteria | 2511231011 | 2511298130 | 325 |
| 112 | iso_pu_bacteria | 2511231016 | 2511327517 | 325 |
| 113 | iso_pu_bacteria | 2511231018 | 2511338532 | 325 |
| 114 | iso_pu_bacteria | 2511231019 | 2511345601 | 325 |
| 115 | iso_pu_bacteria | 2511231022 | 2511365285 | 325 |
| 116 | iso_pu_bacteria | 2511231023 | 2511367680 | 325 |
| 117 | iso_pu_bacteria | 2511231024 | 2511377926 | 325 |
| 118 | iso_pu_bacteria | 2511231031 | 2511415171 | 325 |
| 119 | iso_pu_bacteria | 2511231156 | 2511826420 | 325 |
| 120 | iso_pu_bacteria | 2554235132 | 2554816833 | 325 |
| 121 | iso_pu_bacteria | 2554235231 | 2555249031 | 325 |
| 122 | iso_pu_bacteria | 2596583598 | 2597032094 | 325 |
| 123 | iso_pu_bacteria | 2597489887 | 2597859553 | 325 |
| 124 | iso_pu_bacteria | 2597489888 | 2597864501 | 325 |
| 125 | iso_pu_bacteria | 2597489889 | 2597870310 | 325 |
| 126 | iso_pu_bacteria | 2599185160 | 2599354374 | 325 |
| 127 | iso_pu_bacteria | 2599185161 | 2599359912 | 325 |
| 128 | iso_pu_bacteria | 2599185162 | 2599366234 | 325 |
| 129 | iso_pu_bacteria | 2599185163 | 2599373024 | 325 |
| 130 | iso_pu_bacteria | 2599185164 | 2599379482 | 325 |
| 131 | iso_pu_bacteria | 2599185165 | 2599385540 | 325 |
| 132 | iso_pu_bacteria | 2599185166 | 2599391883 | 325 |
| 133 | iso_pu_bacteria | 2599185167 | 2599397628 | 325 |
| 134 | iso_pu_bacteria | 2599185168 | 2599403649 | 325 |
| 135 | iso_pu_bacteria | 2599185178 | 2599448391 | 325 |
| 136 | iso_pu_bacteria | 2599185179 | 2599452074 | 325 |
| 137 | iso_pu_bacteria | 2599185181 | 2599461208 | 325 |
| 138 | iso_pu_bacteria | 2599185182 | 2599469750 | 325 |
| 139 | iso_pu_bacteria | 2599185185 | 2599482383 | 325 |
| 140 | iso_pu_bacteria | 2599185186 | 2599490228 | 325 |
| 141 | iso_pu_bacteria | 2599185188 | 2599503375 | 325 |
| 142 | iso_pu_bacteria | 2599185189 | 2599506714 | 325 |
| 143 | iso_pu_bacteria | 2599185190 | 2599513543 | 325 |
| 144 | iso_pu_bacteria | 2599185191 | 2599517954 | 325 |
| 145 | iso_pu_bacteria | 2599185212 | 2599614975 | 325 |
| 146 | iso_pu_bacteria | 2599185248 | 2599771146 | 325 |
| 147 | iso_pu_bacteria | 2599185257 | 2599803897 | 325 |
| 148 | iso_pu_bacteria | 2599185288 | 2599880819 | 325 |
| 149 | iso_pu_bacteria | 2599185289 | 2599886294 | 325 |
| 150 | iso_pu_bacteria | 2599185290 | 2599892220 | 325 |
| 151 | iso_pu_bacteria | 2599185291 | 2599898008 | 325 |
| 152 | iso_pu_bacteria | 2599185300 | 2599934743 | 325 |
| 153 | iso_pu_bacteria | 2599185302 | 2599943901 | 325 |
| 154 | iso_pu_bacteria | 2599185303 | 2599949802 | 325 |
| 155 | iso_pu_bacteria | 2599185304 | 2599955885 | 325 |
| 156 | iso_pu_bacteria | 2599185305 | 2599960321 | 325 |
| 157 | iso_pu_bacteria | 2599185306 | 2599967881 | 325 |
| 158 | iso_pu_bacteria | 2599185308 | 2599979087 | 325 |
| 159 | iso_pu_bacteria | 2599185309 | 2599986574 | 325 |
| 160 | iso_pu_bacteria | 2599185310 | 2599989611 | 325 |
| 161 | iso_pu_bacteria | 2599185311 | 2599997642 | 325 |
| 162 | iso_pu_bacteria | 2599185312 | 2600000042 | 325 |
| 163 | iso_pu_bacteria | 2599185313 | 2600005026 | 325 |
| 164 | iso_pu_bacteria | 2599185314 | 2600013046 | 325 |
| 165 | iso_pu_bacteria | 2599185315 | 2600017822 | 325 |
| 166 | iso_pu_bacteria | 2599185316 | 2600024743 | 325 |
| 167 | iso_pu_bacteria | 2599185317 | 2600030543 | 325 |
| 168 | iso_pu_bacteria | 2599185318 | 2600038162 | 325 |
| 169 | iso_pu_bacteria | 2599185319 | 2600044476 | 325 |
| 170 | iso_pu_bacteria | 2599185320 | 2600048298 | 325 |
| 171 | iso_pu_bacteria | 2599185321 | 2600055384 | 325 |
| 172 | iso_pu_bacteria | 2599185322 | 2600061504 | 325 |
| 173 | iso_pu_bacteria | 2599185323 | 2600066178 | 325 |
| 174 | iso_pu_bacteria | 2599185324 | 2600070095 | 325 |
| 175 | iso_pu_bacteria | 2599185325 | 2600077986 | 325 |
| 176 | iso_pu_bacteria | 2599185356 | 2600213823 | 325 |
| 177 | iso_pu_bacteria | 2600254930 | 2600359986 | 325 |
| 178 | iso_pu_bacteria | 2600254931 | 2600364457 | 325 |
| 179 | iso_pu_bacteria | 2600255296 | 2601690194 | 325 |
| 180 | iso_pu_bacteria | 2600255313 | 2601773991 | 325 |
| 181 | iso_pu_bacteria | 2600255318 | 2601796488 | 325 |
| 182 | iso_pu_bacteria | 2603880185 | 2606073638 | 325 |
| 183 | iso_pu_bacteria | 2603880199 | 2606126718 | 325 |
| 184 | iso_pu_bacteria | 2606217733 | 2608379872 | 325 |
| 185 | iso_pu_bacteria | 2619619299 | 2621298986 | 325 |
| 186 | iso_pu_bacteria | 2623620443 | 2624482133 | 325 |
| 187 | iso_pu_bacteria | 2623620446 | 2624490765 | 325 |
| 188 | iso_pu_bacteria | 2643221571 | 2643871209 | 325 |
| 189 | iso_pu_bacteria | 2643221650 | 2644281894 | 325 |
| 190 | iso_pu_bacteria | 2643221713 | 2644620497 | 325 |
| 191 | iso_pu_bacteria | 2651869719 | 2652544064 | 325 |
| 192 | iso_pu_bacteria | 2667528170 | 2671090102 | 325 |
| 193 | iso_pu_bacteria | 2667528171 | 2671096955 | 325 |
| 194 | iso_pu_bacteria | 2667528176 | 2671125261 | 325 |
| 195 | iso_pu_bacteria | 2671180172 | 2671770534 | 325 |
| 196 | iso_pu_bacteria | 2675903420 | 2677899464 | 325 |
| 197 | iso_pu_bacteria | 2675903515 | 2678264768 | 325 |
| 198 | iso_pu_bacteria | 2713897148 | 2715750161 | 325 |
| 199 | iso_pu_bacteria | 2713897149 | 2715759904 | 325 |
| 200 | iso_pu_bacteria | 2718217725 | 2718635371 | 325 |
| 201 | iso_pu_bacteria | 2721755607 | 2723249287 | 325 |
| 202 | iso_pu_bacteria | 2738541265 | 2738672231 | 325 |
| 203 | iso_pu_bacteria | 2738541282 | 2738750624 | 325 |
| 204 | iso_pu_bacteria | 2738541294 | 2738806127 | 325 |
| 205 | iso_pu_bacteria | 2738541303 | 2738859665 | 325 |
| 206 | iso_pu_bacteria | 2738541309 | 2738893487 | 325 |
| 207 | iso_pu_bacteria | 2738543025 | 2739315170 | 325 |
| 208 | iso_pu_bacteria | 2740892503 | 2743739084 | 325 |
| 209 | iso_pu_bacteria | 2744054620 | 2745005222 | 325 |
| 210 | iso_pu_bacteria | 2765235841 | 2765585536 | 325 |
| 211 | iso_pu_bacteria | 2773857673 | 2774133072 | 325 |
| 212 | iso_pu_bacteria | 2784132063 | 2784263099 | 325 |
| 213 | iso_pu_bacteria | 2791355137 | 2792833089 | 325 |
| 214 | iso_pu_bacteria | 2791355520 | 2794594969 | 325 |
| 215 | iso_pu_bacteria | 2806310737 | 2807407076 | 325 |
| 216 | iso_pu_bacteria | 2806310745 | 2807455407 | 325 |
| 217 | iso_pu_bacteria | 2808606361 | 2808857801 | 325 |
| 218 | iso_pu_bacteria | 2808606376 | 2808926249 | 325 |
| 219 | iso_pu_bacteria | 2808606377 | 2808931875 | 325 |
| 220 | iso_pu_bacteria | 2808606378 | 2808937918 | 325 |
| 221 | iso_pu_bacteria | 2808606380 | 2808948378 | 325 |
| 222 | iso_pu_bacteria | 2808606381 | 2808953995 | 325 |
| 223 | iso_pu_bacteria | 2808606383 | 2808966232 | 325 |
| 224 | iso_pu_bacteria | 2808606385 | 2808978932 | 325 |
| 225 | iso_pu_bacteria | 2808606388 | 2808994753 | 325 |
| 226 | iso_pu_bacteria | 2808606389 | 2809001124 | 325 |
| 227 | iso_pu_bacteria | 2808606445 | 2809219058 | 325 |
| 228 | iso_pu_bacteria | 2816332298 | 2817491850 | 325 |
| 229 | iso_pu_bacteria | 2818991456 | 2819655873 | 325 |
| 230 | iso_pu_bacteria | 2818991464 | 2819702048 | 325 |
| 231 | iso_pu_bacteria | 2825651385 | 2825656351 | 325 |
| 232 | iso_pu_bacteria | 2826581358 | 2826585981 | 325 |
| 233 | iso_pu_bacteria | 2834028612 | 2834032643 | 325 |
| 234 | iso_pu_bacteria | 2842815866 | 2842819012 | 325 |
| 235 | iso_pu_bacteria | 2842826826 | 2842830446 | 325 |
| 236 | iso_pu_bacteria | 2842832357 | 2842836740 | 325 |
| 237 | iso_pu_bacteria | 2842837860 | 2842842004 | 325 |
| 238 | iso_pu_bacteria | 2842843487 | 2842844848 | 325 |
| 239 | iso_pu_bacteria | 2842849001 | 2842854433 | 325 |
| 240 | iso_pu_bacteria | 2842854478 | 2842856738 | 325 |
| 241 | iso_pu_bacteria | 2844665904 | 2844671992 | 325 |
| 242 | iso_pu_bacteria | 2852612431 | 2852613846 | 325 |
| 243 | iso_pu_bacteria | 2852657418 | 2852661306 | 325 |
| 244 | iso_pu_bacteria | 2852667396 | 2852668418 | 325 |
| 245 | iso_pu_bacteria | 2860339153 | 2860341040 | 325 |
| 246 | iso_pu_bacteria | 2860867994 | 2860871002 | 325 |
| 247 | iso_pu_bacteria | 2878029506 | 2878034114 | 325 |
| 248 | iso_pu_bacteria | 2880230671 | 2880234739 | 325 |
| 249 | iso_pu_bacteria | 2885266251 | 2885269349 | 325 |
| 250 | iso_pu_bacteria | 2900577576 | 2900578505 | 325 |
| 251 | iso_pu_bacteria | 2904518522 | 2904521126 | 325 |
| 252 | iso_pu_bacteria | 2904615490 | 2904618790 | 325 |
| 253 | iso_pu_bacteria | 2908446538 | 2908449134 | 325 |
| 254 | iso_pu_bacteria | 2912963787 | 2912967776 | 325 |
| 255 | iso_pu_bacteria | 2913036834 | 2913041369 | 325 |
| 256 | iso_pu_bacteria | 2917070673 | 2917075337 | 325 |
| 257 | iso_pu_bacteria | 2919063839 | 2919066823 | 325 |
| 258 | iso_pu_bacteria | 2919155634 | 2919158751 | 325 |
| 259 | iso_pu_bacteria | 2919385768 | 2919388212 | 325 |
| 260 | iso_pu_bacteria | 2919456309 | 2919460864 | 325 |
| 261 | iso_pu_bacteria | 2919481497 | 2919484292 | 325 |
| 262 | iso_pu_bacteria | 2919487758 | 2919489602 | 325 |
| 263 | iso_pu_bacteria | 2919697872 | 2919703193 | 325 |
| 264 | iso_pu_bacteria | 2923153595 | 2923158165 | 325 |
| 265 | iso_pu_bacteria | 2923586266 | 2923590229 | 325 |
| 266 | iso_pu_bacteria | 2928058823 | 2928060462 | 325 |
| 267 | iso_pu_bacteria | 2929144301 | 2929148695 | 325 |
| 268 | iso_pu_bacteria | 2929189879 | 2929193069 | 325 |
| 269 | iso_pu_bacteria | 2931369376 | 2931373874 | 325 |
| 270 | iso_pu_bacteria | 2931390751 | 2931393421 | 325 |
| 271 | iso_pu_bacteria | 2931396565 | 2931396778 | 325 |
| 272 | iso_pu_bacteria | 2935353572 | 2935356324 | 325 |
| 273 | iso_pu_bacteria | 2939651529 | 2939655771 | 325 |
| 274 | iso_pu_bacteria | 2945928738 | 2945932923 | 325 |
| 275 | iso_pu_bacteria | 2945961074 | 2945965353 | 325 |
| 276 | iso_pu_bacteria | 2946006987 | 2946009197 | 325 |
| 277 | iso_pu_bacteria | 2946027586 | 2946031345 | 325 |
| 278 | iso_pu_bacteria | 2947233263 | 2947238318 | 325 |
| 279 | iso_pu_bacteria | 2969304461 | 2969308895 | 325 |
| 280 | iso_pu_bacteria | 2974289157 | 2974289722 | 325 |
| 281 | iso_pu_bacteria | 2984286254 | 2984288012 | 325 |
| 282 | iso_pu_bacteria | 2988728565 | 2988730277 | 325 |
| 283 | iso_pu_bacteria | 2998139840 | 2998144198 | 325 |
| 284 | iso_pu_bacteria | 3007395558 | 3007397466 | 325 |
| 285 | iso_pu_bacteria | 3007419365 | 3007424632 | 325 |
| 286 | iso_pu_bacteria | 3007614139 | 3007617490 | 325 |
| 287 | iso_pu_bacteria | 3007718800 | 3007724154 | 325 |
| 288 | iso_pu_bacteria | 3007803356 | 3007805125 | 325 |
| 289 | iso_pu_bacteria | 3007855910 | 3007858823 | 325 |
| 290 | iso_pu_bacteria | 3007861166 | 3007865630 | 325 |
| 291 | iso_pu_bacteria | 3007866637 | 3007870620 | 325 |
| 292 | iso_pu_bacteria | 3007872151 | 3007876781 | 325 |
| 293 | iso_pu_bacteria | 637000220 | 637321789 | 325 |
| 294 | iso_pu_bacteria | 651053060 | 651174137 | 325 |
| 295 | iso_pu_bacteria | 8011350971 | 8011356767 | 325 |
| 296 | iso_pu_bacteria | 8015687852 | 8015692261 | 325 |
| 297 | iso_pu_bacteria | 8019769354 | 8019772953 | 325 |
| 298 | iso_pu_bacteria | 8019775933 | 8019779507 | 325 |
| 299 | iso_pu_bacteria | 8029995093 | 8029996687 | 325 |
| 300 | iso_pu_bacteria | 8039098773 | 8039099267 | 325 |
| 301 | iso_pu_bacteria | 8052494512 | 8052495829 | 325 |
| 302 | iso_pu_bacteria | 8054285046 | 8054291230 | 325 |
| 303 | iso_pu_bacteria | 8054347763 | 8054347830 | 325 |
| 304 | iso_pu_bacteria | 8054503363 | 8054506844 | 325 |
| 305 | iso_pu_bacteria | 8054929484 | 8054929904 | 325 |
| 306 | iso_pu_bacteria | 8055817908 | 8055821636 | 325 |
| 307 | iso_pu_bacteria | 8055878733 | 8055881290 | 325 |
| 308 | iso_pu_bacteria | 8056115690 | 8056117587 | 325 |
| 309 | iso_pu_bacteria | 8056120720 | 8056124665 | 325 |
| 310 | iso_pu_bacteria | 8056137416 | 8056138739 | 325 |
| 311 | iso_pu_bacteria | 8056143049 | 8056144695 | 325 |
| 312 | iso_pu_bacteria | 8056148874 | 8056154282 | 325 |
| 313 | iso_pu_bacteria | 8056155041 | 8056156791 | 325 |
| 314 | iso_pu_bacteria | 8056161164 | 8056165482 | 325 |
| 315 | iso_pu_bacteria | 8056166840 | 8056167089 | 325 |
| 316 | iso_pu_bacteria | 8056172158 | 8056173058 | 325 |
| 317 | iso_pu_bacteria | 8056569372 | 8056573920 | 325 |
| 318 | iso_pu_bacteria | 8057798959 | 8057804287 | 325 |
| 319 | 3300003322 | rootL2_10329293 | rootL2_103292932 | 326 |
| 320 | 3300005295 | Ga0065707_10087248 | Ga0065707_100872483 | 326 |
| 321 | 3300005844 | Ga0068862_100101611 | Ga0068862_1001016112 | 326 |
| 322 | 3300006195 | Ga0075366_10032757 | Ga0075366_100327575 | 326 |
| 323 | 3300006844 | Ga0075428_100002850 | Ga0075428_10000285016 | 326 |
| 324 | 3300006846 | Ga0075430_100000819 | Ga0075430_10000081913 | 326 |
| 325 | 3300006847 | Ga0075431_100073385 | Ga0075431_1000733852 | 326 |
| 326 | 3300009553 | Ga0105249_10130012 | Ga0105249_101300122 | 326 |
| 327 | 3300025933 | Ga0207706_10283240 | Ga0207706_102832402 | 326 |
| 328 | 3300026116 | Ga0207674_10296281 | Ga0207674_102962812 | 326 |
| 329 | 3300030745 | Ga0316182_1369220 | Ga0316182_13692201 | 326 |
| 330 | 3300031727 | Ga0316576_10271767 | Ga0316576_102717671 | 326 |
| 331 | 3300032002 | Ga0307416_100246747 | Ga0307416_1002467472 | 326 |
| 332 | 3300032005 | Ga0307411_10316373 | Ga0307411_103163731 | 326 |
| 333 | 3300032133 | Ga0316583_10071149 | Ga0316583_100711491 | 326 |
| 334 | 3300036712 | Ga0316584_0192025 | Ga0316584_0192025_475_1467 | 326 |
| 335 | 3300037312 | Ga0395899_0208222 | Ga0395899_0208222_74_1060 | 326 |
| 336 | 3300037418 | Ga0395900_0069418 | Ga0395900_0069418_454_1440 | 326 |
| 337 | 3300046524 | Ga0495648_0018685 | Ga0495648_0018685_3464_4453 | 326 |
| 338 | 3300047470 | Ga0495681_0000096 | Ga0495681_0000096_72709_73707 | 326 |
| 339 | 3300049459 | Ga0495678_007749 | Ga0495678_007749_2326_3324 | 326 |
| 340 | 3300049575 | Ga0501039_0025552 | Ga0501039_0025552_130_1119 | 326 |
| 341 | 3300049575 | Ga0501039_0163216 | Ga0501039_0163216_722_1711 | 326 |
| 342 | 3300049576 | Ga0501040_0025008 | Ga0501040_0025008_100_1089 | 326 |
| 343 | 3300049577 | Ga0501041_0051034 | Ga0501041_0051034_553_1542 | 326 |
| 344 | 3300049577 | Ga0501041_0103644 | Ga0501041_0103644_658_1647 | 326 |
| 345 | 3300049588 | Ga0501072_0007631 | Ga0501072_0007631_7155_8144 | 326 |
| 346 | 3300049591 | Ga0501075_0018737 | Ga0501075_0018737_351_1340 | 326 |
| 347 | 3300049592 | Ga0501076_0082546 | Ga0501076_0082546_1362_2351 | 326 |
| 348 | 3300049593 | Ga0501077_0053264 | Ga0501077_0053264_1128_2117 | 326 |
| 349 | 3300049743 | Ga0501081_0037087 | Ga0501081_0037087_1413_2402 | 326 |
| 350 | 3300049824 | Ga0501045_0031062 | Ga0501045_0031062_1763_2752 | 326 |
| 351 | 3300050508 | nmdc:mga09592_50901_c1 | nmdc:mga09592_50901_c1_529_1518 | 326 |
| 352 | 3300050509 | nmdc:mga0qj67_601_c1 | nmdc:mga0qj67_601_c1_14938_15927 | 326 |
| 353 | 3300050510 | nmdc:mga06r32_3624_c1 | nmdc:mga06r32_3624_c1_4107_5096 | 326 |
| 354 | 3300053156 | Ga0500622_0103814 | Ga0500622_0103814_139_1128 | 326 |
| 355 | 3300059421 | Ga0590071_000163 | Ga0590071_000163_5059_6048 | 326 |
| 356 | 3300059423 | Ga0590074_001576 | Ga0590074_001576_554_1543 | 326 |
| 357 | 3300059424 | Ga0590075_000814 | Ga0590075_000814_6202_7191 | 326 |
| 358 | 3300059424 | Ga0590075_002455 | Ga0590075_002455_1825_2814 | 326 |
| 359 | 3300059424 | Ga0590075_022142 | Ga0590075_022142_273_1262 | 326 |
| 360 | 3300059426 | Ga0590077_000265 | Ga0590077_000265_10373_11362 | 326 |
| 361 | 3300059426 | Ga0590077_000589 | Ga0590077_000589_4816_5805 | 326 |
| 362 | 3300059426 | Ga0590077_006114 | Ga0590077_006114_123_1310 | 326 |
| 363 | 3300060353 | Ga0501082_0042202 | Ga0501082_0042202_1804_2793 | 326 |
| 364 | iso_pu_bacteria | 2511231012 | 2511301656 | 326 |
| 365 | iso_pu_bacteria | 2511231014 | 2511314954 | 326 |
| 366 | iso_pu_bacteria | 2511231015 | 2511322937 | 326 |
| 367 | iso_pu_bacteria | 2511231017 | 2511330577 | 326 |
| 368 | iso_pu_bacteria | 2511231020 | 2511351335 | 326 |
| 369 | iso_pu_bacteria | 2511231021 | 2511353802 | 326 |
| 370 | iso_pu_bacteria | 2600254954 | 2600445450 | 326 |
| 371 | iso_pu_bacteria | 2600255389 | 2602009860 | 326 |
| 372 | iso_pu_bacteria | 2643221565 | 2643841929 | 326 |
| 373 | iso_pu_bacteria | 2643221589 | 2643957120 | 326 |
| 374 | iso_pu_bacteria | 2643221602 | 2644022096 | 326 |
| 375 | iso_pu_bacteria | 2643221633 | 2644188073 | 326 |
| 376 | iso_pu_bacteria | 2738543004 | 2739196950 | 326 |
| 377 | iso_pu_bacteria | 2738543015 | 2739261632 | 326 |
| 378 | iso_pu_bacteria | 2773857670 | 2774122603 | 326 |
| 379 | iso_pu_bacteria | 2784132072 | 2784316670 | 326 |
| 380 | iso_pu_bacteria | 2786546517 | 2787436900 | 326 |
| 381 | iso_pu_bacteria | 2808606373 | 2808907116 | 326 |
| 382 | iso_pu_bacteria | 2818991438 | 2819550876 | 326 |
| 383 | iso_pu_bacteria | 2904550169 | 2904554843 | 326 |
| 384 | iso_pu_bacteria | 2919501602 | 2919504027 | 326 |
| 385 | iso_pu_bacteria | 2926063275 | 2926065400 | 326 |
| 386 | iso_pu_bacteria | 2939636861 | 2939637414 | 326 |
| 387 | iso_pu_bacteria | 3007511990 | 3007515953 | 326 |
| 388 | iso_pu_bacteria | 3007619802 | 3007625481 | 326 |
| 389 | iso_pu_bacteria | 8034962539 | 8034965676 | 326 |
| 390 | iso_pu_bacteria | 8056125926 | 8056130483 | 326 |
| 391 | iso_pu_bacteria | 8056177738 | 8056180072 | 326 |
| 392 | 3300005290 | Ga0065712_10171865 | Ga0065712_101718651 | 327 |
| 393 | 3300005347 | Ga0070668_100389909 | Ga0070668_1003899091 | 327 |
| 394 | 3300005367 | Ga0070667_100428467 | Ga0070667_1004284672 | 327 |
| 395 | 3300005445 | Ga0070708_100013258 | Ga0070708_1000132583 | 327 |
| 396 | 3300005467 | Ga0070706_100300993 | Ga0070706_1003009931 | 327 |
| 397 | 3300005468 | Ga0070707_100013239 | Ga0070707_1000132395 | 327 |
| 398 | 3300005518 | Ga0070699_100378174 | Ga0070699_1003781741 | 327 |
| 399 | 3300005548 | Ga0070665_100062105 | Ga0070665_1000621051 | 327 |
| 400 | 3300005614 | Ga0068856_100014486 | Ga0068856_1000144863 | 327 |
| 401 | 3300005617 | Ga0068859_100255294 | Ga0068859_1002552943 | 327 |
| 402 | 3300005719 | Ga0068861_100004019 | Ga0068861_1000040197 | 327 |
| 403 | 3300005719 | Ga0068861_100061495 | Ga0068861_1000614954 | 327 |
| 404 | 3300006042 | Ga0075368_10005176 | Ga0075368_100051765 | 327 |
| 405 | 3300006353 | Ga0075370_10031952 | Ga0075370_100319523 | 327 |
| 406 | 3300006844 | Ga0075428_100495260 | Ga0075428_1004952602 | 327 |
| 407 | 3300006852 | Ga0075433_10003532 | Ga0075433_100035328 | 327 |
| 408 | 3300006871 | Ga0075434_100002217 | Ga0075434_1000022174 | 327 |
| 409 | 3300006931 | Ga0097620_100255271 | Ga0097620_1002552713 | 327 |
| 410 | 3300009551 | Ga0105238_10191741 | Ga0105238_101917413 | 327 |
| 411 | 3300015265 | Ga0182005_1008708 | Ga0182005_10087081 | 327 |
| 412 | 3300025735 | Ga0207713_1000074 | Ga0207713_100007463 | 327 |
| 413 | 3300025910 | Ga0207684_10092749 | Ga0207684_100927493 | 327 |
| 414 | 3300025924 | Ga0207694_10127649 | Ga0207694_101276492 | 327 |
| 415 | 3300025942 | Ga0207689_10162701 | Ga0207689_101627011 | 327 |
| 416 | 3300025986 | Ga0207658_10233507 | Ga0207658_102335072 | 327 |
| 417 | 3300026078 | Ga0207702_10058448 | Ga0207702_100584483 | 327 |
| 418 | 3300026118 | Ga0207675_100002359 | Ga0207675_1000023598 | 327 |
| 419 | 3300026118 | Ga0207675_100088645 | Ga0207675_1000886451 | 327 |
| 420 | 3300027907 | Ga0207428_10123984 | Ga0207428_101239842 | 327 |
| 421 | 3300028379 | Ga0268266_10040702 | Ga0268266_100407025 | 327 |
| 422 | 3300037471 | Ga0395905_0061804 | Ga0395905_0061804_1630_2634 | 327 |
| 423 | 3300039447 | Ga0436361_0061781 | Ga0436361_0061781_801_1805 | 327 |
| 424 | 3300041404 | Ga0439436_0000467 | Ga0439436_0000467_4325_5335 | 327 |
| 425 | 3300041405 | Ga0439438_000199 | Ga0439438_000199_11070_12080 | 327 |
| 426 | 3300041407 | Ga0439447_005735 | Ga0439447_005735_2395_3405 | 327 |
| 427 | 3300041411 | Ga0439466_0003528 | Ga0439466_0003528_1126_2136 | 327 |
| 428 | 3300042006 | Ga0439432_000453 | Ga0439432_000453_12830_13840 | 327 |
| 429 | 3300042010 | Ga0439452_001617 | Ga0439452_001617_4375_5385 | 327 |
| 430 | 3300042016 | Ga0439463_005916 | Ga0439463_005916_1993_2976 | 327 |
| 431 | 3300042016 | Ga0439463_006484 | Ga0439463_006484_209_1192 | 327 |
| 432 | 3300042435 | Ga0439434_0005186 | Ga0439434_0005186_693_1703 | 327 |
| 433 | 3300042531 | Ga0450918_010522 | Ga0450918_010522_22_1014 | 327 |
| 434 | 3300044712 | Ga0453684_0093289 | Ga0453684_0093289_2614_3600 | 327 |
| 435 | 3300045051 | Ga0451576_0000245 | Ga0451576_0000245_103880_104866 | 327 |
| 436 | 3300046458 | Ga0495591_000606 | Ga0495591_000606_16429_17412 | 327 |
| 437 | 3300046458 | Ga0495591_001733 | Ga0495591_001733_2452_3435 | 327 |
| 438 | 3300046458 | Ga0495591_004519 | Ga0495591_004519_1106_2089 | 327 |
| 439 | 3300046458 | Ga0495591_012722 | Ga0495591_012722_385_1368 | 327 |
| 440 | 3300046460 | Ga0495638_0013005 | Ga0495638_0013005_2942_3952 | 327 |
| 441 | 3300046460 | Ga0495638_0035693 | Ga0495638_0035693_524_1507 | 327 |
| 442 | 3300046471 | Ga0495650_0001905 | Ga0495650_0001905_12005_12988 | 327 |
| 443 | 3300046471 | Ga0495650_0009537 | Ga0495650_0009537_1553_2536 | 327 |
| 444 | 3300046474 | Ga0495605_0000149 | Ga0495605_0000149_14185_15168 | 327 |
| 445 | 3300046474 | Ga0495605_0000155 | Ga0495605_0000155_34359_35342 | 327 |
| 446 | 3300046474 | Ga0495605_0012717 | Ga0495605_0012717_1376_2359 | 327 |
| 447 | 3300046474 | Ga0495605_0030530 | Ga0495605_0030530_1558_2541 | 327 |
| 448 | 3300046491 | Ga0495584_0018462 | Ga0495584_0018462_1841_2824 | 327 |
| 449 | 3300046492 | Ga0495585_0054711 | Ga0495585_0054711_803_1786 | 327 |
| 450 | 3300046500 | Ga0495596_0016124 | Ga0495596_0016124_1157_2140 | 327 |
| 451 | 3300046501 | Ga0495607_0000444 | Ga0495607_0000444_18189_19172 | 327 |
| 452 | 3300046501 | Ga0495607_0003552 | Ga0495607_0003552_3395_4378 | 327 |
| 453 | 3300046501 | Ga0495607_0014044 | Ga0495607_0014044_2244_3227 | 327 |
| 454 | 3300046501 | Ga0495607_0037807 | Ga0495607_0037807_719_1702 | 327 |
| 455 | 3300046501 | Ga0495607_0123140 | Ga0495607_0123140_254_1237 | 327 |
| 456 | 3300046506 | Ga0495583_0001312 | Ga0495583_0001312_1976_2959 | 327 |
| 457 | 3300046506 | Ga0495583_0001496 | Ga0495583_0001496_5463_6446 | 327 |
| 458 | 3300046506 | Ga0495583_0003690 | Ga0495583_0003690_3184_4167 | 327 |
| 459 | 3300046506 | Ga0495583_0016076 | Ga0495583_0016076_1944_2927 | 327 |
| 460 | 3300046506 | Ga0495583_0021576 | Ga0495583_0021576_2250_3233 | 327 |
| 461 | 3300046507 | Ga0495606_0000812 | Ga0495606_0000812_12881_13864 | 327 |
| 462 | 3300046507 | Ga0495606_0012469 | Ga0495606_0012469_2444_3427 | 327 |
| 463 | 3300046513 | Ga0495616_0070726 | Ga0495616_0070726_411_1394 | 327 |
| 464 | 3300046513 | Ga0495616_0134480 | Ga0495616_0134480_68_1051 | 327 |
| 465 | 3300046515 | Ga0495620_0000426 | Ga0495620_0000426_1786_2769 | 327 |
| 466 | 3300046515 | Ga0495620_0016779 | Ga0495620_0016779_590_1573 | 327 |
| 467 | 3300046518 | Ga0495631_0014028 | Ga0495631_0014028_1872_2855 | 327 |
| 468 | 3300046518 | Ga0495631_0094122 | Ga0495631_0094122_178_1161 | 327 |
| 469 | 3300046519 | Ga0495632_0001013 | Ga0495632_0001013_2214_3197 | 327 |
| 470 | 3300046519 | Ga0495632_0001944 | Ga0495632_0001944_14344_15327 | 327 |
| 471 | 3300046519 | Ga0495632_0016468 | Ga0495632_0016468_2672_3655 | 327 |
| 472 | 3300046520 | Ga0495637_0000204 | Ga0495637_0000204_32466_33449 | 327 |
| 473 | 3300046520 | Ga0495637_0000844 | Ga0495637_0000844_5566_6549 | 327 |
| 474 | 3300046520 | Ga0495637_0024226 | Ga0495637_0024226_82_1065 | 327 |
| 475 | 3300046522 | Ga0495643_0005885 | Ga0495643_0005885_6382_7365 | 327 |
| 476 | 3300046523 | Ga0495644_0021435 | Ga0495644_0021435_779_1762 | 327 |
| 477 | 3300046524 | Ga0495648_0019694 | Ga0495648_0019694_1139_2122 | 327 |
| 478 | 3300046524 | Ga0495648_0028466 | Ga0495648_0028466_990_1973 | 327 |
| 479 | 3300046530 | Ga0495654_0006257 | Ga0495654_0006257_3585_4568 | 327 |
| 480 | 3300046538 | Ga0495609_0000087 | Ga0495609_0000087_108810_109793 | 327 |
| 481 | 3300046538 | Ga0495609_0000141 | Ga0495609_0000141_57955_58938 | 327 |
| 482 | 3300046616 | Ga0495668_0042934 | Ga0495668_0042934_1124_2107 | 327 |
| 483 | 3300046616 | Ga0495668_0044303 | Ga0495668_0044303_1178_2161 | 327 |
| 484 | 3300046648 | Ga0495611_0000518 | Ga0495611_0000518_511_1494 | 327 |
| 485 | 3300046648 | Ga0495611_0053707 | Ga0495611_0053707_731_1714 | 327 |
| 486 | 3300046660 | Ga0495625_0000145 | Ga0495625_0000145_33694_34677 | 327 |
| 487 | 3300046665 | Ga0495661_0000193 | Ga0495661_0000193_3363_4346 | 327 |
| 488 | 3300046665 | Ga0495661_0000332 | Ga0495661_0000332_36817_37800 | 327 |
| 489 | 3300046665 | Ga0495661_0018326 | Ga0495661_0018326_1908_2891 | 327 |
| 490 | 3300046665 | Ga0495661_0057437 | Ga0495661_0057437_1258_2241 | 327 |
| 491 | 3300046692 | Ga0495671_0012860 | Ga0495671_0012860_379_1362 | 327 |
| 492 | 3300046692 | Ga0495671_0148663 | Ga0495671_0148663_80_1063 | 327 |
| 493 | 3300046692 | Ga0495671_0148669 | Ga0495671_0148669_80_1063 | 327 |
| 494 | 3300046794 | Ga0495589_0026703 | Ga0495589_0026703_1238_2224 | 327 |
| 495 | 3300046810 | Ga0495660_0077244 | Ga0495660_0077244_151_1134 | 327 |
| 496 | 3300046810 | Ga0495660_0094427 | Ga0495660_0094427_474_1457 | 327 |
| 497 | 3300047320 | Ga0495672_0019211 | Ga0495672_0019211_1833_2816 | 327 |
| 498 | 3300047321 | Ga0495676_0000198 | Ga0495676_0000198_33135_34118 | 327 |
| 499 | 3300047446 | Ga0495679_001251 | Ga0495679_001251_13143_14126 | 327 |
| 500 | 3300047469 | Ga0495673_0001573 | Ga0495673_0001573_8475_9458 | 327 |
| 501 | 3300047469 | Ga0495673_0001783 | Ga0495673_0001783_5570_6553 | 327 |
| 502 | 3300047469 | Ga0495673_0016016 | Ga0495673_0016016_1891_2874 | 327 |
| 503 | 3300047469 | Ga0495673_0024116 | Ga0495673_0024116_775_1758 | 327 |
| 504 | 3300047469 | Ga0495673_0024832 | Ga0495673_0024832_1568_2551 | 327 |
| 505 | 3300047469 | Ga0495673_0026259 | Ga0495673_0026259_1709_2692 | 327 |
| 506 | 3300047469 | Ga0495673_0072252 | Ga0495673_0072252_172_1155 | 327 |
| 507 | 3300047470 | Ga0495681_0006191 | Ga0495681_0006191_1696_2679 | 327 |
| 508 | 3300047472 | Ga0495686_0000002 | Ga0495686_0000002_25101_26087 | 327 |
| 509 | 3300048091 | Ga0495626_0000372 | Ga0495626_0000372_32231_33214 | 327 |
| 510 | 3300048913 | Ga0496110_0115517 | Ga0496110_0115517_541_1524 | 327 |
| 511 | 3300048920 | Ga0496117_0128412 | Ga0496117_0128412_286_1269 | 327 |
| 512 | 3300048924 | Ga0496121_0003161 | Ga0496121_0003161_17160_18143 | 327 |
| 513 | 3300048925 | Ga0496122_0056226 | Ga0496122_0056226_304_1287 | 327 |
| 514 | 3300048926 | Ga0496123_0012283 | Ga0496123_0012283_1910_2893 | 327 |
| 515 | 3300048927 | Ga0496124_0001964 | Ga0496124_0001964_19164_20147 | 327 |
| 516 | 3300048927 | Ga0496124_0011212 | Ga0496124_0011212_5724_6707 | 327 |
| 517 | 3300049459 | Ga0495678_000840 | Ga0495678_000840_20874_21857 | 327 |
| 518 | 3300049459 | Ga0495678_006048 | Ga0495678_006048_2713_3696 | 327 |
| 519 | 3300049459 | Ga0495678_021085 | Ga0495678_021085_1630_2613 | 327 |
| 520 | 3300049460 | Ga0495682_0000455 | Ga0495682_0000455_9771_10754 | 327 |
| 521 | 3300049571 | Ga0501034_0019196 | Ga0501034_0019196_3267_4256 | 327 |
| 522 | 3300049574 | Ga0501038_0230651 | Ga0501038_0230651_267_1280 | 327 |
| 523 | 3300049587 | Ga0501071_0014830 | Ga0501071_0014830_644_1657 | 327 |
| 524 | 3300049588 | Ga0501072_0158680 | Ga0501072_0158680_43_1056 | 327 |
| 525 | 3300049591 | Ga0501075_0004498 | Ga0501075_0004498_4851_5864 | 327 |
| 526 | 3300049592 | Ga0501076_0008884 | Ga0501076_0008884_355_1368 | 327 |
| 527 | 3300049742 | Ga0501080_0147150 | Ga0501080_0147150_568_1581 | 327 |
| 528 | 3300049824 | Ga0501045_0044099 | Ga0501045_0044099_1146_2159 | 327 |
| 529 | 3300050493 | nmdc:mga0k408_15227_c1 | nmdc:mga0k408_15227_c1_987_1985 | 327 |
| 530 | 3300050496 | nmdc:mga07m45_45373_c1 | nmdc:mga07m45_45373_c1_762_1754 | 327 |
| 531 | 3300050513 | nmdc:mga0rr50_39121_c1 | nmdc:mga0rr50_39121_c1_188_1180 | 327 |
| 532 | 3300054114 | Ga0501084_0010475 | Ga0501084_0010475_123_1136 | 327 |
| 533 | 3300060353 | Ga0501082_0073461 | Ga0501082_0073461_1381_2394 | 327 |
| 534 | 3300003758 | Ga0055532_1001166 | Ga0055532_10011664 | 328 |
| 535 | 3300003758 | Ga0055532_1002123 | Ga0055532_10021235 | 328 |
| 536 | 3300005262 | Ga0065165_1017045 | Ga0065165_10170453 | 328 |
| 537 | 3300005331 | Ga0070670_100119614 | Ga0070670_1001196143 | 328 |
| 538 | 3300005331 | Ga0070670_100127861 | Ga0070670_1001278611 | 328 |
| 539 | 3300005331 | Ga0070670_100287106 | Ga0070670_1002871061 | 328 |
| 540 | 3300005353 | Ga0070669_100274188 | Ga0070669_1002741882 | 328 |
| 541 | 3300005354 | Ga0070675_100318334 | Ga0070675_1003183342 | 328 |
| 542 | 3300005364 | Ga0070673_100177332 | Ga0070673_1001773322 | 328 |
| 543 | 3300005365 | Ga0070688_100072700 | Ga0070688_1000727001 | 328 |
| 544 | 3300005456 | Ga0070678_100038117 | Ga0070678_1000381172 | 328 |
| 545 | 3300005457 | Ga0070662_100319169 | Ga0070662_1003191691 | 328 |
| 546 | 3300005459 | Ga0068867_100012998 | Ga0068867_1000129984 | 328 |
| 547 | 3300005466 | Ga0070685_10080532 | Ga0070685_100805322 | 328 |
| 548 | 3300005563 | Ga0068855_100002275 | Ga0068855_1000022759 | 328 |
| 549 | 3300005564 | Ga0070664_100101171 | Ga0070664_1001011711 | 328 |
| 550 | 3300005564 | Ga0070664_100425382 | Ga0070664_1004253821 | 328 |
| 551 | 3300005577 | Ga0068857_100033795 | Ga0068857_1000337959 | 328 |
| 552 | 3300005578 | Ga0068854_100399414 | Ga0068854_1003994141 | 328 |
| 553 | 3300005618 | Ga0068864_100570329 | Ga0068864_1005703291 | 328 |
| 554 | 3300005719 | Ga0068861_100289953 | Ga0068861_1002899532 | 328 |
| 555 | 3300005719 | Ga0068861_100563130 | Ga0068861_1005631301 | 328 |
| 556 | 3300005841 | Ga0068863_100019292 | Ga0068863_1000192924 | 328 |
| 557 | 3300005841 | Ga0068863_100020109 | Ga0068863_1000201099 | 328 |
| 558 | 3300005842 | Ga0068858_100009576 | Ga0068858_1000095764 | 328 |
| 559 | 3300005843 | Ga0068860_100026522 | Ga0068860_10002652211 | 328 |
| 560 | 3300005844 | Ga0068862_100071025 | Ga0068862_1000710253 | 328 |
| 561 | 3300006028 | Ga0070717_10000029 | Ga0070717_1000002985 | 328 |
| 562 | 3300006028 | Ga0070717_10407657 | Ga0070717_104076572 | 328 |
| 563 | 3300006178 | Ga0075367_10036141 | Ga0075367_100361412 | 328 |
| 564 | 3300006844 | Ga0075428_100160216 | Ga0075428_1001602162 | 328 |
| 565 | 3300006847 | Ga0075431_100080061 | Ga0075431_1000800612 | 328 |
| 566 | 3300006847 | Ga0075431_100198160 | Ga0075431_1001981602 | 328 |
| 567 | 3300006871 | Ga0075434_100199650 | Ga0075434_1001996502 | 328 |
| 568 | 3300006880 | Ga0075429_100000374 | Ga0075429_10000037415 | 328 |
| 569 | 3300006880 | Ga0075429_100042776 | Ga0075429_1000427763 | 328 |
| 570 | 3300006914 | Ga0075436_100319643 | Ga0075436_1003196431 | 328 |
| 571 | 3300009147 | Ga0114129_10001645 | Ga0114129_1000164519 | 328 |
| 572 | 3300009147 | Ga0114129_10068759 | Ga0114129_100687594 | 328 |
| 573 | 3300009147 | Ga0114129_10082926 | Ga0114129_100829262 | 328 |
| 574 | 3300009147 | Ga0114129_10183636 | Ga0114129_101836362 | 328 |
| 575 | 3300009553 | Ga0105249_10022415 | Ga0105249_100224153 | 328 |
| 576 | 3300011119 | Ga0105246_10066146 | Ga0105246_100661463 | 328 |
| 577 | 3300017792 | Ga0163161_10061766 | Ga0163161_100617662 | 328 |
| 578 | 3300025273 | Ga0209673_1000070 | Ga0209673_1000070233 | 328 |
| 579 | 3300025925 | Ga0207650_10196909 | Ga0207650_101969091 | 328 |
| 580 | 3300025931 | Ga0207644_10177770 | Ga0207644_101777702 | 328 |
| 581 | 3300025940 | Ga0207691_10088412 | Ga0207691_100884122 | 328 |
| 582 | 3300025949 | Ga0207667_10006177 | Ga0207667_100061779 | 328 |
| 583 | 3300025960 | Ga0207651_10177345 | Ga0207651_101773452 | 328 |
| 584 | 3300025981 | Ga0207640_10356480 | Ga0207640_103564801 | 328 |
| 585 | 3300026035 | Ga0207703_10018255 | Ga0207703_100182553 | 328 |
| 586 | 3300026035 | Ga0207703_10505908 | Ga0207703_105059082 | 328 |
| 587 | 3300026067 | Ga0207678_10102399 | Ga0207678_101023992 | 328 |
| 588 | 3300026088 | Ga0207641_10017280 | Ga0207641_100172804 | 328 |
| 589 | 3300026089 | Ga0207648_10021724 | Ga0207648_100217244 | 328 |
| 590 | 3300026095 | Ga0207676_10336171 | Ga0207676_103361711 | 328 |
| 591 | 3300026116 | Ga0207674_10003401 | Ga0207674_1000340123 | 328 |
| 592 | 3300026118 | Ga0207675_100114842 | Ga0207675_1001148423 | 328 |
| 593 | 3300026121 | Ga0207683_10424200 | Ga0207683_104242001 | 328 |
| 594 | 3300031727 | Ga0316576_10016093 | Ga0316576_100160932 | 328 |
| 595 | 3300031727 | Ga0316576_10095886 | Ga0316576_100958862 | 328 |
| 596 | 3300031731 | Ga0307405_10211108 | Ga0307405_102111081 | 328 |
| 597 | 3300031733 | Ga0316577_10012767 | Ga0316577_100127672 | 328 |
| 598 | 3300031995 | Ga0307409_100387460 | Ga0307409_1003874602 | 328 |
| 599 | 3300036712 | Ga0316584_0026279 | Ga0316584_0026279_3186_4229 | 328 |
| 600 | 3300036712 | Ga0316584_0154947 | Ga0316584_0154947_67_1074 | 328 |
| 601 | 3300037471 | Ga0395905_0000250 | Ga0395905_0000250_46012_47022 | 328 |
| 602 | 3300044901 | Ga0466960_0014489 | Ga0466960_0014489_1793_2791 | 328 |
| 603 | 3300045051 | Ga0451576_0004166 | Ga0451576_0004166_14459_15484 | 328 |
| 604 | 3300045976 | Ga0466967_0455576 | Ga0466967_0455576_149_1147 | 328 |
| 605 | 3300048912 | Ga0496109_0000208 | Ga0496109_0000208_51174_52217 | 328 |
| 606 | 3300048927 | Ga0496124_0000355 | Ga0496124_0000355_21217_22203 | 328 |
| 607 | 3300048929 | Ga0496126_0047436 | Ga0496126_0047436_538_1545 | 328 |
| 608 | 3300049569 | Ga0501032_0023811 | Ga0501032_0023811_2133_3119 | 328 |
| 609 | 3300049585 | Ga0501069_0014497 | Ga0501069_0014497_2229_3236 | 328 |
| 610 | 3300049586 | Ga0501070_0000091 | Ga0501070_0000091_31735_32742 | 328 |
| 611 | 3300049587 | Ga0501071_0042435 | Ga0501071_0042435_318_1325 | 328 |
| 612 | 3300049589 | Ga0501073_0003905 | Ga0501073_0003905_4385_5392 | 328 |
| 613 | 3300049589 | Ga0501073_0051276 | Ga0501073_0051276_1711_2718 | 328 |
| 614 | 3300049590 | Ga0501074_0036433 | Ga0501074_0036433_1303_2310 | 328 |
| 615 | 3300049741 | Ga0501079_0182006 | Ga0501079_0182006_40_1047 | 328 |
| 616 | 3300049742 | Ga0501080_0020366 | Ga0501080_0020366_3016_4023 | 328 |
| 617 | 3300049744 | Ga0501083_0012467 | Ga0501083_0012467_2806_3813 | 328 |
| 618 | 3300050493 | nmdc:mga0k408_5132_c1 | nmdc:mga0k408_5132_c1_2205_3203 | 328 |
| 619 | 3300050507 | nmdc:mga05p37_24331_c1 | nmdc:mga05p37_24331_c1_2084_3094 | 328 |
| 620 | 3300050507 | nmdc:mga05p37_396262_c1 | nmdc:mga05p37_396262_c1_82_1077 | 328 |
| 621 | 3300050507 | nmdc:mga05p37_5093_c1 | nmdc:mga05p37_5093_c1_6078_7070 | 328 |
| 622 | 3300050507 | nmdc:mga05p37_9838_c1 | nmdc:mga05p37_9838_c1_6354_7370 | 328 |
| 623 | 3300050508 | nmdc:mga09592_1064_c1 | nmdc:mga09592_1064_c1_6050_7042 | 328 |
| 624 | 3300050512 | nmdc:mga0n895_254514_c1 | nmdc:mga0n895_254514_c1_191_1201 | 328 |
| 625 | 3300060353 | Ga0501082_0011509 | Ga0501082_0011509_1105_2112 | 328 |
| 626 | 3300060353 | Ga0501082_0020038 | Ga0501082_0020038_2090_3097 | 328 |
| 627 | 3300001915 | JGI24741J21665_1000701 | JGI24741J21665_10007013 | 329 |
| 628 | 3300001979 | JGI24740J21852_10001102 | JGI24740J21852_100011024 | 329 |
| 629 | 3300001979 | JGI24740J21852_10003569 | JGI24740J21852_100035694 | 329 |
| 630 | 3300002705 | JGI25156J39149_1002620 | JGI25156J39149_10026202 | 329 |
| 631 | 3300002705 | JGI25156J39149_1005280 | JGI25156J39149_10052804 | 329 |
| 632 | 3300002705 | JGI25156J39149_1012602 | JGI25156J39149_10126022 | 329 |
| 633 | 3300002737 | JGI25162J39368_1000190 | JGI25162J39368_100019013 | 329 |
| 634 | 3300002737 | JGI25162J39368_1000250 | JGI25162J39368_100025013 | 329 |
| 635 | 3300002738 | JGI25154J39366_1001045 | JGI25154J39366_10010452 | 329 |
| 636 | 3300002771 | JGI25163J39215_1000539 | JGI25163J39215_10005394 | 329 |
| 637 | 3300002771 | JGI25163J39215_1000541 | JGI25163J39215_10005417 | 329 |
| 638 | 3300002772 | JGI25164J39214_1000157 | JGI25164J39214_100015753 | 329 |
| 639 | 3300002772 | JGI25164J39214_1000192 | JGI25164J39214_100019244 | 329 |
| 640 | 3300003214 | JGI25165J46597_1000284 | JGI25165J46597_100028453 | 329 |
| 641 | 3300003214 | JGI25165J46597_1000346 | JGI25165J46597_100034644 | 329 |
| 642 | 3300003578 | Ga0006562J51391_1015087 | Ga0006562J51391_10150871 | 329 |
| 643 | 3300003578 | Ga0006562J51391_1060129 | Ga0006562J51391_10601292 | 329 |
| 644 | 3300003751 | Ga0055538_1000088 | Ga0055538_100008820 | 329 |
| 645 | 3300003751 | Ga0055538_1001920 | Ga0055538_10019203 | 329 |
| 646 | 3300003751 | Ga0055538_1002774 | Ga0055538_10027742 | 329 |
| 647 | 3300003752 | Ga0055539_1000073 | Ga0055539_100007345 | 329 |
| 648 | 3300003752 | Ga0055539_1000132 | Ga0055539_100013220 | 329 |
| 649 | 3300003756 | Ga0055533_1000135 | Ga0055533_100013520 | 329 |
| 650 | 3300003756 | Ga0055533_1002700 | Ga0055533_10027004 | 329 |
| 651 | 3300003756 | Ga0055533_1004145 | Ga0055533_10041452 | 329 |
| 652 | 3300003758 | Ga0055532_1000090 | Ga0055532_10000907 | 329 |
| 653 | 3300003758 | Ga0055532_1000359 | Ga0055532_100035920 | 329 |
| 654 | 3300003759 | Ga0055525_1000243 | Ga0055525_100024320 | 329 |
| 655 | 3300003759 | Ga0055525_1000387 | Ga0055525_100038724 | 329 |
| 656 | 3300003761 | Ga0055535_1000085 | Ga0055535_10000857 | 329 |
| 657 | 3300003762 | Ga0055542_1000847 | Ga0055542_100084717 | 329 |
| 658 | 3300003763 | Ga0055529_1000134 | Ga0055529_100013498 | 329 |
| 659 | 3300003781 | Ga0055536_1000342 | Ga0055536_100034213 | 329 |
| 660 | 3300003781 | Ga0055536_1002461 | Ga0055536_10024612 | 329 |
| 661 | 3300003791 | Ga0055530_10000472 | Ga0055530_1000047213 | 329 |
| 662 | 3300003791 | Ga0055530_10000512 | Ga0055530_1000051211 | 329 |
| 663 | 3300003792 | Ga0055540_1000424 | Ga0055540_100042411 | 329 |
| 664 | 3300003792 | Ga0055540_1001540 | Ga0055540_100154014 | 329 |
| 665 | 3300003841 | Ga0055541_1000087 | Ga0055541_100008765 | 329 |
| 666 | 3300003841 | Ga0055541_1004035 | Ga0055541_10040352 | 329 |
| 667 | 3300005288 | Ga0065714_10002659 | Ga0065714_1000265912 | 329 |
| 668 | 3300005288 | Ga0065714_10033331 | Ga0065714_100333312 | 329 |
| 669 | 3300005288 | Ga0065714_10065003 | Ga0065714_100650037 | 329 |
| 670 | 3300005288 | Ga0065714_10096482 | Ga0065714_100964822 | 329 |
| 671 | 3300005288 | Ga0065714_10119427 | Ga0065714_101194272 | 329 |
| 672 | 3300005289 | Ga0065704_10003082 | Ga0065704_100030825 | 329 |
| 673 | 3300005290 | Ga0065712_10070057 | Ga0065712_100700576 | 329 |
| 674 | 3300005295 | Ga0065707_10091487 | Ga0065707_100914872 | 329 |
| 675 | 3300005331 | Ga0070670_100001253 | Ga0070670_1000012539 | 329 |
| 676 | 3300005331 | Ga0070670_100026572 | Ga0070670_1000265721 | 329 |
| 677 | 3300005337 | Ga0070682_100088602 | Ga0070682_1000886022 | 329 |
| 678 | 3300005339 | Ga0070660_100099732 | Ga0070660_1000997322 | 329 |
| 679 | 3300005344 | Ga0070661_100000141 | Ga0070661_1000001413 | 329 |
| 680 | 3300005353 | Ga0070669_100001868 | Ga0070669_1000018686 | 329 |
| 681 | 3300005353 | Ga0070669_100006352 | Ga0070669_1000063525 | 329 |
| 682 | 3300005366 | Ga0070659_100001430 | Ga0070659_1000014306 | 329 |
| 683 | 3300005455 | Ga0070663_100000034 | Ga0070663_10000003457 | 329 |
| 684 | 3300005457 | Ga0070662_100007020 | Ga0070662_1000070205 | 329 |
| 685 | 3300005457 | Ga0070662_100007171 | Ga0070662_1000071713 | 329 |
| 686 | 3300005539 | Ga0068853_100043664 | Ga0068853_1000436644 | 329 |
| 687 | 3300005548 | Ga0070665_100098943 | Ga0070665_1000989432 | 329 |
| 688 | 3300005548 | Ga0070665_100336128 | Ga0070665_1003361282 | 329 |
| 689 | 3300005564 | Ga0070664_100000057 | Ga0070664_10000005759 | 329 |
| 690 | 3300005577 | Ga0068857_100009494 | Ga0068857_1000094948 | 329 |
| 691 | 3300005578 | Ga0068854_100000299 | Ga0068854_1000002994 | 329 |
| 692 | 3300005578 | Ga0068854_100128126 | Ga0068854_1001281262 | 329 |
| 693 | 3300005614 | Ga0068856_100000811 | Ga0068856_1000008119 | 329 |
| 694 | 3300005616 | Ga0068852_100265346 | Ga0068852_1002653462 | 329 |
| 695 | 3300005834 | Ga0068851_10000311 | Ga0068851_1000031112 | 329 |
| 696 | 3300005843 | Ga0068860_100000206 | Ga0068860_10000020668 | 329 |
| 697 | 3300006051 | Ga0075364_10075777 | Ga0075364_100757772 | 329 |
| 698 | 3300006051 | Ga0075364_10104320 | Ga0075364_101043202 | 329 |
| 699 | 3300006058 | Ga0075432_10005608 | Ga0075432_100056082 | 329 |
| 700 | 3300006058 | Ga0075432_10023055 | Ga0075432_100230551 | 329 |
| 701 | 3300006237 | Ga0097621_100228652 | Ga0097621_1002286522 | 329 |
| 702 | 3300006944 | Ga0099823_1003401 | Ga0099823_10034019 | 329 |
| 703 | 3300006946 | Ga0079104_1000659 | Ga0079104_100065923 | 329 |
| 704 | 3300006946 | Ga0079104_1005684 | Ga0079104_10056842 | 329 |
| 705 | 3300009011 | Ga0105251_10000336 | Ga0105251_1000033630 | 329 |
| 706 | 3300009011 | Ga0105251_10000879 | Ga0105251_1000087919 | 329 |
| 707 | 3300009011 | Ga0105251_10001202 | Ga0105251_1000120211 | 329 |
| 708 | 3300009011 | Ga0105251_10001712 | Ga0105251_1000171210 | 329 |
| 709 | 3300009011 | Ga0105251_10002150 | Ga0105251_100021509 | 329 |
| 710 | 3300009011 | Ga0105251_10007195 | Ga0105251_100071951 | 329 |
| 711 | 3300009011 | Ga0105251_10052124 | Ga0105251_100521242 | 329 |
| 712 | 3300009011 | Ga0105251_10103416 | Ga0105251_101034162 | 329 |
| 713 | 3300009011 | Ga0105251_10106632 | Ga0105251_101066322 | 329 |
| 714 | 3300009036 | Ga0105244_10002288 | Ga0105244_1000228812 | 329 |
| 715 | 3300009036 | Ga0105244_10005469 | Ga0105244_100054695 | 329 |
| 716 | 3300009036 | Ga0105244_10006237 | Ga0105244_100062375 | 329 |
| 717 | 3300009036 | Ga0105244_10006263 | Ga0105244_100062634 | 329 |
| 718 | 3300009036 | Ga0105244_10058728 | Ga0105244_100587282 | 329 |
| 719 | 3300009036 | Ga0105244_10073413 | Ga0105244_100734131 | 329 |
| 720 | 3300009036 | Ga0105244_10080174 | Ga0105244_100801742 | 329 |
| 721 | 3300009092 | Ga0105250_10000152 | Ga0105250_1000015274 | 329 |
| 722 | 3300009092 | Ga0105250_10000566 | Ga0105250_1000056611 | 329 |
| 723 | 3300009092 | Ga0105250_10001634 | Ga0105250_100016345 | 329 |
| 724 | 3300009092 | Ga0105250_10009340 | Ga0105250_100093402 | 329 |
| 725 | 3300009092 | Ga0105250_10012096 | Ga0105250_100120962 | 329 |
| 726 | 3300009092 | Ga0105250_10018885 | Ga0105250_100188852 | 329 |
| 727 | 3300009092 | Ga0105250_10019617 | Ga0105250_100196173 | 329 |
| 728 | 3300009092 | Ga0105250_10021230 | Ga0105250_100212302 | 329 |
| 729 | 3300009093 | Ga0105240_10023229 | Ga0105240_100232294 | 329 |
| 730 | 3300009093 | Ga0105240_10194299 | Ga0105240_101942993 | 329 |
| 731 | 3300009148 | Ga0105243_10000321 | Ga0105243_100003212 | 329 |
| 732 | 3300009148 | Ga0105243_10000885 | Ga0105243_100008859 | 329 |
| 733 | 3300009148 | Ga0105243_10025570 | Ga0105243_100255702 | 329 |
| 734 | 3300009148 | Ga0105243_10039642 | Ga0105243_100396422 | 329 |
| 735 | 3300009148 | Ga0105243_10110707 | Ga0105243_101107073 | 329 |
| 736 | 3300009177 | Ga0105248_10107584 | Ga0105248_101075842 | 329 |
| 737 | 3300011119 | Ga0105246_10000476 | Ga0105246_100004765 | 329 |
| 738 | 3300011119 | Ga0105246_10000524 | Ga0105246_100005246 | 329 |
| 739 | 3300011119 | Ga0105246_10041030 | Ga0105246_100410302 | 329 |
| 740 | 3300012498 | Ga0157345_1000203 | Ga0157345_10002034 | 329 |
| 741 | 3300013100 | Ga0157373_10002399 | Ga0157373_1000239910 | 329 |
| 742 | 3300013100 | Ga0157373_10005087 | Ga0157373_100050874 | 329 |
| 743 | 3300013100 | Ga0157373_10005895 | Ga0157373_100058956 | 329 |
| 744 | 3300013100 | Ga0157373_10009158 | Ga0157373_100091585 | 329 |
| 745 | 3300013100 | Ga0157373_10011643 | Ga0157373_100116434 | 329 |
| 746 | 3300013100 | Ga0157373_10015891 | Ga0157373_100158914 | 329 |
| 747 | 3300013100 | Ga0157373_10071925 | Ga0157373_100719251 | 329 |
| 748 | 3300013102 | Ga0157371_10000323 | Ga0157371_1000032350 | 329 |
| 749 | 3300013102 | Ga0157371_10001092 | Ga0157371_1000109224 | 329 |
| 750 | 3300013102 | Ga0157371_10001258 | Ga0157371_1000125825 | 329 |
| 751 | 3300013104 | Ga0157370_10000038 | Ga0157370_1000003850 | 329 |
| 752 | 3300013104 | Ga0157370_10056190 | Ga0157370_100561902 | 329 |
| 753 | 3300013104 | Ga0157370_10176684 | Ga0157370_101766842 | 329 |
| 754 | 3300013104 | Ga0157370_10182491 | Ga0157370_101824912 | 329 |
| 755 | 3300013105 | Ga0157369_10008841 | Ga0157369_100088416 | 329 |
| 756 | 3300013105 | Ga0157369_10021204 | Ga0157369_100212044 | 329 |
| 757 | 3300013105 | Ga0157369_10055398 | Ga0157369_100553982 | 329 |
| 758 | 3300013105 | Ga0157369_10139563 | Ga0157369_101395631 | 329 |
| 759 | 3300013105 | Ga0157369_10419654 | Ga0157369_104196541 | 329 |
| 760 | 3300013296 | Ga0157374_10000045 | Ga0157374_1000004521 | 329 |
| 761 | 3300013306 | Ga0163162_10000820 | Ga0163162_100008206 | 329 |
| 762 | 3300013306 | Ga0163162_10482275 | Ga0163162_104822751 | 329 |
| 763 | 3300013307 | Ga0157372_10000663 | Ga0157372_1000066336 | 329 |
| 764 | 3300013307 | Ga0157372_10002748 | Ga0157372_100027488 | 329 |
| 765 | 3300013307 | Ga0157372_10007130 | Ga0157372_100071305 | 329 |
| 766 | 3300013307 | Ga0157372_10024456 | Ga0157372_100244564 | 329 |
| 767 | 3300013308 | Ga0157375_10074741 | Ga0157375_100747412 | 329 |
| 768 | 3300014497 | Ga0182008_10000483 | Ga0182008_100004835 | 329 |
| 769 | 3300014497 | Ga0182008_10001727 | Ga0182008_1000172714 | 329 |
| 770 | 3300014497 | Ga0182008_10002512 | Ga0182008_100025125 | 329 |
| 771 | 3300014497 | Ga0182008_10023541 | Ga0182008_100235412 | 329 |
| 772 | 3300014497 | Ga0182008_10034108 | Ga0182008_100341083 | 329 |
| 773 | 3300014969 | Ga0157376_10000309 | Ga0157376_100003099 | 329 |
| 774 | 3300015261 | Ga0182006_1001817 | Ga0182006_10018176 | 329 |
| 775 | 3300015261 | Ga0182006_1004331 | Ga0182006_10043314 | 329 |
| 776 | 3300015261 | Ga0182006_1004638 | Ga0182006_10046383 | 329 |
| 777 | 3300015261 | Ga0182006_1014999 | Ga0182006_10149992 | 329 |
| 778 | 3300015261 | Ga0182006_1015539 | Ga0182006_10155392 | 329 |
| 779 | 3300015262 | Ga0182007_10002175 | Ga0182007_100021753 | 329 |
| 780 | 3300015262 | Ga0182007_10011984 | Ga0182007_100119843 | 329 |
| 781 | 3300015262 | Ga0182007_10018272 | Ga0182007_100182722 | 329 |
| 782 | 3300015265 | Ga0182005_1001689 | Ga0182005_10016893 | 329 |
| 783 | 3300015265 | Ga0182005_1011469 | Ga0182005_10114692 | 329 |
| 784 | 3300015265 | Ga0182005_1011882 | Ga0182005_10118821 | 329 |
| 785 | 3300017792 | Ga0163161_10005444 | Ga0163161_100054445 | 329 |
| 786 | 3300017792 | Ga0163161_10013673 | Ga0163161_100136739 | 329 |
| 787 | 3300017792 | Ga0163161_10014430 | Ga0163161_100144309 | 329 |
| 788 | 3300017792 | Ga0163161_10043460 | Ga0163161_100434601 | 329 |
| 789 | 3300017792 | Ga0163161_10061444 | Ga0163161_100614442 | 329 |
| 790 | 3300017792 | Ga0163161_10085930 | Ga0163161_100859302 | 329 |
| 791 | 3300017792 | Ga0163161_10111901 | Ga0163161_101119012 | 329 |
| 792 | 3300020077 | Ga0206351_10707377 | Ga0206351_107073771 | 329 |
| 793 | 3300020610 | Ga0154015_1546600 | Ga0154015_15466002 | 329 |
| 794 | 3300025206 | Ga0209435_101037 | Ga0209435_1010376 | 329 |
| 795 | 3300025207 | Ga0209760_100028 | Ga0209760_10002851 | 329 |
| 796 | 3300025207 | Ga0209760_100095 | Ga0209760_1000959 | 329 |
| 797 | 3300025224 | Ga0209784_100006 | Ga0209784_100006105 | 329 |
| 798 | 3300025224 | Ga0209784_100108 | Ga0209784_10010820 | 329 |
| 799 | 3300025224 | Ga0209784_100126 | Ga0209784_10012665 | 329 |
| 800 | 3300025224 | Ga0209784_100846 | Ga0209784_1008464 | 329 |
| 801 | 3300025225 | Ga0209566_100002 | Ga0209566_100002105 | 329 |
| 802 | 3300025225 | Ga0209566_100152 | Ga0209566_10015265 | 329 |
| 803 | 3300025225 | Ga0209566_100602 | Ga0209566_1006024 | 329 |
| 804 | 3300025225 | Ga0209566_103317 | Ga0209566_1033172 | 329 |
| 805 | 3300025226 | Ga0209674_100097 | Ga0209674_100097105 | 329 |
| 806 | 3300025226 | Ga0209674_100168 | Ga0209674_10016869 | 329 |
| 807 | 3300025226 | Ga0209674_100177 | Ga0209674_10017765 | 329 |
| 808 | 3300025226 | Ga0209674_101230 | Ga0209674_1012303 | 329 |
| 809 | 3300025229 | Ga0209147_100018 | Ga0209147_100018395 | 329 |
| 810 | 3300025229 | Ga0209147_100179 | Ga0209147_10017965 | 329 |
| 811 | 3300025230 | Ga0209563_100041 | Ga0209563_100041367 | 329 |
| 812 | 3300025230 | Ga0209563_100142 | Ga0209563_10014265 | 329 |
| 813 | 3300025230 | Ga0209563_101244 | Ga0209563_1012448 | 329 |
| 814 | 3300025230 | Ga0209563_104405 | Ga0209563_1044053 | 329 |
| 815 | 3300025231 | Ga0207427_100007 | Ga0207427_10000749 | 329 |
| 816 | 3300025231 | Ga0207427_100008 | Ga0207427_100008121 | 329 |
| 817 | 3300025233 | Ga0209437_100006 | Ga0209437_100006315 | 329 |
| 818 | 3300025233 | Ga0209437_100014 | Ga0209437_100014590 | 329 |
| 819 | 3300025242 | Ga0209258_100028 | Ga0209258_100028395 | 329 |
| 820 | 3300025242 | Ga0209258_100366 | Ga0209258_10036611 | 329 |
| 821 | 3300025246 | Ga0209646_1000153 | Ga0209646_100015350 | 329 |
| 822 | 3300025246 | Ga0209646_1000465 | Ga0209646_10004658 | 329 |
| 823 | 3300025253 | Ga0209677_100007 | Ga0209677_100007105 | 329 |
| 824 | 3300025253 | Ga0209677_100125 | Ga0209677_10012565 | 329 |
| 825 | 3300025254 | Ga0209148_1000297 | Ga0209148_100029722 | 329 |
| 826 | 3300025256 | Ga0209759_1002551 | Ga0209759_10025514 | 329 |
| 827 | 3300025256 | Ga0209759_1002829 | Ga0209759_10028294 | 329 |
| 828 | 3300025256 | Ga0209759_1007185 | Ga0209759_10071856 | 329 |
| 829 | 3300025261 | Ga0209233_1000008 | Ga0209233_1000008590 | 329 |
| 830 | 3300025261 | Ga0209233_1000086 | Ga0209233_100008649 | 329 |
| 831 | 3300025272 | Ga0209455_1000107 | Ga0209455_100010795 | 329 |
| 832 | 3300025291 | Ga0209675_1010978 | Ga0209675_10109785 | 329 |
| 833 | 3300025292 | Ga0209676_1000006 | Ga0209676_1000006297 | 329 |
| 834 | 3300025292 | Ga0209676_1000109 | Ga0209676_100010967 | 329 |
| 835 | 3300025292 | Ga0209676_1000973 | Ga0209676_100097319 | 329 |
| 836 | 3300025292 | Ga0209676_1006254 | Ga0209676_10062545 | 329 |
| 837 | 3300025298 | Ga0209050_1000070 | Ga0209050_1000070222 | 329 |
| 838 | 3300025298 | Ga0209050_1000399 | Ga0209050_100039922 | 329 |
| 839 | 3300025303 | Ga0209051_1000086 | Ga0209051_100008655 | 329 |
| 840 | 3300025303 | Ga0209051_1000106 | Ga0209051_100010695 | 329 |
| 841 | 3300025304 | Ga0209257_1017856 | Ga0209257_10178562 | 329 |
| 842 | 3300025321 | Ga0207656_10000423 | Ga0207656_1000042312 | 329 |
| 843 | 3300025711 | Ga0207696_1000044 | Ga0207696_1000044258 | 329 |
| 844 | 3300025711 | Ga0207696_1000090 | Ga0207696_100009027 | 329 |
| 845 | 3300025711 | Ga0207696_1000130 | Ga0207696_100013098 | 329 |
| 846 | 3300025711 | Ga0207696_1000144 | Ga0207696_100014419 | 329 |
| 847 | 3300025711 | Ga0207696_1002572 | Ga0207696_10025722 | 329 |
| 848 | 3300025711 | Ga0207696_1006573 | Ga0207696_10065732 | 329 |
| 849 | 3300025711 | Ga0207696_1008004 | Ga0207696_10080042 | 329 |
| 850 | 3300025711 | Ga0207696_1008761 | Ga0207696_10087612 | 329 |
| 851 | 3300025728 | Ga0207655_1000113 | Ga0207655_1000113151 | 329 |
| 852 | 3300025728 | Ga0207655_1001166 | Ga0207655_10011665 | 329 |
| 853 | 3300025728 | Ga0207655_1003265 | Ga0207655_10032654 | 329 |
| 854 | 3300025728 | Ga0207655_1004652 | Ga0207655_10046527 | 329 |
| 855 | 3300025728 | Ga0207655_1006377 | Ga0207655_10063774 | 329 |
| 856 | 3300025728 | Ga0207655_1006442 | Ga0207655_10064424 | 329 |
| 857 | 3300025728 | Ga0207655_1007851 | Ga0207655_10078518 | 329 |
| 858 | 3300025728 | Ga0207655_1013598 | Ga0207655_10135982 | 329 |
| 859 | 3300025728 | Ga0207655_1044533 | Ga0207655_10445332 | 329 |
| 860 | 3300025728 | Ga0207655_1052506 | Ga0207655_10525063 | 329 |
| 861 | 3300025735 | Ga0207713_1000013 | Ga0207713_100001318 | 329 |
| 862 | 3300025735 | Ga0207713_1000442 | Ga0207713_100044232 | 329 |
| 863 | 3300025735 | Ga0207713_1000520 | Ga0207713_100052017 | 329 |
| 864 | 3300025735 | Ga0207713_1000877 | Ga0207713_100087720 | 329 |
| 865 | 3300025735 | Ga0207713_1001968 | Ga0207713_10019687 | 329 |
| 866 | 3300025735 | Ga0207713_1003597 | Ga0207713_10035976 | 329 |
| 867 | 3300025735 | Ga0207713_1004351 | Ga0207713_10043517 | 329 |
| 868 | 3300025735 | Ga0207713_1004461 | Ga0207713_10044612 | 329 |
| 869 | 3300025735 | Ga0207713_1004479 | Ga0207713_10044794 | 329 |
| 870 | 3300025735 | Ga0207713_1006089 | Ga0207713_10060892 | 329 |
| 871 | 3300025735 | Ga0207713_1006195 | Ga0207713_10061958 | 329 |
| 872 | 3300025735 | Ga0207713_1008133 | Ga0207713_10081339 | 329 |
| 873 | 3300025913 | Ga0207695_10009088 | Ga0207695_100090886 | 329 |
| 874 | 3300025913 | Ga0207695_10148904 | Ga0207695_101489043 | 329 |
| 875 | 3300025919 | Ga0207657_10112754 | Ga0207657_101127542 | 329 |
| 876 | 3300025920 | Ga0207649_10000111 | Ga0207649_1000011157 | 329 |
| 877 | 3300025923 | Ga0207681_10008837 | Ga0207681_100088373 | 329 |
| 878 | 3300025923 | Ga0207681_10014938 | Ga0207681_100149382 | 329 |
| 879 | 3300025925 | Ga0207650_10000266 | Ga0207650_1000026649 | 329 |
| 880 | 3300025925 | Ga0207650_10000428 | Ga0207650_1000042829 | 329 |
| 881 | 3300025932 | Ga0207690_10001080 | Ga0207690_100010809 | 329 |
| 882 | 3300025933 | Ga0207706_10006074 | Ga0207706_1000607418 | 329 |
| 883 | 3300025933 | Ga0207706_10041506 | Ga0207706_100415062 | 329 |
| 884 | 3300025935 | Ga0207709_10000013 | Ga0207709_1000001337 | 329 |
| 885 | 3300025935 | Ga0207709_10001932 | Ga0207709_1000193212 | 329 |
| 886 | 3300025935 | Ga0207709_10013065 | Ga0207709_100130652 | 329 |
| 887 | 3300025945 | Ga0207679_10000105 | Ga0207679_100001059 | 329 |
| 888 | 3300025981 | Ga0207640_10000154 | Ga0207640_100001547 | 329 |
| 889 | 3300026035 | Ga0207703_10080423 | Ga0207703_100804232 | 329 |
| 890 | 3300026067 | Ga0207678_10000106 | Ga0207678_1000010657 | 329 |
| 891 | 3300026078 | Ga0207702_10000135 | Ga0207702_1000013579 | 329 |
| 892 | 3300026116 | Ga0207674_10151286 | Ga0207674_101512862 | 329 |
| 893 | 3300026116 | Ga0207674_10555863 | Ga0207674_105558631 | 329 |
| 894 | 3300027111 | Ga0209281_1000010 | Ga0209281_1000010485 | 329 |
| 895 | 3300027111 | Ga0209281_1005767 | Ga0209281_10057675 | 329 |
| 896 | 3300027111 | Ga0209281_1006162 | Ga0209281_10061625 | 329 |
| 897 | 3300027296 | Ga0209389_1000031 | Ga0209389_1000031125 | 329 |
| 898 | 3300027312 | Ga0209371_1000348 | Ga0209371_100034817 | 329 |
| 899 | 3300028379 | Ga0268266_10048574 | Ga0268266_100485742 | 329 |
| 900 | 3300028379 | Ga0268266_10265494 | Ga0268266_102654941 | 329 |
| 901 | 3300028381 | Ga0268264_10000341 | Ga0268264_1000034165 | 329 |
| 902 | 3300028577 | Ga0265318_10000033 | Ga0265318_1000003338 | 329 |
| 903 | 3300030500 | Ga0268256_1000134 | Ga0268256_100013470 | 329 |
| 904 | 3300030521 | Ga0307511_10024878 | Ga0307511_100248783 | 329 |
| 905 | 3300030521 | Ga0307511_10165360 | Ga0307511_101653602 | 329 |
| 906 | 3300030733 | Ga0314311_1063254 | Ga0314311_10632542 | 329 |
| 907 | 3300030735 | Ga0316178_1042235 | Ga0316178_10422355 | 329 |
| 908 | 3300030742 | Ga0316183_1100530 | Ga0316183_11005305 | 329 |
| 909 | 3300031235 | Ga0265330_10000029 | Ga0265330_1000002989 | 329 |
| 910 | 3300031238 | Ga0265332_10004299 | Ga0265332_100042994 | 329 |
| 911 | 3300031239 | Ga0265328_10016457 | Ga0265328_100164573 | 329 |
| 912 | 3300031240 | Ga0265320_10000062 | Ga0265320_1000006291 | 329 |
| 913 | 3300031249 | Ga0265339_10037067 | Ga0265339_100370672 | 329 |
| 914 | 3300031250 | Ga0265331_10000079 | Ga0265331_1000007935 | 329 |
| 915 | 3300031344 | Ga0265316_10019120 | Ga0265316_100191202 | 329 |
| 916 | 3300031548 | Ga0307408_100005919 | Ga0307408_1000059196 | 329 |
| 917 | 3300031548 | Ga0307408_100006681 | Ga0307408_1000066813 | 329 |
| 918 | 3300031548 | Ga0307408_100009169 | Ga0307408_1000091698 | 329 |
| 919 | 3300031548 | Ga0307408_100024887 | Ga0307408_1000248872 | 329 |
| 920 | 3300031548 | Ga0307408_100048945 | Ga0307408_1000489452 | 329 |
| 921 | 3300031548 | Ga0307408_100144913 | Ga0307408_1001449131 | 329 |
| 922 | 3300031548 | Ga0307408_100177630 | Ga0307408_1001776302 | 329 |
| 923 | 3300031548 | Ga0307408_100220735 | Ga0307408_1002207352 | 329 |
| 924 | 3300031595 | Ga0265313_10000344 | Ga0265313_1000034428 | 329 |
| 925 | 3300031711 | Ga0265314_10000138 | Ga0265314_1000013812 | 329 |
| 926 | 3300031731 | Ga0307405_10001021 | Ga0307405_100010214 | 329 |
| 927 | 3300031731 | Ga0307405_10002099 | Ga0307405_100020994 | 329 |
| 928 | 3300031731 | Ga0307405_10032339 | Ga0307405_100323394 | 329 |
| 929 | 3300031824 | Ga0307413_10002828 | Ga0307413_100028285 | 329 |
| 930 | 3300031824 | Ga0307413_10057066 | Ga0307413_100570662 | 329 |
| 931 | 3300031852 | Ga0307410_10007569 | Ga0307410_100075694 | 329 |
| 932 | 3300031901 | Ga0307406_10141122 | Ga0307406_101411221 | 329 |
| 933 | 3300031903 | Ga0307407_10015054 | Ga0307407_100150542 | 329 |
| 934 | 3300031903 | Ga0307407_10027783 | Ga0307407_100277833 | 329 |
| 935 | 3300031903 | Ga0307407_10038255 | Ga0307407_100382551 | 329 |
| 936 | 3300031911 | Ga0307412_10002264 | Ga0307412_100022645 | 329 |
| 937 | 3300031911 | Ga0307412_10005050 | Ga0307412_100050509 | 329 |
| 938 | 3300031911 | Ga0307412_10017840 | Ga0307412_100178402 | 329 |
| 939 | 3300031911 | Ga0307412_10022573 | Ga0307412_100225732 | 329 |
| 940 | 3300031911 | Ga0307412_10111948 | Ga0307412_101119482 | 329 |
| 941 | 3300031911 | Ga0307412_10135198 | Ga0307412_101351982 | 329 |
| 942 | 3300031911 | Ga0307412_10175422 | Ga0307412_101754222 | 329 |
| 943 | 3300031995 | Ga0307409_100001842 | Ga0307409_1000018428 | 329 |
| 944 | 3300031995 | Ga0307409_100090062 | Ga0307409_1000900622 | 329 |
| 945 | 3300031995 | Ga0307409_100231795 | Ga0307409_1002317951 | 329 |
| 946 | 3300031995 | Ga0307409_100362701 | Ga0307409_1003627011 | 329 |
| 947 | 3300032002 | Ga0307416_100004045 | Ga0307416_1000040456 | 329 |
| 948 | 3300032002 | Ga0307416_100071689 | Ga0307416_1000716892 | 329 |
| 949 | 3300032004 | Ga0307414_10130885 | Ga0307414_101308853 | 329 |
| 950 | 3300032004 | Ga0307414_10161927 | Ga0307414_101619271 | 329 |
| 951 | 3300032004 | Ga0307414_10293656 | Ga0307414_102936562 | 329 |
| 952 | 3300032005 | Ga0307411_10001241 | Ga0307411_100012414 | 329 |
| 953 | 3300032005 | Ga0307411_10028369 | Ga0307411_100283691 | 329 |
| 954 | 3300032005 | Ga0307411_10080620 | Ga0307411_100806201 | 329 |
| 955 | 3300032005 | Ga0307411_10082852 | Ga0307411_100828522 | 329 |
| 956 | 3300032126 | Ga0307415_100005809 | Ga0307415_1000058095 | 329 |
| 957 | 3300033180 | Ga0307510_10013692 | Ga0307510_100136925 | 329 |
| 958 | 3300036647 | Ga0316582_0153412 | Ga0316582_0153412_283_1293 | 329 |
| 959 | 3300037418 | Ga0395900_0014044 | Ga0395900_0014044_5052_6047 | 329 |
| 960 | 3300037471 | Ga0395905_0033055 | Ga0395905_0033055_1182_2219 | 329 |
| 961 | 3300037588 | Ga0316581_0029471 | Ga0316581_0029471_461_1471 | 329 |
| 962 | 3300041405 | Ga0439438_003350 | Ga0439438_003350_2709_3755 | 329 |
| 963 | 3300041405 | Ga0439438_006671 | Ga0439438_006671_559_1548 | 329 |
| 964 | 3300041405 | Ga0439438_007036 | Ga0439438_007036_1144_2133 | 329 |
| 965 | 3300041405 | Ga0439438_008145 | Ga0439438_008145_746_1792 | 329 |
| 966 | 3300041405 | Ga0439438_017553 | Ga0439438_017553_476_1465 | 329 |
| 967 | 3300041405 | Ga0439438_018413 | Ga0439438_018413_526_1515 | 329 |
| 968 | 3300041407 | Ga0439447_002028 | Ga0439447_002028_4627_5736 | 329 |
| 969 | 3300041411 | Ga0439466_0000576 | Ga0439466_0000576_6752_7741 | 329 |
| 970 | 3300041411 | Ga0439466_0009827 | Ga0439466_0009827_1564_2553 | 329 |
| 971 | 3300041411 | Ga0439466_0011451 | Ga0439466_0011451_1737_2726 | 329 |
| 972 | 3300041411 | Ga0439466_0021798 | Ga0439466_0021798_1030_2139 | 329 |
| 973 | 3300041411 | Ga0439466_0024369 | Ga0439466_0024369_431_1420 | 329 |
| 974 | 3300042006 | Ga0439432_003737 | Ga0439432_003737_646_1635 | 329 |
| 975 | 3300042006 | Ga0439432_003969 | Ga0439432_003969_4403_5392 | 329 |
| 976 | 3300042006 | Ga0439432_062703 | Ga0439432_062703_108_1097 | 329 |
| 977 | 3300042009 | Ga0439451_004554 | Ga0439451_004554_645_1634 | 329 |
| 978 | 3300042009 | Ga0439451_006133 | Ga0439451_006133_248_1237 | 329 |
| 979 | 3300042009 | Ga0439451_013262 | Ga0439451_013262_589_1578 | 329 |
| 980 | 3300042010 | Ga0439452_000385 | Ga0439452_000385_6032_7021 | 329 |
| 981 | 3300042010 | Ga0439452_023243 | Ga0439452_023243_244_1233 | 329 |
| 982 | 3300042013 | Ga0439456_000112 | Ga0439456_000112_8615_9604 | 329 |
| 983 | 3300042013 | Ga0439456_012493 | Ga0439456_012493_259_1248 | 329 |
| 984 | 3300042016 | Ga0439463_003967 | Ga0439463_003967_1988_3010 | 329 |
| 985 | 3300042115 | Ga0450911_000164 | Ga0450911_000164_5750_6739 | 329 |
| 986 | 3300042136 | Ga0450900_000339 | Ga0450900_000339_717_1706 | 329 |
| 987 | 3300042136 | Ga0450900_005342 | Ga0450900_005342_104_1093 | 329 |
| 988 | 3300042139 | Ga0450904_001639 | Ga0450904_001639_799_1788 | 329 |
| 989 | 3300042139 | Ga0450904_002044 | Ga0450904_002044_1075_2064 | 329 |
| 990 | 3300042142 | Ga0450905_000699 | Ga0450905_000699_2973_3962 | 329 |
| 991 | 3300042533 | Ga0450901_000917 | Ga0450901_000917_1638_2627 | 329 |
| 992 | 3300042993 | Ga0439440_0006923 | Ga0439440_0006923_942_1964 | 329 |
| 993 | 3300046452 | Ga0495617_000491 | Ga0495617_000491_13226_14215 | 329 |
| 994 | 3300046452 | Ga0495617_007572 | Ga0495617_007572_1550_2539 | 329 |
| 995 | 3300046452 | Ga0495617_008183 | Ga0495617_008183_1523_2530 | 329 |
| 996 | 3300046452 | Ga0495617_018006 | Ga0495617_018006_650_1639 | 329 |
| 997 | 3300046452 | Ga0495617_018952 | Ga0495617_018952_857_1846 | 329 |
| 998 | 3300046452 | Ga0495617_020715 | Ga0495617_020715_652_1659 | 329 |
| 999 | 3300046452 | Ga0495617_021143 | Ga0495617_021143_588_1595 | 329 |
| 1000 | 3300046452 | Ga0495617_043083 | Ga0495617_043083_122_1111 | 329 |
| 1001 | 3300046453 | Ga0495627_000130 | Ga0495627_000130_21367_22356 | 329 |
| 1002 | 3300046453 | Ga0495627_000678 | Ga0495627_000678_19250_20257 | 329 |
| 1003 | 3300046453 | Ga0495627_000738 | Ga0495627_000738_7758_8747 | 329 |
| 1004 | 3300046453 | Ga0495627_012248 | Ga0495627_012248_642_1649 | 329 |
| 1005 | 3300046453 | Ga0495627_032885 | Ga0495627_032885_435_1424 | 329 |
| 1006 | 3300046455 | Ga0495603_0074338 | Ga0495603_0074338_400_1401 | 329 |
| 1007 | 3300046455 | Ga0495603_0133081 | Ga0495603_0133081_338_1327 | 329 |
| 1008 | 3300046457 | Ga0495590_0001655 | Ga0495590_0001655_6210_7199 | 329 |
| 1009 | 3300046457 | Ga0495590_0003189 | Ga0495590_0003189_1449_2456 | 329 |
| 1010 | 3300046458 | Ga0495591_001825 | Ga0495591_001825_5449_6456 | 329 |
| 1011 | 3300046458 | Ga0495591_003562 | Ga0495591_003562_5076_6083 | 329 |
| 1012 | 3300046458 | Ga0495591_007562 | Ga0495591_007562_1746_2753 | 329 |
| 1013 | 3300046458 | Ga0495591_010643 | Ga0495591_010643_588_1577 | 329 |
| 1014 | 3300046458 | Ga0495591_013535 | Ga0495591_013535_1190_2197 | 329 |
| 1015 | 3300046458 | Ga0495591_020522 | Ga0495591_020522_543_1550 | 329 |
| 1016 | 3300046458 | Ga0495591_021474 | Ga0495591_021474_441_1448 | 329 |
| 1017 | 3300046460 | Ga0495638_0043309 | Ga0495638_0043309_602_1591 | 329 |
| 1018 | 3300046462 | Ga0495651_0019804 | Ga0495651_0019804_1733_2749 | 329 |
| 1019 | 3300046463 | Ga0495653_0006683 | Ga0495653_0006683_6789_7778 | 329 |
| 1020 | 3300046471 | Ga0495650_0006424 | Ga0495650_0006424_1438_2445 | 329 |
| 1021 | 3300046471 | Ga0495650_0007388 | Ga0495650_0007388_5495_6502 | 329 |
| 1022 | 3300046471 | Ga0495650_0007821 | Ga0495650_0007821_3852_4841 | 329 |
| 1023 | 3300046471 | Ga0495650_0008168 | Ga0495650_0008168_3829_4863 | 329 |
| 1024 | 3300046471 | Ga0495650_0025963 | Ga0495650_0025963_957_1946 | 329 |
| 1025 | 3300046471 | Ga0495650_0061277 | Ga0495650_0061277_172_1179 | 329 |
| 1026 | 3300046471 | Ga0495650_0061278 | Ga0495650_0061278_329_1336 | 329 |
| 1027 | 3300046474 | Ga0495605_0000125 | Ga0495605_0000125_68931_69920 | 329 |
| 1028 | 3300046474 | Ga0495605_0020040 | Ga0495605_0020040_982_1989 | 329 |
| 1029 | 3300046474 | Ga0495605_0029467 | Ga0495605_0029467_632_1702 | 329 |
| 1030 | 3300046474 | Ga0495605_0035701 | Ga0495605_0035701_343_1332 | 329 |
| 1031 | 3300046474 | Ga0495605_0037191 | Ga0495605_0037191_855_1862 | 329 |
| 1032 | 3300046474 | Ga0495605_0038840 | Ga0495605_0038840_329_1318 | 329 |
| 1033 | 3300046474 | Ga0495605_0053038 | Ga0495605_0053038_951_1940 | 329 |
| 1034 | 3300046474 | Ga0495605_0067400 | Ga0495605_0067400_179_1168 | 329 |
| 1035 | 3300046475 | Ga0495639_0001007 | Ga0495639_0001007_4712_5701 | 329 |
| 1036 | 3300046477 | Ga0495664_0067807 | Ga0495664_0067807_506_1504 | 329 |
| 1037 | 3300046491 | Ga0495584_0003136 | Ga0495584_0003136_3592_4581 | 329 |
| 1038 | 3300046491 | Ga0495584_0003623 | Ga0495584_0003623_4288_5277 | 329 |
| 1039 | 3300046491 | Ga0495584_0022348 | Ga0495584_0022348_606_1637 | 329 |
| 1040 | 3300046491 | Ga0495584_0029759 | Ga0495584_0029759_1646_2635 | 329 |
| 1041 | 3300046491 | Ga0495584_0040369 | Ga0495584_0040369_563_1570 | 329 |
| 1042 | 3300046491 | Ga0495584_0047168 | Ga0495584_0047168_525_1532 | 329 |
| 1043 | 3300046492 | Ga0495585_0011254 | Ga0495585_0011254_2803_3810 | 329 |
| 1044 | 3300046492 | Ga0495585_0026516 | Ga0495585_0026516_1661_2668 | 329 |
| 1045 | 3300046492 | Ga0495585_0030156 | Ga0495585_0030156_867_1874 | 329 |
| 1046 | 3300046492 | Ga0495585_0063137 | Ga0495585_0063137_386_1393 | 329 |
| 1047 | 3300046492 | Ga0495585_0090819 | Ga0495585_0090819_549_1538 | 329 |
| 1048 | 3300046499 | Ga0495594_0000599 | Ga0495594_0000599_4363_5352 | 329 |
| 1049 | 3300046499 | Ga0495594_0031316 | Ga0495594_0031316_850_1851 | 329 |
| 1050 | 3300046501 | Ga0495607_0001590 | Ga0495607_0001590_8627_9616 | 329 |
| 1051 | 3300046501 | Ga0495607_0004594 | Ga0495607_0004594_5616_6605 | 329 |
| 1052 | 3300046501 | Ga0495607_0005901 | Ga0495607_0005901_6345_7334 | 329 |
| 1053 | 3300046501 | Ga0495607_0007213 | Ga0495607_0007213_4939_5946 | 329 |
| 1054 | 3300046501 | Ga0495607_0007419 | Ga0495607_0007419_5107_6114 | 329 |
| 1055 | 3300046501 | Ga0495607_0008794 | Ga0495607_0008794_1436_2425 | 329 |
| 1056 | 3300046501 | Ga0495607_0018033 | Ga0495607_0018033_1522_2511 | 329 |
| 1057 | 3300046501 | Ga0495607_0020946 | Ga0495607_0020946_1152_2141 | 329 |
| 1058 | 3300046501 | Ga0495607_0060716 | Ga0495607_0060716_552_1541 | 329 |
| 1059 | 3300046506 | Ga0495583_0000196 | Ga0495583_0000196_68865_69854 | 329 |
| 1060 | 3300046506 | Ga0495583_0002387 | Ga0495583_0002387_13143_14132 | 329 |
| 1061 | 3300046506 | Ga0495583_0018232 | Ga0495583_0018232_1817_2824 | 329 |
| 1062 | 3300046506 | Ga0495583_0039104 | Ga0495583_0039104_109_1098 | 329 |
| 1063 | 3300046506 | Ga0495583_0044448 | Ga0495583_0044448_595_1626 | 329 |
| 1064 | 3300046507 | Ga0495606_0004170 | Ga0495606_0004170_8897_9904 | 329 |
| 1065 | 3300046507 | Ga0495606_0005485 | Ga0495606_0005485_5855_6862 | 329 |
| 1066 | 3300046507 | Ga0495606_0035305 | Ga0495606_0035305_638_1645 | 329 |
| 1067 | 3300046507 | Ga0495606_0038139 | Ga0495606_0038139_1759_2766 | 329 |
| 1068 | 3300046507 | Ga0495606_0050495 | Ga0495606_0050495_407_1414 | 329 |
| 1069 | 3300046507 | Ga0495606_0071879 | Ga0495606_0071879_1016_2005 | 329 |
| 1070 | 3300046507 | Ga0495606_0084158 | Ga0495606_0084158_119_1108 | 329 |
| 1071 | 3300046512 | Ga0495610_0002150 | Ga0495610_0002150_8777_9784 | 329 |
| 1072 | 3300046512 | Ga0495610_0004952 | Ga0495610_0004952_8429_9418 | 329 |
| 1073 | 3300046512 | Ga0495610_0005624 | Ga0495610_0005624_4919_5926 | 329 |
| 1074 | 3300046512 | Ga0495610_0017516 | Ga0495610_0017516_1928_2917 | 329 |
| 1075 | 3300046513 | Ga0495616_0000846 | Ga0495616_0000846_1821_2828 | 329 |
| 1076 | 3300046513 | Ga0495616_0002466 | Ga0495616_0002466_4739_5728 | 329 |
| 1077 | 3300046513 | Ga0495616_0006003 | Ga0495616_0006003_1486_2493 | 329 |
| 1078 | 3300046513 | Ga0495616_0017760 | Ga0495616_0017760_2343_3350 | 329 |
| 1079 | 3300046513 | Ga0495616_0025846 | Ga0495616_0025846_806_1795 | 329 |
| 1080 | 3300046513 | Ga0495616_0035429 | Ga0495616_0035429_631_1638 | 329 |
| 1081 | 3300046515 | Ga0495620_0000003 | Ga0495620_0000003_209245_210234 | 329 |
| 1082 | 3300046515 | Ga0495620_0000055 | Ga0495620_0000055_31330_32319 | 329 |
| 1083 | 3300046515 | Ga0495620_0002668 | Ga0495620_0002668_6976_7983 | 329 |
| 1084 | 3300046515 | Ga0495620_0016857 | Ga0495620_0016857_1007_1996 | 329 |
| 1085 | 3300046515 | Ga0495620_0018067 | Ga0495620_0018067_2280_3287 | 329 |
| 1086 | 3300046515 | Ga0495620_0024440 | Ga0495620_0024440_814_1803 | 329 |
| 1087 | 3300046515 | Ga0495620_0031372 | Ga0495620_0031372_248_1255 | 329 |
| 1088 | 3300046515 | Ga0495620_0035367 | Ga0495620_0035367_764_1771 | 329 |
| 1089 | 3300046517 | Ga0495630_0106308 | Ga0495630_0106308_568_1638 | 329 |
| 1090 | 3300046518 | Ga0495631_0000403 | Ga0495631_0000403_22761_23750 | 329 |
| 1091 | 3300046518 | Ga0495631_0002343 | Ga0495631_0002343_8129_9118 | 329 |
| 1092 | 3300046518 | Ga0495631_0003513 | Ga0495631_0003513_1625_2632 | 329 |
| 1093 | 3300046518 | Ga0495631_0010248 | Ga0495631_0010248_1867_2856 | 329 |
| 1094 | 3300046518 | Ga0495631_0045743 | Ga0495631_0045743_433_1440 | 329 |
| 1095 | 3300046518 | Ga0495631_0087283 | Ga0495631_0087283_189_1196 | 329 |
| 1096 | 3300046519 | Ga0495632_0003227 | Ga0495632_0003227_4861_5868 | 329 |
| 1097 | 3300046519 | Ga0495632_0003468 | Ga0495632_0003468_4895_5884 | 329 |
| 1098 | 3300046519 | Ga0495632_0008801 | Ga0495632_0008801_2442_3449 | 329 |
| 1099 | 3300046519 | Ga0495632_0013378 | Ga0495632_0013378_1760_2749 | 329 |
| 1100 | 3300046519 | Ga0495632_0028525 | Ga0495632_0028525_857_1864 | 329 |
| 1101 | 3300046519 | Ga0495632_0038253 | Ga0495632_0038253_604_1611 | 329 |
| 1102 | 3300046519 | Ga0495632_0041297 | Ga0495632_0041297_1045_2034 | 329 |
| 1103 | 3300046519 | Ga0495632_0081253 | Ga0495632_0081253_109_1098 | 329 |
| 1104 | 3300046519 | Ga0495632_0094292 | Ga0495632_0094292_245_1234 | 329 |
| 1105 | 3300046520 | Ga0495637_0002882 | Ga0495637_0002882_4034_5023 | 329 |
| 1106 | 3300046520 | Ga0495637_0003063 | Ga0495637_0003063_4998_6005 | 329 |
| 1107 | 3300046520 | Ga0495637_0011675 | Ga0495637_0011675_1633_2622 | 329 |
| 1108 | 3300046520 | Ga0495637_0025297 | Ga0495637_0025297_653_1660 | 329 |
| 1109 | 3300046520 | Ga0495637_0028927 | Ga0495637_0028927_1314_2303 | 329 |
| 1110 | 3300046520 | Ga0495637_0035448 | Ga0495637_0035448_546_1553 | 329 |
| 1111 | 3300046520 | Ga0495637_0035484 | Ga0495637_0035484_533_1540 | 329 |
| 1112 | 3300046520 | Ga0495637_0053178 | Ga0495637_0053178_605_1594 | 329 |
| 1113 | 3300046522 | Ga0495643_0000319 | Ga0495643_0000319_4139_5128 | 329 |
| 1114 | 3300046522 | Ga0495643_0006752 | Ga0495643_0006752_647_1654 | 329 |
| 1115 | 3300046522 | Ga0495643_0006925 | Ga0495643_0006925_4681_5670 | 329 |
| 1116 | 3300046522 | Ga0495643_0008963 | Ga0495643_0008963_3444_4433 | 329 |
| 1117 | 3300046522 | Ga0495643_0045252 | Ga0495643_0045252_733_1722 | 329 |
| 1118 | 3300046522 | Ga0495643_0052074 | Ga0495643_0052074_637_1644 | 329 |
| 1119 | 3300046523 | Ga0495644_0037358 | Ga0495644_0037358_307_1314 | 329 |
| 1120 | 3300046524 | Ga0495648_0002744 | Ga0495648_0002744_8620_9609 | 329 |
| 1121 | 3300046524 | Ga0495648_0003294 | Ga0495648_0003294_9070_10059 | 329 |
| 1122 | 3300046524 | Ga0495648_0006599 | Ga0495648_0006599_5695_6684 | 329 |
| 1123 | 3300046524 | Ga0495648_0006625 | Ga0495648_0006625_4390_5397 | 329 |
| 1124 | 3300046524 | Ga0495648_0010717 | Ga0495648_0010717_4419_5408 | 329 |
| 1125 | 3300046524 | Ga0495648_0013998 | Ga0495648_0013998_3403_4410 | 329 |
| 1126 | 3300046524 | Ga0495648_0036735 | Ga0495648_0036735_1095_2084 | 329 |
| 1127 | 3300046524 | Ga0495648_0041162 | Ga0495648_0041162_1270_2259 | 329 |
| 1128 | 3300046524 | Ga0495648_0064793 | Ga0495648_0064793_409_1416 | 329 |
| 1129 | 3300046528 | Ga0495642_0008500 | Ga0495642_0008500_2596_3585 | 329 |
| 1130 | 3300046530 | Ga0495654_0001040 | Ga0495654_0001040_8954_9943 | 329 |
| 1131 | 3300046530 | Ga0495654_0002193 | Ga0495654_0002193_6985_7992 | 329 |
| 1132 | 3300046530 | Ga0495654_0005540 | Ga0495654_0005540_4865_5854 | 329 |
| 1133 | 3300046530 | Ga0495654_0012813 | Ga0495654_0012813_731_1738 | 329 |
| 1134 | 3300046530 | Ga0495654_0013376 | Ga0495654_0013376_2873_3880 | 329 |
| 1135 | 3300046530 | Ga0495654_0014747 | Ga0495654_0014747_1246_2247 | 329 |
| 1136 | 3300046530 | Ga0495654_0022694 | Ga0495654_0022694_1932_2921 | 329 |
| 1137 | 3300046530 | Ga0495654_0023244 | Ga0495654_0023244_82_1071 | 329 |
| 1138 | 3300046530 | Ga0495654_0037775 | Ga0495654_0037775_687_1676 | 329 |
| 1139 | 3300046530 | Ga0495654_0046495 | Ga0495654_0046495_627_1634 | 329 |
| 1140 | 3300046530 | Ga0495654_0058316 | Ga0495654_0058316_609_1598 | 329 |
| 1141 | 3300046536 | Ga0495587_0001552 | Ga0495587_0001552_7421_8491 | 329 |
| 1142 | 3300046538 | Ga0495609_0000412 | Ga0495609_0000412_3364_4353 | 329 |
| 1143 | 3300046538 | Ga0495609_0002027 | Ga0495609_0002027_6752_7759 | 329 |
| 1144 | 3300046538 | Ga0495609_0014786 | Ga0495609_0014786_2648_3637 | 329 |
| 1145 | 3300046538 | Ga0495609_0031227 | Ga0495609_0031227_564_1571 | 329 |
| 1146 | 3300046538 | Ga0495609_0034887 | Ga0495609_0034887_733_1740 | 329 |
| 1147 | 3300046538 | Ga0495609_0076195 | Ga0495609_0076195_337_1344 | 329 |
| 1148 | 3300046542 | Ga0495597_0000097 | Ga0495597_0000097_16148_17137 | 329 |
| 1149 | 3300046542 | Ga0495597_0001638 | Ga0495597_0001638_8952_9959 | 329 |
| 1150 | 3300046542 | Ga0495597_0009054 | Ga0495597_0009054_1630_2619 | 329 |
| 1151 | 3300046542 | Ga0495597_0014532 | Ga0495597_0014532_789_1778 | 329 |
| 1152 | 3300046542 | Ga0495597_0037741 | Ga0495597_0037741_235_1224 | 329 |
| 1153 | 3300046542 | Ga0495597_0041823 | Ga0495597_0041823_493_1500 | 329 |
| 1154 | 3300046542 | Ga0495597_0053787 | Ga0495597_0053787_689_1678 | 329 |
| 1155 | 3300046557 | Ga0495622_0001580 | Ga0495622_0001580_4641_5630 | 329 |
| 1156 | 3300046557 | Ga0495622_0001672 | Ga0495622_0001672_5910_6917 | 329 |
| 1157 | 3300046557 | Ga0495622_0020630 | Ga0495622_0020630_24_1025 | 329 |
| 1158 | 3300046558 | Ga0495633_0000134 | Ga0495633_0000134_67325_68314 | 329 |
| 1159 | 3300046558 | Ga0495633_0006724 | Ga0495633_0006724_1553_2560 | 329 |
| 1160 | 3300046558 | Ga0495633_0011897 | Ga0495633_0011897_1484_2473 | 329 |
| 1161 | 3300046616 | Ga0495668_0003494 | Ga0495668_0003494_6737_7744 | 329 |
| 1162 | 3300046616 | Ga0495668_0046545 | Ga0495668_0046545_518_1525 | 329 |
| 1163 | 3300046642 | Ga0495634_0004253 | Ga0495634_0004253_8575_9645 | 329 |
| 1164 | 3300046642 | Ga0495634_0062713 | Ga0495634_0062713_641_1630 | 329 |
| 1165 | 3300046648 | Ga0495611_0001167 | Ga0495611_0001167_338_1327 | 329 |
| 1166 | 3300046648 | Ga0495611_0002390 | Ga0495611_0002390_1782_2789 | 329 |
| 1167 | 3300046648 | Ga0495611_0034414 | Ga0495611_0034414_582_1589 | 329 |
| 1168 | 3300046648 | Ga0495611_0042599 | Ga0495611_0042599_719_1708 | 329 |
| 1169 | 3300046660 | Ga0495625_0008796 | Ga0495625_0008796_1523_2530 | 329 |
| 1170 | 3300046660 | Ga0495625_0010198 | Ga0495625_0010198_5099_6106 | 329 |
| 1171 | 3300046660 | Ga0495625_0031393 | Ga0495625_0031393_1798_2787 | 329 |
| 1172 | 3300046660 | Ga0495625_0052272 | Ga0495625_0052272_602_1609 | 329 |
| 1173 | 3300046660 | Ga0495625_0108718 | Ga0495625_0108718_646_1653 | 329 |
| 1174 | 3300046660 | Ga0495625_0139380 | Ga0495625_0139380_87_1094 | 329 |
| 1175 | 3300046663 | Ga0495635_0017323 | Ga0495635_0017323_2526_3596 | 329 |
| 1176 | 3300046664 | Ga0495659_0000880 | Ga0495659_0000880_4688_5677 | 329 |
| 1177 | 3300046664 | Ga0495659_0014805 | Ga0495659_0014805_866_1855 | 329 |
| 1178 | 3300046665 | Ga0495661_0000434 | Ga0495661_0000434_31459_32448 | 329 |
| 1179 | 3300046665 | Ga0495661_0000961 | Ga0495661_0000961_16593_17582 | 329 |
| 1180 | 3300046665 | Ga0495661_0009351 | Ga0495661_0009351_73_1062 | 329 |
| 1181 | 3300046665 | Ga0495661_0035857 | Ga0495661_0035857_900_1889 | 329 |
| 1182 | 3300046665 | Ga0495661_0049579 | Ga0495661_0049579_1055_2044 | 329 |
| 1183 | 3300046665 | Ga0495661_0050211 | Ga0495661_0050211_869_1876 | 329 |
| 1184 | 3300046680 | Ga0495646_0016771 | Ga0495646_0016771_810_1799 | 329 |
| 1185 | 3300046680 | Ga0495646_0079342 | Ga0495646_0079342_546_1616 | 329 |
| 1186 | 3300046689 | Ga0495613_0125086 | Ga0495613_0125086_331_1338 | 329 |
| 1187 | 3300046690 | Ga0495624_0004697 | Ga0495624_0004697_2026_3015 | 329 |
| 1188 | 3300046691 | Ga0495670_0001238 | Ga0495670_0001238_6484_7491 | 329 |
| 1189 | 3300046691 | Ga0495670_0003785 | Ga0495670_0003785_4904_5893 | 329 |
| 1190 | 3300046691 | Ga0495670_0016658 | Ga0495670_0016658_1918_2919 | 329 |
| 1191 | 3300046691 | Ga0495670_0028083 | Ga0495670_0028083_443_1432 | 329 |
| 1192 | 3300046691 | Ga0495670_0049170 | Ga0495670_0049170_884_1873 | 329 |
| 1193 | 3300046692 | Ga0495671_0007792 | Ga0495671_0007792_1484_2473 | 329 |
| 1194 | 3300046692 | Ga0495671_0019690 | Ga0495671_0019690_1992_2999 | 329 |
| 1195 | 3300046692 | Ga0495671_0033590 | Ga0495671_0033590_1248_2237 | 329 |
| 1196 | 3300046692 | Ga0495671_0046790 | Ga0495671_0046790_533_1540 | 329 |
| 1197 | 3300046694 | Ga0495649_0002318 | Ga0495649_0002318_5729_6718 | 329 |
| 1198 | 3300046694 | Ga0495649_0006225 | Ga0495649_0006225_1432_2439 | 329 |
| 1199 | 3300046694 | Ga0495649_0023398 | Ga0495649_0023398_644_1651 | 329 |
| 1200 | 3300046694 | Ga0495649_0024703 | Ga0495649_0024703_1143_2132 | 329 |
| 1201 | 3300046694 | Ga0495649_0029524 | Ga0495649_0029524_1296_2303 | 329 |
| 1202 | 3300046694 | Ga0495649_0079465 | Ga0495649_0079465_550_1539 | 329 |
| 1203 | 3300046794 | Ga0495589_0000447 | Ga0495589_0000447_19817_20806 | 329 |
| 1204 | 3300046794 | Ga0495589_0000771 | Ga0495589_0000771_5939_6928 | 329 |
| 1205 | 3300046794 | Ga0495589_0001962 | Ga0495589_0001962_4887_5894 | 329 |
| 1206 | 3300046794 | Ga0495589_0009641 | Ga0495589_0009641_1345_2334 | 329 |
| 1207 | 3300046794 | Ga0495589_0052246 | Ga0495589_0052246_552_1559 | 329 |
| 1208 | 3300046794 | Ga0495589_0061380 | Ga0495589_0061380_432_1421 | 329 |
| 1209 | 3300046809 | Ga0495600_0038024 | Ga0495600_0038024_698_1687 | 329 |
| 1210 | 3300046810 | Ga0495660_0002230 | Ga0495660_0002230_6648_7637 | 329 |
| 1211 | 3300046810 | Ga0495660_0005722 | Ga0495660_0005722_2165_3154 | 329 |
| 1212 | 3300046810 | Ga0495660_0006186 | Ga0495660_0006186_3819_4826 | 329 |
| 1213 | 3300046810 | Ga0495660_0006552 | Ga0495660_0006552_4376_5383 | 329 |
| 1214 | 3300046810 | Ga0495660_0007890 | Ga0495660_0007890_1816_2823 | 329 |
| 1215 | 3300046810 | Ga0495660_0012026 | Ga0495660_0012026_1026_2015 | 329 |
| 1216 | 3300046810 | Ga0495660_0017076 | Ga0495660_0017076_1569_2576 | 329 |
| 1217 | 3300046810 | Ga0495660_0024783 | Ga0495660_0024783_1828_2835 | 329 |
| 1218 | 3300046810 | Ga0495660_0055197 | Ga0495660_0055197_491_1522 | 329 |
| 1219 | 3300047315 | Ga0495581_0065403 | Ga0495581_0065403_562_1551 | 329 |
| 1220 | 3300047317 | Ga0495604_0039934 | Ga0495604_0039934_1772_2761 | 329 |
| 1221 | 3300047318 | Ga0495636_0113760 | Ga0495636_0113760_27_1016 | 329 |
| 1222 | 3300047319 | Ga0495674_0006015 | Ga0495674_0006015_1554_2666 | 329 |
| 1223 | 3300047319 | Ga0495674_0018109 | Ga0495674_0018109_1616_2686 | 329 |
| 1224 | 3300047320 | Ga0495672_0001160 | Ga0495672_0001160_17865_18854 | 329 |
| 1225 | 3300047320 | Ga0495672_0003146 | Ga0495672_0003146_8863_9861 | 329 |
| 1226 | 3300047320 | Ga0495672_0004514 | Ga0495672_0004514_3986_4975 | 329 |
| 1227 | 3300047320 | Ga0495672_0008825 | Ga0495672_0008825_1743_2732 | 329 |
| 1228 | 3300047320 | Ga0495672_0009039 | Ga0495672_0009039_1978_2967 | 329 |
| 1229 | 3300047320 | Ga0495672_0010698 | Ga0495672_0010698_4182_5243 | 329 |
| 1230 | 3300047320 | Ga0495672_0016503 | Ga0495672_0016503_2003_2992 | 329 |
| 1231 | 3300047320 | Ga0495672_0026505 | Ga0495672_0026505_1737_2726 | 329 |
| 1232 | 3300047320 | Ga0495672_0045302 | Ga0495672_0045302_1497_2504 | 329 |
| 1233 | 3300047320 | Ga0495672_0058990 | Ga0495672_0058990_295_1284 | 329 |
| 1234 | 3300047321 | Ga0495676_0013241 | Ga0495676_0013241_1396_2385 | 329 |
| 1235 | 3300047321 | Ga0495676_0013298 | Ga0495676_0013298_5748_6755 | 329 |
| 1236 | 3300047322 | Ga0495680_0026023 | Ga0495680_0026023_2161_3150 | 329 |
| 1237 | 3300047322 | Ga0495680_0073182 | Ga0495680_0073182_1070_2086 | 329 |
| 1238 | 3300047323 | Ga0495683_0000095 | Ga0495683_0000095_30897_31886 | 329 |
| 1239 | 3300047323 | Ga0495683_0000518 | Ga0495683_0000518_5748_6737 | 329 |
| 1240 | 3300047323 | Ga0495683_0035744 | Ga0495683_0035744_778_1809 | 329 |
| 1241 | 3300047323 | Ga0495683_0045918 | Ga0495683_0045918_857_1864 | 329 |
| 1242 | 3300047323 | Ga0495683_0069118 | Ga0495683_0069118_712_1713 | 329 |
| 1243 | 3300047323 | Ga0495683_0096408 | Ga0495683_0096408_129_1136 | 329 |
| 1244 | 3300047443 | Ga0495687_007816 | Ga0495687_007816_592_1581 | 329 |
| 1245 | 3300047443 | Ga0495687_014114 | Ga0495687_014114_2691_3680 | 329 |
| 1246 | 3300047446 | Ga0495679_000511 | Ga0495679_000511_13663_14652 | 329 |
| 1247 | 3300047446 | Ga0495679_004466 | Ga0495679_004466_1296_2303 | 329 |
| 1248 | 3300047446 | Ga0495679_008541 | Ga0495679_008541_2140_3129 | 329 |
| 1249 | 3300047446 | Ga0495679_012912 | Ga0495679_012912_859_1866 | 329 |
| 1250 | 3300047446 | Ga0495679_018784 | Ga0495679_018784_562_1569 | 329 |
| 1251 | 3300047446 | Ga0495679_034807 | Ga0495679_034807_90_1097 | 329 |
| 1252 | 3300047469 | Ga0495673_0000790 | Ga0495673_0000790_22706_23695 | 329 |
| 1253 | 3300047469 | Ga0495673_0000979 | Ga0495673_0000979_9482_10471 | 329 |
| 1254 | 3300047469 | Ga0495673_0002737 | Ga0495673_0002737_2211_3200 | 329 |
| 1255 | 3300047469 | Ga0495673_0005607 | Ga0495673_0005607_1899_2906 | 329 |
| 1256 | 3300047469 | Ga0495673_0020049 | Ga0495673_0020049_642_1649 | 329 |
| 1257 | 3300047469 | Ga0495673_0038270 | Ga0495673_0038270_564_1571 | 329 |
| 1258 | 3300047469 | Ga0495673_0042517 | Ga0495673_0042517_552_1541 | 329 |
| 1259 | 3300047469 | Ga0495673_0064290 | Ga0495673_0064290_370_1377 | 329 |
| 1260 | 3300047470 | Ga0495681_0001286 | Ga0495681_0001286_11455_12444 | 329 |
| 1261 | 3300047470 | Ga0495681_0003091 | Ga0495681_0003091_4888_5895 | 329 |
| 1262 | 3300047470 | Ga0495681_0003471 | Ga0495681_0003471_4503_5510 | 329 |
| 1263 | 3300047470 | Ga0495681_0005125 | Ga0495681_0005125_2106_3095 | 329 |
| 1264 | 3300047470 | Ga0495681_0012187 | Ga0495681_0012187_3258_4247 | 329 |
| 1265 | 3300047470 | Ga0495681_0019702 | Ga0495681_0019702_1993_2982 | 329 |
| 1266 | 3300047470 | Ga0495681_0020155 | Ga0495681_0020155_1809_2816 | 329 |
| 1267 | 3300047470 | Ga0495681_0041036 | Ga0495681_0041036_659_1666 | 329 |
| 1268 | 3300047470 | Ga0495681_0059365 | Ga0495681_0059365_108_1097 | 329 |
| 1269 | 3300047470 | Ga0495681_0101705 | Ga0495681_0101705_246_1235 | 329 |
| 1270 | 3300047471 | Ga0495684_0241063 | Ga0495684_0241063_69_1088 | 329 |
| 1271 | 3300047472 | Ga0495686_0016524 | Ga0495686_0016524_1795_2802 | 329 |
| 1272 | 3300047673 | Ga0495593_0005650 | Ga0495593_0005650_1423_2412 | 329 |
| 1273 | 3300047673 | Ga0495593_0053131 | Ga0495593_0053131_708_1778 | 329 |
| 1274 | 3300048088 | Ga0495602_0027272 | Ga0495602_0027272_1621_2610 | 329 |
| 1275 | 3300048091 | Ga0495626_0003121 | Ga0495626_0003121_4712_5701 | 329 |
| 1276 | 3300048091 | Ga0495626_0005316 | Ga0495626_0005316_1515_2522 | 329 |
| 1277 | 3300048091 | Ga0495626_0005972 | Ga0495626_0005972_3555_4562 | 329 |
| 1278 | 3300048091 | Ga0495626_0016847 | Ga0495626_0016847_728_1717 | 329 |
| 1279 | 3300048091 | Ga0495626_0018036 | Ga0495626_0018036_637_1644 | 329 |
| 1280 | 3300048091 | Ga0495626_0036071 | Ga0495626_0036071_613_1620 | 329 |
| 1281 | 3300048091 | Ga0495626_0039664 | Ga0495626_0039664_719_1726 | 329 |
| 1282 | 3300048091 | Ga0495626_0080728 | Ga0495626_0080728_58_1047 | 329 |
| 1283 | 3300048905 | Ga0496102_0003755 | Ga0496102_0003755_7057_8127 | 329 |
| 1284 | 3300048906 | Ga0496103_0008439 | Ga0496103_0008439_617_1687 | 329 |
| 1285 | 3300048909 | Ga0496106_0158213 | Ga0496106_0158213_609_1598 | 329 |
| 1286 | 3300048913 | Ga0496110_0062813 | Ga0496110_0062813_265_1254 | 329 |
| 1287 | 3300048913 | Ga0496110_0237594 | Ga0496110_0237594_142_1131 | 329 |
| 1288 | 3300048915 | Ga0496112_0066333 | Ga0496112_0066333_1128_2159 | 329 |
| 1289 | 3300048917 | Ga0496114_0055653 | Ga0496114_0055653_1464_2453 | 329 |
| 1290 | 3300048917 | Ga0496114_0366907 | Ga0496114_0366907_232_1221 | 329 |
| 1291 | 3300048918 | Ga0496115_0182534 | Ga0496115_0182534_609_1679 | 329 |
| 1292 | 3300048919 | Ga0496116_0000825 | Ga0496116_0000825_14012_15031 | 329 |
| 1293 | 3300048919 | Ga0496116_0003367 | Ga0496116_0003367_5897_6904 | 329 |
| 1294 | 3300048919 | Ga0496116_0039119 | Ga0496116_0039119_872_1861 | 329 |
| 1295 | 3300048919 | Ga0496116_0051786 | Ga0496116_0051786_1399_2391 | 329 |
| 1296 | 3300048920 | Ga0496117_0001387 | Ga0496117_0001387_10578_11597 | 329 |
| 1297 | 3300048920 | Ga0496117_0014011 | Ga0496117_0014011_4158_5147 | 329 |
| 1298 | 3300048920 | Ga0496117_0016798 | Ga0496117_0016798_4077_5066 | 329 |
| 1299 | 3300048920 | Ga0496117_0022003 | Ga0496117_0022003_1484_2473 | 329 |
| 1300 | 3300048920 | Ga0496117_0029470 | Ga0496117_0029470_1098_2168 | 329 |
| 1301 | 3300048920 | Ga0496117_0029800 | Ga0496117_0029800_1457_2446 | 329 |
| 1302 | 3300048920 | Ga0496117_0031689 | Ga0496117_0031689_2199_3206 | 329 |
| 1303 | 3300048920 | Ga0496117_0055024 | Ga0496117_0055024_1559_2548 | 329 |
| 1304 | 3300048920 | Ga0496117_0085127 | Ga0496117_0085127_779_1768 | 329 |
| 1305 | 3300048921 | Ga0496118_0006011 | Ga0496118_0006011_739_1728 | 329 |
| 1306 | 3300048921 | Ga0496118_0011347 | Ga0496118_0011347_6852_7859 | 329 |
| 1307 | 3300048921 | Ga0496118_0022862 | Ga0496118_0022862_84_1073 | 329 |
| 1308 | 3300048921 | Ga0496118_0031243 | Ga0496118_0031243_1990_2979 | 329 |
| 1309 | 3300048921 | Ga0496118_0031721 | Ga0496118_0031721_724_1794 | 329 |
| 1310 | 3300048921 | Ga0496118_0035603 | Ga0496118_0035603_522_1511 | 329 |
| 1311 | 3300048921 | Ga0496118_0197131 | Ga0496118_0197131_28_1059 | 329 |
| 1312 | 3300048922 | Ga0496119_0000380 | Ga0496119_0000380_29842_30831 | 329 |
| 1313 | 3300048922 | Ga0496119_0042611 | Ga0496119_0042611_1501_2490 | 329 |
| 1314 | 3300048923 | Ga0496120_0008249 | Ga0496120_0008249_917_1906 | 329 |
| 1315 | 3300048923 | Ga0496120_0023099 | Ga0496120_0023099_2162_3151 | 329 |
| 1316 | 3300048923 | Ga0496120_0047569 | Ga0496120_0047569_387_1376 | 329 |
| 1317 | 3300048924 | Ga0496121_0001836 | Ga0496121_0001836_9468_10487 | 329 |
| 1318 | 3300048924 | Ga0496121_0026975 | Ga0496121_0026975_1415_2404 | 329 |
| 1319 | 3300048924 | Ga0496121_0086691 | Ga0496121_0086691_67_1056 | 329 |
| 1320 | 3300048924 | Ga0496121_0157583 | Ga0496121_0157583_197_1267 | 329 |
| 1321 | 3300048924 | Ga0496121_0270359 | Ga0496121_0270359_110_1099 | 329 |
| 1322 | 3300048925 | Ga0496122_0002009 | Ga0496122_0002009_24157_25146 | 329 |
| 1323 | 3300048925 | Ga0496122_0004867 | Ga0496122_0004867_2005_3024 | 329 |
| 1324 | 3300048925 | Ga0496122_0008737 | Ga0496122_0008737_6141_7130 | 329 |
| 1325 | 3300048925 | Ga0496122_0053631 | Ga0496122_0053631_1674_2663 | 329 |
| 1326 | 3300048925 | Ga0496122_0058893 | Ga0496122_0058893_849_1856 | 329 |
| 1327 | 3300048925 | Ga0496122_0063427 | Ga0496122_0063427_1609_2598 | 329 |
| 1328 | 3300048925 | Ga0496122_0159896 | Ga0496122_0159896_326_1315 | 329 |
| 1329 | 3300048925 | Ga0496122_0190426 | Ga0496122_0190426_131_1120 | 329 |
| 1330 | 3300048926 | Ga0496123_0001758 | Ga0496123_0001758_19180_20169 | 329 |
| 1331 | 3300048926 | Ga0496123_0001969 | Ga0496123_0001969_2017_3036 | 329 |
| 1332 | 3300048926 | Ga0496123_0044446 | Ga0496123_0044446_1674_2663 | 329 |
| 1333 | 3300048926 | Ga0496123_0049534 | Ga0496123_0049534_67_1056 | 329 |
| 1334 | 3300048926 | Ga0496123_0050228 | Ga0496123_0050228_121_1110 | 329 |
| 1335 | 3300048926 | Ga0496123_0059156 | Ga0496123_0059156_406_1395 | 329 |
| 1336 | 3300048926 | Ga0496123_0080406 | Ga0496123_0080406_44_1051 | 329 |
| 1337 | 3300048927 | Ga0496124_0010733 | Ga0496124_0010733_5758_6747 | 329 |
| 1338 | 3300048927 | Ga0496124_0016387 | Ga0496124_0016387_1929_2918 | 329 |
| 1339 | 3300048927 | Ga0496124_0036358 | Ga0496124_0036358_1992_2981 | 329 |
| 1340 | 3300048927 | Ga0496124_0040666 | Ga0496124_0040666_178_1167 | 329 |
| 1341 | 3300048927 | Ga0496124_0077880 | Ga0496124_0077880_133_1122 | 329 |
| 1342 | 3300048927 | Ga0496124_0088457 | Ga0496124_0088457_685_1674 | 329 |
| 1343 | 3300048928 | Ga0496125_0001708 | Ga0496125_0001708_29230_30225 | 329 |
| 1344 | 3300048928 | Ga0496125_0002601 | Ga0496125_0002601_5772_6761 | 329 |
| 1345 | 3300048928 | Ga0496125_0004067 | Ga0496125_0004067_13900_14889 | 329 |
| 1346 | 3300048928 | Ga0496125_0015978 | Ga0496125_0015978_4380_5369 | 329 |
| 1347 | 3300048928 | Ga0496125_0024970 | Ga0496125_0024970_2740_3729 | 329 |
| 1348 | 3300048928 | Ga0496125_0040604 | Ga0496125_0040604_2070_3059 | 329 |
| 1349 | 3300048928 | Ga0496125_0057762 | Ga0496125_0057762_63_1052 | 329 |
| 1350 | 3300048928 | Ga0496125_0166633 | Ga0496125_0166633_71_1060 | 329 |
| 1351 | 3300048928 | Ga0496125_0260320 | Ga0496125_0260320_28_1017 | 329 |
| 1352 | 3300048929 | Ga0496126_0077271 | Ga0496126_0077271_575_1606 | 329 |
| 1353 | 3300048929 | Ga0496126_0125613 | Ga0496126_0125613_1046_2116 | 329 |
| 1354 | 3300048929 | Ga0496126_0149185 | Ga0496126_0149185_931_1920 | 329 |
| 1355 | 3300049459 | Ga0495678_000108 | Ga0495678_000108_31487_32476 | 329 |
| 1356 | 3300049459 | Ga0495678_002964 | Ga0495678_002964_5126_6115 | 329 |
| 1357 | 3300049459 | Ga0495678_003513 | Ga0495678_003513_3925_4914 | 329 |
| 1358 | 3300049459 | Ga0495678_004960 | Ga0495678_004960_5643_6650 | 329 |
| 1359 | 3300049459 | Ga0495678_014005 | Ga0495678_014005_858_1865 | 329 |
| 1360 | 3300049459 | Ga0495678_015411 | Ga0495678_015411_1525_2514 | 329 |
| 1361 | 3300049459 | Ga0495678_016012 | Ga0495678_016012_1829_2836 | 329 |
| 1362 | 3300049459 | Ga0495678_016355 | Ga0495678_016355_881_1888 | 329 |
| 1363 | 3300049459 | Ga0495678_024087 | Ga0495678_024087_673_1704 | 329 |
| 1364 | 3300049459 | Ga0495678_027380 | Ga0495678_027380_895_1902 | 329 |
| 1365 | 3300049459 | Ga0495678_031546 | Ga0495678_031546_514_1548 | 329 |
| 1366 | 3300049459 | Ga0495678_040676 | Ga0495678_040676_201_1208 | 329 |
| 1367 | 3300049460 | Ga0495682_0009522 | Ga0495682_0009522_1650_2657 | 329 |
| 1368 | 3300049460 | Ga0495682_0011582 | Ga0495682_0011582_952_1941 | 329 |
| 1369 | 3300049460 | Ga0495682_0012034 | Ga0495682_0012034_1545_2552 | 329 |
| 1370 | 3300049571 | Ga0501034_0000692 | Ga0501034_0000692_45001_45990 | 329 |
| 1371 | 3300049662 | Ga0501222_005762 | Ga0501222_005762_254_1243 | 329 |
| 1372 | 3300049742 | Ga0501080_0282518 | Ga0501080_0282518_396_1403 | 329 |
| 1373 | 3300049744 | Ga0501083_0163911 | Ga0501083_0163911_182_1177 | 329 |
| 1374 | 3300053111 | Ga0500572_002588 | Ga0500572_002588_1559_2566 | 329 |
| 1375 | 3300053135 | Ga0500659_0006736 | Ga0500659_0006736_3804_4793 | 329 |
| 1376 | 3300053140 | Ga0500573_0006921 | Ga0500573_0006921_4021_5010 | 329 |
| 1377 | 3300053161 | Ga0500634_0037027 | Ga0500634_0037027_32_1021 | 329 |
| 1378 | iso_pu_bacteria | 2512047018 | 2512328488 | 329 |
| 1379 | iso_pu_bacteria | 2554235341 | 2555671469 | 329 |
| 1380 | iso_pu_bacteria | 2582580891 | 2583793931 | 329 |
| 1381 | iso_pu_bacteria | 2883087390 | 2883092079 | 329 |
| 1382 | iso_pu_bacteria | 640427133 | 640486163 | 329 |
| 1383 | iso_pu_bacteria | 8055770955 | 8055775471 | 329 |
| 1384 | 2124908027 | MRS2a_Contig_120 | MRS2a_00022400 | 330 |
| 1385 | 3300003791 | Ga0055530_10016313 | Ga0055530_100163133 | 330 |
| 1386 | 3300005288 | Ga0065714_10000330 | Ga0065714_100003307 | 330 |
| 1387 | 3300005289 | Ga0065704_10008505 | Ga0065704_100085052 | 330 |
| 1388 | 3300005289 | Ga0065704_10108857 | Ga0065704_101088572 | 330 |
| 1389 | 3300005290 | Ga0065712_10004185 | Ga0065712_100041857 | 330 |
| 1390 | 3300005937 | Ga0081455_10006895 | Ga0081455_100068951 | 330 |
| 1391 | 3300005983 | Ga0081540_1065174 | Ga0081540_10651742 | 330 |
| 1392 | 3300006028 | Ga0070717_10249014 | Ga0070717_102490141 | 330 |
| 1393 | 3300006051 | Ga0075364_10042831 | Ga0075364_100428311 | 330 |
| 1394 | 3300006051 | Ga0075364_10105228 | Ga0075364_101052282 | 330 |
| 1395 | 3300006058 | Ga0075432_10012010 | Ga0075432_100120102 | 330 |
| 1396 | 3300006058 | Ga0075432_10024079 | Ga0075432_100240792 | 330 |
| 1397 | 3300006058 | Ga0075432_10083102 | Ga0075432_100831021 | 330 |
| 1398 | 3300006177 | Ga0075362_10047569 | Ga0075362_100475692 | 330 |
| 1399 | 3300006844 | Ga0075428_100011312 | Ga0075428_1000113122 | 330 |
| 1400 | 3300006914 | Ga0075436_100101739 | Ga0075436_1001017391 | 330 |
| 1401 | 3300006914 | Ga0075436_100172035 | Ga0075436_1001720351 | 330 |
| 1402 | 3300006946 | Ga0079104_1000374 | Ga0079104_100037412 | 330 |
| 1403 | 3300009011 | Ga0105251_10005549 | Ga0105251_100055495 | 330 |
| 1404 | 3300009036 | Ga0105244_10097605 | Ga0105244_100976052 | 330 |
| 1405 | 3300009148 | Ga0105243_10071214 | Ga0105243_100712142 | 330 |
| 1406 | 3300009176 | Ga0105242_10382587 | Ga0105242_103825872 | 330 |
| 1407 | 3300011119 | Ga0105246_10038366 | Ga0105246_100383661 | 330 |
| 1408 | 3300013100 | Ga0157373_10042835 | Ga0157373_100428352 | 330 |
| 1409 | 3300014325 | Ga0163163_10028117 | Ga0163163_100281175 | 330 |
| 1410 | 3300014497 | Ga0182008_10004519 | Ga0182008_100045194 | 330 |
| 1411 | 3300014497 | Ga0182008_10016035 | Ga0182008_100160352 | 330 |
| 1412 | 3300014497 | Ga0182008_10048881 | Ga0182008_100488812 | 330 |
| 1413 | 3300015265 | Ga0182005_1029400 | Ga0182005_10294001 | 330 |
| 1414 | 3300017792 | Ga0163161_10212972 | Ga0163161_102129722 | 330 |
| 1415 | 3300025292 | Ga0209676_1007011 | Ga0209676_10070119 | 330 |
| 1416 | 3300025298 | Ga0209050_1000279 | Ga0209050_100027930 | 330 |
| 1417 | 3300025298 | Ga0209050_1001030 | Ga0209050_100103013 | 330 |
| 1418 | 3300025303 | Ga0209051_1020153 | Ga0209051_10201531 | 330 |
| 1419 | 3300025728 | Ga0207655_1023439 | Ga0207655_10234392 | 330 |
| 1420 | 3300025728 | Ga0207655_1044493 | Ga0207655_10444932 | 330 |
| 1421 | 3300025728 | Ga0207655_1050415 | Ga0207655_10504152 | 330 |
| 1422 | 3300025735 | Ga0207713_1004774 | Ga0207713_10047745 | 330 |
| 1423 | 3300025735 | Ga0207713_1005720 | Ga0207713_10057204 | 330 |
| 1424 | 3300025893 | Ga0207682_10030553 | Ga0207682_100305532 | 330 |
| 1425 | 3300025928 | Ga0207700_10053947 | Ga0207700_100539473 | 330 |
| 1426 | 3300025935 | Ga0207709_10027350 | Ga0207709_100273502 | 330 |
| 1427 | 3300027111 | Ga0209281_1000363 | Ga0209281_100036334 | 330 |
| 1428 | 3300027907 | Ga0207428_10018636 | Ga0207428_100186364 | 330 |
| 1429 | 3300027907 | Ga0207428_10022914 | Ga0207428_100229142 | 330 |
| 1430 | 3300027907 | Ga0207428_10064191 | Ga0207428_100641912 | 330 |
| 1431 | 3300027907 | Ga0207428_10152155 | Ga0207428_101521552 | 330 |
| 1432 | 3300031344 | Ga0265316_10057920 | Ga0265316_100579203 | 330 |
| 1433 | 3300031548 | Ga0307408_100000258 | Ga0307408_10000025818 | 330 |
| 1434 | 3300031911 | Ga0307412_10017511 | Ga0307412_100175113 | 330 |
| 1435 | 3300032004 | Ga0307414_10263482 | Ga0307414_102634821 | 330 |
| 1436 | 3300032005 | Ga0307411_10170724 | Ga0307411_101707242 | 330 |
| 1437 | 3300032126 | Ga0307415_100027497 | Ga0307415_1000274974 | 330 |
| 1438 | 3300037418 | Ga0395900_0055459 | Ga0395900_0055459_2177_3196 | 330 |
| 1439 | 3300037471 | Ga0395905_0003678 | Ga0395905_0003678_12083_13102 | 330 |
| 1440 | 3300037471 | Ga0395905_0009396 | Ga0395905_0009396_3217_4236 | 330 |
| 1441 | 3300037471 | Ga0395905_0010241 | Ga0395905_0010241_2893_3912 | 330 |
| 1442 | 3300037471 | Ga0395905_0321207 | Ga0395905_0321207_335_1387 | 330 |
| 1443 | 3300037471 | Ga0395905_0451643 | Ga0395905_0451643_93_1112 | 330 |
| 1444 | 3300041405 | Ga0439438_001081 | Ga0439438_001081_1381_2373 | 330 |
| 1445 | 3300041405 | Ga0439438_009641 | Ga0439438_009641_1552_2544 | 330 |
| 1446 | 3300041405 | Ga0439438_012124 | Ga0439438_012124_1497_2534 | 330 |
| 1447 | 3300041405 | Ga0439438_018179 | Ga0439438_018179_291_1283 | 330 |
| 1448 | 3300041405 | Ga0439438_040394 | Ga0439438_040394_36_1028 | 330 |
| 1449 | 3300041407 | Ga0439447_000861 | Ga0439447_000861_6538_7530 | 330 |
| 1450 | 3300041407 | Ga0439447_004405 | Ga0439447_004405_2357_3394 | 330 |
| 1451 | 3300041407 | Ga0439447_017548 | Ga0439447_017548_813_1805 | 330 |
| 1452 | 3300041407 | Ga0439447_030845 | Ga0439447_030845_142_1200 | 330 |
| 1453 | 3300041411 | Ga0439466_0004846 | Ga0439466_0004846_63_1121 | 330 |
| 1454 | 3300041411 | Ga0439466_0009355 | Ga0439466_0009355_352_1344 | 330 |
| 1455 | 3300041411 | Ga0439466_0012467 | Ga0439466_0012467_600_1592 | 330 |
| 1456 | 3300042006 | Ga0439432_004712 | Ga0439432_004712_2702_3694 | 330 |
| 1457 | 3300042006 | Ga0439432_013859 | Ga0439432_013859_1292_2284 | 330 |
| 1458 | 3300042009 | Ga0439451_013115 | Ga0439451_013115_392_1384 | 330 |
| 1459 | 3300042010 | Ga0439452_000387 | Ga0439452_000387_19038_20030 | 330 |
| 1460 | 3300042010 | Ga0439452_000902 | Ga0439452_000902_4406_5398 | 330 |
| 1461 | 3300042010 | Ga0439452_003120 | Ga0439452_003120_3591_4583 | 330 |
| 1462 | 3300042010 | Ga0439452_013230 | Ga0439452_013230_213_1205 | 330 |
| 1463 | 3300042010 | Ga0439452_024936 | Ga0439452_024936_245_1237 | 330 |
| 1464 | 3300042013 | Ga0439456_006368 | Ga0439456_006368_260_1252 | 330 |
| 1465 | 3300042013 | Ga0439456_026847 | Ga0439456_026847_16_1008 | 330 |
| 1466 | 3300042016 | Ga0439463_024219 | Ga0439463_024219_418_1410 | 330 |
| 1467 | 3300042115 | Ga0450911_002661 | Ga0450911_002661_1998_3020 | 330 |
| 1468 | 3300042115 | Ga0450911_004135 | Ga0450911_004135_1218_2255 | 330 |
| 1469 | 3300042115 | Ga0450911_004457 | Ga0450911_004457_700_1692 | 330 |
| 1470 | 3300042122 | Ga0450920_001490 | Ga0450920_001490_1396_2433 | 330 |
| 1471 | 3300042124 | Ga0450922_000524 | Ga0450922_000524_1362_2399 | 330 |
| 1472 | 3300042137 | Ga0450902_002208 | Ga0450902_002208_378_1370 | 330 |
| 1473 | 3300042137 | Ga0450902_018125 | Ga0450902_018125_19_1011 | 330 |
| 1474 | 3300042138 | Ga0450903_002755 | Ga0450903_002755_843_1835 | 330 |
| 1475 | 3300042138 | Ga0450903_005900 | Ga0450903_005900_332_1324 | 330 |
| 1476 | 3300042138 | Ga0450903_009029 | Ga0450903_009029_322_1314 | 330 |
| 1477 | 3300042145 | Ga0450906_005166 | Ga0450906_005166_1324_2361 | 330 |
| 1478 | 3300042146 | Ga0450907_000150 | Ga0450907_000150_6684_7676 | 330 |
| 1479 | 3300042146 | Ga0450907_000551 | Ga0450907_000551_2537_3574 | 330 |
| 1480 | 3300042156 | Ga0439446_0016919 | Ga0439446_0016919_283_1275 | 330 |
| 1481 | 3300042185 | Ga0450909_010176 | Ga0450909_010176_212_1204 | 330 |
| 1482 | 3300042435 | Ga0439434_0001826 | Ga0439434_0001826_992_1984 | 330 |
| 1483 | 3300042876 | Ga0451577_0163721 | Ga0451577_0163721_142_1158 | 330 |
| 1484 | 3300044712 | Ga0453684_0022287 | Ga0453684_0022287_4668_5699 | 330 |
| 1485 | 3300046452 | Ga0495617_001369 | Ga0495617_001369_1909_2946 | 330 |
| 1486 | 3300046452 | Ga0495617_004672 | Ga0495617_004672_569_1561 | 330 |
| 1487 | 3300046452 | Ga0495617_010219 | Ga0495617_010219_1095_2162 | 330 |
| 1488 | 3300046452 | Ga0495617_032926 | Ga0495617_032926_158_1177 | 330 |
| 1489 | 3300046453 | Ga0495627_029220 | Ga0495627_029220_509_1576 | 330 |
| 1490 | 3300046455 | Ga0495603_0001173 | Ga0495603_0001173_1369_2373 | 330 |
| 1491 | 3300046457 | Ga0495590_0002014 | Ga0495590_0002014_2071_3063 | 330 |
| 1492 | 3300046457 | Ga0495590_0002963 | Ga0495590_0002963_320_1357 | 330 |
| 1493 | 3300046458 | Ga0495591_000583 | Ga0495591_000583_19454_20446 | 330 |
| 1494 | 3300046458 | Ga0495591_017861 | Ga0495591_017861_92_1084 | 330 |
| 1495 | 3300046458 | Ga0495591_044538 | Ga0495591_044538_179_1171 | 330 |
| 1496 | 3300046460 | Ga0495638_0002845 | Ga0495638_0002845_4667_5659 | 330 |
| 1497 | 3300046460 | Ga0495638_0022694 | Ga0495638_0022694_197_1189 | 330 |
| 1498 | 3300046460 | Ga0495638_0038187 | Ga0495638_0038187_509_1690 | 330 |
| 1499 | 3300046460 | Ga0495638_0041879 | Ga0495638_0041879_32_1024 | 330 |
| 1500 | 3300046460 | Ga0495638_0043307 | Ga0495638_0043307_357_1349 | 330 |
| 1501 | 3300046460 | Ga0495638_0043740 | Ga0495638_0043740_729_1742 | 330 |
| 1502 | 3300046460 | Ga0495638_0058258 | Ga0495638_0058258_1019_2011 | 330 |
| 1503 | 3300046460 | Ga0495638_0077827 | Ga0495638_0077827_817_1809 | 330 |
| 1504 | 3300046460 | Ga0495638_0123636 | Ga0495638_0123636_428_1420 | 330 |
| 1505 | 3300046460 | Ga0495638_0183243 | Ga0495638_0183243_146_1138 | 330 |
| 1506 | 3300046471 | Ga0495650_0008917 | Ga0495650_0008917_3131_4123 | 330 |
| 1507 | 3300046471 | Ga0495650_0022495 | Ga0495650_0022495_32_1024 | 330 |
| 1508 | 3300046471 | Ga0495650_0041584 | Ga0495650_0041584_194_1186 | 330 |
| 1509 | 3300046473 | Ga0495582_0023355 | Ga0495582_0023355_964_1956 | 330 |
| 1510 | 3300046474 | Ga0495605_0002655 | Ga0495605_0002655_4165_5202 | 330 |
| 1511 | 3300046474 | Ga0495605_0016129 | Ga0495605_0016129_2495_3487 | 330 |
| 1512 | 3300046474 | Ga0495605_0090915 | Ga0495605_0090915_373_1365 | 330 |
| 1513 | 3300046475 | Ga0495639_0022411 | Ga0495639_0022411_734_1726 | 330 |
| 1514 | 3300046491 | Ga0495584_0005124 | Ga0495584_0005124_3012_4004 | 330 |
| 1515 | 3300046491 | Ga0495584_0023593 | Ga0495584_0023593_595_1587 | 330 |
| 1516 | 3300046491 | Ga0495584_0030919 | Ga0495584_0030919_302_1294 | 330 |
| 1517 | 3300046491 | Ga0495584_0033432 | Ga0495584_0033432_1190_2182 | 330 |
| 1518 | 3300046491 | Ga0495584_0040836 | Ga0495584_0040836_354_1346 | 330 |
| 1519 | 3300046491 | Ga0495584_0121403 | Ga0495584_0121403_174_1166 | 330 |
| 1520 | 3300046492 | Ga0495585_0003321 | Ga0495585_0003321_1333_2325 | 330 |
| 1521 | 3300046492 | Ga0495585_0021336 | Ga0495585_0021336_1689_2681 | 330 |
| 1522 | 3300046492 | Ga0495585_0036338 | Ga0495585_0036338_1510_2502 | 330 |
| 1523 | 3300046492 | Ga0495585_0050344 | Ga0495585_0050344_1084_2151 | 330 |
| 1524 | 3300046499 | Ga0495594_0061306 | Ga0495594_0061306_510_1502 | 330 |
| 1525 | 3300046499 | Ga0495594_0067401 | Ga0495594_0067401_85_1077 | 330 |
| 1526 | 3300046500 | Ga0495596_0000417 | Ga0495596_0000417_18828_19820 | 330 |
| 1527 | 3300046501 | Ga0495607_0012159 | Ga0495607_0012159_1134_2126 | 330 |
| 1528 | 3300046501 | Ga0495607_0024678 | Ga0495607_0024678_1271_2263 | 330 |
| 1529 | 3300046501 | Ga0495607_0168276 | Ga0495607_0168276_77_1069 | 330 |
| 1530 | 3300046506 | Ga0495583_0002113 | Ga0495583_0002113_12813_13805 | 330 |
| 1531 | 3300046506 | Ga0495583_0006007 | Ga0495583_0006007_213_1205 | 330 |
| 1532 | 3300046507 | Ga0495606_0004874 | Ga0495606_0004874_6694_7686 | 330 |
| 1533 | 3300046507 | Ga0495606_0012961 | Ga0495606_0012961_4696_5688 | 330 |
| 1534 | 3300046507 | Ga0495606_0019626 | Ga0495606_0019626_2316_3308 | 330 |
| 1535 | 3300046507 | Ga0495606_0132984 | Ga0495606_0132984_255_1247 | 330 |
| 1536 | 3300046512 | Ga0495610_0006156 | Ga0495610_0006156_5728_6774 | 330 |
| 1537 | 3300046512 | Ga0495610_0012671 | Ga0495610_0012671_1420_2412 | 330 |
| 1538 | 3300046512 | Ga0495610_0018794 | Ga0495610_0018794_1618_2610 | 330 |
| 1539 | 3300046512 | Ga0495610_0050580 | Ga0495610_0050580_382_1374 | 330 |
| 1540 | 3300046513 | Ga0495616_0015840 | Ga0495616_0015840_232_1224 | 330 |
| 1541 | 3300046513 | Ga0495616_0022980 | Ga0495616_0022980_1191_2183 | 330 |
| 1542 | 3300046513 | Ga0495616_0046285 | Ga0495616_0046285_95_1162 | 330 |
| 1543 | 3300046513 | Ga0495616_0094665 | Ga0495616_0094665_182_1174 | 330 |
| 1544 | 3300046515 | Ga0495620_0027962 | Ga0495620_0027962_1502_2494 | 330 |
| 1545 | 3300046515 | Ga0495620_0028903 | Ga0495620_0028903_91_1083 | 330 |
| 1546 | 3300046515 | Ga0495620_0030977 | Ga0495620_0030977_613_1605 | 330 |
| 1547 | 3300046516 | Ga0495628_0124647 | Ga0495628_0124647_282_1274 | 330 |
| 1548 | 3300046517 | Ga0495630_0059672 | Ga0495630_0059672_121_1113 | 330 |
| 1549 | 3300046518 | Ga0495631_0050644 | Ga0495631_0050644_380_1372 | 330 |
| 1550 | 3300046518 | Ga0495631_0075043 | Ga0495631_0075043_345_1337 | 330 |
| 1551 | 3300046519 | Ga0495632_0003740 | Ga0495632_0003740_8691_9683 | 330 |
| 1552 | 3300046519 | Ga0495632_0022411 | Ga0495632_0022411_1691_2683 | 330 |
| 1553 | 3300046519 | Ga0495632_0024132 | Ga0495632_0024132_1745_2737 | 330 |
| 1554 | 3300046519 | Ga0495632_0027803 | Ga0495632_0027803_585_1577 | 330 |
| 1555 | 3300046519 | Ga0495632_0043909 | Ga0495632_0043909_165_1157 | 330 |
| 1556 | 3300046519 | Ga0495632_0089788 | Ga0495632_0089788_143_1156 | 330 |
| 1557 | 3300046519 | Ga0495632_0144821 | Ga0495632_0144821_77_1069 | 330 |
| 1558 | 3300046520 | Ga0495637_0003572 | Ga0495637_0003572_5887_6879 | 330 |
| 1559 | 3300046520 | Ga0495637_0003788 | Ga0495637_0003788_1448_2440 | 330 |
| 1560 | 3300046520 | Ga0495637_0014418 | Ga0495637_0014418_1533_2600 | 330 |
| 1561 | 3300046520 | Ga0495637_0017782 | Ga0495637_0017782_112_1104 | 330 |
| 1562 | 3300046520 | Ga0495637_0044726 | Ga0495637_0044726_263_1255 | 330 |
| 1563 | 3300046522 | Ga0495643_0009349 | Ga0495643_0009349_1588_2580 | 330 |
| 1564 | 3300046522 | Ga0495643_0043071 | Ga0495643_0043071_1389_2381 | 330 |
| 1565 | 3300046522 | Ga0495643_0071467 | Ga0495643_0071467_149_1141 | 330 |
| 1566 | 3300046523 | Ga0495644_0000931 | Ga0495644_0000931_6436_7428 | 330 |
| 1567 | 3300046523 | Ga0495644_0004035 | Ga0495644_0004035_2500_3492 | 330 |
| 1568 | 3300046523 | Ga0495644_0007984 | Ga0495644_0007984_2627_3694 | 330 |
| 1569 | 3300046523 | Ga0495644_0053304 | Ga0495644_0053304_429_1421 | 330 |
| 1570 | 3300046523 | Ga0495644_0061190 | Ga0495644_0061190_275_1267 | 330 |
| 1571 | 3300046524 | Ga0495648_0012418 | Ga0495648_0012418_672_1664 | 330 |
| 1572 | 3300046524 | Ga0495648_0024066 | Ga0495648_0024066_1416_2453 | 330 |
| 1573 | 3300046524 | Ga0495648_0058881 | Ga0495648_0058881_1071_2063 | 330 |
| 1574 | 3300046524 | Ga0495648_0060300 | Ga0495648_0060300_235_1275 | 330 |
| 1575 | 3300046524 | Ga0495648_0076387 | Ga0495648_0076387_546_1538 | 330 |
| 1576 | 3300046524 | Ga0495648_0091035 | Ga0495648_0091035_582_1601 | 330 |
| 1577 | 3300046524 | Ga0495648_0099124 | Ga0495648_0099124_159_1151 | 330 |
| 1578 | 3300046524 | Ga0495648_0103052 | Ga0495648_0103052_128_1120 | 330 |
| 1579 | 3300046526 | Ga0495666_0014798 | Ga0495666_0014798_1661_2653 | 330 |
| 1580 | 3300046528 | Ga0495642_0000324 | Ga0495642_0000324_19215_20207 | 330 |
| 1581 | 3300046528 | Ga0495642_0003106 | Ga0495642_0003106_1332_2324 | 330 |
| 1582 | 3300046530 | Ga0495654_0002384 | Ga0495654_0002384_6994_7986 | 330 |
| 1583 | 3300046530 | Ga0495654_0011815 | Ga0495654_0011815_1946_2956 | 330 |
| 1584 | 3300046530 | Ga0495654_0033992 | Ga0495654_0033992_177_1169 | 330 |
| 1585 | 3300046530 | Ga0495654_0038555 | Ga0495654_0038555_1294_2286 | 330 |
| 1586 | 3300046530 | Ga0495654_0048135 | Ga0495654_0048135_177_1169 | 330 |
| 1587 | 3300046530 | Ga0495654_0097278 | Ga0495654_0097278_167_1159 | 330 |
| 1588 | 3300046535 | Ga0495586_0035029 | Ga0495586_0035029_739_1731 | 330 |
| 1589 | 3300046536 | Ga0495587_0040276 | Ga0495587_0040276_896_1888 | 330 |
| 1590 | 3300046542 | Ga0495597_0005980 | Ga0495597_0005980_4286_5278 | 330 |
| 1591 | 3300046542 | Ga0495597_0014297 | Ga0495597_0014297_568_1560 | 330 |
| 1592 | 3300046542 | Ga0495597_0022179 | Ga0495597_0022179_245_1237 | 330 |
| 1593 | 3300046542 | Ga0495597_0028619 | Ga0495597_0028619_86_1153 | 330 |
| 1594 | 3300046542 | Ga0495597_0031562 | Ga0495597_0031562_46_1038 | 330 |
| 1595 | 3300046542 | Ga0495597_0058525 | Ga0495597_0058525_481_1473 | 330 |
| 1596 | 3300046542 | Ga0495597_0080423 | Ga0495597_0080423_222_1214 | 330 |
| 1597 | 3300046543 | Ga0495645_0057903 | Ga0495645_0057903_636_1628 | 330 |
| 1598 | 3300046557 | Ga0495622_0002250 | Ga0495622_0002250_8383_9375 | 330 |
| 1599 | 3300046615 | Ga0495656_0002042 | Ga0495656_0002042_396_1388 | 330 |
| 1600 | 3300046616 | Ga0495668_0003191 | Ga0495668_0003191_4148_5140 | 330 |
| 1601 | 3300046660 | Ga0495625_0020848 | Ga0495625_0020848_1438_2430 | 330 |
| 1602 | 3300046660 | Ga0495625_0022935 | Ga0495625_0022935_2075_3067 | 330 |
| 1603 | 3300046660 | Ga0495625_0055240 | Ga0495625_0055240_1268_2335 | 330 |
| 1604 | 3300046660 | Ga0495625_0206656 | Ga0495625_0206656_128_1141 | 330 |
| 1605 | 3300046663 | Ga0495635_0017140 | Ga0495635_0017140_3933_4925 | 330 |
| 1606 | 3300046664 | Ga0495659_0041933 | Ga0495659_0041933_394_1386 | 330 |
| 1607 | 3300046665 | Ga0495661_0020927 | Ga0495661_0020927_1899_2966 | 330 |
| 1608 | 3300046665 | Ga0495661_0038010 | Ga0495661_0038010_572_1564 | 330 |
| 1609 | 3300046665 | Ga0495661_0050909 | Ga0495661_0050909_139_1131 | 330 |
| 1610 | 3300046674 | Ga0495588_0013970 | Ga0495588_0013970_737_1729 | 330 |
| 1611 | 3300046674 | Ga0495588_0014483 | Ga0495588_0014483_1638_2630 | 330 |
| 1612 | 3300046679 | Ga0495623_0005516 | Ga0495623_0005516_1656_2648 | 330 |
| 1613 | 3300046680 | Ga0495646_0010680 | Ga0495646_0010680_3104_4096 | 330 |
| 1614 | 3300046684 | Ga0495669_0006925 | Ga0495669_0006925_436_1473 | 330 |
| 1615 | 3300046689 | Ga0495613_0061386 | Ga0495613_0061386_261_1253 | 330 |
| 1616 | 3300046691 | Ga0495670_0002916 | Ga0495670_0002916_5374_6441 | 330 |
| 1617 | 3300046691 | Ga0495670_0016065 | Ga0495670_0016065_1583_2575 | 330 |
| 1618 | 3300046691 | Ga0495670_0036366 | Ga0495670_0036366_280_1299 | 330 |
| 1619 | 3300046691 | Ga0495670_0139802 | Ga0495670_0139802_181_1173 | 330 |
| 1620 | 3300046691 | Ga0495670_0148032 | Ga0495670_0148032_117_1109 | 330 |
| 1621 | 3300046692 | Ga0495671_0003100 | Ga0495671_0003100_2835_3827 | 330 |
| 1622 | 3300046692 | Ga0495671_0004392 | Ga0495671_0004392_2922_3926 | 330 |
| 1623 | 3300046692 | Ga0495671_0022847 | Ga0495671_0022847_193_1260 | 330 |
| 1624 | 3300046692 | Ga0495671_0029469 | Ga0495671_0029469_965_1957 | 330 |
| 1625 | 3300046692 | Ga0495671_0070407 | Ga0495671_0070407_163_1155 | 330 |
| 1626 | 3300046692 | Ga0495671_0086623 | Ga0495671_0086623_244_1236 | 330 |
| 1627 | 3300046692 | Ga0495671_0117081 | Ga0495671_0117081_77_1069 | 330 |
| 1628 | 3300046694 | Ga0495649_0032639 | Ga0495649_0032639_1246_2238 | 330 |
| 1629 | 3300046694 | Ga0495649_0044463 | Ga0495649_0044463_841_1833 | 330 |
| 1630 | 3300046694 | Ga0495649_0099761 | Ga0495649_0099761_449_1441 | 330 |
| 1631 | 3300046694 | Ga0495649_0128680 | Ga0495649_0128680_202_1239 | 330 |
| 1632 | 3300046794 | Ga0495589_0004203 | Ga0495589_0004203_2182_3174 | 330 |
| 1633 | 3300046794 | Ga0495589_0011083 | Ga0495589_0011083_1975_2967 | 330 |
| 1634 | 3300046794 | Ga0495589_0016468 | Ga0495589_0016468_1455_2447 | 330 |
| 1635 | 3300046794 | Ga0495589_0030092 | Ga0495589_0030092_29_1066 | 330 |
| 1636 | 3300046809 | Ga0495600_0079784 | Ga0495600_0079784_1084_2076 | 330 |
| 1637 | 3300046810 | Ga0495660_0031821 | Ga0495660_0031821_1162_2154 | 330 |
| 1638 | 3300046810 | Ga0495660_0034262 | Ga0495660_0034262_1816_2808 | 330 |
| 1639 | 3300046810 | Ga0495660_0051114 | Ga0495660_0051114_1049_2116 | 330 |
| 1640 | 3300046810 | Ga0495660_0125275 | Ga0495660_0125275_147_1139 | 330 |
| 1641 | 3300047315 | Ga0495581_0034967 | Ga0495581_0034967_983_1975 | 330 |
| 1642 | 3300047317 | Ga0495604_0015101 | Ga0495604_0015101_4093_5085 | 330 |
| 1643 | 3300047317 | Ga0495604_0154785 | Ga0495604_0154785_224_1216 | 330 |
| 1644 | 3300047320 | Ga0495672_0005570 | Ga0495672_0005570_8278_9315 | 330 |
| 1645 | 3300047320 | Ga0495672_0025656 | Ga0495672_0025656_1327_2394 | 330 |
| 1646 | 3300047320 | Ga0495672_0032346 | Ga0495672_0032346_1451_2464 | 330 |
| 1647 | 3300047320 | Ga0495672_0045814 | Ga0495672_0045814_574_1611 | 330 |
| 1648 | 3300047320 | Ga0495672_0114778 | Ga0495672_0114778_155_1147 | 330 |
| 1649 | 3300047320 | Ga0495672_0139855 | Ga0495672_0139855_147_1139 | 330 |
| 1650 | 3300047322 | Ga0495680_0135828 | Ga0495680_0135828_503_1495 | 330 |
| 1651 | 3300047323 | Ga0495683_0005438 | Ga0495683_0005438_4253_5245 | 330 |
| 1652 | 3300047323 | Ga0495683_0010889 | Ga0495683_0010889_1484_2476 | 330 |
| 1653 | 3300047323 | Ga0495683_0022912 | Ga0495683_0022912_945_1937 | 330 |
| 1654 | 3300047323 | Ga0495683_0057272 | Ga0495683_0057272_663_1730 | 330 |
| 1655 | 3300047443 | Ga0495687_003637 | Ga0495687_003637_8919_9938 | 330 |
| 1656 | 3300047445 | Ga0495677_0008145 | Ga0495677_0008145_2125_3117 | 330 |
| 1657 | 3300047446 | Ga0495679_029101 | Ga0495679_029101_201_1196 | 330 |
| 1658 | 3300047446 | Ga0495679_050817 | Ga0495679_050817_53_1045 | 330 |
| 1659 | 3300047447 | Ga0495685_058451 | Ga0495685_058451_286_1278 | 330 |
| 1660 | 3300047469 | Ga0495673_0001198 | Ga0495673_0001198_19181_20173 | 330 |
| 1661 | 3300047469 | Ga0495673_0001605 | Ga0495673_0001605_4488_5480 | 330 |
| 1662 | 3300047469 | Ga0495673_0009482 | Ga0495673_0009482_232_1224 | 330 |
| 1663 | 3300047469 | Ga0495673_0022149 | Ga0495673_0022149_1485_2504 | 330 |
| 1664 | 3300047469 | Ga0495673_0040801 | Ga0495673_0040801_98_1135 | 330 |
| 1665 | 3300047469 | Ga0495673_0049216 | Ga0495673_0049216_717_1709 | 330 |
| 1666 | 3300047469 | Ga0495673_0054301 | Ga0495673_0054301_351_1343 | 330 |
| 1667 | 3300047469 | Ga0495673_0062620 | Ga0495673_0062620_98_1090 | 330 |
| 1668 | 3300047469 | Ga0495673_0069974 | Ga0495673_0069974_295_1362 | 330 |
| 1669 | 3300047470 | Ga0495681_0012740 | Ga0495681_0012740_2411_3448 | 330 |
| 1670 | 3300047470 | Ga0495681_0013863 | Ga0495681_0013863_1611_2603 | 330 |
| 1671 | 3300047470 | Ga0495681_0015876 | Ga0495681_0015876_1392_2459 | 330 |
| 1672 | 3300047470 | Ga0495681_0027964 | Ga0495681_0027964_1886_2878 | 330 |
| 1673 | 3300047470 | Ga0495681_0045766 | Ga0495681_0045766_801_1793 | 330 |
| 1674 | 3300047471 | Ga0495684_0063127 | Ga0495684_0063127_469_1461 | 330 |
| 1675 | 3300047472 | Ga0495686_0013800 | Ga0495686_0013800_794_1786 | 330 |
| 1676 | 3300047472 | Ga0495686_0046404 | Ga0495686_0046404_159_1151 | 330 |
| 1677 | 3300047472 | Ga0495686_0046757 | Ga0495686_0046757_1027_2019 | 330 |
| 1678 | 3300047673 | Ga0495593_0056236 | Ga0495593_0056236_337_1329 | 330 |
| 1679 | 3300047673 | Ga0495593_0147256 | Ga0495593_0147256_97_1089 | 330 |
| 1680 | 3300048091 | Ga0495626_0000869 | Ga0495626_0000869_6568_7560 | 330 |
| 1681 | 3300048091 | Ga0495626_0001573 | Ga0495626_0001573_8254_9246 | 330 |
| 1682 | 3300048091 | Ga0495626_0002679 | Ga0495626_0002679_4461_5453 | 330 |
| 1683 | 3300048091 | Ga0495626_0003172 | Ga0495626_0003172_8293_9288 | 330 |
| 1684 | 3300048091 | Ga0495626_0008011 | Ga0495626_0008011_1245_2291 | 330 |
| 1685 | 3300048091 | Ga0495626_0009785 | Ga0495626_0009785_3808_4800 | 330 |
| 1686 | 3300048915 | Ga0496112_0551740 | Ga0496112_0551740_17_1036 | 330 |
| 1687 | 3300048919 | Ga0496116_0000017 | Ga0496116_0000017_165598_166608 | 330 |
| 1688 | 3300048920 | Ga0496117_0050688 | Ga0496117_0050688_38_1048 | 330 |
| 1689 | 3300048921 | Ga0496118_0009157 | Ga0496118_0009157_932_1942 | 330 |
| 1690 | 3300048921 | Ga0496118_0079811 | Ga0496118_0079811_1109_2101 | 330 |
| 1691 | 3300048924 | Ga0496121_0003439 | Ga0496121_0003439_3676_4686 | 330 |
| 1692 | 3300048925 | Ga0496122_0002967 | Ga0496122_0002967_7587_8597 | 330 |
| 1693 | 3300048926 | Ga0496123_0003732 | Ga0496123_0003732_10167_11177 | 330 |
| 1694 | 3300048927 | Ga0496124_0002197 | Ga0496124_0002197_4475_5485 | 330 |
| 1695 | 3300048927 | Ga0496124_0008144 | Ga0496124_0008144_8238_9230 | 330 |
| 1696 | 3300048927 | Ga0496124_0009954 | Ga0496124_0009954_5129_6139 | 330 |
| 1697 | 3300048927 | Ga0496124_0048703 | Ga0496124_0048703_207_1199 | 330 |
| 1698 | 3300048928 | Ga0496125_0006782 | Ga0496125_0006782_6975_7985 | 330 |
| 1699 | 3300048928 | Ga0496125_0033279 | Ga0496125_0033279_3074_4066 | 330 |
| 1700 | 3300048929 | Ga0496126_0002106 | Ga0496126_0002106_1345_2355 | 330 |
| 1701 | 3300049459 | Ga0495678_041608 | Ga0495678_041608_116_1108 | 330 |
| 1702 | 3300049459 | Ga0495678_053268 | Ga0495678_053268_50_1042 | 330 |
| 1703 | 3300049459 | Ga0495678_058387 | Ga0495678_058387_179_1171 | 330 |
| 1704 | 3300049460 | Ga0495682_0014986 | Ga0495682_0014986_1221_2213 | 330 |
| 1705 | 3300049515 | Ga0501292_000011 | Ga0501292_000011_17403_18464 | 330 |
| 1706 | 3300049517 | Ga0501294_000347 | Ga0501294_000347_3966_5027 | 330 |
| 1707 | 3300049523 | Ga0501300_000069 | Ga0501300_000069_8890_9951 | 330 |
| 1708 | 3300049576 | Ga0501040_0249286 | Ga0501040_0249286_109_1173 | 330 |
| 1709 | 3300049577 | Ga0501041_0095854 | Ga0501041_0095854_110_1162 | 330 |
| 1710 | 3300049591 | Ga0501075_0147628 | Ga0501075_0147628_235_1287 | 330 |
| 1711 | 3300049652 | Ga0501202_001132 | Ga0501202_001132_1219_2280 | 330 |
| 1712 | 3300049662 | Ga0501222_001390 | Ga0501222_001390_1158_2219 | 330 |
| 1713 | 3300049663 | Ga0501223_000035 | Ga0501223_000035_19461_20486 | 330 |
| 1714 | 3300049663 | Ga0501223_000477 | Ga0501223_000477_3188_4249 | 330 |
| 1715 | 3300049664 | Ga0501224_000029 | Ga0501224_000029_19511_20536 | 330 |
| 1716 | 3300049668 | Ga0501233_003337 | Ga0501233_003337_1253_2314 | 330 |
| 1717 | 3300049669 | Ga0501235_004886 | Ga0501235_004886_1643_2704 | 330 |
| 1718 | 3300049688 | Ga0501259_000102 | Ga0501259_000102_9475_10536 | 330 |
| 1719 | 3300049690 | Ga0501261_000002 | Ga0501261_000002_59666_60727 | 330 |
| 1720 | 3300049705 | Ga0501225_0000026 | Ga0501225_0000026_27478_28503 | 330 |
| 1721 | 3300049705 | Ga0501225_0015943 | Ga0501225_0015943_817_1878 | 330 |
| 1722 | 3300049708 | Ga0501245_000127 | Ga0501245_000127_3267_4328 | 330 |
| 1723 | 3300049775 | Ga0501279_000002 | Ga0501279_000002_53591_54652 | 330 |
| 1724 | 3300049776 | Ga0501280_000039 | Ga0501280_000039_35445_36506 | 330 |
| 1725 | 3300049777 | Ga0501281_00158 | Ga0501281_00158_1632_2693 | 330 |
| 1726 | 3300049779 | Ga0501283_000479 | Ga0501283_000479_1785_2846 | 330 |
| 1727 | 3300049853 | Ga0501226_000052 | Ga0501226_000052_23979_25004 | 330 |
| 1728 | 3300050489 | nmdc:mga03683_13495_c1 | nmdc:mga03683_13495_c1_1527_2519 | 330 |
| 1729 | 3300050491 | nmdc:mga00v17_139627_c1 | nmdc:mga00v17_139627_c1_150_1187 | 330 |
| 1730 | 3300050491 | nmdc:mga00v17_184678_c1 | nmdc:mga00v17_184678_c1_41_1033 | 330 |
| 1731 | 3300050491 | nmdc:mga00v17_40492_c1 | nmdc:mga00v17_40492_c1_370_1362 | 330 |
| 1732 | 3300053085 | Ga0495619_0026580 | Ga0495619_0026580_2018_3016 | 330 |
| 1733 | 3300053116 | Ga0500592_000011 | Ga0500592_000011_67354_68364 | 330 |
| 1734 | 3300053122 | Ga0500608_000587 | Ga0500608_000587_9823_10821 | 330 |
| 1735 | 3300053125 | Ga0500618_000316 | Ga0500618_000316_19792_20787 | 330 |
| 1736 | 3300053139 | Ga0500568_0051705 | Ga0500568_0051705_20_1012 | 330 |
| 1737 | 3300053158 | Ga0500627_0000050 | Ga0500627_0000050_3808_4818 | 330 |
| 1738 | 3300061734 | Ga0530510_0363122 | Ga0530510_0363122_17_1069 | 330 |
| 1739 | iso_pu_bacteria | 2808606382 | 2808957123 | 330 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8grv-assembly1.cif.gz_A | dictyostelium discoideum lactate dehydrogenase (dicldha)with nad | 0.9691 | 1 | 328 |
| 5z1z-assembly1.cif.gz_D | the apo-structure of d-lactate dehydrogenase from escherichia coli | 0.9654 | 1 | 328 |
| 5z1z-assembly1.cif.gz_D | the apo-structure of d-lactate dehydrogenase from escherichia coli | 0.9624 | 1 | 328 |
| 8grv-assembly1.cif.gz_A | dictyostelium discoideum lactate dehydrogenase (dicldha)with nad | 0.9605 | 1 | 328 |
| 8i5z-assembly1.cif.gz_A | ldh mutant p101q-(an unexpected single-point mutation triggers the unleashing of catalytic potential of a nadh-dependent dehydrogenase) | 0.9571 | 3 | 327 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9P7P8_47_141_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9901 | 48 | 141 | 3.40.50.720 |
| af_P52643_123_325_3.30.360.10 | Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 | 0.9883 | 123 | 321 | 3.30.360.10 |
| af_Q54UF7_111_296_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9864 | 113 | 295 | 3.40.50.720 |
| af_Q9P7P8_108_296_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9862 | 109 | 295 | 3.40.50.720 |
| af_Q54UF7_112_330_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9853 | 114 | 323 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A085VFL6-F1-model_v4 | 2-hydroxyacid dehydrogenase | 0.9938 | 1 | 329 |
GO:0008720
GO:0051287 |
| AF-A0A5E7VC76-F1-model_v4 | D-lactate dehydrogenase (EC 1.1.1.28) | 0.9937 | 1 | 330 |
GO:0008720
GO:0051287 |
| AF-A0A5B0ES95-F1-model_v4 | 2-hydroxyacid dehydrogenase | 0.9937 | 1 | 329 |
GO:0008720
GO:0051287 |
| AF-A0A2K4I4N8-F1-model_v4 | Hydroxyacid dehydrogenase | 0.9936 | 1 | 329 |
GO:0008720
GO:0051287 |
| AF-A0A562QFM9-F1-model_v4 | D-lactate dehydrogenase | 0.9933 | 95 | 328 |
GO:0008720
GO:0051287 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar