F495541

General Info

Members Datasets Scaffolds Average Seq Length
1739 696 1477 331

Family's Representative Sequence

Representative Sequence 3300059426|Ga0590077_006114|Ga0590077_006114_123_1310
Length 395
Sequence MSRAAALTVRRARGRGQELPQYRIYLALGARQATQGAPSAGFSTSSIVFIGAALTALFVLPRGTRPMRVAFFNTHRFDREFFDAANAACDHQLHYIDARLTRQTSALAQGYPAVCAFVNDQLDSAVLNDLHSGGTRMIALRSAGFNHVDLSKARQLGFTVSRVPAYSPHAVAEHTVALILTLNRKIHRAYARVREGNFALDGLLGFDLHGRTVGVVGTGKIGTLVARMLIGFGCRVVAFDTRLNRECEAMGVGYVTLDALWAQSDIVTLHTPLTDQTRHIVNAAAIGRMKPGVMIINTGRGALVDTAALIDGFKSGRIGYLGLDVYEEEEALFFQDLSSDVIQDDVFARLLTFPNVIVTAHQAFFTRDALRAISETTLHNLSAFEQGKRSGNELW

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2511231004 Pseudomonas sp. GM102 Isolate Nodule
3 2511231006 Pseudomonas sp. GM17 Isolate Nodule
4 2511231007 Pseudomonas sp. GM18 Isolate Nodule
5 2511231008 Pseudomonas sp. GM21 Isolate Nodule
6 2511231010 Pseudomonas sp. GM25 Isolate Nodule
7 2511231011 Pseudomonas sp. GM30 Isolate Nodule
8 2511231012 Pseudomonas sp. GM33 Isolate Nodule
9 2511231014 Pseudomonas sp. GM48 Isolate Nodule
10 2511231015 Pseudomonas sp. GM49 Isolate Nodule
11 2511231016 Pseudomonas sp. GM50 Isolate Nodule
12 2511231017 Pseudomonas sp. GM55 Isolate Nodule
13 2511231018 Pseudomonas sp. GM60 Isolate Nodule
14 2511231019 Pseudomonas sp. GM67 Isolate Nodule
15 2511231020 Pseudomonas sp. GM74 Isolate Nodule
16 2511231021 Pseudomonas sp. GM78 Isolate Nodule
17 2511231022 Pseudomonas sp. GM79 Isolate Nodule
18 2511231023 Pseudomonas sp. GM80 Isolate Nodule
19 2511231024 Pseudomonas sp. GM84 Isolate Nodule
20 2511231031 Pseudomonas sp. GM16 Isolate Nodule
21 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
22 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
23 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
24 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
25 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
26 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
27 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
28 2554235132 Pseudomonas aeruginosa PGPR2 Isolate Unclassified
29 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
30 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
31 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
32 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
33 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
34 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
35 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
36 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
37 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
38 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
39 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
40 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
41 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
42 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
43 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
44 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
45 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
46 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
47 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
48 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
49 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
50 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
51 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
52 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
53 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
54 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
55 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
56 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
57 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
58 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
59 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
60 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
61 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
62 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
63 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
64 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
65 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
66 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
67 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
68 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
69 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
70 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
71 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
72 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
73 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
74 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
75 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
76 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
77 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
78 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
79 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
80 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
81 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
82 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
83 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
84 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
85 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
86 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
87 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
88 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
89 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
90 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
91 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
92 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
93 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
94 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
95 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
96 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
97 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
98 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
99 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
100 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
101 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
102 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
103 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
104 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
105 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
106 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
107 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
108 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
109 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
110 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
111 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
112 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
113 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
114 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
115 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
116 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
117 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
118 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
119 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
120 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
121 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
122 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
123 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
124 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
125 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
126 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
127 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
128 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
129 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
130 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
131 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
132 2765235841 Pseudomonas putida AA7 Isolate Unclassified
133 2773857670 Pseudomonas sp. 478 Isolate Unclassified
134 2773857673 Pseudomonas sp. 443 Isolate Unclassified
135 2784132063 Pseudomonas sp. 424 Isolate Unclassified
136 2784132072 Pseudomonas sp. 460 Isolate Unclassified
137 2786546517 Verrucomicrobia bacterium LW23 Isolate Rhizoplane
138 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
139 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
140 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
141 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
142 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
143 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
144 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
145 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
146 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
147 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
148 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
149 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
150 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
151 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
152 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
153 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
154 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
155 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
156 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
157 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
158 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
159 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
160 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
161 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
162 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
163 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
164 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
165 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
166 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
167 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
168 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
169 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
170 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
171 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
172 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
173 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
174 2854681122 Luteovulum sphaeroides SCJ Isolate Unclassified
175 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
176 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
177 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
178 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
179 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
180 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
181 2885266251 Ralstonia sp. SET104 Isolate Nodule
182 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
183 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
184 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
185 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
186 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
187 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
188 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
189 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
190 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
191 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
192 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
193 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
194 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
195 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
196 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
197 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
198 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
199 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
200 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
201 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
202 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
203 2928058823 Ralstonia sp. 1138 Isolate Unclassified
204 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
205 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
206 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
207 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
208 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
209 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
210 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
211 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
212 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
213 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
214 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
215 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
216 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
217 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
218 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
219 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
220 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
221 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
222 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
223 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
224 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
225 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
226 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
227 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
228 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
229 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
230 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
231 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
232 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere
233 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
234 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
235 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
236 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
237 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
238 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
239 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
240 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
241 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
242 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
243 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
244 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
245 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
246 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
247 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
248 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
249 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
250 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
251 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
252 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
253 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
254 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
255 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
256 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
257 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
258 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
259 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
260 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
261 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
262 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
263 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
264 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
265 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
266 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
267 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
268 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
269 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
270 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
271 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
272 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
273 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
274 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
275 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
276 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
277 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
278 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
279 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
280 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
281 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
282 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
283 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
284 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
285 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
286 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
287 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
288 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
289 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
290 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
291 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
292 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
293 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
294 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
295 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
296 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
297 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
298 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
299 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
300 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
301 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
302 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
303 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
304 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
305 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
306 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
307 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
308 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
309 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
310 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
311 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
312 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
313 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
314 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
315 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
316 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
317 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
318 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
319 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
320 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
321 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
322 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
323 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
324 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
325 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
326 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
327 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
328 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
329 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
330 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
331 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
332 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
333 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
334 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
335 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
336 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
337 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
338 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
339 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
340 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
341 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
342 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
343 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
344 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
345 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
346 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
347 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
348 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
349 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
350 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
351 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
352 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
353 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
354 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
355 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
356 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
357 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
358 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
359 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
360 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
361 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
362 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
363 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
364 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
365 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
366 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
367 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
368 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
369 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
370 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
371 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
372 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
373 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
374 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
375 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
376 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
377 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
378 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
379 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
380 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
381 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
382 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
383 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
384 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
385 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
386 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
387 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
388 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
389 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
390 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
391 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
392 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
393 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
394 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
395 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
396 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
397 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
398 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
399 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
400 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
401 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
402 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
403 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
404 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
405 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
406 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
407 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
408 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
409 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
410 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
411 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
412 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
413 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
414 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
415 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
416 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
417 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
418 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
419 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
420 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
421 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
422 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
423 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
424 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
425 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
426 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
427 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
428 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
429 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
430 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
431 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
432 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
433 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
434 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
435 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
436 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
437 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
438 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
439 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
440 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
441 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
442 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
443 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
444 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
445 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
446 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
447 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
448 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
449 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
450 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
451 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
452 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
453 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
454 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
455 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
456 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
457 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
458 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
459 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
460 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
461 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
462 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
463 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
464 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
465 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
466 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
467 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
468 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
469 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
470 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
471 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
472 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
473 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
474 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
475 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
476 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
477 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
478 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
479 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
480 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
481 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
482 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
483 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
484 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
485 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
486 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
487 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
488 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
489 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
490 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
491 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
492 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
493 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
494 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
495 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
496 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
497 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
498 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
499 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
500 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
501 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
502 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
503 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
504 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
505 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
506 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
507 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
508 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
509 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
510 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
511 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
512 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
513 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
514 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
515 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
516 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
517 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
518 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
519 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
520 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
521 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
522 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
523 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
524 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
525 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
526 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
527 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
528 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
529 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
530 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
531 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
532 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
533 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
534 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
535 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
536 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
537 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
538 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
539 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
540 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
541 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
542 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
543 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
544 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
545 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
546 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
547 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
548 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
549 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
550 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
551 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
552 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
553 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
554 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
555 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
556 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
557 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
558 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
559 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
560 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
561 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
562 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
563 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
564 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
565 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
566 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
567 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
568 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
569 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
570 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
571 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
572 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
573 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
574 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
575 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
576 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
577 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
578 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
579 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
580 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
581 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
582 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
583 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
584 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
585 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
586 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
587 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
588 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
589 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
590 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
591 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
592 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
593 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
594 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
595 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
596 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
597 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
598 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
599 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
600 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
601 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
602 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
603 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
604 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
605 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
606 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
607 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
608 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
609 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
610 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
611 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
612 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
613 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
614 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
615 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
616 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
617 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
618 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
619 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
620 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
621 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
622 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
623 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
624 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
625 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
626 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
627 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
628 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
629 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
630 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
631 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
632 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
633 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
634 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
635 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
636 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
637 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
638 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
639 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
640 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
641 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
642 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
643 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
644 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
645 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
646 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
647 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
648 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
649 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
650 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
651 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
652 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
653 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
654 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
655 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
656 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
657 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
658 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
659 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
660 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
661 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
662 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
663 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
664 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
665 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
666 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
667 640427133 Stutzerimonas stutzeri A1501 Isolate Rhizosphere
668 651053060 Stutzerimonas stutzeri CMT.A.9 Isolate Rhizosphere
669 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
670 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
671 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
672 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
673 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
674 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere
675 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
676 8052494512 Pseudomonas putida LD6 Isolate Unclassified
677 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
678 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
679 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
680 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
681 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
682 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
683 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
684 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
685 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
686 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
687 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere
688 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
689 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
690 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
691 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
692 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
693 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
694 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
695 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
696 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 84.7
Metatranscriptomes 0.23
Isolates 15.07

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.33
Nodule 1.73
Rhizoplane 4.77
Rhizosphere 76.65
Stem 0
Stem Tuber 0
Unclassified 10.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_120 2124908027 Bacteria 35090
2 JGI24741J21665_1000701 3300001915 Bacteria 10112
3 JGI24740J21852_10001102 3300001979 Bacteria 12202
4 JGI24740J21852_10003569 3300001979 Bacteria 6808
5 JGI24737J22298_10005913 3300001990 Bacteria 4211
6 JGI25156J39149_1002620 3300002705 Bacteria 6325
7 JGI25156J39149_1005280 3300002705 Bacteria 3769
8 JGI25156J39149_1012602 3300002705 Bacteria 1847
9 JGI25162J39368_1000190 3300002737 Bacteria 64314
10 JGI25162J39368_1000250 3300002737 Bacteria 53289
11 JGI25154J39366_1001045 3300002738 Bacteria 11037
12 JGI25163J39215_1000539 3300002771 Bacteria 11095
13 JGI25163J39215_1000541 3300002771 Bacteria 11080
14 JGI25164J39214_1000157 3300002772 Bacteria 64314
15 JGI25164J39214_1000192 3300002772 Bacteria 53289
16 JGI25165J46597_1000284 3300003214 Bacteria 64314
17 JGI25165J46597_1000346 3300003214 Bacteria 53289
18 rootH1_10014100 3300003316 Bacteria 3229
19 rootH2_10152216 3300003320 Bacteria 7206
20 rootL2_10329293 3300003322 Bacteria 1578
21 rootH1_10165822 3300003323 Bacteria 5403
22 Ga0006562J51391_1015087 3300003578 Bacteria 1353
23 Ga0006562J51391_1060129 3300003578 Bacteria 3320
24 Ga0055538_1000088 3300003751 Bacteria 78763
25 Ga0055538_1001920 3300003751 Bacteria 3440
26 Ga0055538_1002774 3300003751 Bacteria 2426
27 Ga0055539_1000073 3300003752 Bacteria 131094
28 Ga0055539_1000132 3300003752 Bacteria 78763
29 Ga0055533_1000135 3300003756 Bacteria 78763
30 Ga0055533_1002700 3300003756 Bacteria 3911
31 Ga0055533_1004145 3300003756 Bacteria 2698
32 Ga0055532_1000090 3300003758 Bacteria 104391
33 Ga0055532_1000359 3300003758 Bacteria 24174
34 Ga0055532_1001166 3300003758 Bacteria 7949
35 Ga0055532_1002123 3300003758 Bacteria 4489
36 Ga0055525_1000243 3300003759 Bacteria 55208
37 Ga0055525_1000387 3300003759 Bacteria 28280
38 Ga0055535_1000085 3300003761 Bacteria 104391
39 Ga0055542_1000847 3300003762 Bacteria 21499
40 Ga0055529_1000134 3300003763 Bacteria 104391
41 Ga0055536_1000342 3300003781 Bacteria 34528
42 Ga0055536_1002461 3300003781 Bacteria 10397
43 Ga0055530_10000472 3300003791 Bacteria 35044
44 Ga0055530_10000512 3300003791 Bacteria 33785
45 Ga0055530_10016313 3300003791 Bacteria 2379
46 Ga0055540_1000424 3300003792 Bacteria 33785
47 Ga0055540_1001540 3300003792 Bacteria 13537
48 Ga0055541_1000087 3300003841 Bacteria 78763
49 Ga0055541_1004035 3300003841 Bacteria 2702
50 Ga0065165_1017045 3300005262 Bacteria 2693
51 Ga0065714_10000330 3300005288 Bacteria 5628
52 Ga0065714_10002659 3300005288 Bacteria 13479
53 Ga0065714_10033331 3300005288 Bacteria 1679
54 Ga0065714_10065003 3300005288 Bacteria 14170
55 Ga0065714_10096482 3300005288 Bacteria 1759
56 Ga0065714_10119427 3300005288 Bacteria 1365
57 Ga0065704_10003082 3300005289 Bacteria 4544
58 Ga0065704_10008505 3300005289 Bacteria 2596
59 Ga0065704_10108857 3300005289 Bacteria 2018
60 Ga0065712_10004185 3300005290 Bacteria 5871
61 Ga0065712_10070057 3300005290 Bacteria 6369
62 Ga0065712_10171865 3300005290 Bacteria 1239
63 Ga0065707_10087248 3300005295 Bacteria 5102
64 Ga0065707_10091487 3300005295 Bacteria 3937
65 Ga0070670_100001253 3300005331 Bacteria 20205
66 Ga0070670_100026572 3300005331 Bacteria 4980
67 Ga0070670_100119614 3300005331 Bacteria 2272
68 Ga0070670_100127861 3300005331 Bacteria 2193
69 Ga0070670_100287106 3300005331 Bacteria 1437
70 Ga0070682_100088602 3300005337 Bacteria 2020
71 Ga0070660_100099732 3300005339 Bacteria 2300
72 Ga0070661_100000141 3300005344 Bacteria 58825
73 Ga0070668_100389909 3300005347 Bacteria 1187
74 Ga0070669_100001868 3300005353 Bacteria 15166
75 Ga0070669_100006352 3300005353 Bacteria 8518
76 Ga0070669_100274188 3300005353 Bacteria 1350
77 Ga0070675_100318334 3300005354 Bacteria 1374
78 Ga0070671_100007902 3300005355 Bacteria 8505
79 Ga0070673_100177332 3300005364 Bacteria 1822
80 Ga0070688_100072700 3300005365 Bacteria 2204
81 Ga0070659_100001430 3300005366 Bacteria 17218
82 Ga0070659_100101107 3300005366 Bacteria 2320
83 Ga0070667_100014111 3300005367 Bacteria 6602
84 Ga0070667_100428467 3300005367 Bacteria 1207
85 Ga0070708_100013258 3300005445 Bacteria 6743
86 Ga0070663_100000034 3300005455 Bacteria 68516
87 Ga0070663_100025939 3300005455 Bacteria 3963
88 Ga0070678_100038117 3300005456 Bacteria 3381
89 Ga0070662_100007020 3300005457 Bacteria 7285
90 Ga0070662_100007171 3300005457 Bacteria 7220
91 Ga0070662_100319169 3300005457 Bacteria 1266
92 Ga0068867_100012998 3300005459 Bacteria 5891
93 Ga0070685_10080532 3300005466 Bacteria 1951
94 Ga0070706_100129499 3300005467 Bacteria 2354
95 Ga0070706_100300993 3300005467 Bacteria 1496
96 Ga0070707_100013239 3300005468 Bacteria 7713
97 Ga0070699_100378174 3300005518 Bacteria 1278
98 Ga0068853_100043664 3300005539 Bacteria 3835
99 Ga0070665_100062105 3300005548 Bacteria 3746
100 Ga0070665_100098295 3300005548 Bacteria 2931
101 Ga0070665_100098943 3300005548 Bacteria 2921
102 Ga0070665_100336128 3300005548 Bacteria 1515
103 Ga0068855_100000854 3300005563 Bacteria 37817
104 Ga0068855_100002275 3300005563 Bacteria 23730
105 Ga0070664_100000057 3300005564 Bacteria 68516
106 Ga0070664_100101171 3300005564 Bacteria 2506
107 Ga0070664_100425382 3300005564 Bacteria 1217
108 Ga0068857_100009494 3300005577 Bacteria 8449
109 Ga0068857_100033795 3300005577 Bacteria 4522
110 Ga0068854_100000299 3300005578 Bacteria 32817
111 Ga0068854_100128126 3300005578 Bacteria 1935
112 Ga0068854_100399414 3300005578 Bacteria 1137
113 Ga0068856_100000811 3300005614 Bacteria 33756
114 Ga0068856_100014486 3300005614 Bacteria 7616
115 Ga0068856_100469407 3300005614 Bacteria 1279
116 Ga0068852_100265346 3300005616 Bacteria 1650
117 Ga0068859_100000075 3300005617 Bacteria 91974
118 Ga0068859_100255294 3300005617 Bacteria 1844
119 Ga0068864_100570329 3300005618 Bacteria 1096
120 Ga0068861_100004019 3300005719 Bacteria 9848
121 Ga0068861_100061495 3300005719 Bacteria 2882
122 Ga0068861_100289953 3300005719 Bacteria 1413
123 Ga0068861_100563130 3300005719 Bacteria 1040
124 Ga0068851_10000311 3300005834 Bacteria 22013
125 Ga0068863_100007182 3300005841 Bacteria 10931
126 Ga0068863_100019292 3300005841 Bacteria 6522
127 Ga0068863_100020109 3300005841 Bacteria 6386
128 Ga0068858_100009576 3300005842 Bacteria 9240
129 Ga0068858_100102602 3300005842 Bacteria 2668
130 Ga0068860_100000206 3300005843 Bacteria 93792
131 Ga0068860_100026522 3300005843 Bacteria 5584
132 Ga0068862_100071025 3300005844 Bacteria 3006
133 Ga0068862_100101611 3300005844 Bacteria 2515
134 Ga0081455_10006895 3300005937 Bacteria 12088
135 Ga0081540_1065174 3300005983 Bacteria 1714
136 Ga0070717_10000029 3300006028 Bacteria 143008
137 Ga0070717_10249014 3300006028 Bacteria 1569
138 Ga0070717_10407657 3300006028 Bacteria 1222
139 Ga0075368_10005176 3300006042 Bacteria 4473
140 Ga0075364_10042831 3300006051 Bacteria 2942
141 Ga0075364_10075777 3300006051 Bacteria 2220
142 Ga0075364_10104320 3300006051 Bacteria 1888
143 Ga0075364_10105228 3300006051 Bacteria 1880
144 Ga0075432_10005608 3300006058 Bacteria 4274
145 Ga0075432_10012010 3300006058 Bacteria 2942
146 Ga0075432_10023055 3300006058 Bacteria 2132
147 Ga0075432_10024079 3300006058 Bacteria 2085
148 Ga0075432_10083102 3300006058 Bacteria 1163
149 Ga0075362_10047569 3300006177 Bacteria 1911
150 Ga0075367_10036141 3300006178 Bacteria 2862
151 Ga0075366_10032757 3300006195 Bacteria 3060
152 Ga0097621_100228652 3300006237 Bacteria 1623
153 Ga0075370_10031952 3300006353 Bacteria 2940
154 Ga0075428_100002850 3300006844 Bacteria 18866
155 Ga0075428_100011312 3300006844 Bacteria 9929
156 Ga0075428_100160216 3300006844 Bacteria 2443
157 Ga0075428_100495260 3300006844 Bacteria 1308
158 Ga0075430_100000819 3300006846 Bacteria 24262
159 Ga0075431_100073385 3300006847 Bacteria 3530
160 Ga0075431_100080061 3300006847 Unclassified 3372
161 Ga0075431_100198160 3300006847 Bacteria 2055
162 Ga0075433_10003532 3300006852 Bacteria 12068
163 Ga0075434_100002217 3300006871 Bacteria 16951
164 Ga0075434_100199650 3300006871 Bacteria 2020
165 Ga0075429_100000374 3300006880 Bacteria 32944
166 Ga0075429_100042776 3300006880 Bacteria 3942
167 Ga0075429_100128534 3300006880 Unclassified 2216
168 Ga0075436_100101739 3300006914 Bacteria 2001
169 Ga0075436_100172035 3300006914 Bacteria 1529
170 Ga0075436_100319643 3300006914 Bacteria 1115
171 Ga0097620_100000075 3300006931 Bacteria 91974
172 Ga0097620_100255271 3300006931 Bacteria 1844
173 Ga0099823_1003401 3300006944 Bacteria 15050
174 Ga0079104_1000374 3300006946 Bacteria 52789
175 Ga0079104_1000659 3300006946 Bacteria 32892
176 Ga0079104_1005684 3300006946 Bacteria 4917
177 Ga0105251_10000336 3300009011 Bacteria 47055
178 Ga0105251_10000879 3300009011 Bacteria 26931
179 Ga0105251_10001202 3300009011 Bacteria 22386
180 Ga0105251_10001712 3300009011 Bacteria 18364
181 Ga0105251_10002150 3300009011 Bacteria 15835
182 Ga0105251_10005549 3300009011 Bacteria 8209
183 Ga0105251_10007195 3300009011 Bacteria 6912
184 Ga0105251_10052124 3300009011 Bacteria 1949
185 Ga0105251_10103416 3300009011 Bacteria 1301
186 Ga0105251_10106632 3300009011 Bacteria 1279
187 Ga0105244_10002288 3300009036 Bacteria 14546
188 Ga0105244_10005469 3300009036 Bacteria 8442
189 Ga0105244_10006237 3300009036 Bacteria 7769
190 Ga0105244_10006263 3300009036 Bacteria 7747
191 Ga0105244_10058728 3300009036 Bacteria 1940
192 Ga0105244_10073413 3300009036 Bacteria 1703
193 Ga0105244_10080174 3300009036 Bacteria 1617
194 Ga0105244_10097605 3300009036 Bacteria 1440
195 Ga0105250_10000152 3300009092 Bacteria 59872
196 Ga0105250_10000566 3300009092 Bacteria 24655
197 Ga0105250_10001634 3300009092 Bacteria 11952
198 Ga0105250_10009340 3300009092 Bacteria 4135
199 Ga0105250_10012096 3300009092 Bacteria 3572
200 Ga0105250_10018885 3300009092 Bacteria 2788
201 Ga0105250_10019617 3300009092 Bacteria 2734
202 Ga0105250_10021230 3300009092 Bacteria 2622
203 Ga0105240_10023229 3300009093 Bacteria 8209
204 Ga0105240_10194299 3300009093 Bacteria 2384
205 Ga0111539_10012498 3300009094 Bacteria 10640
206 Ga0114129_10001645 3300009147 Bacteria 30363
207 Ga0114129_10068759 3300009147 Bacteria 4938
208 Ga0114129_10082926 3300009147 Bacteria 4454
209 Ga0114129_10183636 3300009147 Bacteria 2844
210 Ga0114129_10273643 3300009147 Bacteria 2258
211 Ga0114129_10577780 3300009147 Bacteria 1459
212 Ga0105243_10000321 3300009148 Bacteria 52717
213 Ga0105243_10000885 3300009148 Bacteria 28194
214 Ga0105243_10025570 3300009148 Bacteria 4513
215 Ga0105243_10039642 3300009148 Bacteria 3673
216 Ga0105243_10071214 3300009148 Bacteria 2810
217 Ga0105243_10110707 3300009148 Bacteria 2297
218 Ga0105242_10382587 3300009176 Bacteria 1309
219 Ga0105248_10007246 3300009177 Bacteria 12168
220 Ga0105248_10107584 3300009177 Bacteria 3144
221 Ga0105238_10191741 3300009551 Bacteria 2020
222 Ga0105249_10022415 3300009553 Bacteria 5656
223 Ga0105249_10130012 3300009553 Bacteria 2403
224 Ga0105246_10000476 3300011119 Bacteria 21621
225 Ga0105246_10000524 3300011119 Bacteria 20960
226 Ga0105246_10038366 3300011119 Bacteria 3220
227 Ga0105246_10041030 3300011119 Bacteria 3127
228 Ga0105246_10066146 3300011119 Bacteria 2530
229 Ga0157345_1000203 3300012498 Bacteria 9118
230 Ga0157373_10002399 3300013100 Bacteria 14227
231 Ga0157373_10005087 3300013100 Bacteria 9883
232 Ga0157373_10005895 3300013100 Bacteria 9167
233 Ga0157373_10009158 3300013100 Bacteria 7320
234 Ga0157373_10011643 3300013100 Bacteria 6462
235 Ga0157373_10015891 3300013100 Bacteria 5494
236 Ga0157373_10042835 3300013100 Bacteria 3235
237 Ga0157373_10071925 3300013100 Bacteria 2442
238 Ga0157371_10000323 3300013102 Bacteria 61980
239 Ga0157371_10001092 3300013102 Bacteria 29401
240 Ga0157371_10001258 3300013102 Bacteria 26748
241 Ga0157371_10074350 3300013102 Bacteria 2407
242 Ga0157370_10000038 3300013104 Bacteria 135182
243 Ga0157370_10056190 3300013104 Bacteria 3746
244 Ga0157370_10176684 3300013104 Bacteria 1985
245 Ga0157370_10182491 3300013104 Bacteria 1950
246 Ga0157369_10008841 3300013105 Bacteria 11536
247 Ga0157369_10021204 3300013105 Bacteria 7264
248 Ga0157369_10055398 3300013105 Bacteria 4280
249 Ga0157369_10139563 3300013105 Bacteria 2565
250 Ga0157369_10419654 3300013105 Bacteria 1387
251 Ga0157374_10000045 3300013296 Bacteria 143116
252 Ga0157374_10095271 3300013296 Bacteria 2846
253 Ga0163162_10000820 3300013306 Bacteria 28876
254 Ga0163162_10482275 3300013306 Bacteria 1371
255 Ga0157372_10000663 3300013307 Bacteria 37808
256 Ga0157372_10002748 3300013307 Bacteria 19019
257 Ga0157372_10007130 3300013307 Bacteria 11900
258 Ga0157372_10024456 3300013307 Bacteria 6561
259 Ga0157375_10074741 3300013308 Bacteria 3411
260 Ga0163163_10028117 3300014325 Bacteria 5396
261 Ga0163163_10031095 3300014325 Bacteria 5150
262 Ga0182008_10000483 3300014497 Bacteria 30249
263 Ga0182008_10001727 3300014497 Bacteria 14338
264 Ga0182008_10002512 3300014497 Bacteria 11447
265 Ga0182008_10004519 3300014497 Bacteria 8117
266 Ga0182008_10016035 3300014497 Bacteria 3900
267 Ga0182008_10023541 3300014497 Bacteria 3143
268 Ga0182008_10034108 3300014497 Bacteria 2552
269 Ga0182008_10048881 3300014497 Bacteria 2100
270 Ga0157379_10000104 3300014968 Bacteria 57987
271 Ga0157376_10000309 3300014969 Bacteria 32560
272 Ga0182006_1001817 3300015261 Bacteria 12279
273 Ga0182006_1004331 3300015261 Bacteria 7022
274 Ga0182006_1004638 3300015261 Bacteria 6734
275 Ga0182006_1014999 3300015261 Bacteria 3329
276 Ga0182006_1015539 3300015261 Bacteria 3263
277 Ga0182007_10002175 3300015262 Bacteria 9940
278 Ga0182007_10011984 3300015262 Bacteria 3350
279 Ga0182007_10018272 3300015262 Bacteria 2543
280 Ga0182005_1001689 3300015265 Bacteria 8545
281 Ga0182005_1008708 3300015265 Bacteria 2980
282 Ga0182005_1011469 3300015265 Bacteria 2524
283 Ga0182005_1011882 3300015265 Bacteria 2470
284 Ga0182005_1029400 3300015265 Bacteria 1499
285 Ga0163161_10005444 3300017792 Bacteria 8839
286 Ga0163161_10013673 3300017792 Bacteria 5651
287 Ga0163161_10014430 3300017792 Bacteria 5500
288 Ga0163161_10043460 3300017792 Bacteria 3235
289 Ga0163161_10061444 3300017792 Bacteria 2735
290 Ga0163161_10061766 3300017792 Bacteria 2728
291 Ga0163161_10085930 3300017792 Bacteria 2321
292 Ga0163161_10111901 3300017792 Bacteria 2042
293 Ga0163161_10212972 3300017792 Bacteria 1493
294 Ga0206351_10707377 3300020077 Bacteria 1268
295 Ga0154015_1546600 3300020610 Bacteria 6538
296 Ga0209435_101037 3300025206 Bacteria 3942
297 Ga0209760_100028 3300025207 Bacteria 153020
298 Ga0209760_100095 3300025207 Bacteria 68193
299 Ga0209784_100006 3300025224 Bacteria 930704
300 Ga0209784_100108 3300025224 Bacteria 94409
301 Ga0209784_100126 3300025224 Bacteria 78815
302 Ga0209784_100846 3300025224 Bacteria 6784
303 Ga0209566_100002 3300025225 Bacteria 2614868
304 Ga0209566_100152 3300025225 Bacteria 78864
305 Ga0209566_100602 3300025225 Bacteria 22518
306 Ga0209566_103317 3300025225 Bacteria 2521
307 Ga0209674_100097 3300025226 Bacteria 167285
308 Ga0209674_100168 3300025226 Bacteria 84107
309 Ga0209674_100177 3300025226 Bacteria 78864
310 Ga0209674_101230 3300025226 Bacteria 7288
311 Ga0209147_100018 3300025229 Bacteria 515719
312 Ga0209147_100179 3300025229 Bacteria 78864
313 Ga0209563_100041 3300025230 Bacteria 407467
314 Ga0209563_100142 3300025230 Bacteria 78864
315 Ga0209563_101244 3300025230 Bacteria 6998
316 Ga0209563_104405 3300025230 Bacteria 2698
317 Ga0207427_100007 3300025231 Bacteria 746220
318 Ga0207427_100008 3300025231 Bacteria 740731
319 Ga0209437_100006 3300025233 Bacteria 1042724
320 Ga0209437_100014 3300025233 Bacteria 740714
321 Ga0209258_100028 3300025242 Bacteria 515719
322 Ga0209258_100366 3300025242 Bacteria 59744
323 Ga0209646_1000153 3300025246 Bacteria 96707
324 Ga0209646_1000465 3300025246 Bacteria 20531
325 Ga0209677_100007 3300025253 Bacteria 1021332
326 Ga0209677_100125 3300025253 Bacteria 78864
327 Ga0209148_1000297 3300025254 Bacteria 72735
328 Ga0209759_1002551 3300025256 Bacteria 7905
329 Ga0209759_1002829 3300025256 Bacteria 7322
330 Ga0209759_1007185 3300025256 Bacteria 3620
331 Ga0209233_1000008 3300025261 Bacteria 1356712
332 Ga0209233_1000086 3300025261 Bacteria 331687
333 Ga0209455_1000107 3300025272 Bacteria 195136
334 Ga0209673_1000070 3300025273 Bacteria 241592
335 Ga0209675_1010978 3300025291 Bacteria 3042
336 Ga0209676_1000006 3300025292 Bacteria 1039588
337 Ga0209676_1000109 3300025292 Bacteria 217531
338 Ga0209676_1000973 3300025292 Bacteria 34485
339 Ga0209676_1006254 3300025292 Bacteria 5928
340 Ga0209676_1007011 3300025292 Bacteria 5413
341 Ga0209050_1000070 3300025298 Bacteria 296366
342 Ga0209050_1000279 3300025298 Bacteria 109034
343 Ga0209050_1000399 3300025298 Bacteria 81236
344 Ga0209050_1001030 3300025298 Bacteria 34683
345 Ga0209051_1000086 3300025303 Bacteria 183550
346 Ga0209051_1000106 3300025303 Bacteria 159222
347 Ga0209051_1020153 3300025303 Bacteria 2883
348 Ga0209257_1017856 3300025304 Bacteria 2768
349 Ga0207656_10000423 3300025321 Bacteria 14235
350 Ga0207696_1000044 3300025711 Bacteria 300953
351 Ga0207696_1000090 3300025711 Bacteria 188474
352 Ga0207696_1000130 3300025711 Bacteria 133107
353 Ga0207696_1000144 3300025711 Bacteria 122345
354 Ga0207696_1002572 3300025711 Bacteria 8820
355 Ga0207696_1006573 3300025711 Bacteria 4668
356 Ga0207696_1008004 3300025711 Bacteria 4086
357 Ga0207696_1008761 3300025711 Bacteria 3833
358 Ga0207655_1000113 3300025728 Bacteria 167376
359 Ga0207655_1001166 3300025728 Bacteria 25539
360 Ga0207655_1003265 3300025728 Bacteria 12167
361 Ga0207655_1004652 3300025728 Bacteria 9630
362 Ga0207655_1006377 3300025728 Bacteria 7832
363 Ga0207655_1006442 3300025728 Bacteria 7777
364 Ga0207655_1007851 3300025728 Bacteria 6865
365 Ga0207655_1013598 3300025728 Bacteria 4660
366 Ga0207655_1023439 3300025728 Bacteria 3062
367 Ga0207655_1044493 3300025728 Bacteria 1865
368 Ga0207655_1044533 3300025728 Bacteria 1863
369 Ga0207655_1050415 3300025728 Bacteria 1692
370 Ga0207655_1052506 3300025728 Bacteria 1639
371 Ga0207713_1000013 3300025735 Bacteria 475751
372 Ga0207713_1000074 3300025735 Bacteria 181376
373 Ga0207713_1000442 3300025735 Bacteria 43616
374 Ga0207713_1000520 3300025735 Bacteria 38760
375 Ga0207713_1000877 3300025735 Bacteria 27523
376 Ga0207713_1001968 3300025735 Bacteria 15492
377 Ga0207713_1003597 3300025735 Bacteria 10454
378 Ga0207713_1004351 3300025735 Bacteria 9209
379 Ga0207713_1004461 3300025735 Bacteria 9069
380 Ga0207713_1004479 3300025735 Bacteria 9052
381 Ga0207713_1004774 3300025735 Bacteria 8713
382 Ga0207713_1005720 3300025735 Bacteria 7710
383 Ga0207713_1006089 3300025735 Bacteria 7430
384 Ga0207713_1006195 3300025735 Bacteria 7333
385 Ga0207713_1008133 3300025735 Bacteria 6081
386 Ga0207682_10030553 3300025893 Bacteria 2158
387 Ga0207684_10092749 3300025910 Bacteria 2574
388 Ga0207684_10245410 3300025910 Bacteria 1545
389 Ga0207695_10009088 3300025913 Bacteria 12340
390 Ga0207695_10148904 3300025913 Bacteria 2281
391 Ga0207657_10023036 3300025919 Bacteria 5809
392 Ga0207657_10112754 3300025919 Bacteria 2244
393 Ga0207649_10000111 3300025920 Bacteria 68568
394 Ga0207646_10069491 3300025922 Bacteria 3145
395 Ga0207681_10008837 3300025923 Bacteria 6156
396 Ga0207681_10014938 3300025923 Bacteria 4836
397 Ga0207694_10127649 3300025924 Bacteria 2036
398 Ga0207650_10000266 3300025925 Bacteria 55293
399 Ga0207650_10000428 3300025925 Bacteria 36810
400 Ga0207650_10196909 3300025925 Bacteria 1612
401 Ga0207700_10053947 3300025928 Bacteria 3015
402 Ga0207644_10005170 3300025931 Bacteria 8520
403 Ga0207644_10177770 3300025931 Bacteria 1666
404 Ga0207690_10001080 3300025932 Bacteria 17433
405 Ga0207706_10006074 3300025933 Bacteria 11224
406 Ga0207706_10041506 3300025933 Bacteria 4079
407 Ga0207706_10283240 3300025933 Bacteria 1445
408 Ga0207709_10000013 3300025935 Bacteria 531977
409 Ga0207709_10001932 3300025935 Bacteria 13617
410 Ga0207709_10013065 3300025935 Bacteria 4577
411 Ga0207709_10027350 3300025935 Bacteria 3285
412 Ga0207691_10088412 3300025940 Bacteria 2779
413 Ga0207711_10013500 3300025941 Bacteria 6781
414 Ga0207689_10162701 3300025942 Bacteria 1839
415 Ga0207679_10000105 3300025945 Bacteria 68561
416 Ga0207667_10006177 3300025949 Bacteria 14544
417 Ga0207667_10026197 3300025949 Bacteria 6374
418 Ga0207651_10177345 3300025960 Bacteria 1687
419 Ga0207640_10000154 3300025981 Bacteria 49637
420 Ga0207640_10356480 3300025981 Bacteria 1177
421 Ga0207658_10225297 3300025986 Bacteria 1579
422 Ga0207658_10233507 3300025986 Bacteria 1554
423 Ga0207703_10002028 3300026035 Bacteria 17886
424 Ga0207703_10018255 3300026035 Bacteria 5477
425 Ga0207703_10080423 3300026035 Bacteria 2714
426 Ga0207703_10505908 3300026035 Bacteria 1134
427 Ga0207678_10000106 3300026067 Bacteria 68474
428 Ga0207678_10102399 3300026067 Bacteria 2445
429 Ga0207702_10000135 3300026078 Bacteria 88092
430 Ga0207702_10058448 3300026078 Bacteria 3282
431 Ga0207641_10017280 3300026088 Bacteria 5906
432 Ga0207641_10021949 3300026088 Bacteria 5249
433 Ga0207648_10021724 3300026089 Bacteria 5767
434 Ga0207676_10336171 3300026095 Bacteria 1391
435 Ga0207674_10003401 3300026116 Bacteria 19514
436 Ga0207674_10151286 3300026116 Bacteria 2278
437 Ga0207674_10296281 3300026116 Bacteria 1566
438 Ga0207674_10555863 3300026116 Bacteria 1109
439 Ga0207675_100002359 3300026118 Bacteria 18688
440 Ga0207675_100088645 3300026118 Bacteria 2906
441 Ga0207675_100114842 3300026118 Bacteria 2543
442 Ga0207683_10424200 3300026121 Bacteria 1225
443 Ga0209281_1000010 3300027111 Bacteria 726106
444 Ga0209281_1000363 3300027111 Bacteria 74009
445 Ga0209281_1005767 3300027111 Bacteria 3353
446 Ga0209281_1006162 3300027111 Bacteria 3175
447 Ga0209389_1000031 3300027296 Bacteria 138036
448 Ga0209371_1000348 3300027312 Bacteria 50540
449 Ga0207428_10017008 3300027907 Bacteria 6248
450 Ga0207428_10018636 3300027907 Bacteria 5926
451 Ga0207428_10022914 3300027907 Bacteria 5262
452 Ga0207428_10064191 3300027907 Bacteria 2900
453 Ga0207428_10123984 3300027907 Bacteria 1979
454 Ga0207428_10152155 3300027907 Bacteria 1761
455 Ga0268266_10040702 3300028379 Bacteria 3962
456 Ga0268266_10048574 3300028379 Bacteria 3638
457 Ga0268266_10265494 3300028379 Bacteria 1592
458 Ga0268264_10000341 3300028381 Bacteria 71848
459 Ga0265318_10000033 3300028577 Bacteria 143214
460 Ga0268256_1000134 3300030500 Bacteria 102725
461 Ga0307511_10024878 3300030521 Bacteria 5534
462 Ga0307511_10165360 3300030521 Bacteria 1230
463 Ga0314311_1063254 3300030733 Bacteria 1788
464 Ga0316178_1042235 3300030735 Bacteria 22208
465 Ga0316183_1100530 3300030742 Bacteria 3328
466 Ga0316182_1369220 3300030745 Bacteria 1165
467 Ga0265330_10000029 3300031235 Bacteria 138185
468 Ga0265332_10004299 3300031238 Bacteria 6720
469 Ga0265328_10016457 3300031239 Bacteria 2876
470 Ga0265320_10000062 3300031240 Bacteria 99515
471 Ga0265339_10037067 3300031249 Bacteria 2726
472 Ga0265331_10000079 3300031250 Bacteria 138758
473 Ga0265316_10019120 3300031344 Bacteria 5866
474 Ga0265316_10057920 3300031344 Bacteria 3020
475 Ga0307408_100000258 3300031548 Bacteria 54032
476 Ga0307408_100005919 3300031548 Bacteria 8145
477 Ga0307408_100006681 3300031548 Bacteria 7649
478 Ga0307408_100009169 3300031548 Bacteria 6522
479 Ga0307408_100024887 3300031548 Bacteria 4093
480 Ga0307408_100048945 3300031548 Bacteria 3034
481 Ga0307408_100144913 3300031548 Bacteria 1868
482 Ga0307408_100177630 3300031548 Bacteria 1705
483 Ga0307408_100220735 3300031548 Bacteria 1546
484 Ga0265313_10000344 3300031595 Bacteria 50468
485 Ga0265314_10000138 3300031711 Bacteria 109255
486 Ga0316576_10016093 3300031727 Bacteria 5042
487 Ga0316576_10095886 3300031727 Bacteria 2213
488 Ga0316576_10271767 3300031727 Bacteria 1270
489 Ga0307405_10001021 3300031731 Bacteria 11333
490 Ga0307405_10002099 3300031731 Bacteria 8682
491 Ga0307405_10032339 3300031731 Bacteria 3091
492 Ga0307405_10211108 3300031731 Bacteria 1417
493 Ga0316577_10012767 3300031733 Bacteria 4581
494 Ga0307413_10002828 3300031824 Bacteria 7153
495 Ga0307413_10057066 3300031824 Bacteria 2385
496 Ga0307410_10007569 3300031852 Bacteria 5955
497 Ga0307406_10141122 3300031901 Bacteria 1705
498 Ga0307407_10015054 3300031903 Bacteria 3807
499 Ga0307407_10027783 3300031903 Bacteria 3016
500 Ga0307407_10038255 3300031903 Bacteria 2657
501 Ga0307412_10002264 3300031911 Bacteria 10660
502 Ga0307412_10005050 3300031911 Bacteria 7378
503 Ga0307412_10017511 3300031911 Bacteria 4289
504 Ga0307412_10017840 3300031911 Bacteria 4255
505 Ga0307412_10022573 3300031911 Bacteria 3859
506 Ga0307412_10111948 3300031911 Bacteria 1950
507 Ga0307412_10135198 3300031911 Bacteria 1797
508 Ga0307412_10175422 3300031911 Bacteria 1606
509 Ga0307409_100001842 3300031995 Bacteria 10780
510 Ga0307409_100090062 3300031995 Bacteria 2510
511 Ga0307409_100231795 3300031995 Bacteria 1674
512 Ga0307409_100362701 3300031995 Bacteria 1371
513 Ga0307409_100387460 3300031995 Bacteria 1331
514 Ga0307416_100004045 3300032002 Bacteria 8762
515 Ga0307416_100071689 3300032002 Bacteria 2879
516 Ga0307416_100246747 3300032002 Bacteria 1735
517 Ga0307414_10130885 3300032004 Bacteria 1947
518 Ga0307414_10161927 3300032004 Bacteria 1778
519 Ga0307414_10263482 3300032004 Bacteria 1439
520 Ga0307414_10293656 3300032004 Bacteria 1371
521 Ga0307411_10001241 3300032005 Bacteria 10157
522 Ga0307411_10028369 3300032005 Bacteria 3402
523 Ga0307411_10080620 3300032005 Bacteria 2238
524 Ga0307411_10082852 3300032005 Bacteria 2213
525 Ga0307411_10170724 3300032005 Bacteria 1639
526 Ga0307411_10316373 3300032005 Bacteria 1259
527 Ga0307415_100005809 3300032126 Bacteria 6593
528 Ga0307415_100027497 3300032126 Bacteria 3604
529 Ga0316583_10071149 3300032133 Bacteria 1217
530 Ga0307510_10013692 3300033180 Bacteria 9614
531 Ga0316582_0105580 3300036647 Bacteria 1870
532 Ga0316582_0153412 3300036647 Bacteria 1558
533 Ga0316584_0026279 3300036712 Bacteria 4278
534 Ga0316584_0154947 3300036712 Bacteria 1704
535 Ga0316584_0192025 3300036712 Bacteria 1509
536 Ga0395899_0208222 3300037312 Unclassified 1360
537 Ga0395900_0014044 3300037418 Bacteria 8178
538 Ga0395900_0055459 3300037418 Bacteria 4081
539 Ga0395900_0069418 3300037418 Unclassified 3622
540 Ga0395905_0000013 3300037471 Bacteria 400797
541 Ga0395905_0000189 3300037471 Bacteria 97970
542 Ga0395905_0000250 3300037471 Bacteria 80488
543 Ga0395905_0003678 3300037471 Bacteria 16248
544 Ga0395905_0009396 3300037471 Bacteria 9560
545 Ga0395905_0010241 3300037471 Bacteria 9136
546 Ga0395905_0033055 3300037471 Bacteria 4863
547 Ga0395905_0061804 3300037471 Bacteria 3504
548 Ga0395905_0321207 3300037471 Bacteria 1438
549 Ga0395905_0451643 3300037471 Unclassified 1183
550 Ga0316581_0029471 3300037588 Bacteria 1649
551 Ga0395901_0359629 3300038443 Bacteria 1501
552 Ga0436361_0061781 3300039447 Bacteria 2146
553 Ga0439436_0000467 3300041404 Bacteria 10400
554 Ga0439438_000199 3300041405 Bacteria 27351
555 Ga0439438_001081 3300041405 Bacteria 12185
556 Ga0439438_002280 3300041405 Bacteria 8223
557 Ga0439438_003350 3300041405 Bacteria 6502
558 Ga0439438_006671 3300041405 Bacteria 4037
559 Ga0439438_007036 3300041405 Bacteria 3889
560 Ga0439438_008145 3300041405 Bacteria 3506
561 Ga0439438_009641 3300041405 Bacteria 3112
562 Ga0439438_012124 3300041405 Bacteria 2655
563 Ga0439438_017553 3300041405 Bacteria 2056
564 Ga0439438_018179 3300041405 Bacteria 2007
565 Ga0439438_018413 3300041405 Bacteria 1990
566 Ga0439438_039559 3300041405 Bacteria 1228
567 Ga0439438_040394 3300041405 Bacteria 1212
568 Ga0439447_000861 3300041407 Bacteria 11143
569 Ga0439447_002028 3300041407 Bacteria 7442
570 Ga0439447_004405 3300041407 Bacteria 4852
571 Ga0439447_005735 3300041407 Bacteria 4106
572 Ga0439447_017548 3300041407 Bacteria 1947
573 Ga0439447_030845 3300041407 Bacteria 1348
574 Ga0439466_0000524 3300041411 Bacteria 14461
575 Ga0439466_0000576 3300041411 Bacteria 13787
576 Ga0439466_0003528 3300041411 Bacteria 6052
577 Ga0439466_0004846 3300041411 Bacteria 5174
578 Ga0439466_0009355 3300041411 Bacteria 3661
579 Ga0439466_0009827 3300041411 Bacteria 3564
580 Ga0439466_0011451 3300041411 Bacteria 3282
581 Ga0439466_0012467 3300041411 Bacteria 3130
582 Ga0439466_0021798 3300041411 Bacteria 2266
583 Ga0439466_0024369 3300041411 Bacteria 2121
584 Ga0439465_0016595 3300041413 Bacteria 2297
585 Ga0439432_000453 3300042006 Bacteria 15287
586 Ga0439432_002611 3300042006 Bacteria 6775
587 Ga0439432_003737 3300042006 Bacteria 5624
588 Ga0439432_003969 3300042006 Bacteria 5438
589 Ga0439432_004712 3300042006 Bacteria 4966
590 Ga0439432_013859 3300042006 Bacteria 2734
591 Ga0439432_062703 3300042006 Bacteria 1143
592 Ga0439432_064698 3300042006 Bacteria 1122
593 Ga0439451_004554 3300042009 Bacteria 2821
594 Ga0439451_006133 3300042009 Bacteria 2457
595 Ga0439451_013115 3300042009 Bacteria 1674
596 Ga0439451_013262 3300042009 Bacteria 1666
597 Ga0439452_000385 3300042010 Bacteria 26357
598 Ga0439452_000387 3300042010 Bacteria 26315
599 Ga0439452_000902 3300042010 Bacteria 13558
600 Ga0439452_001617 3300042010 Bacteria 8904
601 Ga0439452_003120 3300042010 Bacteria 5877
602 Ga0439452_013230 3300042010 Bacteria 2321
603 Ga0439452_023243 3300042010 Bacteria 1596
604 Ga0439452_024936 3300042010 Bacteria 1522
605 Ga0439456_000112 3300042013 Bacteria 25773
606 Ga0439456_001877 3300042013 Bacteria 4235
607 Ga0439456_006368 3300042013 Bacteria 2408
608 Ga0439456_012493 3300042013 Bacteria 1760
609 Ga0439456_026847 3300042013 Bacteria 1225
610 Ga0439456_028937 3300042013 Bacteria 1183
611 Ga0439463_003967 3300042016 Bacteria 3727
612 Ga0439463_005916 3300042016 Bacteria 3038
613 Ga0439463_006484 3300042016 Bacteria 2900
614 Ga0439463_024219 3300042016 Bacteria 1521
615 Ga0439463_042289 3300042016 Bacteria 1158
616 Ga0450911_000164 3300042115 Bacteria 26562
617 Ga0450911_001185 3300042115 Bacteria 6364
618 Ga0450911_002661 3300042115 Bacteria 3414
619 Ga0450911_004135 3300042115 Bacteria 2422
620 Ga0450911_004457 3300042115 Bacteria 2293
621 Ga0450920_001490 3300042122 Bacteria 3879
622 Ga0450922_000524 3300042124 Bacteria 4069
623 Ga0450922_001234 3300042124 Bacteria 2532
624 Ga0450890_000208 3300042127 Bacteria 8856
625 Ga0450900_000339 3300042136 Bacteria 3458
626 Ga0450900_005342 3300042136 Bacteria 1514
627 Ga0450902_002208 3300042137 Bacteria 2743
628 Ga0450902_018125 3300042137 Bacteria 1152
629 Ga0450903_002755 3300042138 Bacteria 3097
630 Ga0450903_005900 3300042138 Bacteria 2044
631 Ga0450903_009029 3300042138 Bacteria 1628
632 Ga0450904_001639 3300042139 Bacteria 3009
633 Ga0450904_002044 3300042139 Bacteria 2539
634 Ga0450905_000699 3300042142 Bacteria 4108
635 Ga0450906_005166 3300042145 Bacteria 2702
636 Ga0450907_000150 3300042146 Bacteria 26657
637 Ga0450907_000551 3300042146 Bacteria 10185
638 Ga0450907_001002 3300042146 Bacteria 6648
639 Ga0450910_001623 3300042147 Bacteria 2870
640 Ga0439446_0016919 3300042156 Bacteria 2034
641 Ga0450909_010176 3300042185 Bacteria 1373
642 Ga0439434_0001826 3300042435 Bacteria 6189
643 Ga0439434_0005186 3300042435 Bacteria 3810
644 Ga0439434_0014027 3300042435 Bacteria 2383
645 Ga0439459_0000454 3300042438 Bacteria 5301
646 Ga0439460_0017274 3300042461 Bacteria 1931
647 Ga0450916_003223 3300042530 Bacteria 1780
648 Ga0450918_003211 3300042531 Bacteria 3048
649 Ga0450918_010522 3300042531 Bacteria 1614
650 Ga0450901_000917 3300042533 Bacteria 3447
651 Ga0451577_0000067 3300042876 Bacteria 250981
652 Ga0451577_0163721 3300042876 Bacteria 2004
653 Ga0439440_0006923 3300042993 Bacteria 2294
654 Ga0453683_0003872 3300044673 Bacteria 10853
655 Ga0453684_0000113 3300044712 Bacteria 359598
656 Ga0453684_0000215 3300044712 Bacteria 250981
657 Ga0453684_0014848 3300044712 Bacteria 12394
658 Ga0453684_0022287 3300044712 Bacteria 9406
659 Ga0453684_0093289 3300044712 Bacteria 3709
660 Ga0466960_0014489 3300044901 Bacteria 3376
661 Ga0451576_0000245 3300045051 Bacteria 133069
662 Ga0451576_0001823 3300045051 Bacteria 34651
663 Ga0451576_0004166 3300045051 Bacteria 19034
664 Ga0451576_0260476 3300045051 Bacteria 1813
665 Ga0466958_0228103 3300045836 Bacteria 1189
666 Ga0466967_0455576 3300045976 Unclassified 1251
667 Ga0495617_000491 3300046452 Bacteria 20909
668 Ga0495617_001369 3300046452 Bacteria 10766
669 Ga0495617_004672 3300046452 Bacteria 4953
670 Ga0495617_007572 3300046452 Bacteria 3764
671 Ga0495617_008183 3300046452 Bacteria 3611
672 Ga0495617_010219 3300046452 Bacteria 3214
673 Ga0495617_018006 3300046452 Bacteria 2388
674 Ga0495617_018952 3300046452 Bacteria 2328
675 Ga0495617_020715 3300046452 Bacteria 2222
676 Ga0495617_021143 3300046452 Bacteria 2198
677 Ga0495617_032926 3300046452 Bacteria 1740
678 Ga0495617_043083 3300046452 Bacteria 1507
679 Ga0495627_000130 3300046453 Bacteria 91090
680 Ga0495627_000678 3300046453 Bacteria 26223
681 Ga0495627_000738 3300046453 Bacteria 24598
682 Ga0495627_012248 3300046453 Bacteria 3050
683 Ga0495627_029220 3300046453 Bacteria 1755
684 Ga0495627_032885 3300046453 Bacteria 1629
685 Ga0495603_0001173 3300046455 Bacteria 15276
686 Ga0495603_0074338 3300046455 Bacteria 1995
687 Ga0495603_0133081 3300046455 Bacteria 1447
688 Ga0495590_0001655 3300046457 Bacteria 9500
689 Ga0495590_0002014 3300046457 Bacteria 8544
690 Ga0495590_0002963 3300046457 Bacteria 6972
691 Ga0495590_0003189 3300046457 Bacteria 6706
692 Ga0495591_000583 3300046458 Bacteria 27745
693 Ga0495591_000606 3300046458 Bacteria 27134
694 Ga0495591_001733 3300046458 Bacteria 12997
695 Ga0495591_001825 3300046458 Bacteria 12583
696 Ga0495591_003562 3300046458 Bacteria 7954
697 Ga0495591_004519 3300046458 Bacteria 6761
698 Ga0495591_007562 3300046458 Bacteria 4597
699 Ga0495591_010643 3300046458 Bacteria 3546
700 Ga0495591_012722 3300046458 Bacteria 3116
701 Ga0495591_013535 3300046458 Bacteria 2974
702 Ga0495591_017861 3300046458 Bacteria 2422
703 Ga0495591_020522 3300046458 Bacteria 2180
704 Ga0495591_021474 3300046458 Bacteria 2105
705 Ga0495591_044538 3300046458 Bacteria 1242
706 Ga0495638_0002845 3300046460 Bacteria 13866
707 Ga0495638_0009767 3300046460 Bacteria 6701
708 Ga0495638_0013005 3300046460 Bacteria 5683
709 Ga0495638_0022694 3300046460 Bacteria 4116
710 Ga0495638_0035693 3300046460 Bacteria 3168
711 Ga0495638_0038187 3300046460 Bacteria 3053
712 Ga0495638_0041879 3300046460 Bacteria 2894
713 Ga0495638_0043307 3300046460 Bacteria 2840
714 Ga0495638_0043309 3300046460 Bacteria 2840
715 Ga0495638_0043740 3300046460 Bacteria 2824
716 Ga0495638_0058258 3300046460 Bacteria 2394
717 Ga0495638_0077827 3300046460 Bacteria 2018
718 Ga0495638_0123636 3300046460 Bacteria 1526
719 Ga0495638_0183243 3300046460 Bacteria 1193
720 Ga0495651_0019804 3300046462 Bacteria 5217
721 Ga0495653_0006683 3300046463 Bacteria 9463
722 Ga0495653_0137672 3300046463 Bacteria 1720
723 Ga0495650_0001905 3300046471 Bacteria 18505
724 Ga0495650_0006424 3300046471 Bacteria 7326
725 Ga0495650_0007388 3300046471 Bacteria 6611
726 Ga0495650_0007821 3300046471 Bacteria 6357
727 Ga0495650_0008168 3300046471 Bacteria 6157
728 Ga0495650_0008917 3300046471 Bacteria 5775
729 Ga0495650_0009537 3300046471 Bacteria 5511
730 Ga0495650_0022495 3300046471 Bacteria 3022
731 Ga0495650_0025963 3300046471 Bacteria 2734
732 Ga0495650_0041584 3300046471 Bacteria 1964
733 Ga0495650_0061277 3300046471 Bacteria 1507
734 Ga0495650_0061278 3300046471 Bacteria 1507
735 Ga0495582_0023355 3300046473 Bacteria 3383
736 Ga0495605_0000125 3300046474 Bacteria 101414
737 Ga0495605_0000149 3300046474 Bacteria 90748
738 Ga0495605_0000155 3300046474 Bacteria 88662
739 Ga0495605_0002655 3300046474 Bacteria 10944
740 Ga0495605_0012717 3300046474 Bacteria 4661
741 Ga0495605_0016129 3300046474 Bacteria 4048
742 Ga0495605_0020040 3300046474 Bacteria 3558
743 Ga0495605_0029467 3300046474 Bacteria 2823
744 Ga0495605_0030530 3300046474 Bacteria 2761
745 Ga0495605_0035701 3300046474 Bacteria 2511
746 Ga0495605_0037191 3300046474 Bacteria 2450
747 Ga0495605_0038840 3300046474 Bacteria 2386
748 Ga0495605_0053038 3300046474 Bacteria 1968
749 Ga0495605_0067400 3300046474 Bacteria 1698
750 Ga0495605_0090915 3300046474 Bacteria 1414
751 Ga0495639_0001007 3300046475 Bacteria 12725
752 Ga0495639_0022411 3300046475 Bacteria 2770
753 Ga0495664_0067807 3300046477 Bacteria 2129
754 Ga0495584_0003136 3300046491 Bacteria 9183
755 Ga0495584_0003623 3300046491 Bacteria 8423
756 Ga0495584_0005124 3300046491 Bacteria 6958
757 Ga0495584_0018462 3300046491 Bacteria 3544
758 Ga0495584_0022348 3300046491 Bacteria 3209
759 Ga0495584_0023593 3300046491 Bacteria 3118
760 Ga0495584_0029759 3300046491 Bacteria 2767
761 Ga0495584_0030919 3300046491 Bacteria 2710
762 Ga0495584_0033432 3300046491 Bacteria 2601
763 Ga0495584_0040369 3300046491 Bacteria 2356
764 Ga0495584_0040836 3300046491 Bacteria 2342
765 Ga0495584_0047168 3300046491 Bacteria 2172
766 Ga0495584_0121403 3300046491 Bacteria 1323
767 Ga0495585_0003321 3300046492 Bacteria 10921
768 Ga0495585_0011254 3300046492 Bacteria 5299
769 Ga0495585_0017321 3300046492 Bacteria 4164
770 Ga0495585_0021336 3300046492 Bacteria 3719
771 Ga0495585_0026516 3300046492 Bacteria 3310
772 Ga0495585_0030156 3300046492 Bacteria 3085
773 Ga0495585_0036338 3300046492 Bacteria 2779
774 Ga0495585_0050344 3300046492 Bacteria 2311
775 Ga0495585_0054711 3300046492 Bacteria 2206
776 Ga0495585_0063137 3300046492 Bacteria 2033
777 Ga0495585_0090819 3300046492 Bacteria 1645
778 Ga0495594_0000599 3300046499 Bacteria 18568
779 Ga0495594_0031316 3300046499 Bacteria 2883
780 Ga0495594_0061306 3300046499 Bacteria 2081
781 Ga0495594_0067401 3300046499 Bacteria 1986
782 Ga0495596_0000417 3300046500 Bacteria 27188
783 Ga0495596_0016124 3300046500 Bacteria 3110
784 Ga0495607_0000444 3300046501 Bacteria 41557
785 Ga0495607_0001590 3300046501 Bacteria 19757
786 Ga0495607_0003552 3300046501 Bacteria 11873
787 Ga0495607_0004594 3300046501 Bacteria 10115
788 Ga0495607_0005901 3300046501 Bacteria 8690
789 Ga0495607_0007213 3300046501 Bacteria 7715
790 Ga0495607_0007419 3300046501 Bacteria 7591
791 Ga0495607_0008794 3300046501 Bacteria 6874
792 Ga0495607_0012159 3300046501 Bacteria 5691
793 Ga0495607_0014044 3300046501 Bacteria 5227
794 Ga0495607_0018033 3300046501 Bacteria 4512
795 Ga0495607_0020946 3300046501 Bacteria 4120
796 Ga0495607_0024678 3300046501 Bacteria 3744
797 Ga0495607_0037807 3300046501 Bacteria 2896
798 Ga0495607_0060716 3300046501 Bacteria 2151
799 Ga0495607_0123140 3300046501 Bacteria 1358
800 Ga0495607_0168276 3300046501 Bacteria 1108
801 Ga0495583_0000196 3300046506 Bacteria 101268
802 Ga0495583_0001312 3300046506 Bacteria 25860
803 Ga0495583_0001496 3300046506 Bacteria 23334
804 Ga0495583_0002113 3300046506 Bacteria 17845
805 Ga0495583_0002387 3300046506 Bacteria 16185
806 Ga0495583_0003690 3300046506 Bacteria 11397
807 Ga0495583_0006007 3300046506 Bacteria 8051
808 Ga0495583_0016076 3300046506 Bacteria 4039
809 Ga0495583_0018232 3300046506 Bacteria 3698
810 Ga0495583_0021576 3300046506 Bacteria 3309
811 Ga0495583_0039104 3300046506 Bacteria 2237
812 Ga0495583_0044448 3300046506 Bacteria 2061
813 Ga0495606_0000812 3300046507 Bacteria 47489
814 Ga0495606_0004170 3300046507 Bacteria 14649
815 Ga0495606_0004874 3300046507 Bacteria 13150
816 Ga0495606_0005485 3300046507 Bacteria 12139
817 Ga0495606_0012469 3300046507 Bacteria 6810
818 Ga0495606_0012961 3300046507 Bacteria 6634
819 Ga0495606_0019626 3300046507 Bacteria 5018
820 Ga0495606_0035305 3300046507 Bacteria 3418
821 Ga0495606_0038139 3300046507 Bacteria 3253
822 Ga0495606_0050495 3300046507 Bacteria 2720
823 Ga0495606_0071879 3300046507 Bacteria 2176
824 Ga0495606_0084158 3300046507 Bacteria 1971
825 Ga0495606_0132984 3300046507 Bacteria 1477
826 Ga0495610_0002150 3300046512 Bacteria 16757
827 Ga0495610_0004952 3300046512 Bacteria 9651
828 Ga0495610_0005624 3300046512 Bacteria 8846
829 Ga0495610_0006156 3300046512 Bacteria 8346
830 Ga0495610_0012671 3300046512 Bacteria 5055
831 Ga0495610_0017516 3300046512 Bacteria 4081
832 Ga0495610_0018794 3300046512 Bacteria 3886
833 Ga0495610_0050580 3300046512 Bacteria 2028
834 Ga0495616_0000846 3300046513 Bacteria 22348
835 Ga0495616_0002466 3300046513 Bacteria 12266
836 Ga0495616_0006003 3300046513 Bacteria 7403
837 Ga0495616_0015840 3300046513 Bacteria 4182
838 Ga0495616_0017760 3300046513 Bacteria 3919
839 Ga0495616_0022980 3300046513 Bacteria 3360
840 Ga0495616_0025846 3300046513 Bacteria 3132
841 Ga0495616_0035429 3300046513 Bacteria 2583
842 Ga0495616_0046285 3300046513 Bacteria 2196
843 Ga0495616_0070726 3300046513 Bacteria 1688
844 Ga0495616_0094665 3300046513 Bacteria 1409
845 Ga0495616_0134480 3300046513 Bacteria 1130
846 Ga0495620_0000003 3300046515 Bacteria 345923
847 Ga0495620_0000055 3300046515 Bacteria 99544
848 Ga0495620_0000426 3300046515 Bacteria 28068
849 Ga0495620_0002668 3300046515 Bacteria 10306
850 Ga0495620_0016779 3300046515 Bacteria 3665
851 Ga0495620_0016857 3300046515 Bacteria 3654
852 Ga0495620_0018067 3300046515 Bacteria 3498
853 Ga0495620_0024440 3300046515 Bacteria 2873
854 Ga0495620_0027962 3300046515 Bacteria 2629
855 Ga0495620_0028903 3300046515 Bacteria 2571
856 Ga0495620_0030977 3300046515 Bacteria 2455
857 Ga0495620_0031372 3300046515 Bacteria 2435
858 Ga0495620_0035367 3300046515 Bacteria 2246
859 Ga0495628_0124647 3300046516 Bacteria 1974
860 Ga0495630_0059672 3300046517 Bacteria 2862
861 Ga0495630_0106308 3300046517 Bacteria 2125
862 Ga0495631_0000403 3300046518 Bacteria 29813
863 Ga0495631_0002343 3300046518 Bacteria 10784
864 Ga0495631_0003513 3300046518 Bacteria 8569
865 Ga0495631_0010248 3300046518 Bacteria 4646
866 Ga0495631_0014028 3300046518 Bacteria 3873
867 Ga0495631_0045743 3300046518 Bacteria 1926
868 Ga0495631_0050644 3300046518 Bacteria 1816
869 Ga0495631_0075043 3300046518 Bacteria 1459
870 Ga0495631_0087283 3300046518 Bacteria 1343
871 Ga0495631_0094122 3300046518 Bacteria 1289
872 Ga0495632_0001013 3300046519 Bacteria 24362
873 Ga0495632_0001944 3300046519 Bacteria 16500
874 Ga0495632_0003227 3300046519 Bacteria 11710
875 Ga0495632_0003468 3300046519 Bacteria 11153
876 Ga0495632_0003740 3300046519 Bacteria 10650
877 Ga0495632_0008801 3300046519 Bacteria 6149
878 Ga0495632_0013378 3300046519 Bacteria 4684
879 Ga0495632_0016468 3300046519 Bacteria 4110
880 Ga0495632_0022411 3300046519 Bacteria 3385
881 Ga0495632_0024132 3300046519 Bacteria 3236
882 Ga0495632_0027803 3300046519 Bacteria 2957
883 Ga0495632_0028525 3300046519 Bacteria 2912
884 Ga0495632_0038253 3300046519 Bacteria 2430
885 Ga0495632_0041297 3300046519 Bacteria 2318
886 Ga0495632_0043909 3300046519 Bacteria 2232
887 Ga0495632_0081253 3300046519 Bacteria 1545
888 Ga0495632_0089788 3300046519 Bacteria 1458
889 Ga0495632_0094292 3300046519 Bacteria 1415
890 Ga0495632_0144821 3300046519 Bacteria 1100
891 Ga0495637_0000204 3300046520 Bacteria 46396
892 Ga0495637_0000844 3300046520 Bacteria 20216
893 Ga0495637_0002882 3300046520 Bacteria 9319
894 Ga0495637_0003063 3300046520 Bacteria 8925
895 Ga0495637_0003572 3300046520 Bacteria 8242
896 Ga0495637_0003788 3300046520 Bacteria 7959
897 Ga0495637_0011675 3300046520 Bacteria 4216
898 Ga0495637_0014418 3300046520 Bacteria 3729
899 Ga0495637_0017782 3300046520 Bacteria 3305
900 Ga0495637_0024226 3300046520 Bacteria 2746
901 Ga0495637_0025297 3300046520 Bacteria 2675
902 Ga0495637_0028927 3300046520 Bacteria 2470
903 Ga0495637_0035448 3300046520 Bacteria 2178
904 Ga0495637_0035484 3300046520 Bacteria 2177
905 Ga0495637_0044726 3300046520 Bacteria 1883
906 Ga0495637_0053178 3300046520 Bacteria 1686
907 Ga0495643_0000319 3300046522 Bacteria 66471
908 Ga0495643_0005885 3300046522 Bacteria 8199
909 Ga0495643_0006752 3300046522 Bacteria 7505
910 Ga0495643_0006925 3300046522 Bacteria 7374
911 Ga0495643_0008963 3300046522 Bacteria 6285
912 Ga0495643_0009349 3300046522 Bacteria 6095
913 Ga0495643_0043071 3300046522 Bacteria 2457
914 Ga0495643_0045252 3300046522 Bacteria 2389
915 Ga0495643_0052074 3300046522 Bacteria 2199
916 Ga0495643_0071467 3300046522 Bacteria 1821
917 Ga0495644_0000931 3300046523 Bacteria 12158
918 Ga0495644_0004035 3300046523 Bacteria 5776
919 Ga0495644_0007984 3300046523 Bacteria 4071
920 Ga0495644_0021435 3300046523 Bacteria 2465
921 Ga0495644_0037358 3300046523 Bacteria 1832
922 Ga0495644_0053304 3300046523 Bacteria 1519
923 Ga0495644_0061190 3300046523 Bacteria 1415
924 Ga0495648_0002744 3300046524 Bacteria 15903
925 Ga0495648_0003294 3300046524 Bacteria 14266
926 Ga0495648_0006599 3300046524 Bacteria 9428
927 Ga0495648_0006625 3300046524 Bacteria 9391
928 Ga0495648_0010717 3300046524 Bacteria 6961
929 Ga0495648_0012418 3300046524 Bacteria 6356
930 Ga0495648_0013998 3300046524 Bacteria 5900
931 Ga0495648_0018685 3300046524 Bacteria 4896
932 Ga0495648_0019694 3300046524 Bacteria 4732
933 Ga0495648_0024066 3300046524 Bacteria 4156
934 Ga0495648_0028466 3300046524 Bacteria 3721
935 Ga0495648_0036735 3300046524 Bacteria 3155
936 Ga0495648_0041162 3300046524 Bacteria 2921
937 Ga0495648_0058881 3300046524 Bacteria 2294
938 Ga0495648_0060300 3300046524 Bacteria 2258
939 Ga0495648_0064793 3300046524 Bacteria 2151
940 Ga0495648_0076387 3300046524 Bacteria 1923
941 Ga0495648_0091035 3300046524 Bacteria 1707
942 Ga0495648_0099124 3300046524 Bacteria 1613
943 Ga0495648_0103052 3300046524 Bacteria 1570
944 Ga0495666_0014798 3300046526 Bacteria 3882
945 Ga0495642_0000324 3300046528 Bacteria 26064
946 Ga0495642_0003106 3300046528 Bacteria 6591
947 Ga0495642_0008500 3300046528 Bacteria 3927
948 Ga0495654_0001040 3300046530 Bacteria 20303
949 Ga0495654_0002193 3300046530 Bacteria 12663
950 Ga0495654_0002384 3300046530 Bacteria 12121
951 Ga0495654_0005540 3300046530 Bacteria 7316
952 Ga0495654_0006257 3300046530 Bacteria 6779
953 Ga0495654_0011815 3300046530 Bacteria 4714
954 Ga0495654_0012813 3300046530 Bacteria 4497
955 Ga0495654_0013376 3300046530 Bacteria 4392
956 Ga0495654_0014747 3300046530 Bacteria 4155
957 Ga0495654_0022694 3300046530 Bacteria 3255
958 Ga0495654_0023244 3300046530 Bacteria 3211
959 Ga0495654_0024300 3300046530 Bacteria 3132
960 Ga0495654_0033992 3300046530 Bacteria 2576
961 Ga0495654_0037775 3300046530 Bacteria 2418
962 Ga0495654_0038555 3300046530 Bacteria 2389
963 Ga0495654_0046495 3300046530 Bacteria 2137
964 Ga0495654_0048135 3300046530 Bacteria 2093
965 Ga0495654_0058316 3300046530 Bacteria 1863
966 Ga0495654_0097278 3300046530 Bacteria 1359
967 Ga0495586_0035029 3300046535 Bacteria 2696
968 Ga0495587_0001552 3300046536 Bacteria 15274
969 Ga0495587_0040276 3300046536 Bacteria 2793
970 Ga0495609_0000087 3300046538 Bacteria 110204
971 Ga0495609_0000141 3300046538 Bacteria 75953
972 Ga0495609_0000412 3300046538 Bacteria 35828
973 Ga0495609_0002027 3300046538 Bacteria 12787
974 Ga0495609_0014786 3300046538 Bacteria 3663
975 Ga0495609_0031227 3300046538 Bacteria 2422
976 Ga0495609_0034887 3300046538 Bacteria 2279
977 Ga0495609_0076195 3300046538 Bacteria 1470
978 Ga0495597_0000097 3300046542 Bacteria 78347
979 Ga0495597_0001638 3300046542 Bacteria 15663
980 Ga0495597_0005980 3300046542 Bacteria 6348
981 Ga0495597_0009054 3300046542 Bacteria 4945
982 Ga0495597_0014297 3300046542 Bacteria 3781
983 Ga0495597_0014532 3300046542 Bacteria 3745
984 Ga0495597_0022179 3300046542 Bacteria 2947
985 Ga0495597_0028619 3300046542 Bacteria 2549
986 Ga0495597_0031562 3300046542 Bacteria 2409
987 Ga0495597_0037741 3300046542 Bacteria 2169
988 Ga0495597_0041823 3300046542 Bacteria 2045
989 Ga0495597_0053787 3300046542 Bacteria 1769
990 Ga0495597_0058525 3300046542 Bacteria 1684
991 Ga0495597_0080423 3300046542 Bacteria 1394
992 Ga0495645_0057903 3300046543 Bacteria 2812
993 Ga0495622_0001580 3300046557 Bacteria 11264
994 Ga0495622_0001672 3300046557 Bacteria 10975
995 Ga0495622_0002250 3300046557 Bacteria 9392
996 Ga0495622_0020630 3300046557 Bacteria 3069
997 Ga0495633_0000134 3300046558 Bacteria 98658
998 Ga0495633_0006724 3300046558 Bacteria 6768
999 Ga0495633_0011897 3300046558 Bacteria 4660
1000 Ga0495656_0002042 3300046615 Bacteria 6650
1001 Ga0495668_0003191 3300046616 Bacteria 12557
1002 Ga0495668_0003494 3300046616 Bacteria 11721
1003 Ga0495668_0042934 3300046616 Bacteria 2515
1004 Ga0495668_0044303 3300046616 Bacteria 2473
1005 Ga0495668_0046545 3300046616 Bacteria 2409
1006 Ga0495634_0004253 3300046642 Bacteria 11290
1007 Ga0495634_0062713 3300046642 Bacteria 2468
1008 Ga0495611_0000518 3300046648 Bacteria 22917
1009 Ga0495611_0001167 3300046648 Bacteria 13700
1010 Ga0495611_0002390 3300046648 Bacteria 8637
1011 Ga0495611_0034414 3300046648 Bacteria 2239
1012 Ga0495611_0042599 3300046648 Bacteria 2027
1013 Ga0495611_0053707 3300046648 Bacteria 1819
1014 Ga0495625_0000145 3300046660 Bacteria 108480
1015 Ga0495625_0008796 3300046660 Bacteria 8550
1016 Ga0495625_0010198 3300046660 Bacteria 7797
1017 Ga0495625_0020848 3300046660 Bacteria 5053
1018 Ga0495625_0022935 3300046660 Bacteria 4775
1019 Ga0495625_0031393 3300046660 Bacteria 3952
1020 Ga0495625_0052272 3300046660 Bacteria 2926
1021 Ga0495625_0055240 3300046660 Bacteria 2832
1022 Ga0495625_0108718 3300046660 Bacteria 1897
1023 Ga0495625_0139380 3300046660 Bacteria 1637
1024 Ga0495625_0206656 3300046660 Bacteria 1293
1025 Ga0495635_0017140 3300046663 Bacteria 5058
1026 Ga0495635_0017323 3300046663 Bacteria 5033
1027 Ga0495659_0000880 3300046664 Bacteria 10670
1028 Ga0495659_0014805 3300046664 Bacteria 2558
1029 Ga0495659_0041933 3300046664 Bacteria 1636
1030 Ga0495661_0000193 3300046665 Bacteria 70300
1031 Ga0495661_0000332 3300046665 Bacteria 51357
1032 Ga0495661_0000434 3300046665 Bacteria 44139
1033 Ga0495661_0000961 3300046665 Bacteria 26164
1034 Ga0495661_0009351 3300046665 Bacteria 6728
1035 Ga0495661_0018326 3300046665 Bacteria 4607
1036 Ga0495661_0020927 3300046665 Bacteria 4266
1037 Ga0495661_0035857 3300046665 Bacteria 3109
1038 Ga0495661_0038010 3300046665 Bacteria 3002
1039 Ga0495661_0049579 3300046665 Bacteria 2545
1040 Ga0495661_0050211 3300046665 Bacteria 2526
1041 Ga0495661_0050909 3300046665 Bacteria 2504
1042 Ga0495661_0057437 3300046665 Bacteria 2323
1043 Ga0495588_0013970 3300046674 Bacteria 3835
1044 Ga0495588_0014483 3300046674 Bacteria 3775
1045 Ga0495623_0005516 3300046679 Bacteria 8262
1046 Ga0495623_0021429 3300046679 Bacteria 4172
1047 Ga0495646_0010680 3300046680 Bacteria 5834
1048 Ga0495646_0016771 3300046680 Bacteria 4651
1049 Ga0495646_0079342 3300046680 Bacteria 1916
1050 Ga0495669_0006925 3300046684 Bacteria 4749
1051 Ga0495613_0061386 3300046689 Bacteria 2752
1052 Ga0495613_0124318 3300046689 Bacteria 1851
1053 Ga0495613_0125086 3300046689 Bacteria 1844
1054 Ga0495624_0004697 3300046690 Bacteria 9945
1055 Ga0495670_0001238 3300046691 Bacteria 12451
1056 Ga0495670_0002916 3300046691 Bacteria 8428
1057 Ga0495670_0003785 3300046691 Bacteria 7435
1058 Ga0495670_0016065 3300046691 Bacteria 3679
1059 Ga0495670_0016658 3300046691 Bacteria 3614
1060 Ga0495670_0028083 3300046691 Bacteria 2788
1061 Ga0495670_0036366 3300046691 Bacteria 2453
1062 Ga0495670_0049170 3300046691 Bacteria 2109
1063 Ga0495670_0139802 3300046691 Bacteria 1266
1064 Ga0495670_0148032 3300046691 Bacteria 1230
1065 Ga0495671_0003100 3300046692 Bacteria 10333
1066 Ga0495671_0004392 3300046692 Bacteria 8442
1067 Ga0495671_0007792 3300046692 Bacteria 6064
1068 Ga0495671_0012860 3300046692 Bacteria 4555
1069 Ga0495671_0019690 3300046692 Bacteria 3562
1070 Ga0495671_0022847 3300046692 Bacteria 3271
1071 Ga0495671_0029469 3300046692 Bacteria 2818
1072 Ga0495671_0033590 3300046692 Bacteria 2612
1073 Ga0495671_0046790 3300046692 Bacteria 2162
1074 Ga0495671_0070407 3300046692 Bacteria 1718
1075 Ga0495671_0086623 3300046692 Bacteria 1534
1076 Ga0495671_0117081 3300046692 Bacteria 1300
1077 Ga0495671_0148663 3300046692 Bacteria 1140
1078 Ga0495671_0148669 3300046692 Bacteria 1140
1079 Ga0495649_0002318 3300046694 Bacteria 13492
1080 Ga0495649_0006225 3300046694 Bacteria 7442
1081 Ga0495649_0023398 3300046694 Bacteria 3452
1082 Ga0495649_0024703 3300046694 Bacteria 3350
1083 Ga0495649_0029524 3300046694 Bacteria 3032
1084 Ga0495649_0032639 3300046694 Bacteria 2867
1085 Ga0495649_0044463 3300046694 Bacteria 2424
1086 Ga0495649_0079465 3300046694 Bacteria 1754
1087 Ga0495649_0099761 3300046694 Bacteria 1544
1088 Ga0495649_0128680 3300046694 Bacteria 1336
1089 Ga0495589_0000447 3300046794 Bacteria 30382
1090 Ga0495589_0000771 3300046794 Bacteria 20448
1091 Ga0495589_0001962 3300046794 Bacteria 11644
1092 Ga0495589_0004203 3300046794 Bacteria 7702
1093 Ga0495589_0009641 3300046794 Bacteria 5020
1094 Ga0495589_0011083 3300046794 Bacteria 4677
1095 Ga0495589_0016468 3300046794 Bacteria 3800
1096 Ga0495589_0026703 3300046794 Bacteria 2924
1097 Ga0495589_0030092 3300046794 Bacteria 2735
1098 Ga0495589_0052246 3300046794 Bacteria 2019
1099 Ga0495589_0061380 3300046794 Bacteria 1845
1100 Ga0495600_0038024 3300046809 Bacteria 3130
1101 Ga0495600_0079784 3300046809 Bacteria 2136
1102 Ga0495660_0002230 3300046810 Bacteria 12466
1103 Ga0495660_0005722 3300046810 Bacteria 7422
1104 Ga0495660_0006186 3300046810 Bacteria 7105
1105 Ga0495660_0006552 3300046810 Bacteria 6878
1106 Ga0495660_0007890 3300046810 Bacteria 6249
1107 Ga0495660_0012026 3300046810 Bacteria 5019
1108 Ga0495660_0017076 3300046810 Bacteria 4179
1109 Ga0495660_0024783 3300046810 Bacteria 3414
1110 Ga0495660_0031821 3300046810 Bacteria 2964
1111 Ga0495660_0034262 3300046810 Bacteria 2842
1112 Ga0495660_0051114 3300046810 Bacteria 2249
1113 Ga0495660_0055197 3300046810 Bacteria 2151
1114 Ga0495660_0077244 3300046810 Bacteria 1752
1115 Ga0495660_0094427 3300046810 Bacteria 1549
1116 Ga0495660_0125275 3300046810 Bacteria 1294
1117 Ga0495581_0034967 3300047315 Bacteria 2907
1118 Ga0495581_0065403 3300047315 Bacteria 2102
1119 Ga0495604_0001553 3300047317 Bacteria 18920
1120 Ga0495604_0015101 3300047317 Bacteria 6161
1121 Ga0495604_0039934 3300047317 Bacteria 3686
1122 Ga0495604_0154785 3300047317 Bacteria 1625
1123 Ga0495636_0020991 3300047318 Bacteria 2634
1124 Ga0495636_0113760 3300047318 Bacteria 1192
1125 Ga0495674_0006015 3300047319 Bacteria 11653
1126 Ga0495674_0018109 3300047319 Bacteria 6557
1127 Ga0495672_0001160 3300047320 Bacteria 26644
1128 Ga0495672_0003146 3300047320 Bacteria 14369
1129 Ga0495672_0004514 3300047320 Bacteria 11361
1130 Ga0495672_0005570 3300047320 Bacteria 9956
1131 Ga0495672_0008825 3300047320 Bacteria 7380
1132 Ga0495672_0009039 3300047320 Bacteria 7264
1133 Ga0495672_0010698 3300047320 Bacteria 6514
1134 Ga0495672_0016503 3300047320 Bacteria 4972
1135 Ga0495672_0019211 3300047320 Bacteria 4513
1136 Ga0495672_0025656 3300047320 Bacteria 3767
1137 Ga0495672_0026505 3300047320 Bacteria 3698
1138 Ga0495672_0032346 3300047320 Bacteria 3256
1139 Ga0495672_0045302 3300047320 Bacteria 2632
1140 Ga0495672_0045814 3300047320 Bacteria 2613
1141 Ga0495672_0058990 3300047320 Bacteria 2222
1142 Ga0495672_0114778 3300047320 Bacteria 1440
1143 Ga0495672_0139855 3300047320 Bacteria 1265
1144 Ga0495676_0000198 3300047321 Bacteria 47538
1145 Ga0495676_0013241 3300047321 Bacteria 7416
1146 Ga0495676_0013298 3300047321 Bacteria 7397
1147 Ga0495680_0003997 3300047322 Bacteria 14242
1148 Ga0495680_0026023 3300047322 Bacteria 4831
1149 Ga0495680_0073182 3300047322 Bacteria 2605
1150 Ga0495680_0135828 3300047322 Bacteria 1803
1151 Ga0495683_0000095 3300047323 Bacteria 89824
1152 Ga0495683_0000518 3300047323 Bacteria 29629
1153 Ga0495683_0005438 3300047323 Bacteria 7068
1154 Ga0495683_0010889 3300047323 Bacteria 4795
1155 Ga0495683_0022912 3300047323 Bacteria 3211
1156 Ga0495683_0035744 3300047323 Bacteria 2525
1157 Ga0495683_0045918 3300047323 Bacteria 2193
1158 Ga0495683_0057272 3300047323 Bacteria 1937
1159 Ga0495683_0069118 3300047323 Bacteria 1736
1160 Ga0495683_0096408 3300047323 Bacteria 1427
1161 Ga0495687_000169 3300047443 Bacteria 97243
1162 Ga0495687_003637 3300047443 Bacteria 11002
1163 Ga0495687_007816 3300047443 Bacteria 6225
1164 Ga0495687_014114 3300047443 Bacteria 4129
1165 Ga0495677_0008145 3300047445 Bacteria 3891
1166 Ga0495679_000511 3300047446 Bacteria 27627
1167 Ga0495679_001251 3300047446 Bacteria 15040
1168 Ga0495679_004466 3300047446 Bacteria 6438
1169 Ga0495679_008541 3300047446 Bacteria 4155
1170 Ga0495679_012912 3300047446 Bacteria 3158
1171 Ga0495679_018784 3300047446 Bacteria 2444
1172 Ga0495679_029101 3300047446 Bacteria 1804
1173 Ga0495679_034807 3300047446 Bacteria 1600
1174 Ga0495679_050817 3300047446 Bacteria 1245
1175 Ga0495685_058451 3300047447 Bacteria 1301
1176 Ga0495673_0000790 3300047469 Bacteria 29784
1177 Ga0495673_0000979 3300047469 Bacteria 25628
1178 Ga0495673_0001198 3300047469 Bacteria 21631
1179 Ga0495673_0001573 3300047469 Bacteria 17895
1180 Ga0495673_0001605 3300047469 Bacteria 17595
1181 Ga0495673_0001783 3300047469 Bacteria 16344
1182 Ga0495673_0002737 3300047469 Bacteria 12081
1183 Ga0495673_0005607 3300047469 Bacteria 7553
1184 Ga0495673_0009482 3300047469 Bacteria 5388
1185 Ga0495673_0016016 3300047469 Bacteria 3846
1186 Ga0495673_0020049 3300047469 Bacteria 3335
1187 Ga0495673_0022149 3300047469 Bacteria 3119
1188 Ga0495673_0024116 3300047469 Bacteria 2946
1189 Ga0495673_0024832 3300047469 Bacteria 2887
1190 Ga0495673_0026259 3300047469 Bacteria 2786
1191 Ga0495673_0038270 3300047469 Bacteria 2183
1192 Ga0495673_0040801 3300047469 Bacteria 2093
1193 Ga0495673_0042517 3300047469 Bacteria 2039
1194 Ga0495673_0049216 3300047469 Bacteria 1855
1195 Ga0495673_0054301 3300047469 Bacteria 1742
1196 Ga0495673_0062620 3300047469 Bacteria 1588
1197 Ga0495673_0064290 3300047469 Bacteria 1561
1198 Ga0495673_0069974 3300047469 Bacteria 1479
1199 Ga0495673_0072252 3300047469 Bacteria 1448
1200 Ga0495681_0000096 3300047470 Bacteria 76473
1201 Ga0495681_0001286 3300047470 Bacteria 19000
1202 Ga0495681_0003091 3300047470 Bacteria 11668
1203 Ga0495681_0003471 3300047470 Bacteria 10960
1204 Ga0495681_0005125 3300047470 Bacteria 8831
1205 Ga0495681_0006191 3300047470 Bacteria 7892
1206 Ga0495681_0012187 3300047470 Bacteria 5066
1207 Ga0495681_0012740 3300047470 Bacteria 4922
1208 Ga0495681_0013863 3300047470 Bacteria 4658
1209 Ga0495681_0015876 3300047470 Bacteria 4249
1210 Ga0495681_0019702 3300047470 Bacteria 3675
1211 Ga0495681_0020155 3300047470 Bacteria 3622
1212 Ga0495681_0027964 3300047470 Bacteria 2909
1213 Ga0495681_0041036 3300047470 Bacteria 2249
1214 Ga0495681_0045766 3300047470 Bacteria 2091
1215 Ga0495681_0059365 3300047470 Bacteria 1769
1216 Ga0495681_0101705 3300047470 Bacteria 1255
1217 Ga0495684_0063127 3300047471 Bacteria 2817
1218 Ga0495684_0241063 3300047471 Bacteria 1319
1219 Ga0495686_0000002 3300047472 Bacteria 1050777
1220 Ga0495686_0013800 3300047472 Bacteria 5597
1221 Ga0495686_0016524 3300047472 Bacteria 5003
1222 Ga0495686_0046404 3300047472 Bacteria 2746
1223 Ga0495686_0046757 3300047472 Bacteria 2734
1224 Ga0495593_0005650 3300047673 Bacteria 7382
1225 Ga0495593_0053131 3300047673 Bacteria 2138
1226 Ga0495593_0056236 3300047673 Bacteria 2069
1227 Ga0495593_0147256 3300047673 Bacteria 1191
1228 Ga0495602_0027272 3300048088 Bacteria 5491
1229 Ga0495626_0000372 3300048091 Bacteria 46880
1230 Ga0495626_0000869 3300048091 Bacteria 26839
1231 Ga0495626_0001573 3300048091 Bacteria 17887
1232 Ga0495626_0002679 3300048091 Bacteria 12038
1233 Ga0495626_0003121 3300048091 Bacteria 10849
1234 Ga0495626_0003172 3300048091 Bacteria 10710
1235 Ga0495626_0005316 3300048091 Bacteria 7589
1236 Ga0495626_0005972 3300048091 Bacteria 7005
1237 Ga0495626_0008011 3300048091 Bacteria 5836
1238 Ga0495626_0009785 3300048091 Bacteria 5160
1239 Ga0495626_0016847 3300048091 Bacteria 3703
1240 Ga0495626_0018036 3300048091 Bacteria 3554
1241 Ga0495626_0036071 3300048091 Bacteria 2357
1242 Ga0495626_0039664 3300048091 Bacteria 2227
1243 Ga0495626_0080728 3300048091 Bacteria 1445
1244 Ga0496102_0003755 3300048905 Bacteria 12838
1245 Ga0496103_0008439 3300048906 Bacteria 6119
1246 Ga0496106_0000067 3300048909 Bacteria 83475
1247 Ga0496106_0158213 3300048909 Bacteria 1790
1248 Ga0496109_0000208 3300048912 Bacteria 57821
1249 Ga0496110_0062813 3300048913 Bacteria 3281
1250 Ga0496110_0115517 3300048913 Bacteria 2416
1251 Ga0496110_0237594 3300048913 Bacteria 1658
1252 Ga0496112_0066333 3300048915 Bacteria 3561
1253 Ga0496112_0551740 3300048915 Bacteria 1086
1254 Ga0496114_0055653 3300048917 Bacteria 3300
1255 Ga0496114_0366907 3300048917 Bacteria 1274
1256 Ga0496115_0137956 3300048918 Unclassified 2011
1257 Ga0496115_0182534 3300048918 Bacteria 1734
1258 Ga0496116_0000017 3300048919 Bacteria 554463
1259 Ga0496116_0000825 3300048919 Bacteria 39115
1260 Ga0496116_0003367 3300048919 Bacteria 15867
1261 Ga0496116_0039119 3300048919 Bacteria 3282
1262 Ga0496116_0050155 3300048919 Bacteria 2783
1263 Ga0496116_0051786 3300048919 Unclassified 2724
1264 Ga0496117_0001387 3300048920 Bacteria 35141
1265 Ga0496117_0014011 3300048920 Bacteria 6939
1266 Ga0496117_0016798 3300048920 Bacteria 6150
1267 Ga0496117_0022003 3300048920 Bacteria 5128
1268 Ga0496117_0029470 3300048920 Bacteria 4230
1269 Ga0496117_0029800 3300048920 Bacteria 4200
1270 Ga0496117_0031689 3300048920 Bacteria 4031
1271 Ga0496117_0050688 3300048920 Bacteria 2942
1272 Ga0496117_0055024 3300048920 Bacteria 2783
1273 Ga0496117_0072491 3300048920 Bacteria 2302
1274 Ga0496117_0085127 3300048920 Bacteria 2060
1275 Ga0496117_0128412 3300048920 Bacteria 1542
1276 Ga0496118_0006011 3300048921 Bacteria 13528
1277 Ga0496118_0009157 3300048921 Bacteria 10063
1278 Ga0496118_0011347 3300048921 Bacteria 8709
1279 Ga0496118_0022862 3300048921 Bacteria 5451
1280 Ga0496118_0031243 3300048921 Bacteria 4420
1281 Ga0496118_0031721 3300048921 Bacteria 4373
1282 Ga0496118_0035603 3300048921 Bacteria 4038
1283 Ga0496118_0044214 3300048921 Bacteria 3490
1284 Ga0496118_0079811 3300048921 Bacteria 2306
1285 Ga0496118_0197131 3300048921 Bacteria 1197
1286 Ga0496119_0000380 3300048922 Bacteria 61208
1287 Ga0496119_0042611 3300048922 Bacteria 2876
1288 Ga0496120_0008249 3300048923 Bacteria 7610
1289 Ga0496120_0023099 3300048923 Bacteria 3897
1290 Ga0496120_0047569 3300048923 Bacteria 2472
1291 Ga0496121_0001836 3300048924 Bacteria 34258
1292 Ga0496121_0003161 3300048924 Bacteria 23741
1293 Ga0496121_0003439 3300048924 Bacteria 22622
1294 Ga0496121_0004616 3300048924 Bacteria 18345
1295 Ga0496121_0026975 3300048924 Bacteria 5390
1296 Ga0496121_0086691 3300048924 Bacteria 2460
1297 Ga0496121_0157583 3300048924 Bacteria 1664
1298 Ga0496121_0270359 3300048924 Bacteria 1168
1299 Ga0496122_0002009 3300048925 Bacteria 30251
1300 Ga0496122_0002967 3300048925 Bacteria 23120
1301 Ga0496122_0004867 3300048925 Bacteria 16328
1302 Ga0496122_0008737 3300048925 Bacteria 10844
1303 Ga0496122_0053631 3300048925 Bacteria 3037
1304 Ga0496122_0056226 3300048925 Bacteria 2935
1305 Ga0496122_0058893 3300048925 Bacteria 2839
1306 Ga0496122_0063427 3300048925 Bacteria 2697
1307 Ga0496122_0159896 3300048925 Bacteria 1375
1308 Ga0496122_0190426 3300048925 Bacteria 1212
1309 Ga0496123_0001758 3300048926 Bacteria 28593
1310 Ga0496123_0001969 3300048926 Bacteria 26631
1311 Ga0496123_0003732 3300048926 Bacteria 16728
1312 Ga0496123_0012283 3300048926 Bacteria 7319
1313 Ga0496123_0044446 3300048926 Bacteria 3037
1314 Ga0496123_0049534 3300048926 Bacteria 2815
1315 Ga0496123_0050228 3300048926 Bacteria 2788
1316 Ga0496123_0059156 3300048926 Bacteria 2480
1317 Ga0496123_0080406 3300048926 Bacteria 1986
1318 Ga0496124_0000355 3300048927 Bacteria 83748
1319 Ga0496124_0001964 3300048927 Bacteria 28105
1320 Ga0496124_0002197 3300048927 Bacteria 26029
1321 Ga0496124_0008144 3300048927 Bacteria 11003
1322 Ga0496124_0009954 3300048927 Bacteria 9713
1323 Ga0496124_0010733 3300048927 Bacteria 9235
1324 Ga0496124_0011212 3300048927 Bacteria 8985
1325 Ga0496124_0016387 3300048927 Bacteria 7049
1326 Ga0496124_0036358 3300048927 Bacteria 4297
1327 Ga0496124_0040666 3300048927 Bacteria 4020
1328 Ga0496124_0048703 3300048927 Bacteria 3619
1329 Ga0496124_0077880 3300048927 Bacteria 2733
1330 Ga0496124_0088457 3300048927 Bacteria 2531
1331 Ga0496125_0001708 3300048928 Bacteria 30582
1332 Ga0496125_0002601 3300048928 Bacteria 23166
1333 Ga0496125_0004067 3300048928 Bacteria 17128
1334 Ga0496125_0006782 3300048928 Bacteria 12294
1335 Ga0496125_0015978 3300048928 Bacteria 7229
1336 Ga0496125_0024970 3300048928 Bacteria 5483
1337 Ga0496125_0033279 3300048928 Bacteria 4564
1338 Ga0496125_0040604 3300048928 Bacteria 3988
1339 Ga0496125_0057762 3300048928 Bacteria 3139
1340 Ga0496125_0166633 3300048928 Bacteria 1487
1341 Ga0496125_0260320 3300048928 Bacteria 1087
1342 Ga0496126_0002106 3300048929 Bacteria 27865
1343 Ga0496126_0047436 3300048929 Bacteria 3933
1344 Ga0496126_0077271 3300048929 Bacteria 2952
1345 Ga0496126_0125613 3300048929 Bacteria 2220
1346 Ga0496126_0149185 3300048929 Bacteria 2005
1347 Ga0495678_000108 3300049459 Bacteria 99839
1348 Ga0495678_000840 3300049459 Bacteria 27428
1349 Ga0495678_002964 3300049459 Bacteria 10830
1350 Ga0495678_003513 3300049459 Bacteria 9642
1351 Ga0495678_004960 3300049459 Bacteria 7502
1352 Ga0495678_006048 3300049459 Bacteria 6518
1353 Ga0495678_007749 3300049459 Bacteria 5531
1354 Ga0495678_014005 3300049459 Bacteria 3742
1355 Ga0495678_015411 3300049459 Bacteria 3517
1356 Ga0495678_016012 3300049459 Bacteria 3441
1357 Ga0495678_016355 3300049459 Bacteria 3394
1358 Ga0495678_021085 3300049459 Bacteria 2874
1359 Ga0495678_024087 3300049459 Bacteria 2634
1360 Ga0495678_027380 3300049459 Bacteria 2418
1361 Ga0495678_031546 3300049459 Bacteria 2208
1362 Ga0495678_040676 3300049459 Bacteria 1866
1363 Ga0495678_041608 3300049459 Bacteria 1837
1364 Ga0495678_053268 3300049459 Bacteria 1554
1365 Ga0495678_058387 3300049459 Bacteria 1458
1366 Ga0495682_0000455 3300049460 Bacteria 28192
1367 Ga0495682_0009522 3300049460 Bacteria 3790
1368 Ga0495682_0011582 3300049460 Bacteria 3392
1369 Ga0495682_0012034 3300049460 Bacteria 3324
1370 Ga0495682_0014986 3300049460 Bacteria 2937
1371 Ga0501292_000011 3300049515 Bacteria 72009
1372 Ga0501294_000347 3300049517 Bacteria 5611
1373 Ga0501300_000069 3300049523 Bacteria 15019
1374 Ga0501032_0023811 3300049569 Bacteria 4228
1375 Ga0501034_0000692 3300049571 Bacteria 51206
1376 Ga0501034_0019196 3300049571 Bacteria 6999
1377 Ga0501038_0230651 3300049574 Bacteria 1474
1378 Ga0501039_0025552 3300049575 Bacteria 4539
1379 Ga0501039_0163216 3300049575 Bacteria 1752
1380 Ga0501040_0025008 3300049576 Bacteria 4012
1381 Ga0501040_0249286 3300049576 Bacteria 1266
1382 Ga0501041_0051034 3300049577 Bacteria 2521
1383 Ga0501041_0095854 3300049577 Bacteria 1834
1384 Ga0501041_0103644 3300049577 Bacteria 1762
1385 Ga0501069_0014497 3300049585 Bacteria 4215
1386 Ga0501070_0000091 3300049586 Bacteria 77270
1387 Ga0501071_0014830 3300049587 Bacteria 5338
1388 Ga0501071_0042435 3300049587 Bacteria 3260
1389 Ga0501072_0007631 3300049588 Bacteria 8212
1390 Ga0501072_0158680 3300049588 Bacteria 1804
1391 Ga0501073_0003905 3300049589 Bacteria 11195
1392 Ga0501073_0051276 3300049589 Bacteria 2890
1393 Ga0501074_0036433 3300049590 Bacteria 3563
1394 Ga0501075_0004498 3300049591 Bacteria 9443
1395 Ga0501075_0018737 3300049591 Bacteria 5015
1396 Ga0501075_0147628 3300049591 Bacteria 1792
1397 Ga0501076_0008884 3300049592 Bacteria 7391
1398 Ga0501076_0082546 3300049592 Bacteria 2580
1399 Ga0501077_0053264 3300049593 Bacteria 2569
1400 Ga0501202_001132 3300049652 Bacteria 4165
1401 Ga0501222_001390 3300049662 Bacteria 3383
1402 Ga0501222_005762 3300049662 Bacteria 1667
1403 Ga0501223_000035 3300049663 Bacteria 48008
1404 Ga0501223_000477 3300049663 Bacteria 9652
1405 Ga0501224_000029 3300049664 Bacteria 48059
1406 Ga0501233_003337 3300049668 Bacteria 2882
1407 Ga0501235_004886 3300049669 Bacteria 2904
1408 Ga0501257_000060 3300049686 Bacteria 30706
1409 Ga0501259_000102 3300049688 Bacteria 12304
1410 Ga0501261_000002 3300049690 Bacteria 117168
1411 Ga0501225_0000026 3300049705 Bacteria 48959
1412 Ga0501225_0015943 3300049705 Bacteria 2088
1413 Ga0501245_000127 3300049708 Bacteria 7800
1414 Ga0501079_0182006 3300049741 Bacteria 1640
1415 Ga0501080_0020366 3300049742 Bacteria 6138
1416 Ga0501080_0147150 3300049742 Bacteria 2178
1417 Ga0501080_0282518 3300049742 Bacteria 1509
1418 Ga0501081_0037087 3300049743 Bacteria 3326
1419 Ga0501083_0012467 3300049744 Bacteria 5945
1420 Ga0501083_0050417 3300049744 Bacteria 2801
1421 Ga0501083_0163911 3300049744 Bacteria 1453
1422 Ga0501279_000002 3300049775 Bacteria 205937
1423 Ga0501280_000039 3300049776 Bacteria 38634
1424 Ga0501281_00158 3300049777 Bacteria 7930
1425 Ga0501283_000479 3300049779 Bacteria 5256
1426 Ga0501045_0031062 3300049824 Bacteria 3868
1427 Ga0501045_0044099 3300049824 Bacteria 3248
1428 Ga0501226_000028 3300049853 Bacteria 88553
1429 Ga0501226_000052 3300049853 Bacteria 44514
1430 nmdc:mga03683_13495_c1 3300050489 Bacteria 3008
1431 nmdc:mga00v17_139627_c1 3300050491 Bacteria 1553
1432 nmdc:mga00v17_184678_c1 3300050491 Bacteria 1346
1433 nmdc:mga00v17_40492_c1 3300050491 Bacteria 1894
1434 nmdc:mga0k408_15227_c1 3300050493 Bacteria 4250
1435 nmdc:mga0k408_5132_c1 3300050493 Bacteria 6936
1436 nmdc:mga07m45_45373_c1 3300050496 Bacteria 2468
1437 nmdc:mga05p37_237288_c1 3300050507 Bacteria 2194
1438 nmdc:mga05p37_24331_c1 3300050507 Bacteria 4863
1439 nmdc:mga05p37_396262_c1 3300050507 Bacteria 1613
1440 nmdc:mga05p37_5093_c1 3300050507 Bacteria 15413
1441 nmdc:mga05p37_9838_c1 3300050507 Bacteria 11350
1442 nmdc:mga09592_1064_c1 3300050508 Bacteria 21795
1443 nmdc:mga09592_50901_c1 3300050508 Bacteria 3493
1444 nmdc:mga0qj67_601_c1 3300050509 Bacteria 24570
1445 nmdc:mga06r32_3624_c1 3300050510 Bacteria 13783
1446 nmdc:mga08y16_51094_c1 3300050511 Bacteria 4325
1447 nmdc:mga0n895_254514_c1 3300050512 Bacteria 1782
1448 nmdc:mga0n895_35166_c1 3300050512 Bacteria 4828
1449 nmdc:mga0rr50_39121_c1 3300050513 Bacteria 2673
1450 nmdc:mga0a205_2369_c1 3300050515 Bacteria 16612
1451 Ga0495619_0026580 3300053085 Bacteria 3724
1452 Ga0500572_002588 3300053111 Bacteria 4300
1453 Ga0500592_000011 3300053116 Bacteria 73738
1454 Ga0500608_000587 3300053122 Bacteria 13374
1455 Ga0500618_000316 3300053125 Bacteria 35628
1456 Ga0500659_0006736 3300053135 Bacteria 6374
1457 Ga0500568_0051705 3300053139 Bacteria 1616
1458 Ga0500573_0006921 3300053140 Bacteria 6158
1459 Ga0500616_0001324 3300053153 Bacteria 24390
1460 Ga0500622_0103814 3300053156 Bacteria 1396
1461 Ga0500627_0000050 3300053158 Bacteria 56420
1462 Ga0500634_0037027 3300053161 Bacteria 2655
1463 Ga0500599_012595 3300053736 Bacteria 1137
1464 Ga0501084_0010475 3300054114 Bacteria 7663
1465 Ga0590071_000163 3300059421 Bacteria 19124
1466 Ga0590074_001576 3300059423 Bacteria 3703
1467 Ga0590075_000814 3300059424 Bacteria 8188
1468 Ga0590075_002455 3300059424 Bacteria 4436
1469 Ga0590075_022142 3300059424 Bacteria 1589
1470 Ga0590077_000265 3300059426 Bacteria 14856
1471 Ga0590077_000589 3300059426 Bacteria 9989
1472 Ga0590077_006114 3300059426 Bacteria 2470
1473 Ga0501082_0011509 3300060353 Bacteria 7616
1474 Ga0501082_0020038 3300060353 Bacteria 5763
1475 Ga0501082_0042202 3300060353 Bacteria 3933
1476 Ga0501082_0073461 3300060353 Bacteria 2946
1477 Ga0530510_0363122 3300061734 Bacteria 1089

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045836 Ga0466958_0228103 Ga0466958_0228103_29_832 265
2 3300036647 Ga0316582_0105580 Ga0316582_0105580_58_933 289
3 3300006880 Ga0075429_100128534 Ga0075429_1001285343 296
4 3300027907 Ga0207428_10017008 Ga0207428_100170082 296
5 3300038443 Ga0395901_0359629 Ga0395901_0359629_445_1404 310
6 3300045051 Ga0451576_0260476 Ga0451576_0260476_388_1413 310
7 3300009147 Ga0114129_10577780 Ga0114129_105777802 311
8 3300050507 nmdc:mga05p37_237288_c1 nmdc:mga05p37_237288_c1_220_1230 311
9 3300005355 Ga0070671_100007902 Ga0070671_1000079023 312
10 3300005367 Ga0070667_100014111 Ga0070667_1000141116 312
11 3300005548 Ga0070665_100098295 Ga0070665_1000982953 312
12 3300005841 Ga0068863_100007182 Ga0068863_1000071828 312
13 3300014968 Ga0157379_10000104 Ga0157379_1000010436 312
14 3300025931 Ga0207644_10005170 Ga0207644_100051703 312
15 3300025986 Ga0207658_10225297 Ga0207658_102252972 312
16 3300026088 Ga0207641_10021949 Ga0207641_100219494 312
17 3300044712 Ga0453684_0000113 Ga0453684_0000113_40610_41635 313
18 3300049744 Ga0501083_0050417 Ga0501083_0050417_21_983 313
19 3300042876 Ga0451577_0000067 Ga0451577_0000067_144725_145771 314
20 3300044673 Ga0453683_0003872 Ga0453683_0003872_3417_4463 314
21 3300044712 Ga0453684_0000215 Ga0453684_0000215_105211_106257 314
22 3300045051 Ga0451576_0001823 Ga0451576_0001823_25745_26791 314
23 3300042530 Ga0450916_003223 Ga0450916_003223_471_1466 316
24 3300049853 Ga0501226_000028 Ga0501226_000028_76907_77902 316
25 3300003320 rootH2_10152216 rootH2_101522163 317
26 3300003323 rootH1_10165822 rootH1_101658223 317
27 3300048909 Ga0496106_0000067 Ga0496106_0000067_52413_53420 317
28 3300048919 Ga0496116_0050155 Ga0496116_0050155_706_1710 317
29 3300048920 Ga0496117_0072491 Ga0496117_0072491_669_1673 317
30 3300048921 Ga0496118_0044214 Ga0496118_0044214_1299_2303 317
31 3300048924 Ga0496121_0004616 Ga0496121_0004616_7515_8522 317
32 3300041405 Ga0439438_039559 Ga0439438_039559_17_1036 318
33 3300044712 Ga0453684_0014848 Ga0453684_0014848_363_1358 318
34 3300042013 Ga0439456_028937 Ga0439456_028937_153_1145 319
35 3300046492 Ga0495585_0017321 Ga0495585_0017321_2064_3053 319
36 3300047443 Ga0495687_000169 Ga0495687_000169_37009_38034 319
37 3300003316 rootH1_10014100 rootH1_100141004 320
38 3300046460 Ga0495638_0009767 Ga0495638_0009767_5554_6546 320
39 3300046530 Ga0495654_0024300 Ga0495654_0024300_1138_2130 320
40 3300005617 Ga0068859_100000075 Ga0068859_10000007527 321
41 3300005842 Ga0068858_100102602 Ga0068858_1001026022 321
42 3300006931 Ga0097620_100000075 Ga0097620_10000007527 321
43 3300009177 Ga0105248_10007246 Ga0105248_100072465 321
44 3300014325 Ga0163163_10031095 Ga0163163_100310954 321
45 3300025941 Ga0207711_10013500 Ga0207711_100135004 321
46 3300026035 Ga0207703_10002028 Ga0207703_1000202812 321
47 3300042006 Ga0439432_064698 Ga0439432_064698_100_1065 321
48 3300042013 Ga0439456_001877 Ga0439456_001877_1333_2322 322
49 3300037471 Ga0395905_0000013 Ga0395905_0000013_261322_262302 323
50 3300041405 Ga0439438_002280 Ga0439438_002280_6601_7590 323
51 3300041411 Ga0439466_0000524 Ga0439466_0000524_6793_7782 323
52 3300041413 Ga0439465_0016595 Ga0439465_0016595_435_1424 323
53 3300042006 Ga0439432_002611 Ga0439432_002611_4219_5208 323
54 3300042016 Ga0439463_042289 Ga0439463_042289_26_1015 323
55 3300042115 Ga0450911_001185 Ga0450911_001185_4834_5823 323
56 3300042124 Ga0450922_001234 Ga0450922_001234_813_1802 323
57 3300042127 Ga0450890_000208 Ga0450890_000208_6795_7784 323
58 3300042146 Ga0450907_001002 Ga0450907_001002_4092_5081 323
59 3300042147 Ga0450910_001623 Ga0450910_001623_679_1668 323
60 3300042435 Ga0439434_0014027 Ga0439434_0014027_850_1839 323
61 3300042438 Ga0439459_0000454 Ga0439459_0000454_3651_4646 323
62 3300042461 Ga0439460_0017274 Ga0439460_0017274_799_1788 323
63 3300042531 Ga0450918_003211 Ga0450918_003211_1397_2386 323
64 3300049686 Ga0501257_000060 Ga0501257_000060_17604_18599 323
65 3300053153 Ga0500616_0001324 Ga0500616_0001324_8033_9034 323
66 3300053736 Ga0500599_012595 Ga0500599_012595_91_1092 323
67 iso_pu_bacteria 2599185307 2599972877 323
68 iso_pu_bacteria 2600255283 2601625520 323
69 iso_pu_bacteria 2811994881 2812371084 323
70 iso_pu_bacteria 2923519811 2923525191 323
71 3300046463 Ga0495653_0137672 Ga0495653_0137672_105_1175 324
72 3300046679 Ga0495623_0021429 Ga0495623_0021429_639_1709 324
73 3300046689 Ga0495613_0124318 Ga0495613_0124318_649_1719 324
74 3300047317 Ga0495604_0001553 Ga0495604_0001553_13787_14857 324
75 3300047322 Ga0495680_0003997 Ga0495680_0003997_9127_10197 324
76 iso_pu_bacteria 2515154088 2515497002 324
77 iso_pu_bacteria 2515154129 2515720115 324
78 iso_pu_bacteria 2515154137 2515758805 324
79 iso_pu_bacteria 2515154202 2516084894 324
80 iso_pu_bacteria 2515154203 2516088304 324
81 iso_pu_bacteria 2738541271 2738689167 324
82 iso_pu_bacteria 2738543016 2739264554 324
83 iso_pu_bacteria 2854681122 2854683139 324
84 iso_pu_bacteria 2881101125 2881103792 324
85 iso_pu_bacteria 2910245624 2910249661 324
86 3300001990 JGI24737J22298_10005913 JGI24737J22298_100059132 325
87 3300005366 Ga0070659_100101107 Ga0070659_1001011072 325
88 3300005455 Ga0070663_100025939 Ga0070663_1000259391 325
89 3300005467 Ga0070706_100129499 Ga0070706_1001294991 325
90 3300005563 Ga0068855_100000854 Ga0068855_10000085433 325
91 3300005614 Ga0068856_100469407 Ga0068856_1004694071 325
92 3300009094 Ga0111539_10012498 Ga0111539_100124989 325
93 3300009147 Ga0114129_10273643 Ga0114129_102736433 325
94 3300013102 Ga0157371_10074350 Ga0157371_100743502 325
95 3300013296 Ga0157374_10095271 Ga0157374_100952712 325
96 3300025910 Ga0207684_10245410 Ga0207684_102454101 325
97 3300025919 Ga0207657_10023036 Ga0207657_100230365 325
98 3300025922 Ga0207646_10069491 Ga0207646_100694912 325
99 3300025949 Ga0207667_10026197 Ga0207667_100261978 325
100 3300037471 Ga0395905_0000189 Ga0395905_0000189_35547_36542 325
101 3300047318 Ga0495636_0020991 Ga0495636_0020991_14_994 325
102 3300048918 Ga0496115_0137956 Ga0496115_0137956_325_1305 325
103 3300050511 nmdc:mga08y16_51094_c1 nmdc:mga08y16_51094_c1_555_1553 325
104 3300050512 nmdc:mga0n895_35166_c1 nmdc:mga0n895_35166_c1_1320_2318 325
105 3300050515 nmdc:mga0a205_2369_c1 nmdc:mga0a205_2369_c1_4598_5596 325
106 iso_pu_bacteria 2511231004 2511254684 325
107 iso_pu_bacteria 2511231006 2511266561 325
108 iso_pu_bacteria 2511231007 2511271497 325
109 iso_pu_bacteria 2511231008 2511278713 325
110 iso_pu_bacteria 2511231010 2511291739 325
111 iso_pu_bacteria 2511231011 2511298130 325
112 iso_pu_bacteria 2511231016 2511327517 325
113 iso_pu_bacteria 2511231018 2511338532 325
114 iso_pu_bacteria 2511231019 2511345601 325
115 iso_pu_bacteria 2511231022 2511365285 325
116 iso_pu_bacteria 2511231023 2511367680 325
117 iso_pu_bacteria 2511231024 2511377926 325
118 iso_pu_bacteria 2511231031 2511415171 325
119 iso_pu_bacteria 2511231156 2511826420 325
120 iso_pu_bacteria 2554235132 2554816833 325
121 iso_pu_bacteria 2554235231 2555249031 325
122 iso_pu_bacteria 2596583598 2597032094 325
123 iso_pu_bacteria 2597489887 2597859553 325
124 iso_pu_bacteria 2597489888 2597864501 325
125 iso_pu_bacteria 2597489889 2597870310 325
126 iso_pu_bacteria 2599185160 2599354374 325
127 iso_pu_bacteria 2599185161 2599359912 325
128 iso_pu_bacteria 2599185162 2599366234 325
129 iso_pu_bacteria 2599185163 2599373024 325
130 iso_pu_bacteria 2599185164 2599379482 325
131 iso_pu_bacteria 2599185165 2599385540 325
132 iso_pu_bacteria 2599185166 2599391883 325
133 iso_pu_bacteria 2599185167 2599397628 325
134 iso_pu_bacteria 2599185168 2599403649 325
135 iso_pu_bacteria 2599185178 2599448391 325
136 iso_pu_bacteria 2599185179 2599452074 325
137 iso_pu_bacteria 2599185181 2599461208 325
138 iso_pu_bacteria 2599185182 2599469750 325
139 iso_pu_bacteria 2599185185 2599482383 325
140 iso_pu_bacteria 2599185186 2599490228 325
141 iso_pu_bacteria 2599185188 2599503375 325
142 iso_pu_bacteria 2599185189 2599506714 325
143 iso_pu_bacteria 2599185190 2599513543 325
144 iso_pu_bacteria 2599185191 2599517954 325
145 iso_pu_bacteria 2599185212 2599614975 325
146 iso_pu_bacteria 2599185248 2599771146 325
147 iso_pu_bacteria 2599185257 2599803897 325
148 iso_pu_bacteria 2599185288 2599880819 325
149 iso_pu_bacteria 2599185289 2599886294 325
150 iso_pu_bacteria 2599185290 2599892220 325
151 iso_pu_bacteria 2599185291 2599898008 325
152 iso_pu_bacteria 2599185300 2599934743 325
153 iso_pu_bacteria 2599185302 2599943901 325
154 iso_pu_bacteria 2599185303 2599949802 325
155 iso_pu_bacteria 2599185304 2599955885 325
156 iso_pu_bacteria 2599185305 2599960321 325
157 iso_pu_bacteria 2599185306 2599967881 325
158 iso_pu_bacteria 2599185308 2599979087 325
159 iso_pu_bacteria 2599185309 2599986574 325
160 iso_pu_bacteria 2599185310 2599989611 325
161 iso_pu_bacteria 2599185311 2599997642 325
162 iso_pu_bacteria 2599185312 2600000042 325
163 iso_pu_bacteria 2599185313 2600005026 325
164 iso_pu_bacteria 2599185314 2600013046 325
165 iso_pu_bacteria 2599185315 2600017822 325
166 iso_pu_bacteria 2599185316 2600024743 325
167 iso_pu_bacteria 2599185317 2600030543 325
168 iso_pu_bacteria 2599185318 2600038162 325
169 iso_pu_bacteria 2599185319 2600044476 325
170 iso_pu_bacteria 2599185320 2600048298 325
171 iso_pu_bacteria 2599185321 2600055384 325
172 iso_pu_bacteria 2599185322 2600061504 325
173 iso_pu_bacteria 2599185323 2600066178 325
174 iso_pu_bacteria 2599185324 2600070095 325
175 iso_pu_bacteria 2599185325 2600077986 325
176 iso_pu_bacteria 2599185356 2600213823 325
177 iso_pu_bacteria 2600254930 2600359986 325
178 iso_pu_bacteria 2600254931 2600364457 325
179 iso_pu_bacteria 2600255296 2601690194 325
180 iso_pu_bacteria 2600255313 2601773991 325
181 iso_pu_bacteria 2600255318 2601796488 325
182 iso_pu_bacteria 2603880185 2606073638 325
183 iso_pu_bacteria 2603880199 2606126718 325
184 iso_pu_bacteria 2606217733 2608379872 325
185 iso_pu_bacteria 2619619299 2621298986 325
186 iso_pu_bacteria 2623620443 2624482133 325
187 iso_pu_bacteria 2623620446 2624490765 325
188 iso_pu_bacteria 2643221571 2643871209 325
189 iso_pu_bacteria 2643221650 2644281894 325
190 iso_pu_bacteria 2643221713 2644620497 325
191 iso_pu_bacteria 2651869719 2652544064 325
192 iso_pu_bacteria 2667528170 2671090102 325
193 iso_pu_bacteria 2667528171 2671096955 325
194 iso_pu_bacteria 2667528176 2671125261 325
195 iso_pu_bacteria 2671180172 2671770534 325
196 iso_pu_bacteria 2675903420 2677899464 325
197 iso_pu_bacteria 2675903515 2678264768 325
198 iso_pu_bacteria 2713897148 2715750161 325
199 iso_pu_bacteria 2713897149 2715759904 325
200 iso_pu_bacteria 2718217725 2718635371 325
201 iso_pu_bacteria 2721755607 2723249287 325
202 iso_pu_bacteria 2738541265 2738672231 325
203 iso_pu_bacteria 2738541282 2738750624 325
204 iso_pu_bacteria 2738541294 2738806127 325
205 iso_pu_bacteria 2738541303 2738859665 325
206 iso_pu_bacteria 2738541309 2738893487 325
207 iso_pu_bacteria 2738543025 2739315170 325
208 iso_pu_bacteria 2740892503 2743739084 325
209 iso_pu_bacteria 2744054620 2745005222 325
210 iso_pu_bacteria 2765235841 2765585536 325
211 iso_pu_bacteria 2773857673 2774133072 325
212 iso_pu_bacteria 2784132063 2784263099 325
213 iso_pu_bacteria 2791355137 2792833089 325
214 iso_pu_bacteria 2791355520 2794594969 325
215 iso_pu_bacteria 2806310737 2807407076 325
216 iso_pu_bacteria 2806310745 2807455407 325
217 iso_pu_bacteria 2808606361 2808857801 325
218 iso_pu_bacteria 2808606376 2808926249 325
219 iso_pu_bacteria 2808606377 2808931875 325
220 iso_pu_bacteria 2808606378 2808937918 325
221 iso_pu_bacteria 2808606380 2808948378 325
222 iso_pu_bacteria 2808606381 2808953995 325
223 iso_pu_bacteria 2808606383 2808966232 325
224 iso_pu_bacteria 2808606385 2808978932 325
225 iso_pu_bacteria 2808606388 2808994753 325
226 iso_pu_bacteria 2808606389 2809001124 325
227 iso_pu_bacteria 2808606445 2809219058 325
228 iso_pu_bacteria 2816332298 2817491850 325
229 iso_pu_bacteria 2818991456 2819655873 325
230 iso_pu_bacteria 2818991464 2819702048 325
231 iso_pu_bacteria 2825651385 2825656351 325
232 iso_pu_bacteria 2826581358 2826585981 325
233 iso_pu_bacteria 2834028612 2834032643 325
234 iso_pu_bacteria 2842815866 2842819012 325
235 iso_pu_bacteria 2842826826 2842830446 325
236 iso_pu_bacteria 2842832357 2842836740 325
237 iso_pu_bacteria 2842837860 2842842004 325
238 iso_pu_bacteria 2842843487 2842844848 325
239 iso_pu_bacteria 2842849001 2842854433 325
240 iso_pu_bacteria 2842854478 2842856738 325
241 iso_pu_bacteria 2844665904 2844671992 325
242 iso_pu_bacteria 2852612431 2852613846 325
243 iso_pu_bacteria 2852657418 2852661306 325
244 iso_pu_bacteria 2852667396 2852668418 325
245 iso_pu_bacteria 2860339153 2860341040 325
246 iso_pu_bacteria 2860867994 2860871002 325
247 iso_pu_bacteria 2878029506 2878034114 325
248 iso_pu_bacteria 2880230671 2880234739 325
249 iso_pu_bacteria 2885266251 2885269349 325
250 iso_pu_bacteria 2900577576 2900578505 325
251 iso_pu_bacteria 2904518522 2904521126 325
252 iso_pu_bacteria 2904615490 2904618790 325
253 iso_pu_bacteria 2908446538 2908449134 325
254 iso_pu_bacteria 2912963787 2912967776 325
255 iso_pu_bacteria 2913036834 2913041369 325
256 iso_pu_bacteria 2917070673 2917075337 325
257 iso_pu_bacteria 2919063839 2919066823 325
258 iso_pu_bacteria 2919155634 2919158751 325
259 iso_pu_bacteria 2919385768 2919388212 325
260 iso_pu_bacteria 2919456309 2919460864 325
261 iso_pu_bacteria 2919481497 2919484292 325
262 iso_pu_bacteria 2919487758 2919489602 325
263 iso_pu_bacteria 2919697872 2919703193 325
264 iso_pu_bacteria 2923153595 2923158165 325
265 iso_pu_bacteria 2923586266 2923590229 325
266 iso_pu_bacteria 2928058823 2928060462 325
267 iso_pu_bacteria 2929144301 2929148695 325
268 iso_pu_bacteria 2929189879 2929193069 325
269 iso_pu_bacteria 2931369376 2931373874 325
270 iso_pu_bacteria 2931390751 2931393421 325
271 iso_pu_bacteria 2931396565 2931396778 325
272 iso_pu_bacteria 2935353572 2935356324 325
273 iso_pu_bacteria 2939651529 2939655771 325
274 iso_pu_bacteria 2945928738 2945932923 325
275 iso_pu_bacteria 2945961074 2945965353 325
276 iso_pu_bacteria 2946006987 2946009197 325
277 iso_pu_bacteria 2946027586 2946031345 325
278 iso_pu_bacteria 2947233263 2947238318 325
279 iso_pu_bacteria 2969304461 2969308895 325
280 iso_pu_bacteria 2974289157 2974289722 325
281 iso_pu_bacteria 2984286254 2984288012 325
282 iso_pu_bacteria 2988728565 2988730277 325
283 iso_pu_bacteria 2998139840 2998144198 325
284 iso_pu_bacteria 3007395558 3007397466 325
285 iso_pu_bacteria 3007419365 3007424632 325
286 iso_pu_bacteria 3007614139 3007617490 325
287 iso_pu_bacteria 3007718800 3007724154 325
288 iso_pu_bacteria 3007803356 3007805125 325
289 iso_pu_bacteria 3007855910 3007858823 325
290 iso_pu_bacteria 3007861166 3007865630 325
291 iso_pu_bacteria 3007866637 3007870620 325
292 iso_pu_bacteria 3007872151 3007876781 325
293 iso_pu_bacteria 637000220 637321789 325
294 iso_pu_bacteria 651053060 651174137 325
295 iso_pu_bacteria 8011350971 8011356767 325
296 iso_pu_bacteria 8015687852 8015692261 325
297 iso_pu_bacteria 8019769354 8019772953 325
298 iso_pu_bacteria 8019775933 8019779507 325
299 iso_pu_bacteria 8029995093 8029996687 325
300 iso_pu_bacteria 8039098773 8039099267 325
301 iso_pu_bacteria 8052494512 8052495829 325
302 iso_pu_bacteria 8054285046 8054291230 325
303 iso_pu_bacteria 8054347763 8054347830 325
304 iso_pu_bacteria 8054503363 8054506844 325
305 iso_pu_bacteria 8054929484 8054929904 325
306 iso_pu_bacteria 8055817908 8055821636 325
307 iso_pu_bacteria 8055878733 8055881290 325
308 iso_pu_bacteria 8056115690 8056117587 325
309 iso_pu_bacteria 8056120720 8056124665 325
310 iso_pu_bacteria 8056137416 8056138739 325
311 iso_pu_bacteria 8056143049 8056144695 325
312 iso_pu_bacteria 8056148874 8056154282 325
313 iso_pu_bacteria 8056155041 8056156791 325
314 iso_pu_bacteria 8056161164 8056165482 325
315 iso_pu_bacteria 8056166840 8056167089 325
316 iso_pu_bacteria 8056172158 8056173058 325
317 iso_pu_bacteria 8056569372 8056573920 325
318 iso_pu_bacteria 8057798959 8057804287 325
319 3300003322 rootL2_10329293 rootL2_103292932 326
320 3300005295 Ga0065707_10087248 Ga0065707_100872483 326
321 3300005844 Ga0068862_100101611 Ga0068862_1001016112 326
322 3300006195 Ga0075366_10032757 Ga0075366_100327575 326
323 3300006844 Ga0075428_100002850 Ga0075428_10000285016 326
324 3300006846 Ga0075430_100000819 Ga0075430_10000081913 326
325 3300006847 Ga0075431_100073385 Ga0075431_1000733852 326
326 3300009553 Ga0105249_10130012 Ga0105249_101300122 326
327 3300025933 Ga0207706_10283240 Ga0207706_102832402 326
328 3300026116 Ga0207674_10296281 Ga0207674_102962812 326
329 3300030745 Ga0316182_1369220 Ga0316182_13692201 326
330 3300031727 Ga0316576_10271767 Ga0316576_102717671 326
331 3300032002 Ga0307416_100246747 Ga0307416_1002467472 326
332 3300032005 Ga0307411_10316373 Ga0307411_103163731 326
333 3300032133 Ga0316583_10071149 Ga0316583_100711491 326
334 3300036712 Ga0316584_0192025 Ga0316584_0192025_475_1467 326
335 3300037312 Ga0395899_0208222 Ga0395899_0208222_74_1060 326
336 3300037418 Ga0395900_0069418 Ga0395900_0069418_454_1440 326
337 3300046524 Ga0495648_0018685 Ga0495648_0018685_3464_4453 326
338 3300047470 Ga0495681_0000096 Ga0495681_0000096_72709_73707 326
339 3300049459 Ga0495678_007749 Ga0495678_007749_2326_3324 326
340 3300049575 Ga0501039_0025552 Ga0501039_0025552_130_1119 326
341 3300049575 Ga0501039_0163216 Ga0501039_0163216_722_1711 326
342 3300049576 Ga0501040_0025008 Ga0501040_0025008_100_1089 326
343 3300049577 Ga0501041_0051034 Ga0501041_0051034_553_1542 326
344 3300049577 Ga0501041_0103644 Ga0501041_0103644_658_1647 326
345 3300049588 Ga0501072_0007631 Ga0501072_0007631_7155_8144 326
346 3300049591 Ga0501075_0018737 Ga0501075_0018737_351_1340 326
347 3300049592 Ga0501076_0082546 Ga0501076_0082546_1362_2351 326
348 3300049593 Ga0501077_0053264 Ga0501077_0053264_1128_2117 326
349 3300049743 Ga0501081_0037087 Ga0501081_0037087_1413_2402 326
350 3300049824 Ga0501045_0031062 Ga0501045_0031062_1763_2752 326
351 3300050508 nmdc:mga09592_50901_c1 nmdc:mga09592_50901_c1_529_1518 326
352 3300050509 nmdc:mga0qj67_601_c1 nmdc:mga0qj67_601_c1_14938_15927 326
353 3300050510 nmdc:mga06r32_3624_c1 nmdc:mga06r32_3624_c1_4107_5096 326
354 3300053156 Ga0500622_0103814 Ga0500622_0103814_139_1128 326
355 3300059421 Ga0590071_000163 Ga0590071_000163_5059_6048 326
356 3300059423 Ga0590074_001576 Ga0590074_001576_554_1543 326
357 3300059424 Ga0590075_000814 Ga0590075_000814_6202_7191 326
358 3300059424 Ga0590075_002455 Ga0590075_002455_1825_2814 326
359 3300059424 Ga0590075_022142 Ga0590075_022142_273_1262 326
360 3300059426 Ga0590077_000265 Ga0590077_000265_10373_11362 326
361 3300059426 Ga0590077_000589 Ga0590077_000589_4816_5805 326
362 3300059426 Ga0590077_006114 Ga0590077_006114_123_1310 326
363 3300060353 Ga0501082_0042202 Ga0501082_0042202_1804_2793 326
364 iso_pu_bacteria 2511231012 2511301656 326
365 iso_pu_bacteria 2511231014 2511314954 326
366 iso_pu_bacteria 2511231015 2511322937 326
367 iso_pu_bacteria 2511231017 2511330577 326
368 iso_pu_bacteria 2511231020 2511351335 326
369 iso_pu_bacteria 2511231021 2511353802 326
370 iso_pu_bacteria 2600254954 2600445450 326
371 iso_pu_bacteria 2600255389 2602009860 326
372 iso_pu_bacteria 2643221565 2643841929 326
373 iso_pu_bacteria 2643221589 2643957120 326
374 iso_pu_bacteria 2643221602 2644022096 326
375 iso_pu_bacteria 2643221633 2644188073 326
376 iso_pu_bacteria 2738543004 2739196950 326
377 iso_pu_bacteria 2738543015 2739261632 326
378 iso_pu_bacteria 2773857670 2774122603 326
379 iso_pu_bacteria 2784132072 2784316670 326
380 iso_pu_bacteria 2786546517 2787436900 326
381 iso_pu_bacteria 2808606373 2808907116 326
382 iso_pu_bacteria 2818991438 2819550876 326
383 iso_pu_bacteria 2904550169 2904554843 326
384 iso_pu_bacteria 2919501602 2919504027 326
385 iso_pu_bacteria 2926063275 2926065400 326
386 iso_pu_bacteria 2939636861 2939637414 326
387 iso_pu_bacteria 3007511990 3007515953 326
388 iso_pu_bacteria 3007619802 3007625481 326
389 iso_pu_bacteria 8034962539 8034965676 326
390 iso_pu_bacteria 8056125926 8056130483 326
391 iso_pu_bacteria 8056177738 8056180072 326
392 3300005290 Ga0065712_10171865 Ga0065712_101718651 327
393 3300005347 Ga0070668_100389909 Ga0070668_1003899091 327
394 3300005367 Ga0070667_100428467 Ga0070667_1004284672 327
395 3300005445 Ga0070708_100013258 Ga0070708_1000132583 327
396 3300005467 Ga0070706_100300993 Ga0070706_1003009931 327
397 3300005468 Ga0070707_100013239 Ga0070707_1000132395 327
398 3300005518 Ga0070699_100378174 Ga0070699_1003781741 327
399 3300005548 Ga0070665_100062105 Ga0070665_1000621051 327
400 3300005614 Ga0068856_100014486 Ga0068856_1000144863 327
401 3300005617 Ga0068859_100255294 Ga0068859_1002552943 327
402 3300005719 Ga0068861_100004019 Ga0068861_1000040197 327
403 3300005719 Ga0068861_100061495 Ga0068861_1000614954 327
404 3300006042 Ga0075368_10005176 Ga0075368_100051765 327
405 3300006353 Ga0075370_10031952 Ga0075370_100319523 327
406 3300006844 Ga0075428_100495260 Ga0075428_1004952602 327
407 3300006852 Ga0075433_10003532 Ga0075433_100035328 327
408 3300006871 Ga0075434_100002217 Ga0075434_1000022174 327
409 3300006931 Ga0097620_100255271 Ga0097620_1002552713 327
410 3300009551 Ga0105238_10191741 Ga0105238_101917413 327
411 3300015265 Ga0182005_1008708 Ga0182005_10087081 327
412 3300025735 Ga0207713_1000074 Ga0207713_100007463 327
413 3300025910 Ga0207684_10092749 Ga0207684_100927493 327
414 3300025924 Ga0207694_10127649 Ga0207694_101276492 327
415 3300025942 Ga0207689_10162701 Ga0207689_101627011 327
416 3300025986 Ga0207658_10233507 Ga0207658_102335072 327
417 3300026078 Ga0207702_10058448 Ga0207702_100584483 327
418 3300026118 Ga0207675_100002359 Ga0207675_1000023598 327
419 3300026118 Ga0207675_100088645 Ga0207675_1000886451 327
420 3300027907 Ga0207428_10123984 Ga0207428_101239842 327
421 3300028379 Ga0268266_10040702 Ga0268266_100407025 327
422 3300037471 Ga0395905_0061804 Ga0395905_0061804_1630_2634 327
423 3300039447 Ga0436361_0061781 Ga0436361_0061781_801_1805 327
424 3300041404 Ga0439436_0000467 Ga0439436_0000467_4325_5335 327
425 3300041405 Ga0439438_000199 Ga0439438_000199_11070_12080 327
426 3300041407 Ga0439447_005735 Ga0439447_005735_2395_3405 327
427 3300041411 Ga0439466_0003528 Ga0439466_0003528_1126_2136 327
428 3300042006 Ga0439432_000453 Ga0439432_000453_12830_13840 327
429 3300042010 Ga0439452_001617 Ga0439452_001617_4375_5385 327
430 3300042016 Ga0439463_005916 Ga0439463_005916_1993_2976 327
431 3300042016 Ga0439463_006484 Ga0439463_006484_209_1192 327
432 3300042435 Ga0439434_0005186 Ga0439434_0005186_693_1703 327
433 3300042531 Ga0450918_010522 Ga0450918_010522_22_1014 327
434 3300044712 Ga0453684_0093289 Ga0453684_0093289_2614_3600 327
435 3300045051 Ga0451576_0000245 Ga0451576_0000245_103880_104866 327
436 3300046458 Ga0495591_000606 Ga0495591_000606_16429_17412 327
437 3300046458 Ga0495591_001733 Ga0495591_001733_2452_3435 327
438 3300046458 Ga0495591_004519 Ga0495591_004519_1106_2089 327
439 3300046458 Ga0495591_012722 Ga0495591_012722_385_1368 327
440 3300046460 Ga0495638_0013005 Ga0495638_0013005_2942_3952 327
441 3300046460 Ga0495638_0035693 Ga0495638_0035693_524_1507 327
442 3300046471 Ga0495650_0001905 Ga0495650_0001905_12005_12988 327
443 3300046471 Ga0495650_0009537 Ga0495650_0009537_1553_2536 327
444 3300046474 Ga0495605_0000149 Ga0495605_0000149_14185_15168 327
445 3300046474 Ga0495605_0000155 Ga0495605_0000155_34359_35342 327
446 3300046474 Ga0495605_0012717 Ga0495605_0012717_1376_2359 327
447 3300046474 Ga0495605_0030530 Ga0495605_0030530_1558_2541 327
448 3300046491 Ga0495584_0018462 Ga0495584_0018462_1841_2824 327
449 3300046492 Ga0495585_0054711 Ga0495585_0054711_803_1786 327
450 3300046500 Ga0495596_0016124 Ga0495596_0016124_1157_2140 327
451 3300046501 Ga0495607_0000444 Ga0495607_0000444_18189_19172 327
452 3300046501 Ga0495607_0003552 Ga0495607_0003552_3395_4378 327
453 3300046501 Ga0495607_0014044 Ga0495607_0014044_2244_3227 327
454 3300046501 Ga0495607_0037807 Ga0495607_0037807_719_1702 327
455 3300046501 Ga0495607_0123140 Ga0495607_0123140_254_1237 327
456 3300046506 Ga0495583_0001312 Ga0495583_0001312_1976_2959 327
457 3300046506 Ga0495583_0001496 Ga0495583_0001496_5463_6446 327
458 3300046506 Ga0495583_0003690 Ga0495583_0003690_3184_4167 327
459 3300046506 Ga0495583_0016076 Ga0495583_0016076_1944_2927 327
460 3300046506 Ga0495583_0021576 Ga0495583_0021576_2250_3233 327
461 3300046507 Ga0495606_0000812 Ga0495606_0000812_12881_13864 327
462 3300046507 Ga0495606_0012469 Ga0495606_0012469_2444_3427 327
463 3300046513 Ga0495616_0070726 Ga0495616_0070726_411_1394 327
464 3300046513 Ga0495616_0134480 Ga0495616_0134480_68_1051 327
465 3300046515 Ga0495620_0000426 Ga0495620_0000426_1786_2769 327
466 3300046515 Ga0495620_0016779 Ga0495620_0016779_590_1573 327
467 3300046518 Ga0495631_0014028 Ga0495631_0014028_1872_2855 327
468 3300046518 Ga0495631_0094122 Ga0495631_0094122_178_1161 327
469 3300046519 Ga0495632_0001013 Ga0495632_0001013_2214_3197 327
470 3300046519 Ga0495632_0001944 Ga0495632_0001944_14344_15327 327
471 3300046519 Ga0495632_0016468 Ga0495632_0016468_2672_3655 327
472 3300046520 Ga0495637_0000204 Ga0495637_0000204_32466_33449 327
473 3300046520 Ga0495637_0000844 Ga0495637_0000844_5566_6549 327
474 3300046520 Ga0495637_0024226 Ga0495637_0024226_82_1065 327
475 3300046522 Ga0495643_0005885 Ga0495643_0005885_6382_7365 327
476 3300046523 Ga0495644_0021435 Ga0495644_0021435_779_1762 327
477 3300046524 Ga0495648_0019694 Ga0495648_0019694_1139_2122 327
478 3300046524 Ga0495648_0028466 Ga0495648_0028466_990_1973 327
479 3300046530 Ga0495654_0006257 Ga0495654_0006257_3585_4568 327
480 3300046538 Ga0495609_0000087 Ga0495609_0000087_108810_109793 327
481 3300046538 Ga0495609_0000141 Ga0495609_0000141_57955_58938 327
482 3300046616 Ga0495668_0042934 Ga0495668_0042934_1124_2107 327
483 3300046616 Ga0495668_0044303 Ga0495668_0044303_1178_2161 327
484 3300046648 Ga0495611_0000518 Ga0495611_0000518_511_1494 327
485 3300046648 Ga0495611_0053707 Ga0495611_0053707_731_1714 327
486 3300046660 Ga0495625_0000145 Ga0495625_0000145_33694_34677 327
487 3300046665 Ga0495661_0000193 Ga0495661_0000193_3363_4346 327
488 3300046665 Ga0495661_0000332 Ga0495661_0000332_36817_37800 327
489 3300046665 Ga0495661_0018326 Ga0495661_0018326_1908_2891 327
490 3300046665 Ga0495661_0057437 Ga0495661_0057437_1258_2241 327
491 3300046692 Ga0495671_0012860 Ga0495671_0012860_379_1362 327
492 3300046692 Ga0495671_0148663 Ga0495671_0148663_80_1063 327
493 3300046692 Ga0495671_0148669 Ga0495671_0148669_80_1063 327
494 3300046794 Ga0495589_0026703 Ga0495589_0026703_1238_2224 327
495 3300046810 Ga0495660_0077244 Ga0495660_0077244_151_1134 327
496 3300046810 Ga0495660_0094427 Ga0495660_0094427_474_1457 327
497 3300047320 Ga0495672_0019211 Ga0495672_0019211_1833_2816 327
498 3300047321 Ga0495676_0000198 Ga0495676_0000198_33135_34118 327
499 3300047446 Ga0495679_001251 Ga0495679_001251_13143_14126 327
500 3300047469 Ga0495673_0001573 Ga0495673_0001573_8475_9458 327
501 3300047469 Ga0495673_0001783 Ga0495673_0001783_5570_6553 327
502 3300047469 Ga0495673_0016016 Ga0495673_0016016_1891_2874 327
503 3300047469 Ga0495673_0024116 Ga0495673_0024116_775_1758 327
504 3300047469 Ga0495673_0024832 Ga0495673_0024832_1568_2551 327
505 3300047469 Ga0495673_0026259 Ga0495673_0026259_1709_2692 327
506 3300047469 Ga0495673_0072252 Ga0495673_0072252_172_1155 327
507 3300047470 Ga0495681_0006191 Ga0495681_0006191_1696_2679 327
508 3300047472 Ga0495686_0000002 Ga0495686_0000002_25101_26087 327
509 3300048091 Ga0495626_0000372 Ga0495626_0000372_32231_33214 327
510 3300048913 Ga0496110_0115517 Ga0496110_0115517_541_1524 327
511 3300048920 Ga0496117_0128412 Ga0496117_0128412_286_1269 327
512 3300048924 Ga0496121_0003161 Ga0496121_0003161_17160_18143 327
513 3300048925 Ga0496122_0056226 Ga0496122_0056226_304_1287 327
514 3300048926 Ga0496123_0012283 Ga0496123_0012283_1910_2893 327
515 3300048927 Ga0496124_0001964 Ga0496124_0001964_19164_20147 327
516 3300048927 Ga0496124_0011212 Ga0496124_0011212_5724_6707 327
517 3300049459 Ga0495678_000840 Ga0495678_000840_20874_21857 327
518 3300049459 Ga0495678_006048 Ga0495678_006048_2713_3696 327
519 3300049459 Ga0495678_021085 Ga0495678_021085_1630_2613 327
520 3300049460 Ga0495682_0000455 Ga0495682_0000455_9771_10754 327
521 3300049571 Ga0501034_0019196 Ga0501034_0019196_3267_4256 327
522 3300049574 Ga0501038_0230651 Ga0501038_0230651_267_1280 327
523 3300049587 Ga0501071_0014830 Ga0501071_0014830_644_1657 327
524 3300049588 Ga0501072_0158680 Ga0501072_0158680_43_1056 327
525 3300049591 Ga0501075_0004498 Ga0501075_0004498_4851_5864 327
526 3300049592 Ga0501076_0008884 Ga0501076_0008884_355_1368 327
527 3300049742 Ga0501080_0147150 Ga0501080_0147150_568_1581 327
528 3300049824 Ga0501045_0044099 Ga0501045_0044099_1146_2159 327
529 3300050493 nmdc:mga0k408_15227_c1 nmdc:mga0k408_15227_c1_987_1985 327
530 3300050496 nmdc:mga07m45_45373_c1 nmdc:mga07m45_45373_c1_762_1754 327
531 3300050513 nmdc:mga0rr50_39121_c1 nmdc:mga0rr50_39121_c1_188_1180 327
532 3300054114 Ga0501084_0010475 Ga0501084_0010475_123_1136 327
533 3300060353 Ga0501082_0073461 Ga0501082_0073461_1381_2394 327
534 3300003758 Ga0055532_1001166 Ga0055532_10011664 328
535 3300003758 Ga0055532_1002123 Ga0055532_10021235 328
536 3300005262 Ga0065165_1017045 Ga0065165_10170453 328
537 3300005331 Ga0070670_100119614 Ga0070670_1001196143 328
538 3300005331 Ga0070670_100127861 Ga0070670_1001278611 328
539 3300005331 Ga0070670_100287106 Ga0070670_1002871061 328
540 3300005353 Ga0070669_100274188 Ga0070669_1002741882 328
541 3300005354 Ga0070675_100318334 Ga0070675_1003183342 328
542 3300005364 Ga0070673_100177332 Ga0070673_1001773322 328
543 3300005365 Ga0070688_100072700 Ga0070688_1000727001 328
544 3300005456 Ga0070678_100038117 Ga0070678_1000381172 328
545 3300005457 Ga0070662_100319169 Ga0070662_1003191691 328
546 3300005459 Ga0068867_100012998 Ga0068867_1000129984 328
547 3300005466 Ga0070685_10080532 Ga0070685_100805322 328
548 3300005563 Ga0068855_100002275 Ga0068855_1000022759 328
549 3300005564 Ga0070664_100101171 Ga0070664_1001011711 328
550 3300005564 Ga0070664_100425382 Ga0070664_1004253821 328
551 3300005577 Ga0068857_100033795 Ga0068857_1000337959 328
552 3300005578 Ga0068854_100399414 Ga0068854_1003994141 328
553 3300005618 Ga0068864_100570329 Ga0068864_1005703291 328
554 3300005719 Ga0068861_100289953 Ga0068861_1002899532 328
555 3300005719 Ga0068861_100563130 Ga0068861_1005631301 328
556 3300005841 Ga0068863_100019292 Ga0068863_1000192924 328
557 3300005841 Ga0068863_100020109 Ga0068863_1000201099 328
558 3300005842 Ga0068858_100009576 Ga0068858_1000095764 328
559 3300005843 Ga0068860_100026522 Ga0068860_10002652211 328
560 3300005844 Ga0068862_100071025 Ga0068862_1000710253 328
561 3300006028 Ga0070717_10000029 Ga0070717_1000002985 328
562 3300006028 Ga0070717_10407657 Ga0070717_104076572 328
563 3300006178 Ga0075367_10036141 Ga0075367_100361412 328
564 3300006844 Ga0075428_100160216 Ga0075428_1001602162 328
565 3300006847 Ga0075431_100080061 Ga0075431_1000800612 328
566 3300006847 Ga0075431_100198160 Ga0075431_1001981602 328
567 3300006871 Ga0075434_100199650 Ga0075434_1001996502 328
568 3300006880 Ga0075429_100000374 Ga0075429_10000037415 328
569 3300006880 Ga0075429_100042776 Ga0075429_1000427763 328
570 3300006914 Ga0075436_100319643 Ga0075436_1003196431 328
571 3300009147 Ga0114129_10001645 Ga0114129_1000164519 328
572 3300009147 Ga0114129_10068759 Ga0114129_100687594 328
573 3300009147 Ga0114129_10082926 Ga0114129_100829262 328
574 3300009147 Ga0114129_10183636 Ga0114129_101836362 328
575 3300009553 Ga0105249_10022415 Ga0105249_100224153 328
576 3300011119 Ga0105246_10066146 Ga0105246_100661463 328
577 3300017792 Ga0163161_10061766 Ga0163161_100617662 328
578 3300025273 Ga0209673_1000070 Ga0209673_1000070233 328
579 3300025925 Ga0207650_10196909 Ga0207650_101969091 328
580 3300025931 Ga0207644_10177770 Ga0207644_101777702 328
581 3300025940 Ga0207691_10088412 Ga0207691_100884122 328
582 3300025949 Ga0207667_10006177 Ga0207667_100061779 328
583 3300025960 Ga0207651_10177345 Ga0207651_101773452 328
584 3300025981 Ga0207640_10356480 Ga0207640_103564801 328
585 3300026035 Ga0207703_10018255 Ga0207703_100182553 328
586 3300026035 Ga0207703_10505908 Ga0207703_105059082 328
587 3300026067 Ga0207678_10102399 Ga0207678_101023992 328
588 3300026088 Ga0207641_10017280 Ga0207641_100172804 328
589 3300026089 Ga0207648_10021724 Ga0207648_100217244 328
590 3300026095 Ga0207676_10336171 Ga0207676_103361711 328
591 3300026116 Ga0207674_10003401 Ga0207674_1000340123 328
592 3300026118 Ga0207675_100114842 Ga0207675_1001148423 328
593 3300026121 Ga0207683_10424200 Ga0207683_104242001 328
594 3300031727 Ga0316576_10016093 Ga0316576_100160932 328
595 3300031727 Ga0316576_10095886 Ga0316576_100958862 328
596 3300031731 Ga0307405_10211108 Ga0307405_102111081 328
597 3300031733 Ga0316577_10012767 Ga0316577_100127672 328
598 3300031995 Ga0307409_100387460 Ga0307409_1003874602 328
599 3300036712 Ga0316584_0026279 Ga0316584_0026279_3186_4229 328
600 3300036712 Ga0316584_0154947 Ga0316584_0154947_67_1074 328
601 3300037471 Ga0395905_0000250 Ga0395905_0000250_46012_47022 328
602 3300044901 Ga0466960_0014489 Ga0466960_0014489_1793_2791 328
603 3300045051 Ga0451576_0004166 Ga0451576_0004166_14459_15484 328
604 3300045976 Ga0466967_0455576 Ga0466967_0455576_149_1147 328
605 3300048912 Ga0496109_0000208 Ga0496109_0000208_51174_52217 328
606 3300048927 Ga0496124_0000355 Ga0496124_0000355_21217_22203 328
607 3300048929 Ga0496126_0047436 Ga0496126_0047436_538_1545 328
608 3300049569 Ga0501032_0023811 Ga0501032_0023811_2133_3119 328
609 3300049585 Ga0501069_0014497 Ga0501069_0014497_2229_3236 328
610 3300049586 Ga0501070_0000091 Ga0501070_0000091_31735_32742 328
611 3300049587 Ga0501071_0042435 Ga0501071_0042435_318_1325 328
612 3300049589 Ga0501073_0003905 Ga0501073_0003905_4385_5392 328
613 3300049589 Ga0501073_0051276 Ga0501073_0051276_1711_2718 328
614 3300049590 Ga0501074_0036433 Ga0501074_0036433_1303_2310 328
615 3300049741 Ga0501079_0182006 Ga0501079_0182006_40_1047 328
616 3300049742 Ga0501080_0020366 Ga0501080_0020366_3016_4023 328
617 3300049744 Ga0501083_0012467 Ga0501083_0012467_2806_3813 328
618 3300050493 nmdc:mga0k408_5132_c1 nmdc:mga0k408_5132_c1_2205_3203 328
619 3300050507 nmdc:mga05p37_24331_c1 nmdc:mga05p37_24331_c1_2084_3094 328
620 3300050507 nmdc:mga05p37_396262_c1 nmdc:mga05p37_396262_c1_82_1077 328
621 3300050507 nmdc:mga05p37_5093_c1 nmdc:mga05p37_5093_c1_6078_7070 328
622 3300050507 nmdc:mga05p37_9838_c1 nmdc:mga05p37_9838_c1_6354_7370 328
623 3300050508 nmdc:mga09592_1064_c1 nmdc:mga09592_1064_c1_6050_7042 328
624 3300050512 nmdc:mga0n895_254514_c1 nmdc:mga0n895_254514_c1_191_1201 328
625 3300060353 Ga0501082_0011509 Ga0501082_0011509_1105_2112 328
626 3300060353 Ga0501082_0020038 Ga0501082_0020038_2090_3097 328
627 3300001915 JGI24741J21665_1000701 JGI24741J21665_10007013 329
628 3300001979 JGI24740J21852_10001102 JGI24740J21852_100011024 329
629 3300001979 JGI24740J21852_10003569 JGI24740J21852_100035694 329
630 3300002705 JGI25156J39149_1002620 JGI25156J39149_10026202 329
631 3300002705 JGI25156J39149_1005280 JGI25156J39149_10052804 329
632 3300002705 JGI25156J39149_1012602 JGI25156J39149_10126022 329
633 3300002737 JGI25162J39368_1000190 JGI25162J39368_100019013 329
634 3300002737 JGI25162J39368_1000250 JGI25162J39368_100025013 329
635 3300002738 JGI25154J39366_1001045 JGI25154J39366_10010452 329
636 3300002771 JGI25163J39215_1000539 JGI25163J39215_10005394 329
637 3300002771 JGI25163J39215_1000541 JGI25163J39215_10005417 329
638 3300002772 JGI25164J39214_1000157 JGI25164J39214_100015753 329
639 3300002772 JGI25164J39214_1000192 JGI25164J39214_100019244 329
640 3300003214 JGI25165J46597_1000284 JGI25165J46597_100028453 329
641 3300003214 JGI25165J46597_1000346 JGI25165J46597_100034644 329
642 3300003578 Ga0006562J51391_1015087 Ga0006562J51391_10150871 329
643 3300003578 Ga0006562J51391_1060129 Ga0006562J51391_10601292 329
644 3300003751 Ga0055538_1000088 Ga0055538_100008820 329
645 3300003751 Ga0055538_1001920 Ga0055538_10019203 329
646 3300003751 Ga0055538_1002774 Ga0055538_10027742 329
647 3300003752 Ga0055539_1000073 Ga0055539_100007345 329
648 3300003752 Ga0055539_1000132 Ga0055539_100013220 329
649 3300003756 Ga0055533_1000135 Ga0055533_100013520 329
650 3300003756 Ga0055533_1002700 Ga0055533_10027004 329
651 3300003756 Ga0055533_1004145 Ga0055533_10041452 329
652 3300003758 Ga0055532_1000090 Ga0055532_10000907 329
653 3300003758 Ga0055532_1000359 Ga0055532_100035920 329
654 3300003759 Ga0055525_1000243 Ga0055525_100024320 329
655 3300003759 Ga0055525_1000387 Ga0055525_100038724 329
656 3300003761 Ga0055535_1000085 Ga0055535_10000857 329
657 3300003762 Ga0055542_1000847 Ga0055542_100084717 329
658 3300003763 Ga0055529_1000134 Ga0055529_100013498 329
659 3300003781 Ga0055536_1000342 Ga0055536_100034213 329
660 3300003781 Ga0055536_1002461 Ga0055536_10024612 329
661 3300003791 Ga0055530_10000472 Ga0055530_1000047213 329
662 3300003791 Ga0055530_10000512 Ga0055530_1000051211 329
663 3300003792 Ga0055540_1000424 Ga0055540_100042411 329
664 3300003792 Ga0055540_1001540 Ga0055540_100154014 329
665 3300003841 Ga0055541_1000087 Ga0055541_100008765 329
666 3300003841 Ga0055541_1004035 Ga0055541_10040352 329
667 3300005288 Ga0065714_10002659 Ga0065714_1000265912 329
668 3300005288 Ga0065714_10033331 Ga0065714_100333312 329
669 3300005288 Ga0065714_10065003 Ga0065714_100650037 329
670 3300005288 Ga0065714_10096482 Ga0065714_100964822 329
671 3300005288 Ga0065714_10119427 Ga0065714_101194272 329
672 3300005289 Ga0065704_10003082 Ga0065704_100030825 329
673 3300005290 Ga0065712_10070057 Ga0065712_100700576 329
674 3300005295 Ga0065707_10091487 Ga0065707_100914872 329
675 3300005331 Ga0070670_100001253 Ga0070670_1000012539 329
676 3300005331 Ga0070670_100026572 Ga0070670_1000265721 329
677 3300005337 Ga0070682_100088602 Ga0070682_1000886022 329
678 3300005339 Ga0070660_100099732 Ga0070660_1000997322 329
679 3300005344 Ga0070661_100000141 Ga0070661_1000001413 329
680 3300005353 Ga0070669_100001868 Ga0070669_1000018686 329
681 3300005353 Ga0070669_100006352 Ga0070669_1000063525 329
682 3300005366 Ga0070659_100001430 Ga0070659_1000014306 329
683 3300005455 Ga0070663_100000034 Ga0070663_10000003457 329
684 3300005457 Ga0070662_100007020 Ga0070662_1000070205 329
685 3300005457 Ga0070662_100007171 Ga0070662_1000071713 329
686 3300005539 Ga0068853_100043664 Ga0068853_1000436644 329
687 3300005548 Ga0070665_100098943 Ga0070665_1000989432 329
688 3300005548 Ga0070665_100336128 Ga0070665_1003361282 329
689 3300005564 Ga0070664_100000057 Ga0070664_10000005759 329
690 3300005577 Ga0068857_100009494 Ga0068857_1000094948 329
691 3300005578 Ga0068854_100000299 Ga0068854_1000002994 329
692 3300005578 Ga0068854_100128126 Ga0068854_1001281262 329
693 3300005614 Ga0068856_100000811 Ga0068856_1000008119 329
694 3300005616 Ga0068852_100265346 Ga0068852_1002653462 329
695 3300005834 Ga0068851_10000311 Ga0068851_1000031112 329
696 3300005843 Ga0068860_100000206 Ga0068860_10000020668 329
697 3300006051 Ga0075364_10075777 Ga0075364_100757772 329
698 3300006051 Ga0075364_10104320 Ga0075364_101043202 329
699 3300006058 Ga0075432_10005608 Ga0075432_100056082 329
700 3300006058 Ga0075432_10023055 Ga0075432_100230551 329
701 3300006237 Ga0097621_100228652 Ga0097621_1002286522 329
702 3300006944 Ga0099823_1003401 Ga0099823_10034019 329
703 3300006946 Ga0079104_1000659 Ga0079104_100065923 329
704 3300006946 Ga0079104_1005684 Ga0079104_10056842 329
705 3300009011 Ga0105251_10000336 Ga0105251_1000033630 329
706 3300009011 Ga0105251_10000879 Ga0105251_1000087919 329
707 3300009011 Ga0105251_10001202 Ga0105251_1000120211 329
708 3300009011 Ga0105251_10001712 Ga0105251_1000171210 329
709 3300009011 Ga0105251_10002150 Ga0105251_100021509 329
710 3300009011 Ga0105251_10007195 Ga0105251_100071951 329
711 3300009011 Ga0105251_10052124 Ga0105251_100521242 329
712 3300009011 Ga0105251_10103416 Ga0105251_101034162 329
713 3300009011 Ga0105251_10106632 Ga0105251_101066322 329
714 3300009036 Ga0105244_10002288 Ga0105244_1000228812 329
715 3300009036 Ga0105244_10005469 Ga0105244_100054695 329
716 3300009036 Ga0105244_10006237 Ga0105244_100062375 329
717 3300009036 Ga0105244_10006263 Ga0105244_100062634 329
718 3300009036 Ga0105244_10058728 Ga0105244_100587282 329
719 3300009036 Ga0105244_10073413 Ga0105244_100734131 329
720 3300009036 Ga0105244_10080174 Ga0105244_100801742 329
721 3300009092 Ga0105250_10000152 Ga0105250_1000015274 329
722 3300009092 Ga0105250_10000566 Ga0105250_1000056611 329
723 3300009092 Ga0105250_10001634 Ga0105250_100016345 329
724 3300009092 Ga0105250_10009340 Ga0105250_100093402 329
725 3300009092 Ga0105250_10012096 Ga0105250_100120962 329
726 3300009092 Ga0105250_10018885 Ga0105250_100188852 329
727 3300009092 Ga0105250_10019617 Ga0105250_100196173 329
728 3300009092 Ga0105250_10021230 Ga0105250_100212302 329
729 3300009093 Ga0105240_10023229 Ga0105240_100232294 329
730 3300009093 Ga0105240_10194299 Ga0105240_101942993 329
731 3300009148 Ga0105243_10000321 Ga0105243_100003212 329
732 3300009148 Ga0105243_10000885 Ga0105243_100008859 329
733 3300009148 Ga0105243_10025570 Ga0105243_100255702 329
734 3300009148 Ga0105243_10039642 Ga0105243_100396422 329
735 3300009148 Ga0105243_10110707 Ga0105243_101107073 329
736 3300009177 Ga0105248_10107584 Ga0105248_101075842 329
737 3300011119 Ga0105246_10000476 Ga0105246_100004765 329
738 3300011119 Ga0105246_10000524 Ga0105246_100005246 329
739 3300011119 Ga0105246_10041030 Ga0105246_100410302 329
740 3300012498 Ga0157345_1000203 Ga0157345_10002034 329
741 3300013100 Ga0157373_10002399 Ga0157373_1000239910 329
742 3300013100 Ga0157373_10005087 Ga0157373_100050874 329
743 3300013100 Ga0157373_10005895 Ga0157373_100058956 329
744 3300013100 Ga0157373_10009158 Ga0157373_100091585 329
745 3300013100 Ga0157373_10011643 Ga0157373_100116434 329
746 3300013100 Ga0157373_10015891 Ga0157373_100158914 329
747 3300013100 Ga0157373_10071925 Ga0157373_100719251 329
748 3300013102 Ga0157371_10000323 Ga0157371_1000032350 329
749 3300013102 Ga0157371_10001092 Ga0157371_1000109224 329
750 3300013102 Ga0157371_10001258 Ga0157371_1000125825 329
751 3300013104 Ga0157370_10000038 Ga0157370_1000003850 329
752 3300013104 Ga0157370_10056190 Ga0157370_100561902 329
753 3300013104 Ga0157370_10176684 Ga0157370_101766842 329
754 3300013104 Ga0157370_10182491 Ga0157370_101824912 329
755 3300013105 Ga0157369_10008841 Ga0157369_100088416 329
756 3300013105 Ga0157369_10021204 Ga0157369_100212044 329
757 3300013105 Ga0157369_10055398 Ga0157369_100553982 329
758 3300013105 Ga0157369_10139563 Ga0157369_101395631 329
759 3300013105 Ga0157369_10419654 Ga0157369_104196541 329
760 3300013296 Ga0157374_10000045 Ga0157374_1000004521 329
761 3300013306 Ga0163162_10000820 Ga0163162_100008206 329
762 3300013306 Ga0163162_10482275 Ga0163162_104822751 329
763 3300013307 Ga0157372_10000663 Ga0157372_1000066336 329
764 3300013307 Ga0157372_10002748 Ga0157372_100027488 329
765 3300013307 Ga0157372_10007130 Ga0157372_100071305 329
766 3300013307 Ga0157372_10024456 Ga0157372_100244564 329
767 3300013308 Ga0157375_10074741 Ga0157375_100747412 329
768 3300014497 Ga0182008_10000483 Ga0182008_100004835 329
769 3300014497 Ga0182008_10001727 Ga0182008_1000172714 329
770 3300014497 Ga0182008_10002512 Ga0182008_100025125 329
771 3300014497 Ga0182008_10023541 Ga0182008_100235412 329
772 3300014497 Ga0182008_10034108 Ga0182008_100341083 329
773 3300014969 Ga0157376_10000309 Ga0157376_100003099 329
774 3300015261 Ga0182006_1001817 Ga0182006_10018176 329
775 3300015261 Ga0182006_1004331 Ga0182006_10043314 329
776 3300015261 Ga0182006_1004638 Ga0182006_10046383 329
777 3300015261 Ga0182006_1014999 Ga0182006_10149992 329
778 3300015261 Ga0182006_1015539 Ga0182006_10155392 329
779 3300015262 Ga0182007_10002175 Ga0182007_100021753 329
780 3300015262 Ga0182007_10011984 Ga0182007_100119843 329
781 3300015262 Ga0182007_10018272 Ga0182007_100182722 329
782 3300015265 Ga0182005_1001689 Ga0182005_10016893 329
783 3300015265 Ga0182005_1011469 Ga0182005_10114692 329
784 3300015265 Ga0182005_1011882 Ga0182005_10118821 329
785 3300017792 Ga0163161_10005444 Ga0163161_100054445 329
786 3300017792 Ga0163161_10013673 Ga0163161_100136739 329
787 3300017792 Ga0163161_10014430 Ga0163161_100144309 329
788 3300017792 Ga0163161_10043460 Ga0163161_100434601 329
789 3300017792 Ga0163161_10061444 Ga0163161_100614442 329
790 3300017792 Ga0163161_10085930 Ga0163161_100859302 329
791 3300017792 Ga0163161_10111901 Ga0163161_101119012 329
792 3300020077 Ga0206351_10707377 Ga0206351_107073771 329
793 3300020610 Ga0154015_1546600 Ga0154015_15466002 329
794 3300025206 Ga0209435_101037 Ga0209435_1010376 329
795 3300025207 Ga0209760_100028 Ga0209760_10002851 329
796 3300025207 Ga0209760_100095 Ga0209760_1000959 329
797 3300025224 Ga0209784_100006 Ga0209784_100006105 329
798 3300025224 Ga0209784_100108 Ga0209784_10010820 329
799 3300025224 Ga0209784_100126 Ga0209784_10012665 329
800 3300025224 Ga0209784_100846 Ga0209784_1008464 329
801 3300025225 Ga0209566_100002 Ga0209566_100002105 329
802 3300025225 Ga0209566_100152 Ga0209566_10015265 329
803 3300025225 Ga0209566_100602 Ga0209566_1006024 329
804 3300025225 Ga0209566_103317 Ga0209566_1033172 329
805 3300025226 Ga0209674_100097 Ga0209674_100097105 329
806 3300025226 Ga0209674_100168 Ga0209674_10016869 329
807 3300025226 Ga0209674_100177 Ga0209674_10017765 329
808 3300025226 Ga0209674_101230 Ga0209674_1012303 329
809 3300025229 Ga0209147_100018 Ga0209147_100018395 329
810 3300025229 Ga0209147_100179 Ga0209147_10017965 329
811 3300025230 Ga0209563_100041 Ga0209563_100041367 329
812 3300025230 Ga0209563_100142 Ga0209563_10014265 329
813 3300025230 Ga0209563_101244 Ga0209563_1012448 329
814 3300025230 Ga0209563_104405 Ga0209563_1044053 329
815 3300025231 Ga0207427_100007 Ga0207427_10000749 329
816 3300025231 Ga0207427_100008 Ga0207427_100008121 329
817 3300025233 Ga0209437_100006 Ga0209437_100006315 329
818 3300025233 Ga0209437_100014 Ga0209437_100014590 329
819 3300025242 Ga0209258_100028 Ga0209258_100028395 329
820 3300025242 Ga0209258_100366 Ga0209258_10036611 329
821 3300025246 Ga0209646_1000153 Ga0209646_100015350 329
822 3300025246 Ga0209646_1000465 Ga0209646_10004658 329
823 3300025253 Ga0209677_100007 Ga0209677_100007105 329
824 3300025253 Ga0209677_100125 Ga0209677_10012565 329
825 3300025254 Ga0209148_1000297 Ga0209148_100029722 329
826 3300025256 Ga0209759_1002551 Ga0209759_10025514 329
827 3300025256 Ga0209759_1002829 Ga0209759_10028294 329
828 3300025256 Ga0209759_1007185 Ga0209759_10071856 329
829 3300025261 Ga0209233_1000008 Ga0209233_1000008590 329
830 3300025261 Ga0209233_1000086 Ga0209233_100008649 329
831 3300025272 Ga0209455_1000107 Ga0209455_100010795 329
832 3300025291 Ga0209675_1010978 Ga0209675_10109785 329
833 3300025292 Ga0209676_1000006 Ga0209676_1000006297 329
834 3300025292 Ga0209676_1000109 Ga0209676_100010967 329
835 3300025292 Ga0209676_1000973 Ga0209676_100097319 329
836 3300025292 Ga0209676_1006254 Ga0209676_10062545 329
837 3300025298 Ga0209050_1000070 Ga0209050_1000070222 329
838 3300025298 Ga0209050_1000399 Ga0209050_100039922 329
839 3300025303 Ga0209051_1000086 Ga0209051_100008655 329
840 3300025303 Ga0209051_1000106 Ga0209051_100010695 329
841 3300025304 Ga0209257_1017856 Ga0209257_10178562 329
842 3300025321 Ga0207656_10000423 Ga0207656_1000042312 329
843 3300025711 Ga0207696_1000044 Ga0207696_1000044258 329
844 3300025711 Ga0207696_1000090 Ga0207696_100009027 329
845 3300025711 Ga0207696_1000130 Ga0207696_100013098 329
846 3300025711 Ga0207696_1000144 Ga0207696_100014419 329
847 3300025711 Ga0207696_1002572 Ga0207696_10025722 329
848 3300025711 Ga0207696_1006573 Ga0207696_10065732 329
849 3300025711 Ga0207696_1008004 Ga0207696_10080042 329
850 3300025711 Ga0207696_1008761 Ga0207696_10087612 329
851 3300025728 Ga0207655_1000113 Ga0207655_1000113151 329
852 3300025728 Ga0207655_1001166 Ga0207655_10011665 329
853 3300025728 Ga0207655_1003265 Ga0207655_10032654 329
854 3300025728 Ga0207655_1004652 Ga0207655_10046527 329
855 3300025728 Ga0207655_1006377 Ga0207655_10063774 329
856 3300025728 Ga0207655_1006442 Ga0207655_10064424 329
857 3300025728 Ga0207655_1007851 Ga0207655_10078518 329
858 3300025728 Ga0207655_1013598 Ga0207655_10135982 329
859 3300025728 Ga0207655_1044533 Ga0207655_10445332 329
860 3300025728 Ga0207655_1052506 Ga0207655_10525063 329
861 3300025735 Ga0207713_1000013 Ga0207713_100001318 329
862 3300025735 Ga0207713_1000442 Ga0207713_100044232 329
863 3300025735 Ga0207713_1000520 Ga0207713_100052017 329
864 3300025735 Ga0207713_1000877 Ga0207713_100087720 329
865 3300025735 Ga0207713_1001968 Ga0207713_10019687 329
866 3300025735 Ga0207713_1003597 Ga0207713_10035976 329
867 3300025735 Ga0207713_1004351 Ga0207713_10043517 329
868 3300025735 Ga0207713_1004461 Ga0207713_10044612 329
869 3300025735 Ga0207713_1004479 Ga0207713_10044794 329
870 3300025735 Ga0207713_1006089 Ga0207713_10060892 329
871 3300025735 Ga0207713_1006195 Ga0207713_10061958 329
872 3300025735 Ga0207713_1008133 Ga0207713_10081339 329
873 3300025913 Ga0207695_10009088 Ga0207695_100090886 329
874 3300025913 Ga0207695_10148904 Ga0207695_101489043 329
875 3300025919 Ga0207657_10112754 Ga0207657_101127542 329
876 3300025920 Ga0207649_10000111 Ga0207649_1000011157 329
877 3300025923 Ga0207681_10008837 Ga0207681_100088373 329
878 3300025923 Ga0207681_10014938 Ga0207681_100149382 329
879 3300025925 Ga0207650_10000266 Ga0207650_1000026649 329
880 3300025925 Ga0207650_10000428 Ga0207650_1000042829 329
881 3300025932 Ga0207690_10001080 Ga0207690_100010809 329
882 3300025933 Ga0207706_10006074 Ga0207706_1000607418 329
883 3300025933 Ga0207706_10041506 Ga0207706_100415062 329
884 3300025935 Ga0207709_10000013 Ga0207709_1000001337 329
885 3300025935 Ga0207709_10001932 Ga0207709_1000193212 329
886 3300025935 Ga0207709_10013065 Ga0207709_100130652 329
887 3300025945 Ga0207679_10000105 Ga0207679_100001059 329
888 3300025981 Ga0207640_10000154 Ga0207640_100001547 329
889 3300026035 Ga0207703_10080423 Ga0207703_100804232 329
890 3300026067 Ga0207678_10000106 Ga0207678_1000010657 329
891 3300026078 Ga0207702_10000135 Ga0207702_1000013579 329
892 3300026116 Ga0207674_10151286 Ga0207674_101512862 329
893 3300026116 Ga0207674_10555863 Ga0207674_105558631 329
894 3300027111 Ga0209281_1000010 Ga0209281_1000010485 329
895 3300027111 Ga0209281_1005767 Ga0209281_10057675 329
896 3300027111 Ga0209281_1006162 Ga0209281_10061625 329
897 3300027296 Ga0209389_1000031 Ga0209389_1000031125 329
898 3300027312 Ga0209371_1000348 Ga0209371_100034817 329
899 3300028379 Ga0268266_10048574 Ga0268266_100485742 329
900 3300028379 Ga0268266_10265494 Ga0268266_102654941 329
901 3300028381 Ga0268264_10000341 Ga0268264_1000034165 329
902 3300028577 Ga0265318_10000033 Ga0265318_1000003338 329
903 3300030500 Ga0268256_1000134 Ga0268256_100013470 329
904 3300030521 Ga0307511_10024878 Ga0307511_100248783 329
905 3300030521 Ga0307511_10165360 Ga0307511_101653602 329
906 3300030733 Ga0314311_1063254 Ga0314311_10632542 329
907 3300030735 Ga0316178_1042235 Ga0316178_10422355 329
908 3300030742 Ga0316183_1100530 Ga0316183_11005305 329
909 3300031235 Ga0265330_10000029 Ga0265330_1000002989 329
910 3300031238 Ga0265332_10004299 Ga0265332_100042994 329
911 3300031239 Ga0265328_10016457 Ga0265328_100164573 329
912 3300031240 Ga0265320_10000062 Ga0265320_1000006291 329
913 3300031249 Ga0265339_10037067 Ga0265339_100370672 329
914 3300031250 Ga0265331_10000079 Ga0265331_1000007935 329
915 3300031344 Ga0265316_10019120 Ga0265316_100191202 329
916 3300031548 Ga0307408_100005919 Ga0307408_1000059196 329
917 3300031548 Ga0307408_100006681 Ga0307408_1000066813 329
918 3300031548 Ga0307408_100009169 Ga0307408_1000091698 329
919 3300031548 Ga0307408_100024887 Ga0307408_1000248872 329
920 3300031548 Ga0307408_100048945 Ga0307408_1000489452 329
921 3300031548 Ga0307408_100144913 Ga0307408_1001449131 329
922 3300031548 Ga0307408_100177630 Ga0307408_1001776302 329
923 3300031548 Ga0307408_100220735 Ga0307408_1002207352 329
924 3300031595 Ga0265313_10000344 Ga0265313_1000034428 329
925 3300031711 Ga0265314_10000138 Ga0265314_1000013812 329
926 3300031731 Ga0307405_10001021 Ga0307405_100010214 329
927 3300031731 Ga0307405_10002099 Ga0307405_100020994 329
928 3300031731 Ga0307405_10032339 Ga0307405_100323394 329
929 3300031824 Ga0307413_10002828 Ga0307413_100028285 329
930 3300031824 Ga0307413_10057066 Ga0307413_100570662 329
931 3300031852 Ga0307410_10007569 Ga0307410_100075694 329
932 3300031901 Ga0307406_10141122 Ga0307406_101411221 329
933 3300031903 Ga0307407_10015054 Ga0307407_100150542 329
934 3300031903 Ga0307407_10027783 Ga0307407_100277833 329
935 3300031903 Ga0307407_10038255 Ga0307407_100382551 329
936 3300031911 Ga0307412_10002264 Ga0307412_100022645 329
937 3300031911 Ga0307412_10005050 Ga0307412_100050509 329
938 3300031911 Ga0307412_10017840 Ga0307412_100178402 329
939 3300031911 Ga0307412_10022573 Ga0307412_100225732 329
940 3300031911 Ga0307412_10111948 Ga0307412_101119482 329
941 3300031911 Ga0307412_10135198 Ga0307412_101351982 329
942 3300031911 Ga0307412_10175422 Ga0307412_101754222 329
943 3300031995 Ga0307409_100001842 Ga0307409_1000018428 329
944 3300031995 Ga0307409_100090062 Ga0307409_1000900622 329
945 3300031995 Ga0307409_100231795 Ga0307409_1002317951 329
946 3300031995 Ga0307409_100362701 Ga0307409_1003627011 329
947 3300032002 Ga0307416_100004045 Ga0307416_1000040456 329
948 3300032002 Ga0307416_100071689 Ga0307416_1000716892 329
949 3300032004 Ga0307414_10130885 Ga0307414_101308853 329
950 3300032004 Ga0307414_10161927 Ga0307414_101619271 329
951 3300032004 Ga0307414_10293656 Ga0307414_102936562 329
952 3300032005 Ga0307411_10001241 Ga0307411_100012414 329
953 3300032005 Ga0307411_10028369 Ga0307411_100283691 329
954 3300032005 Ga0307411_10080620 Ga0307411_100806201 329
955 3300032005 Ga0307411_10082852 Ga0307411_100828522 329
956 3300032126 Ga0307415_100005809 Ga0307415_1000058095 329
957 3300033180 Ga0307510_10013692 Ga0307510_100136925 329
958 3300036647 Ga0316582_0153412 Ga0316582_0153412_283_1293 329
959 3300037418 Ga0395900_0014044 Ga0395900_0014044_5052_6047 329
960 3300037471 Ga0395905_0033055 Ga0395905_0033055_1182_2219 329
961 3300037588 Ga0316581_0029471 Ga0316581_0029471_461_1471 329
962 3300041405 Ga0439438_003350 Ga0439438_003350_2709_3755 329
963 3300041405 Ga0439438_006671 Ga0439438_006671_559_1548 329
964 3300041405 Ga0439438_007036 Ga0439438_007036_1144_2133 329
965 3300041405 Ga0439438_008145 Ga0439438_008145_746_1792 329
966 3300041405 Ga0439438_017553 Ga0439438_017553_476_1465 329
967 3300041405 Ga0439438_018413 Ga0439438_018413_526_1515 329
968 3300041407 Ga0439447_002028 Ga0439447_002028_4627_5736 329
969 3300041411 Ga0439466_0000576 Ga0439466_0000576_6752_7741 329
970 3300041411 Ga0439466_0009827 Ga0439466_0009827_1564_2553 329
971 3300041411 Ga0439466_0011451 Ga0439466_0011451_1737_2726 329
972 3300041411 Ga0439466_0021798 Ga0439466_0021798_1030_2139 329
973 3300041411 Ga0439466_0024369 Ga0439466_0024369_431_1420 329
974 3300042006 Ga0439432_003737 Ga0439432_003737_646_1635 329
975 3300042006 Ga0439432_003969 Ga0439432_003969_4403_5392 329
976 3300042006 Ga0439432_062703 Ga0439432_062703_108_1097 329
977 3300042009 Ga0439451_004554 Ga0439451_004554_645_1634 329
978 3300042009 Ga0439451_006133 Ga0439451_006133_248_1237 329
979 3300042009 Ga0439451_013262 Ga0439451_013262_589_1578 329
980 3300042010 Ga0439452_000385 Ga0439452_000385_6032_7021 329
981 3300042010 Ga0439452_023243 Ga0439452_023243_244_1233 329
982 3300042013 Ga0439456_000112 Ga0439456_000112_8615_9604 329
983 3300042013 Ga0439456_012493 Ga0439456_012493_259_1248 329
984 3300042016 Ga0439463_003967 Ga0439463_003967_1988_3010 329
985 3300042115 Ga0450911_000164 Ga0450911_000164_5750_6739 329
986 3300042136 Ga0450900_000339 Ga0450900_000339_717_1706 329
987 3300042136 Ga0450900_005342 Ga0450900_005342_104_1093 329
988 3300042139 Ga0450904_001639 Ga0450904_001639_799_1788 329
989 3300042139 Ga0450904_002044 Ga0450904_002044_1075_2064 329
990 3300042142 Ga0450905_000699 Ga0450905_000699_2973_3962 329
991 3300042533 Ga0450901_000917 Ga0450901_000917_1638_2627 329
992 3300042993 Ga0439440_0006923 Ga0439440_0006923_942_1964 329
993 3300046452 Ga0495617_000491 Ga0495617_000491_13226_14215 329
994 3300046452 Ga0495617_007572 Ga0495617_007572_1550_2539 329
995 3300046452 Ga0495617_008183 Ga0495617_008183_1523_2530 329
996 3300046452 Ga0495617_018006 Ga0495617_018006_650_1639 329
997 3300046452 Ga0495617_018952 Ga0495617_018952_857_1846 329
998 3300046452 Ga0495617_020715 Ga0495617_020715_652_1659 329
999 3300046452 Ga0495617_021143 Ga0495617_021143_588_1595 329
1000 3300046452 Ga0495617_043083 Ga0495617_043083_122_1111 329
1001 3300046453 Ga0495627_000130 Ga0495627_000130_21367_22356 329
1002 3300046453 Ga0495627_000678 Ga0495627_000678_19250_20257 329
1003 3300046453 Ga0495627_000738 Ga0495627_000738_7758_8747 329
1004 3300046453 Ga0495627_012248 Ga0495627_012248_642_1649 329
1005 3300046453 Ga0495627_032885 Ga0495627_032885_435_1424 329
1006 3300046455 Ga0495603_0074338 Ga0495603_0074338_400_1401 329
1007 3300046455 Ga0495603_0133081 Ga0495603_0133081_338_1327 329
1008 3300046457 Ga0495590_0001655 Ga0495590_0001655_6210_7199 329
1009 3300046457 Ga0495590_0003189 Ga0495590_0003189_1449_2456 329
1010 3300046458 Ga0495591_001825 Ga0495591_001825_5449_6456 329
1011 3300046458 Ga0495591_003562 Ga0495591_003562_5076_6083 329
1012 3300046458 Ga0495591_007562 Ga0495591_007562_1746_2753 329
1013 3300046458 Ga0495591_010643 Ga0495591_010643_588_1577 329
1014 3300046458 Ga0495591_013535 Ga0495591_013535_1190_2197 329
1015 3300046458 Ga0495591_020522 Ga0495591_020522_543_1550 329
1016 3300046458 Ga0495591_021474 Ga0495591_021474_441_1448 329
1017 3300046460 Ga0495638_0043309 Ga0495638_0043309_602_1591 329
1018 3300046462 Ga0495651_0019804 Ga0495651_0019804_1733_2749 329
1019 3300046463 Ga0495653_0006683 Ga0495653_0006683_6789_7778 329
1020 3300046471 Ga0495650_0006424 Ga0495650_0006424_1438_2445 329
1021 3300046471 Ga0495650_0007388 Ga0495650_0007388_5495_6502 329
1022 3300046471 Ga0495650_0007821 Ga0495650_0007821_3852_4841 329
1023 3300046471 Ga0495650_0008168 Ga0495650_0008168_3829_4863 329
1024 3300046471 Ga0495650_0025963 Ga0495650_0025963_957_1946 329
1025 3300046471 Ga0495650_0061277 Ga0495650_0061277_172_1179 329
1026 3300046471 Ga0495650_0061278 Ga0495650_0061278_329_1336 329
1027 3300046474 Ga0495605_0000125 Ga0495605_0000125_68931_69920 329
1028 3300046474 Ga0495605_0020040 Ga0495605_0020040_982_1989 329
1029 3300046474 Ga0495605_0029467 Ga0495605_0029467_632_1702 329
1030 3300046474 Ga0495605_0035701 Ga0495605_0035701_343_1332 329
1031 3300046474 Ga0495605_0037191 Ga0495605_0037191_855_1862 329
1032 3300046474 Ga0495605_0038840 Ga0495605_0038840_329_1318 329
1033 3300046474 Ga0495605_0053038 Ga0495605_0053038_951_1940 329
1034 3300046474 Ga0495605_0067400 Ga0495605_0067400_179_1168 329
1035 3300046475 Ga0495639_0001007 Ga0495639_0001007_4712_5701 329
1036 3300046477 Ga0495664_0067807 Ga0495664_0067807_506_1504 329
1037 3300046491 Ga0495584_0003136 Ga0495584_0003136_3592_4581 329
1038 3300046491 Ga0495584_0003623 Ga0495584_0003623_4288_5277 329
1039 3300046491 Ga0495584_0022348 Ga0495584_0022348_606_1637 329
1040 3300046491 Ga0495584_0029759 Ga0495584_0029759_1646_2635 329
1041 3300046491 Ga0495584_0040369 Ga0495584_0040369_563_1570 329
1042 3300046491 Ga0495584_0047168 Ga0495584_0047168_525_1532 329
1043 3300046492 Ga0495585_0011254 Ga0495585_0011254_2803_3810 329
1044 3300046492 Ga0495585_0026516 Ga0495585_0026516_1661_2668 329
1045 3300046492 Ga0495585_0030156 Ga0495585_0030156_867_1874 329
1046 3300046492 Ga0495585_0063137 Ga0495585_0063137_386_1393 329
1047 3300046492 Ga0495585_0090819 Ga0495585_0090819_549_1538 329
1048 3300046499 Ga0495594_0000599 Ga0495594_0000599_4363_5352 329
1049 3300046499 Ga0495594_0031316 Ga0495594_0031316_850_1851 329
1050 3300046501 Ga0495607_0001590 Ga0495607_0001590_8627_9616 329
1051 3300046501 Ga0495607_0004594 Ga0495607_0004594_5616_6605 329
1052 3300046501 Ga0495607_0005901 Ga0495607_0005901_6345_7334 329
1053 3300046501 Ga0495607_0007213 Ga0495607_0007213_4939_5946 329
1054 3300046501 Ga0495607_0007419 Ga0495607_0007419_5107_6114 329
1055 3300046501 Ga0495607_0008794 Ga0495607_0008794_1436_2425 329
1056 3300046501 Ga0495607_0018033 Ga0495607_0018033_1522_2511 329
1057 3300046501 Ga0495607_0020946 Ga0495607_0020946_1152_2141 329
1058 3300046501 Ga0495607_0060716 Ga0495607_0060716_552_1541 329
1059 3300046506 Ga0495583_0000196 Ga0495583_0000196_68865_69854 329
1060 3300046506 Ga0495583_0002387 Ga0495583_0002387_13143_14132 329
1061 3300046506 Ga0495583_0018232 Ga0495583_0018232_1817_2824 329
1062 3300046506 Ga0495583_0039104 Ga0495583_0039104_109_1098 329
1063 3300046506 Ga0495583_0044448 Ga0495583_0044448_595_1626 329
1064 3300046507 Ga0495606_0004170 Ga0495606_0004170_8897_9904 329
1065 3300046507 Ga0495606_0005485 Ga0495606_0005485_5855_6862 329
1066 3300046507 Ga0495606_0035305 Ga0495606_0035305_638_1645 329
1067 3300046507 Ga0495606_0038139 Ga0495606_0038139_1759_2766 329
1068 3300046507 Ga0495606_0050495 Ga0495606_0050495_407_1414 329
1069 3300046507 Ga0495606_0071879 Ga0495606_0071879_1016_2005 329
1070 3300046507 Ga0495606_0084158 Ga0495606_0084158_119_1108 329
1071 3300046512 Ga0495610_0002150 Ga0495610_0002150_8777_9784 329
1072 3300046512 Ga0495610_0004952 Ga0495610_0004952_8429_9418 329
1073 3300046512 Ga0495610_0005624 Ga0495610_0005624_4919_5926 329
1074 3300046512 Ga0495610_0017516 Ga0495610_0017516_1928_2917 329
1075 3300046513 Ga0495616_0000846 Ga0495616_0000846_1821_2828 329
1076 3300046513 Ga0495616_0002466 Ga0495616_0002466_4739_5728 329
1077 3300046513 Ga0495616_0006003 Ga0495616_0006003_1486_2493 329
1078 3300046513 Ga0495616_0017760 Ga0495616_0017760_2343_3350 329
1079 3300046513 Ga0495616_0025846 Ga0495616_0025846_806_1795 329
1080 3300046513 Ga0495616_0035429 Ga0495616_0035429_631_1638 329
1081 3300046515 Ga0495620_0000003 Ga0495620_0000003_209245_210234 329
1082 3300046515 Ga0495620_0000055 Ga0495620_0000055_31330_32319 329
1083 3300046515 Ga0495620_0002668 Ga0495620_0002668_6976_7983 329
1084 3300046515 Ga0495620_0016857 Ga0495620_0016857_1007_1996 329
1085 3300046515 Ga0495620_0018067 Ga0495620_0018067_2280_3287 329
1086 3300046515 Ga0495620_0024440 Ga0495620_0024440_814_1803 329
1087 3300046515 Ga0495620_0031372 Ga0495620_0031372_248_1255 329
1088 3300046515 Ga0495620_0035367 Ga0495620_0035367_764_1771 329
1089 3300046517 Ga0495630_0106308 Ga0495630_0106308_568_1638 329
1090 3300046518 Ga0495631_0000403 Ga0495631_0000403_22761_23750 329
1091 3300046518 Ga0495631_0002343 Ga0495631_0002343_8129_9118 329
1092 3300046518 Ga0495631_0003513 Ga0495631_0003513_1625_2632 329
1093 3300046518 Ga0495631_0010248 Ga0495631_0010248_1867_2856 329
1094 3300046518 Ga0495631_0045743 Ga0495631_0045743_433_1440 329
1095 3300046518 Ga0495631_0087283 Ga0495631_0087283_189_1196 329
1096 3300046519 Ga0495632_0003227 Ga0495632_0003227_4861_5868 329
1097 3300046519 Ga0495632_0003468 Ga0495632_0003468_4895_5884 329
1098 3300046519 Ga0495632_0008801 Ga0495632_0008801_2442_3449 329
1099 3300046519 Ga0495632_0013378 Ga0495632_0013378_1760_2749 329
1100 3300046519 Ga0495632_0028525 Ga0495632_0028525_857_1864 329
1101 3300046519 Ga0495632_0038253 Ga0495632_0038253_604_1611 329
1102 3300046519 Ga0495632_0041297 Ga0495632_0041297_1045_2034 329
1103 3300046519 Ga0495632_0081253 Ga0495632_0081253_109_1098 329
1104 3300046519 Ga0495632_0094292 Ga0495632_0094292_245_1234 329
1105 3300046520 Ga0495637_0002882 Ga0495637_0002882_4034_5023 329
1106 3300046520 Ga0495637_0003063 Ga0495637_0003063_4998_6005 329
1107 3300046520 Ga0495637_0011675 Ga0495637_0011675_1633_2622 329
1108 3300046520 Ga0495637_0025297 Ga0495637_0025297_653_1660 329
1109 3300046520 Ga0495637_0028927 Ga0495637_0028927_1314_2303 329
1110 3300046520 Ga0495637_0035448 Ga0495637_0035448_546_1553 329
1111 3300046520 Ga0495637_0035484 Ga0495637_0035484_533_1540 329
1112 3300046520 Ga0495637_0053178 Ga0495637_0053178_605_1594 329
1113 3300046522 Ga0495643_0000319 Ga0495643_0000319_4139_5128 329
1114 3300046522 Ga0495643_0006752 Ga0495643_0006752_647_1654 329
1115 3300046522 Ga0495643_0006925 Ga0495643_0006925_4681_5670 329
1116 3300046522 Ga0495643_0008963 Ga0495643_0008963_3444_4433 329
1117 3300046522 Ga0495643_0045252 Ga0495643_0045252_733_1722 329
1118 3300046522 Ga0495643_0052074 Ga0495643_0052074_637_1644 329
1119 3300046523 Ga0495644_0037358 Ga0495644_0037358_307_1314 329
1120 3300046524 Ga0495648_0002744 Ga0495648_0002744_8620_9609 329
1121 3300046524 Ga0495648_0003294 Ga0495648_0003294_9070_10059 329
1122 3300046524 Ga0495648_0006599 Ga0495648_0006599_5695_6684 329
1123 3300046524 Ga0495648_0006625 Ga0495648_0006625_4390_5397 329
1124 3300046524 Ga0495648_0010717 Ga0495648_0010717_4419_5408 329
1125 3300046524 Ga0495648_0013998 Ga0495648_0013998_3403_4410 329
1126 3300046524 Ga0495648_0036735 Ga0495648_0036735_1095_2084 329
1127 3300046524 Ga0495648_0041162 Ga0495648_0041162_1270_2259 329
1128 3300046524 Ga0495648_0064793 Ga0495648_0064793_409_1416 329
1129 3300046528 Ga0495642_0008500 Ga0495642_0008500_2596_3585 329
1130 3300046530 Ga0495654_0001040 Ga0495654_0001040_8954_9943 329
1131 3300046530 Ga0495654_0002193 Ga0495654_0002193_6985_7992 329
1132 3300046530 Ga0495654_0005540 Ga0495654_0005540_4865_5854 329
1133 3300046530 Ga0495654_0012813 Ga0495654_0012813_731_1738 329
1134 3300046530 Ga0495654_0013376 Ga0495654_0013376_2873_3880 329
1135 3300046530 Ga0495654_0014747 Ga0495654_0014747_1246_2247 329
1136 3300046530 Ga0495654_0022694 Ga0495654_0022694_1932_2921 329
1137 3300046530 Ga0495654_0023244 Ga0495654_0023244_82_1071 329
1138 3300046530 Ga0495654_0037775 Ga0495654_0037775_687_1676 329
1139 3300046530 Ga0495654_0046495 Ga0495654_0046495_627_1634 329
1140 3300046530 Ga0495654_0058316 Ga0495654_0058316_609_1598 329
1141 3300046536 Ga0495587_0001552 Ga0495587_0001552_7421_8491 329
1142 3300046538 Ga0495609_0000412 Ga0495609_0000412_3364_4353 329
1143 3300046538 Ga0495609_0002027 Ga0495609_0002027_6752_7759 329
1144 3300046538 Ga0495609_0014786 Ga0495609_0014786_2648_3637 329
1145 3300046538 Ga0495609_0031227 Ga0495609_0031227_564_1571 329
1146 3300046538 Ga0495609_0034887 Ga0495609_0034887_733_1740 329
1147 3300046538 Ga0495609_0076195 Ga0495609_0076195_337_1344 329
1148 3300046542 Ga0495597_0000097 Ga0495597_0000097_16148_17137 329
1149 3300046542 Ga0495597_0001638 Ga0495597_0001638_8952_9959 329
1150 3300046542 Ga0495597_0009054 Ga0495597_0009054_1630_2619 329
1151 3300046542 Ga0495597_0014532 Ga0495597_0014532_789_1778 329
1152 3300046542 Ga0495597_0037741 Ga0495597_0037741_235_1224 329
1153 3300046542 Ga0495597_0041823 Ga0495597_0041823_493_1500 329
1154 3300046542 Ga0495597_0053787 Ga0495597_0053787_689_1678 329
1155 3300046557 Ga0495622_0001580 Ga0495622_0001580_4641_5630 329
1156 3300046557 Ga0495622_0001672 Ga0495622_0001672_5910_6917 329
1157 3300046557 Ga0495622_0020630 Ga0495622_0020630_24_1025 329
1158 3300046558 Ga0495633_0000134 Ga0495633_0000134_67325_68314 329
1159 3300046558 Ga0495633_0006724 Ga0495633_0006724_1553_2560 329
1160 3300046558 Ga0495633_0011897 Ga0495633_0011897_1484_2473 329
1161 3300046616 Ga0495668_0003494 Ga0495668_0003494_6737_7744 329
1162 3300046616 Ga0495668_0046545 Ga0495668_0046545_518_1525 329
1163 3300046642 Ga0495634_0004253 Ga0495634_0004253_8575_9645 329
1164 3300046642 Ga0495634_0062713 Ga0495634_0062713_641_1630 329
1165 3300046648 Ga0495611_0001167 Ga0495611_0001167_338_1327 329
1166 3300046648 Ga0495611_0002390 Ga0495611_0002390_1782_2789 329
1167 3300046648 Ga0495611_0034414 Ga0495611_0034414_582_1589 329
1168 3300046648 Ga0495611_0042599 Ga0495611_0042599_719_1708 329
1169 3300046660 Ga0495625_0008796 Ga0495625_0008796_1523_2530 329
1170 3300046660 Ga0495625_0010198 Ga0495625_0010198_5099_6106 329
1171 3300046660 Ga0495625_0031393 Ga0495625_0031393_1798_2787 329
1172 3300046660 Ga0495625_0052272 Ga0495625_0052272_602_1609 329
1173 3300046660 Ga0495625_0108718 Ga0495625_0108718_646_1653 329
1174 3300046660 Ga0495625_0139380 Ga0495625_0139380_87_1094 329
1175 3300046663 Ga0495635_0017323 Ga0495635_0017323_2526_3596 329
1176 3300046664 Ga0495659_0000880 Ga0495659_0000880_4688_5677 329
1177 3300046664 Ga0495659_0014805 Ga0495659_0014805_866_1855 329
1178 3300046665 Ga0495661_0000434 Ga0495661_0000434_31459_32448 329
1179 3300046665 Ga0495661_0000961 Ga0495661_0000961_16593_17582 329
1180 3300046665 Ga0495661_0009351 Ga0495661_0009351_73_1062 329
1181 3300046665 Ga0495661_0035857 Ga0495661_0035857_900_1889 329
1182 3300046665 Ga0495661_0049579 Ga0495661_0049579_1055_2044 329
1183 3300046665 Ga0495661_0050211 Ga0495661_0050211_869_1876 329
1184 3300046680 Ga0495646_0016771 Ga0495646_0016771_810_1799 329
1185 3300046680 Ga0495646_0079342 Ga0495646_0079342_546_1616 329
1186 3300046689 Ga0495613_0125086 Ga0495613_0125086_331_1338 329
1187 3300046690 Ga0495624_0004697 Ga0495624_0004697_2026_3015 329
1188 3300046691 Ga0495670_0001238 Ga0495670_0001238_6484_7491 329
1189 3300046691 Ga0495670_0003785 Ga0495670_0003785_4904_5893 329
1190 3300046691 Ga0495670_0016658 Ga0495670_0016658_1918_2919 329
1191 3300046691 Ga0495670_0028083 Ga0495670_0028083_443_1432 329
1192 3300046691 Ga0495670_0049170 Ga0495670_0049170_884_1873 329
1193 3300046692 Ga0495671_0007792 Ga0495671_0007792_1484_2473 329
1194 3300046692 Ga0495671_0019690 Ga0495671_0019690_1992_2999 329
1195 3300046692 Ga0495671_0033590 Ga0495671_0033590_1248_2237 329
1196 3300046692 Ga0495671_0046790 Ga0495671_0046790_533_1540 329
1197 3300046694 Ga0495649_0002318 Ga0495649_0002318_5729_6718 329
1198 3300046694 Ga0495649_0006225 Ga0495649_0006225_1432_2439 329
1199 3300046694 Ga0495649_0023398 Ga0495649_0023398_644_1651 329
1200 3300046694 Ga0495649_0024703 Ga0495649_0024703_1143_2132 329
1201 3300046694 Ga0495649_0029524 Ga0495649_0029524_1296_2303 329
1202 3300046694 Ga0495649_0079465 Ga0495649_0079465_550_1539 329
1203 3300046794 Ga0495589_0000447 Ga0495589_0000447_19817_20806 329
1204 3300046794 Ga0495589_0000771 Ga0495589_0000771_5939_6928 329
1205 3300046794 Ga0495589_0001962 Ga0495589_0001962_4887_5894 329
1206 3300046794 Ga0495589_0009641 Ga0495589_0009641_1345_2334 329
1207 3300046794 Ga0495589_0052246 Ga0495589_0052246_552_1559 329
1208 3300046794 Ga0495589_0061380 Ga0495589_0061380_432_1421 329
1209 3300046809 Ga0495600_0038024 Ga0495600_0038024_698_1687 329
1210 3300046810 Ga0495660_0002230 Ga0495660_0002230_6648_7637 329
1211 3300046810 Ga0495660_0005722 Ga0495660_0005722_2165_3154 329
1212 3300046810 Ga0495660_0006186 Ga0495660_0006186_3819_4826 329
1213 3300046810 Ga0495660_0006552 Ga0495660_0006552_4376_5383 329
1214 3300046810 Ga0495660_0007890 Ga0495660_0007890_1816_2823 329
1215 3300046810 Ga0495660_0012026 Ga0495660_0012026_1026_2015 329
1216 3300046810 Ga0495660_0017076 Ga0495660_0017076_1569_2576 329
1217 3300046810 Ga0495660_0024783 Ga0495660_0024783_1828_2835 329
1218 3300046810 Ga0495660_0055197 Ga0495660_0055197_491_1522 329
1219 3300047315 Ga0495581_0065403 Ga0495581_0065403_562_1551 329
1220 3300047317 Ga0495604_0039934 Ga0495604_0039934_1772_2761 329
1221 3300047318 Ga0495636_0113760 Ga0495636_0113760_27_1016 329
1222 3300047319 Ga0495674_0006015 Ga0495674_0006015_1554_2666 329
1223 3300047319 Ga0495674_0018109 Ga0495674_0018109_1616_2686 329
1224 3300047320 Ga0495672_0001160 Ga0495672_0001160_17865_18854 329
1225 3300047320 Ga0495672_0003146 Ga0495672_0003146_8863_9861 329
1226 3300047320 Ga0495672_0004514 Ga0495672_0004514_3986_4975 329
1227 3300047320 Ga0495672_0008825 Ga0495672_0008825_1743_2732 329
1228 3300047320 Ga0495672_0009039 Ga0495672_0009039_1978_2967 329
1229 3300047320 Ga0495672_0010698 Ga0495672_0010698_4182_5243 329
1230 3300047320 Ga0495672_0016503 Ga0495672_0016503_2003_2992 329
1231 3300047320 Ga0495672_0026505 Ga0495672_0026505_1737_2726 329
1232 3300047320 Ga0495672_0045302 Ga0495672_0045302_1497_2504 329
1233 3300047320 Ga0495672_0058990 Ga0495672_0058990_295_1284 329
1234 3300047321 Ga0495676_0013241 Ga0495676_0013241_1396_2385 329
1235 3300047321 Ga0495676_0013298 Ga0495676_0013298_5748_6755 329
1236 3300047322 Ga0495680_0026023 Ga0495680_0026023_2161_3150 329
1237 3300047322 Ga0495680_0073182 Ga0495680_0073182_1070_2086 329
1238 3300047323 Ga0495683_0000095 Ga0495683_0000095_30897_31886 329
1239 3300047323 Ga0495683_0000518 Ga0495683_0000518_5748_6737 329
1240 3300047323 Ga0495683_0035744 Ga0495683_0035744_778_1809 329
1241 3300047323 Ga0495683_0045918 Ga0495683_0045918_857_1864 329
1242 3300047323 Ga0495683_0069118 Ga0495683_0069118_712_1713 329
1243 3300047323 Ga0495683_0096408 Ga0495683_0096408_129_1136 329
1244 3300047443 Ga0495687_007816 Ga0495687_007816_592_1581 329
1245 3300047443 Ga0495687_014114 Ga0495687_014114_2691_3680 329
1246 3300047446 Ga0495679_000511 Ga0495679_000511_13663_14652 329
1247 3300047446 Ga0495679_004466 Ga0495679_004466_1296_2303 329
1248 3300047446 Ga0495679_008541 Ga0495679_008541_2140_3129 329
1249 3300047446 Ga0495679_012912 Ga0495679_012912_859_1866 329
1250 3300047446 Ga0495679_018784 Ga0495679_018784_562_1569 329
1251 3300047446 Ga0495679_034807 Ga0495679_034807_90_1097 329
1252 3300047469 Ga0495673_0000790 Ga0495673_0000790_22706_23695 329
1253 3300047469 Ga0495673_0000979 Ga0495673_0000979_9482_10471 329
1254 3300047469 Ga0495673_0002737 Ga0495673_0002737_2211_3200 329
1255 3300047469 Ga0495673_0005607 Ga0495673_0005607_1899_2906 329
1256 3300047469 Ga0495673_0020049 Ga0495673_0020049_642_1649 329
1257 3300047469 Ga0495673_0038270 Ga0495673_0038270_564_1571 329
1258 3300047469 Ga0495673_0042517 Ga0495673_0042517_552_1541 329
1259 3300047469 Ga0495673_0064290 Ga0495673_0064290_370_1377 329
1260 3300047470 Ga0495681_0001286 Ga0495681_0001286_11455_12444 329
1261 3300047470 Ga0495681_0003091 Ga0495681_0003091_4888_5895 329
1262 3300047470 Ga0495681_0003471 Ga0495681_0003471_4503_5510 329
1263 3300047470 Ga0495681_0005125 Ga0495681_0005125_2106_3095 329
1264 3300047470 Ga0495681_0012187 Ga0495681_0012187_3258_4247 329
1265 3300047470 Ga0495681_0019702 Ga0495681_0019702_1993_2982 329
1266 3300047470 Ga0495681_0020155 Ga0495681_0020155_1809_2816 329
1267 3300047470 Ga0495681_0041036 Ga0495681_0041036_659_1666 329
1268 3300047470 Ga0495681_0059365 Ga0495681_0059365_108_1097 329
1269 3300047470 Ga0495681_0101705 Ga0495681_0101705_246_1235 329
1270 3300047471 Ga0495684_0241063 Ga0495684_0241063_69_1088 329
1271 3300047472 Ga0495686_0016524 Ga0495686_0016524_1795_2802 329
1272 3300047673 Ga0495593_0005650 Ga0495593_0005650_1423_2412 329
1273 3300047673 Ga0495593_0053131 Ga0495593_0053131_708_1778 329
1274 3300048088 Ga0495602_0027272 Ga0495602_0027272_1621_2610 329
1275 3300048091 Ga0495626_0003121 Ga0495626_0003121_4712_5701 329
1276 3300048091 Ga0495626_0005316 Ga0495626_0005316_1515_2522 329
1277 3300048091 Ga0495626_0005972 Ga0495626_0005972_3555_4562 329
1278 3300048091 Ga0495626_0016847 Ga0495626_0016847_728_1717 329
1279 3300048091 Ga0495626_0018036 Ga0495626_0018036_637_1644 329
1280 3300048091 Ga0495626_0036071 Ga0495626_0036071_613_1620 329
1281 3300048091 Ga0495626_0039664 Ga0495626_0039664_719_1726 329
1282 3300048091 Ga0495626_0080728 Ga0495626_0080728_58_1047 329
1283 3300048905 Ga0496102_0003755 Ga0496102_0003755_7057_8127 329
1284 3300048906 Ga0496103_0008439 Ga0496103_0008439_617_1687 329
1285 3300048909 Ga0496106_0158213 Ga0496106_0158213_609_1598 329
1286 3300048913 Ga0496110_0062813 Ga0496110_0062813_265_1254 329
1287 3300048913 Ga0496110_0237594 Ga0496110_0237594_142_1131 329
1288 3300048915 Ga0496112_0066333 Ga0496112_0066333_1128_2159 329
1289 3300048917 Ga0496114_0055653 Ga0496114_0055653_1464_2453 329
1290 3300048917 Ga0496114_0366907 Ga0496114_0366907_232_1221 329
1291 3300048918 Ga0496115_0182534 Ga0496115_0182534_609_1679 329
1292 3300048919 Ga0496116_0000825 Ga0496116_0000825_14012_15031 329
1293 3300048919 Ga0496116_0003367 Ga0496116_0003367_5897_6904 329
1294 3300048919 Ga0496116_0039119 Ga0496116_0039119_872_1861 329
1295 3300048919 Ga0496116_0051786 Ga0496116_0051786_1399_2391 329
1296 3300048920 Ga0496117_0001387 Ga0496117_0001387_10578_11597 329
1297 3300048920 Ga0496117_0014011 Ga0496117_0014011_4158_5147 329
1298 3300048920 Ga0496117_0016798 Ga0496117_0016798_4077_5066 329
1299 3300048920 Ga0496117_0022003 Ga0496117_0022003_1484_2473 329
1300 3300048920 Ga0496117_0029470 Ga0496117_0029470_1098_2168 329
1301 3300048920 Ga0496117_0029800 Ga0496117_0029800_1457_2446 329
1302 3300048920 Ga0496117_0031689 Ga0496117_0031689_2199_3206 329
1303 3300048920 Ga0496117_0055024 Ga0496117_0055024_1559_2548 329
1304 3300048920 Ga0496117_0085127 Ga0496117_0085127_779_1768 329
1305 3300048921 Ga0496118_0006011 Ga0496118_0006011_739_1728 329
1306 3300048921 Ga0496118_0011347 Ga0496118_0011347_6852_7859 329
1307 3300048921 Ga0496118_0022862 Ga0496118_0022862_84_1073 329
1308 3300048921 Ga0496118_0031243 Ga0496118_0031243_1990_2979 329
1309 3300048921 Ga0496118_0031721 Ga0496118_0031721_724_1794 329
1310 3300048921 Ga0496118_0035603 Ga0496118_0035603_522_1511 329
1311 3300048921 Ga0496118_0197131 Ga0496118_0197131_28_1059 329
1312 3300048922 Ga0496119_0000380 Ga0496119_0000380_29842_30831 329
1313 3300048922 Ga0496119_0042611 Ga0496119_0042611_1501_2490 329
1314 3300048923 Ga0496120_0008249 Ga0496120_0008249_917_1906 329
1315 3300048923 Ga0496120_0023099 Ga0496120_0023099_2162_3151 329
1316 3300048923 Ga0496120_0047569 Ga0496120_0047569_387_1376 329
1317 3300048924 Ga0496121_0001836 Ga0496121_0001836_9468_10487 329
1318 3300048924 Ga0496121_0026975 Ga0496121_0026975_1415_2404 329
1319 3300048924 Ga0496121_0086691 Ga0496121_0086691_67_1056 329
1320 3300048924 Ga0496121_0157583 Ga0496121_0157583_197_1267 329
1321 3300048924 Ga0496121_0270359 Ga0496121_0270359_110_1099 329
1322 3300048925 Ga0496122_0002009 Ga0496122_0002009_24157_25146 329
1323 3300048925 Ga0496122_0004867 Ga0496122_0004867_2005_3024 329
1324 3300048925 Ga0496122_0008737 Ga0496122_0008737_6141_7130 329
1325 3300048925 Ga0496122_0053631 Ga0496122_0053631_1674_2663 329
1326 3300048925 Ga0496122_0058893 Ga0496122_0058893_849_1856 329
1327 3300048925 Ga0496122_0063427 Ga0496122_0063427_1609_2598 329
1328 3300048925 Ga0496122_0159896 Ga0496122_0159896_326_1315 329
1329 3300048925 Ga0496122_0190426 Ga0496122_0190426_131_1120 329
1330 3300048926 Ga0496123_0001758 Ga0496123_0001758_19180_20169 329
1331 3300048926 Ga0496123_0001969 Ga0496123_0001969_2017_3036 329
1332 3300048926 Ga0496123_0044446 Ga0496123_0044446_1674_2663 329
1333 3300048926 Ga0496123_0049534 Ga0496123_0049534_67_1056 329
1334 3300048926 Ga0496123_0050228 Ga0496123_0050228_121_1110 329
1335 3300048926 Ga0496123_0059156 Ga0496123_0059156_406_1395 329
1336 3300048926 Ga0496123_0080406 Ga0496123_0080406_44_1051 329
1337 3300048927 Ga0496124_0010733 Ga0496124_0010733_5758_6747 329
1338 3300048927 Ga0496124_0016387 Ga0496124_0016387_1929_2918 329
1339 3300048927 Ga0496124_0036358 Ga0496124_0036358_1992_2981 329
1340 3300048927 Ga0496124_0040666 Ga0496124_0040666_178_1167 329
1341 3300048927 Ga0496124_0077880 Ga0496124_0077880_133_1122 329
1342 3300048927 Ga0496124_0088457 Ga0496124_0088457_685_1674 329
1343 3300048928 Ga0496125_0001708 Ga0496125_0001708_29230_30225 329
1344 3300048928 Ga0496125_0002601 Ga0496125_0002601_5772_6761 329
1345 3300048928 Ga0496125_0004067 Ga0496125_0004067_13900_14889 329
1346 3300048928 Ga0496125_0015978 Ga0496125_0015978_4380_5369 329
1347 3300048928 Ga0496125_0024970 Ga0496125_0024970_2740_3729 329
1348 3300048928 Ga0496125_0040604 Ga0496125_0040604_2070_3059 329
1349 3300048928 Ga0496125_0057762 Ga0496125_0057762_63_1052 329
1350 3300048928 Ga0496125_0166633 Ga0496125_0166633_71_1060 329
1351 3300048928 Ga0496125_0260320 Ga0496125_0260320_28_1017 329
1352 3300048929 Ga0496126_0077271 Ga0496126_0077271_575_1606 329
1353 3300048929 Ga0496126_0125613 Ga0496126_0125613_1046_2116 329
1354 3300048929 Ga0496126_0149185 Ga0496126_0149185_931_1920 329
1355 3300049459 Ga0495678_000108 Ga0495678_000108_31487_32476 329
1356 3300049459 Ga0495678_002964 Ga0495678_002964_5126_6115 329
1357 3300049459 Ga0495678_003513 Ga0495678_003513_3925_4914 329
1358 3300049459 Ga0495678_004960 Ga0495678_004960_5643_6650 329
1359 3300049459 Ga0495678_014005 Ga0495678_014005_858_1865 329
1360 3300049459 Ga0495678_015411 Ga0495678_015411_1525_2514 329
1361 3300049459 Ga0495678_016012 Ga0495678_016012_1829_2836 329
1362 3300049459 Ga0495678_016355 Ga0495678_016355_881_1888 329
1363 3300049459 Ga0495678_024087 Ga0495678_024087_673_1704 329
1364 3300049459 Ga0495678_027380 Ga0495678_027380_895_1902 329
1365 3300049459 Ga0495678_031546 Ga0495678_031546_514_1548 329
1366 3300049459 Ga0495678_040676 Ga0495678_040676_201_1208 329
1367 3300049460 Ga0495682_0009522 Ga0495682_0009522_1650_2657 329
1368 3300049460 Ga0495682_0011582 Ga0495682_0011582_952_1941 329
1369 3300049460 Ga0495682_0012034 Ga0495682_0012034_1545_2552 329
1370 3300049571 Ga0501034_0000692 Ga0501034_0000692_45001_45990 329
1371 3300049662 Ga0501222_005762 Ga0501222_005762_254_1243 329
1372 3300049742 Ga0501080_0282518 Ga0501080_0282518_396_1403 329
1373 3300049744 Ga0501083_0163911 Ga0501083_0163911_182_1177 329
1374 3300053111 Ga0500572_002588 Ga0500572_002588_1559_2566 329
1375 3300053135 Ga0500659_0006736 Ga0500659_0006736_3804_4793 329
1376 3300053140 Ga0500573_0006921 Ga0500573_0006921_4021_5010 329
1377 3300053161 Ga0500634_0037027 Ga0500634_0037027_32_1021 329
1378 iso_pu_bacteria 2512047018 2512328488 329
1379 iso_pu_bacteria 2554235341 2555671469 329
1380 iso_pu_bacteria 2582580891 2583793931 329
1381 iso_pu_bacteria 2883087390 2883092079 329
1382 iso_pu_bacteria 640427133 640486163 329
1383 iso_pu_bacteria 8055770955 8055775471 329
1384 2124908027 MRS2a_Contig_120 MRS2a_00022400 330
1385 3300003791 Ga0055530_10016313 Ga0055530_100163133 330
1386 3300005288 Ga0065714_10000330 Ga0065714_100003307 330
1387 3300005289 Ga0065704_10008505 Ga0065704_100085052 330
1388 3300005289 Ga0065704_10108857 Ga0065704_101088572 330
1389 3300005290 Ga0065712_10004185 Ga0065712_100041857 330
1390 3300005937 Ga0081455_10006895 Ga0081455_100068951 330
1391 3300005983 Ga0081540_1065174 Ga0081540_10651742 330
1392 3300006028 Ga0070717_10249014 Ga0070717_102490141 330
1393 3300006051 Ga0075364_10042831 Ga0075364_100428311 330
1394 3300006051 Ga0075364_10105228 Ga0075364_101052282 330
1395 3300006058 Ga0075432_10012010 Ga0075432_100120102 330
1396 3300006058 Ga0075432_10024079 Ga0075432_100240792 330
1397 3300006058 Ga0075432_10083102 Ga0075432_100831021 330
1398 3300006177 Ga0075362_10047569 Ga0075362_100475692 330
1399 3300006844 Ga0075428_100011312 Ga0075428_1000113122 330
1400 3300006914 Ga0075436_100101739 Ga0075436_1001017391 330
1401 3300006914 Ga0075436_100172035 Ga0075436_1001720351 330
1402 3300006946 Ga0079104_1000374 Ga0079104_100037412 330
1403 3300009011 Ga0105251_10005549 Ga0105251_100055495 330
1404 3300009036 Ga0105244_10097605 Ga0105244_100976052 330
1405 3300009148 Ga0105243_10071214 Ga0105243_100712142 330
1406 3300009176 Ga0105242_10382587 Ga0105242_103825872 330
1407 3300011119 Ga0105246_10038366 Ga0105246_100383661 330
1408 3300013100 Ga0157373_10042835 Ga0157373_100428352 330
1409 3300014325 Ga0163163_10028117 Ga0163163_100281175 330
1410 3300014497 Ga0182008_10004519 Ga0182008_100045194 330
1411 3300014497 Ga0182008_10016035 Ga0182008_100160352 330
1412 3300014497 Ga0182008_10048881 Ga0182008_100488812 330
1413 3300015265 Ga0182005_1029400 Ga0182005_10294001 330
1414 3300017792 Ga0163161_10212972 Ga0163161_102129722 330
1415 3300025292 Ga0209676_1007011 Ga0209676_10070119 330
1416 3300025298 Ga0209050_1000279 Ga0209050_100027930 330
1417 3300025298 Ga0209050_1001030 Ga0209050_100103013 330
1418 3300025303 Ga0209051_1020153 Ga0209051_10201531 330
1419 3300025728 Ga0207655_1023439 Ga0207655_10234392 330
1420 3300025728 Ga0207655_1044493 Ga0207655_10444932 330
1421 3300025728 Ga0207655_1050415 Ga0207655_10504152 330
1422 3300025735 Ga0207713_1004774 Ga0207713_10047745 330
1423 3300025735 Ga0207713_1005720 Ga0207713_10057204 330
1424 3300025893 Ga0207682_10030553 Ga0207682_100305532 330
1425 3300025928 Ga0207700_10053947 Ga0207700_100539473 330
1426 3300025935 Ga0207709_10027350 Ga0207709_100273502 330
1427 3300027111 Ga0209281_1000363 Ga0209281_100036334 330
1428 3300027907 Ga0207428_10018636 Ga0207428_100186364 330
1429 3300027907 Ga0207428_10022914 Ga0207428_100229142 330
1430 3300027907 Ga0207428_10064191 Ga0207428_100641912 330
1431 3300027907 Ga0207428_10152155 Ga0207428_101521552 330
1432 3300031344 Ga0265316_10057920 Ga0265316_100579203 330
1433 3300031548 Ga0307408_100000258 Ga0307408_10000025818 330
1434 3300031911 Ga0307412_10017511 Ga0307412_100175113 330
1435 3300032004 Ga0307414_10263482 Ga0307414_102634821 330
1436 3300032005 Ga0307411_10170724 Ga0307411_101707242 330
1437 3300032126 Ga0307415_100027497 Ga0307415_1000274974 330
1438 3300037418 Ga0395900_0055459 Ga0395900_0055459_2177_3196 330
1439 3300037471 Ga0395905_0003678 Ga0395905_0003678_12083_13102 330
1440 3300037471 Ga0395905_0009396 Ga0395905_0009396_3217_4236 330
1441 3300037471 Ga0395905_0010241 Ga0395905_0010241_2893_3912 330
1442 3300037471 Ga0395905_0321207 Ga0395905_0321207_335_1387 330
1443 3300037471 Ga0395905_0451643 Ga0395905_0451643_93_1112 330
1444 3300041405 Ga0439438_001081 Ga0439438_001081_1381_2373 330
1445 3300041405 Ga0439438_009641 Ga0439438_009641_1552_2544 330
1446 3300041405 Ga0439438_012124 Ga0439438_012124_1497_2534 330
1447 3300041405 Ga0439438_018179 Ga0439438_018179_291_1283 330
1448 3300041405 Ga0439438_040394 Ga0439438_040394_36_1028 330
1449 3300041407 Ga0439447_000861 Ga0439447_000861_6538_7530 330
1450 3300041407 Ga0439447_004405 Ga0439447_004405_2357_3394 330
1451 3300041407 Ga0439447_017548 Ga0439447_017548_813_1805 330
1452 3300041407 Ga0439447_030845 Ga0439447_030845_142_1200 330
1453 3300041411 Ga0439466_0004846 Ga0439466_0004846_63_1121 330
1454 3300041411 Ga0439466_0009355 Ga0439466_0009355_352_1344 330
1455 3300041411 Ga0439466_0012467 Ga0439466_0012467_600_1592 330
1456 3300042006 Ga0439432_004712 Ga0439432_004712_2702_3694 330
1457 3300042006 Ga0439432_013859 Ga0439432_013859_1292_2284 330
1458 3300042009 Ga0439451_013115 Ga0439451_013115_392_1384 330
1459 3300042010 Ga0439452_000387 Ga0439452_000387_19038_20030 330
1460 3300042010 Ga0439452_000902 Ga0439452_000902_4406_5398 330
1461 3300042010 Ga0439452_003120 Ga0439452_003120_3591_4583 330
1462 3300042010 Ga0439452_013230 Ga0439452_013230_213_1205 330
1463 3300042010 Ga0439452_024936 Ga0439452_024936_245_1237 330
1464 3300042013 Ga0439456_006368 Ga0439456_006368_260_1252 330
1465 3300042013 Ga0439456_026847 Ga0439456_026847_16_1008 330
1466 3300042016 Ga0439463_024219 Ga0439463_024219_418_1410 330
1467 3300042115 Ga0450911_002661 Ga0450911_002661_1998_3020 330
1468 3300042115 Ga0450911_004135 Ga0450911_004135_1218_2255 330
1469 3300042115 Ga0450911_004457 Ga0450911_004457_700_1692 330
1470 3300042122 Ga0450920_001490 Ga0450920_001490_1396_2433 330
1471 3300042124 Ga0450922_000524 Ga0450922_000524_1362_2399 330
1472 3300042137 Ga0450902_002208 Ga0450902_002208_378_1370 330
1473 3300042137 Ga0450902_018125 Ga0450902_018125_19_1011 330
1474 3300042138 Ga0450903_002755 Ga0450903_002755_843_1835 330
1475 3300042138 Ga0450903_005900 Ga0450903_005900_332_1324 330
1476 3300042138 Ga0450903_009029 Ga0450903_009029_322_1314 330
1477 3300042145 Ga0450906_005166 Ga0450906_005166_1324_2361 330
1478 3300042146 Ga0450907_000150 Ga0450907_000150_6684_7676 330
1479 3300042146 Ga0450907_000551 Ga0450907_000551_2537_3574 330
1480 3300042156 Ga0439446_0016919 Ga0439446_0016919_283_1275 330
1481 3300042185 Ga0450909_010176 Ga0450909_010176_212_1204 330
1482 3300042435 Ga0439434_0001826 Ga0439434_0001826_992_1984 330
1483 3300042876 Ga0451577_0163721 Ga0451577_0163721_142_1158 330
1484 3300044712 Ga0453684_0022287 Ga0453684_0022287_4668_5699 330
1485 3300046452 Ga0495617_001369 Ga0495617_001369_1909_2946 330
1486 3300046452 Ga0495617_004672 Ga0495617_004672_569_1561 330
1487 3300046452 Ga0495617_010219 Ga0495617_010219_1095_2162 330
1488 3300046452 Ga0495617_032926 Ga0495617_032926_158_1177 330
1489 3300046453 Ga0495627_029220 Ga0495627_029220_509_1576 330
1490 3300046455 Ga0495603_0001173 Ga0495603_0001173_1369_2373 330
1491 3300046457 Ga0495590_0002014 Ga0495590_0002014_2071_3063 330
1492 3300046457 Ga0495590_0002963 Ga0495590_0002963_320_1357 330
1493 3300046458 Ga0495591_000583 Ga0495591_000583_19454_20446 330
1494 3300046458 Ga0495591_017861 Ga0495591_017861_92_1084 330
1495 3300046458 Ga0495591_044538 Ga0495591_044538_179_1171 330
1496 3300046460 Ga0495638_0002845 Ga0495638_0002845_4667_5659 330
1497 3300046460 Ga0495638_0022694 Ga0495638_0022694_197_1189 330
1498 3300046460 Ga0495638_0038187 Ga0495638_0038187_509_1690 330
1499 3300046460 Ga0495638_0041879 Ga0495638_0041879_32_1024 330
1500 3300046460 Ga0495638_0043307 Ga0495638_0043307_357_1349 330
1501 3300046460 Ga0495638_0043740 Ga0495638_0043740_729_1742 330
1502 3300046460 Ga0495638_0058258 Ga0495638_0058258_1019_2011 330
1503 3300046460 Ga0495638_0077827 Ga0495638_0077827_817_1809 330
1504 3300046460 Ga0495638_0123636 Ga0495638_0123636_428_1420 330
1505 3300046460 Ga0495638_0183243 Ga0495638_0183243_146_1138 330
1506 3300046471 Ga0495650_0008917 Ga0495650_0008917_3131_4123 330
1507 3300046471 Ga0495650_0022495 Ga0495650_0022495_32_1024 330
1508 3300046471 Ga0495650_0041584 Ga0495650_0041584_194_1186 330
1509 3300046473 Ga0495582_0023355 Ga0495582_0023355_964_1956 330
1510 3300046474 Ga0495605_0002655 Ga0495605_0002655_4165_5202 330
1511 3300046474 Ga0495605_0016129 Ga0495605_0016129_2495_3487 330
1512 3300046474 Ga0495605_0090915 Ga0495605_0090915_373_1365 330
1513 3300046475 Ga0495639_0022411 Ga0495639_0022411_734_1726 330
1514 3300046491 Ga0495584_0005124 Ga0495584_0005124_3012_4004 330
1515 3300046491 Ga0495584_0023593 Ga0495584_0023593_595_1587 330
1516 3300046491 Ga0495584_0030919 Ga0495584_0030919_302_1294 330
1517 3300046491 Ga0495584_0033432 Ga0495584_0033432_1190_2182 330
1518 3300046491 Ga0495584_0040836 Ga0495584_0040836_354_1346 330
1519 3300046491 Ga0495584_0121403 Ga0495584_0121403_174_1166 330
1520 3300046492 Ga0495585_0003321 Ga0495585_0003321_1333_2325 330
1521 3300046492 Ga0495585_0021336 Ga0495585_0021336_1689_2681 330
1522 3300046492 Ga0495585_0036338 Ga0495585_0036338_1510_2502 330
1523 3300046492 Ga0495585_0050344 Ga0495585_0050344_1084_2151 330
1524 3300046499 Ga0495594_0061306 Ga0495594_0061306_510_1502 330
1525 3300046499 Ga0495594_0067401 Ga0495594_0067401_85_1077 330
1526 3300046500 Ga0495596_0000417 Ga0495596_0000417_18828_19820 330
1527 3300046501 Ga0495607_0012159 Ga0495607_0012159_1134_2126 330
1528 3300046501 Ga0495607_0024678 Ga0495607_0024678_1271_2263 330
1529 3300046501 Ga0495607_0168276 Ga0495607_0168276_77_1069 330
1530 3300046506 Ga0495583_0002113 Ga0495583_0002113_12813_13805 330
1531 3300046506 Ga0495583_0006007 Ga0495583_0006007_213_1205 330
1532 3300046507 Ga0495606_0004874 Ga0495606_0004874_6694_7686 330
1533 3300046507 Ga0495606_0012961 Ga0495606_0012961_4696_5688 330
1534 3300046507 Ga0495606_0019626 Ga0495606_0019626_2316_3308 330
1535 3300046507 Ga0495606_0132984 Ga0495606_0132984_255_1247 330
1536 3300046512 Ga0495610_0006156 Ga0495610_0006156_5728_6774 330
1537 3300046512 Ga0495610_0012671 Ga0495610_0012671_1420_2412 330
1538 3300046512 Ga0495610_0018794 Ga0495610_0018794_1618_2610 330
1539 3300046512 Ga0495610_0050580 Ga0495610_0050580_382_1374 330
1540 3300046513 Ga0495616_0015840 Ga0495616_0015840_232_1224 330
1541 3300046513 Ga0495616_0022980 Ga0495616_0022980_1191_2183 330
1542 3300046513 Ga0495616_0046285 Ga0495616_0046285_95_1162 330
1543 3300046513 Ga0495616_0094665 Ga0495616_0094665_182_1174 330
1544 3300046515 Ga0495620_0027962 Ga0495620_0027962_1502_2494 330
1545 3300046515 Ga0495620_0028903 Ga0495620_0028903_91_1083 330
1546 3300046515 Ga0495620_0030977 Ga0495620_0030977_613_1605 330
1547 3300046516 Ga0495628_0124647 Ga0495628_0124647_282_1274 330
1548 3300046517 Ga0495630_0059672 Ga0495630_0059672_121_1113 330
1549 3300046518 Ga0495631_0050644 Ga0495631_0050644_380_1372 330
1550 3300046518 Ga0495631_0075043 Ga0495631_0075043_345_1337 330
1551 3300046519 Ga0495632_0003740 Ga0495632_0003740_8691_9683 330
1552 3300046519 Ga0495632_0022411 Ga0495632_0022411_1691_2683 330
1553 3300046519 Ga0495632_0024132 Ga0495632_0024132_1745_2737 330
1554 3300046519 Ga0495632_0027803 Ga0495632_0027803_585_1577 330
1555 3300046519 Ga0495632_0043909 Ga0495632_0043909_165_1157 330
1556 3300046519 Ga0495632_0089788 Ga0495632_0089788_143_1156 330
1557 3300046519 Ga0495632_0144821 Ga0495632_0144821_77_1069 330
1558 3300046520 Ga0495637_0003572 Ga0495637_0003572_5887_6879 330
1559 3300046520 Ga0495637_0003788 Ga0495637_0003788_1448_2440 330
1560 3300046520 Ga0495637_0014418 Ga0495637_0014418_1533_2600 330
1561 3300046520 Ga0495637_0017782 Ga0495637_0017782_112_1104 330
1562 3300046520 Ga0495637_0044726 Ga0495637_0044726_263_1255 330
1563 3300046522 Ga0495643_0009349 Ga0495643_0009349_1588_2580 330
1564 3300046522 Ga0495643_0043071 Ga0495643_0043071_1389_2381 330
1565 3300046522 Ga0495643_0071467 Ga0495643_0071467_149_1141 330
1566 3300046523 Ga0495644_0000931 Ga0495644_0000931_6436_7428 330
1567 3300046523 Ga0495644_0004035 Ga0495644_0004035_2500_3492 330
1568 3300046523 Ga0495644_0007984 Ga0495644_0007984_2627_3694 330
1569 3300046523 Ga0495644_0053304 Ga0495644_0053304_429_1421 330
1570 3300046523 Ga0495644_0061190 Ga0495644_0061190_275_1267 330
1571 3300046524 Ga0495648_0012418 Ga0495648_0012418_672_1664 330
1572 3300046524 Ga0495648_0024066 Ga0495648_0024066_1416_2453 330
1573 3300046524 Ga0495648_0058881 Ga0495648_0058881_1071_2063 330
1574 3300046524 Ga0495648_0060300 Ga0495648_0060300_235_1275 330
1575 3300046524 Ga0495648_0076387 Ga0495648_0076387_546_1538 330
1576 3300046524 Ga0495648_0091035 Ga0495648_0091035_582_1601 330
1577 3300046524 Ga0495648_0099124 Ga0495648_0099124_159_1151 330
1578 3300046524 Ga0495648_0103052 Ga0495648_0103052_128_1120 330
1579 3300046526 Ga0495666_0014798 Ga0495666_0014798_1661_2653 330
1580 3300046528 Ga0495642_0000324 Ga0495642_0000324_19215_20207 330
1581 3300046528 Ga0495642_0003106 Ga0495642_0003106_1332_2324 330
1582 3300046530 Ga0495654_0002384 Ga0495654_0002384_6994_7986 330
1583 3300046530 Ga0495654_0011815 Ga0495654_0011815_1946_2956 330
1584 3300046530 Ga0495654_0033992 Ga0495654_0033992_177_1169 330
1585 3300046530 Ga0495654_0038555 Ga0495654_0038555_1294_2286 330
1586 3300046530 Ga0495654_0048135 Ga0495654_0048135_177_1169 330
1587 3300046530 Ga0495654_0097278 Ga0495654_0097278_167_1159 330
1588 3300046535 Ga0495586_0035029 Ga0495586_0035029_739_1731 330
1589 3300046536 Ga0495587_0040276 Ga0495587_0040276_896_1888 330
1590 3300046542 Ga0495597_0005980 Ga0495597_0005980_4286_5278 330
1591 3300046542 Ga0495597_0014297 Ga0495597_0014297_568_1560 330
1592 3300046542 Ga0495597_0022179 Ga0495597_0022179_245_1237 330
1593 3300046542 Ga0495597_0028619 Ga0495597_0028619_86_1153 330
1594 3300046542 Ga0495597_0031562 Ga0495597_0031562_46_1038 330
1595 3300046542 Ga0495597_0058525 Ga0495597_0058525_481_1473 330
1596 3300046542 Ga0495597_0080423 Ga0495597_0080423_222_1214 330
1597 3300046543 Ga0495645_0057903 Ga0495645_0057903_636_1628 330
1598 3300046557 Ga0495622_0002250 Ga0495622_0002250_8383_9375 330
1599 3300046615 Ga0495656_0002042 Ga0495656_0002042_396_1388 330
1600 3300046616 Ga0495668_0003191 Ga0495668_0003191_4148_5140 330
1601 3300046660 Ga0495625_0020848 Ga0495625_0020848_1438_2430 330
1602 3300046660 Ga0495625_0022935 Ga0495625_0022935_2075_3067 330
1603 3300046660 Ga0495625_0055240 Ga0495625_0055240_1268_2335 330
1604 3300046660 Ga0495625_0206656 Ga0495625_0206656_128_1141 330
1605 3300046663 Ga0495635_0017140 Ga0495635_0017140_3933_4925 330
1606 3300046664 Ga0495659_0041933 Ga0495659_0041933_394_1386 330
1607 3300046665 Ga0495661_0020927 Ga0495661_0020927_1899_2966 330
1608 3300046665 Ga0495661_0038010 Ga0495661_0038010_572_1564 330
1609 3300046665 Ga0495661_0050909 Ga0495661_0050909_139_1131 330
1610 3300046674 Ga0495588_0013970 Ga0495588_0013970_737_1729 330
1611 3300046674 Ga0495588_0014483 Ga0495588_0014483_1638_2630 330
1612 3300046679 Ga0495623_0005516 Ga0495623_0005516_1656_2648 330
1613 3300046680 Ga0495646_0010680 Ga0495646_0010680_3104_4096 330
1614 3300046684 Ga0495669_0006925 Ga0495669_0006925_436_1473 330
1615 3300046689 Ga0495613_0061386 Ga0495613_0061386_261_1253 330
1616 3300046691 Ga0495670_0002916 Ga0495670_0002916_5374_6441 330
1617 3300046691 Ga0495670_0016065 Ga0495670_0016065_1583_2575 330
1618 3300046691 Ga0495670_0036366 Ga0495670_0036366_280_1299 330
1619 3300046691 Ga0495670_0139802 Ga0495670_0139802_181_1173 330
1620 3300046691 Ga0495670_0148032 Ga0495670_0148032_117_1109 330
1621 3300046692 Ga0495671_0003100 Ga0495671_0003100_2835_3827 330
1622 3300046692 Ga0495671_0004392 Ga0495671_0004392_2922_3926 330
1623 3300046692 Ga0495671_0022847 Ga0495671_0022847_193_1260 330
1624 3300046692 Ga0495671_0029469 Ga0495671_0029469_965_1957 330
1625 3300046692 Ga0495671_0070407 Ga0495671_0070407_163_1155 330
1626 3300046692 Ga0495671_0086623 Ga0495671_0086623_244_1236 330
1627 3300046692 Ga0495671_0117081 Ga0495671_0117081_77_1069 330
1628 3300046694 Ga0495649_0032639 Ga0495649_0032639_1246_2238 330
1629 3300046694 Ga0495649_0044463 Ga0495649_0044463_841_1833 330
1630 3300046694 Ga0495649_0099761 Ga0495649_0099761_449_1441 330
1631 3300046694 Ga0495649_0128680 Ga0495649_0128680_202_1239 330
1632 3300046794 Ga0495589_0004203 Ga0495589_0004203_2182_3174 330
1633 3300046794 Ga0495589_0011083 Ga0495589_0011083_1975_2967 330
1634 3300046794 Ga0495589_0016468 Ga0495589_0016468_1455_2447 330
1635 3300046794 Ga0495589_0030092 Ga0495589_0030092_29_1066 330
1636 3300046809 Ga0495600_0079784 Ga0495600_0079784_1084_2076 330
1637 3300046810 Ga0495660_0031821 Ga0495660_0031821_1162_2154 330
1638 3300046810 Ga0495660_0034262 Ga0495660_0034262_1816_2808 330
1639 3300046810 Ga0495660_0051114 Ga0495660_0051114_1049_2116 330
1640 3300046810 Ga0495660_0125275 Ga0495660_0125275_147_1139 330
1641 3300047315 Ga0495581_0034967 Ga0495581_0034967_983_1975 330
1642 3300047317 Ga0495604_0015101 Ga0495604_0015101_4093_5085 330
1643 3300047317 Ga0495604_0154785 Ga0495604_0154785_224_1216 330
1644 3300047320 Ga0495672_0005570 Ga0495672_0005570_8278_9315 330
1645 3300047320 Ga0495672_0025656 Ga0495672_0025656_1327_2394 330
1646 3300047320 Ga0495672_0032346 Ga0495672_0032346_1451_2464 330
1647 3300047320 Ga0495672_0045814 Ga0495672_0045814_574_1611 330
1648 3300047320 Ga0495672_0114778 Ga0495672_0114778_155_1147 330
1649 3300047320 Ga0495672_0139855 Ga0495672_0139855_147_1139 330
1650 3300047322 Ga0495680_0135828 Ga0495680_0135828_503_1495 330
1651 3300047323 Ga0495683_0005438 Ga0495683_0005438_4253_5245 330
1652 3300047323 Ga0495683_0010889 Ga0495683_0010889_1484_2476 330
1653 3300047323 Ga0495683_0022912 Ga0495683_0022912_945_1937 330
1654 3300047323 Ga0495683_0057272 Ga0495683_0057272_663_1730 330
1655 3300047443 Ga0495687_003637 Ga0495687_003637_8919_9938 330
1656 3300047445 Ga0495677_0008145 Ga0495677_0008145_2125_3117 330
1657 3300047446 Ga0495679_029101 Ga0495679_029101_201_1196 330
1658 3300047446 Ga0495679_050817 Ga0495679_050817_53_1045 330
1659 3300047447 Ga0495685_058451 Ga0495685_058451_286_1278 330
1660 3300047469 Ga0495673_0001198 Ga0495673_0001198_19181_20173 330
1661 3300047469 Ga0495673_0001605 Ga0495673_0001605_4488_5480 330
1662 3300047469 Ga0495673_0009482 Ga0495673_0009482_232_1224 330
1663 3300047469 Ga0495673_0022149 Ga0495673_0022149_1485_2504 330
1664 3300047469 Ga0495673_0040801 Ga0495673_0040801_98_1135 330
1665 3300047469 Ga0495673_0049216 Ga0495673_0049216_717_1709 330
1666 3300047469 Ga0495673_0054301 Ga0495673_0054301_351_1343 330
1667 3300047469 Ga0495673_0062620 Ga0495673_0062620_98_1090 330
1668 3300047469 Ga0495673_0069974 Ga0495673_0069974_295_1362 330
1669 3300047470 Ga0495681_0012740 Ga0495681_0012740_2411_3448 330
1670 3300047470 Ga0495681_0013863 Ga0495681_0013863_1611_2603 330
1671 3300047470 Ga0495681_0015876 Ga0495681_0015876_1392_2459 330
1672 3300047470 Ga0495681_0027964 Ga0495681_0027964_1886_2878 330
1673 3300047470 Ga0495681_0045766 Ga0495681_0045766_801_1793 330
1674 3300047471 Ga0495684_0063127 Ga0495684_0063127_469_1461 330
1675 3300047472 Ga0495686_0013800 Ga0495686_0013800_794_1786 330
1676 3300047472 Ga0495686_0046404 Ga0495686_0046404_159_1151 330
1677 3300047472 Ga0495686_0046757 Ga0495686_0046757_1027_2019 330
1678 3300047673 Ga0495593_0056236 Ga0495593_0056236_337_1329 330
1679 3300047673 Ga0495593_0147256 Ga0495593_0147256_97_1089 330
1680 3300048091 Ga0495626_0000869 Ga0495626_0000869_6568_7560 330
1681 3300048091 Ga0495626_0001573 Ga0495626_0001573_8254_9246 330
1682 3300048091 Ga0495626_0002679 Ga0495626_0002679_4461_5453 330
1683 3300048091 Ga0495626_0003172 Ga0495626_0003172_8293_9288 330
1684 3300048091 Ga0495626_0008011 Ga0495626_0008011_1245_2291 330
1685 3300048091 Ga0495626_0009785 Ga0495626_0009785_3808_4800 330
1686 3300048915 Ga0496112_0551740 Ga0496112_0551740_17_1036 330
1687 3300048919 Ga0496116_0000017 Ga0496116_0000017_165598_166608 330
1688 3300048920 Ga0496117_0050688 Ga0496117_0050688_38_1048 330
1689 3300048921 Ga0496118_0009157 Ga0496118_0009157_932_1942 330
1690 3300048921 Ga0496118_0079811 Ga0496118_0079811_1109_2101 330
1691 3300048924 Ga0496121_0003439 Ga0496121_0003439_3676_4686 330
1692 3300048925 Ga0496122_0002967 Ga0496122_0002967_7587_8597 330
1693 3300048926 Ga0496123_0003732 Ga0496123_0003732_10167_11177 330
1694 3300048927 Ga0496124_0002197 Ga0496124_0002197_4475_5485 330
1695 3300048927 Ga0496124_0008144 Ga0496124_0008144_8238_9230 330
1696 3300048927 Ga0496124_0009954 Ga0496124_0009954_5129_6139 330
1697 3300048927 Ga0496124_0048703 Ga0496124_0048703_207_1199 330
1698 3300048928 Ga0496125_0006782 Ga0496125_0006782_6975_7985 330
1699 3300048928 Ga0496125_0033279 Ga0496125_0033279_3074_4066 330
1700 3300048929 Ga0496126_0002106 Ga0496126_0002106_1345_2355 330
1701 3300049459 Ga0495678_041608 Ga0495678_041608_116_1108 330
1702 3300049459 Ga0495678_053268 Ga0495678_053268_50_1042 330
1703 3300049459 Ga0495678_058387 Ga0495678_058387_179_1171 330
1704 3300049460 Ga0495682_0014986 Ga0495682_0014986_1221_2213 330
1705 3300049515 Ga0501292_000011 Ga0501292_000011_17403_18464 330
1706 3300049517 Ga0501294_000347 Ga0501294_000347_3966_5027 330
1707 3300049523 Ga0501300_000069 Ga0501300_000069_8890_9951 330
1708 3300049576 Ga0501040_0249286 Ga0501040_0249286_109_1173 330
1709 3300049577 Ga0501041_0095854 Ga0501041_0095854_110_1162 330
1710 3300049591 Ga0501075_0147628 Ga0501075_0147628_235_1287 330
1711 3300049652 Ga0501202_001132 Ga0501202_001132_1219_2280 330
1712 3300049662 Ga0501222_001390 Ga0501222_001390_1158_2219 330
1713 3300049663 Ga0501223_000035 Ga0501223_000035_19461_20486 330
1714 3300049663 Ga0501223_000477 Ga0501223_000477_3188_4249 330
1715 3300049664 Ga0501224_000029 Ga0501224_000029_19511_20536 330
1716 3300049668 Ga0501233_003337 Ga0501233_003337_1253_2314 330
1717 3300049669 Ga0501235_004886 Ga0501235_004886_1643_2704 330
1718 3300049688 Ga0501259_000102 Ga0501259_000102_9475_10536 330
1719 3300049690 Ga0501261_000002 Ga0501261_000002_59666_60727 330
1720 3300049705 Ga0501225_0000026 Ga0501225_0000026_27478_28503 330
1721 3300049705 Ga0501225_0015943 Ga0501225_0015943_817_1878 330
1722 3300049708 Ga0501245_000127 Ga0501245_000127_3267_4328 330
1723 3300049775 Ga0501279_000002 Ga0501279_000002_53591_54652 330
1724 3300049776 Ga0501280_000039 Ga0501280_000039_35445_36506 330
1725 3300049777 Ga0501281_00158 Ga0501281_00158_1632_2693 330
1726 3300049779 Ga0501283_000479 Ga0501283_000479_1785_2846 330
1727 3300049853 Ga0501226_000052 Ga0501226_000052_23979_25004 330
1728 3300050489 nmdc:mga03683_13495_c1 nmdc:mga03683_13495_c1_1527_2519 330
1729 3300050491 nmdc:mga00v17_139627_c1 nmdc:mga00v17_139627_c1_150_1187 330
1730 3300050491 nmdc:mga00v17_184678_c1 nmdc:mga00v17_184678_c1_41_1033 330
1731 3300050491 nmdc:mga00v17_40492_c1 nmdc:mga00v17_40492_c1_370_1362 330
1732 3300053085 Ga0495619_0026580 Ga0495619_0026580_2018_3016 330
1733 3300053116 Ga0500592_000011 Ga0500592_000011_67354_68364 330
1734 3300053122 Ga0500608_000587 Ga0500608_000587_9823_10821 330
1735 3300053125 Ga0500618_000316 Ga0500618_000316_19792_20787 330
1736 3300053139 Ga0500568_0051705 Ga0500568_0051705_20_1012 330
1737 3300053158 Ga0500627_0000050 Ga0500627_0000050_3808_4818 330
1738 3300061734 Ga0530510_0363122 Ga0530510_0363122_17_1069 330
1739 iso_pu_bacteria 2808606382 2808957123 330

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00389

2-Hacid_dh

D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain

69

394

0.96

PF02826

2-Hacid_dh_C

D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain

176

363

0.94

PF03446

NAD_binding_2

NAD binding domain of 6-phosphogluconate dehydrogenase

212

330

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
8grv-assembly1.cif.gz_A dictyostelium discoideum lactate dehydrogenase (dicldha)with nad 0.9691 1 328
5z1z-assembly1.cif.gz_D the apo-structure of d-lactate dehydrogenase from escherichia coli 0.9654 1 328
5z1z-assembly1.cif.gz_D the apo-structure of d-lactate dehydrogenase from escherichia coli 0.9624 1 328
8grv-assembly1.cif.gz_A dictyostelium discoideum lactate dehydrogenase (dicldha)with nad 0.9605 1 328
8i5z-assembly1.cif.gz_A ldh mutant p101q-(an unexpected single-point mutation triggers the unleashing of catalytic potential of a nadh-dependent dehydrogenase) 0.9571 3 327
ID Description Score Start End Superfamily
af_Q9P7P8_47_141_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9901 48 141 3.40.50.720
af_P52643_123_325_3.30.360.10 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9883 123 321 3.30.360.10
af_Q54UF7_111_296_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9864 113 295 3.40.50.720
af_Q9P7P8_108_296_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9862 109 295 3.40.50.720
af_Q54UF7_112_330_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9853 114 323 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A085VFL6-F1-model_v4 2-hydroxyacid dehydrogenase 0.9938 1 329 GO:0008720
GO:0051287
AF-A0A5E7VC76-F1-model_v4 D-lactate dehydrogenase (EC 1.1.1.28) 0.9937 1 330 GO:0008720
GO:0051287
AF-A0A5B0ES95-F1-model_v4 2-hydroxyacid dehydrogenase 0.9937 1 329 GO:0008720
GO:0051287
AF-A0A2K4I4N8-F1-model_v4 Hydroxyacid dehydrogenase 0.9936 1 329 GO:0008720
GO:0051287
AF-A0A562QFM9-F1-model_v4 D-lactate dehydrogenase 0.9933 95 328 GO:0008720
GO:0051287

Feature Viewer

pLDDT pTM Quality
93.64 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map