F495545

General Info

Members Datasets Scaffolds Average Seq Length
1741 911 3482 336

Family's Representative Sequence

Representative Sequence 3300009765|Ga0123341_1000001|Ga0123341_100000183
Length 365
Sequence MGAAGFSAGPPTRKDKTTEKVGKKMKNTLLSAALGAAVLALGASAASATTLGDVKAKGFVQCGVNTGLTGFAAPDASGNWAGFDVDFCKAVASAVFGDPTKVKYTPTNAKERFTALQSGEIDVLSRNTTWTINRDTALGFNFRPVTYYDGQGFMVRKSLNVKSALELSGAAICVQSGTTTELNLADYFKTNNLQYNPVVFENLPEVNAAYDAGRCDVYTTDQSGLYSLRLTLKNPDEHVILPEIISKEPLGPAVRQGDDQWFDIVSWTAYALINAEEFGITQANVDEMKNSPNPDIKRFLGSEADTKIGTDLGLTNDWAANVIKGVGNYGEIFERNIGQGSPLKIARGLNALWNKGGIQYAPPVR

Samples

Sample ID Description Type Environment
1 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
4 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
5 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
9 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
10 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
11 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
12 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
13 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
14 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
15 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
16 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
17 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
18 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
19 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
20 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
21 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
22 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
23 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
24 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
25 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
26 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
27 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
30 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
40 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
41 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
42 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
43 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
44 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
48 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
49 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
69 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
73 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
74 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
75 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
76 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
77 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
78 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
79 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
80 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
81 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
82 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
83 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
84 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
85 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
86 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
88 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
89 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
90 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
91 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
92 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
93 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
94 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
96 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
97 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
98 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
99 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
100 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
101 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
102 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
103 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
104 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
105 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
106 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
107 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
108 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
109 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
110 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
111 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
112 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
113 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
114 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
115 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
116 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
117 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
118 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
119 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
120 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
121 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
122 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
123 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
124 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
125 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
126 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
127 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
128 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
129 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
130 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
131 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
132 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
133 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
134 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
135 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
136 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
137 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
138 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
139 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
140 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
141 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
143 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
144 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
147 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
148 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
150 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
151 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
152 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
154 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
155 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
156 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
158 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
159 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
210 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
211 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
212 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
213 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
214 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
216 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
218 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
219 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
222 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
223 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
224 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
225 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
226 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
227 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
228 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
229 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
230 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
231 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
232 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
233 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
234 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
235 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
236 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
237 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
238 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
239 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
240 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
241 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
242 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
243 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
244 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
245 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
246 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
247 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
248 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
249 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
250 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
251 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
252 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
253 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
254 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
255 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
256 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
257 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
258 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
259 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
260 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
261 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
262 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
263 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
264 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
265 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
266 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
267 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
268 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
269 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
270 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
271 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
272 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
273 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
274 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
275 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
276 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
277 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
278 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
279 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
280 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
281 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
282 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
283 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
284 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
285 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
286 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
287 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
288 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
289 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
290 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
291 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
292 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
293 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
294 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
295 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
296 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
297 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
298 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
299 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
300 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
301 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
302 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
303 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
304 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
305 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
306 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
307 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
308 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
309 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
310 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
311 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
312 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
313 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
314 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
315 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
316 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
317 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
318 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
319 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
320 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
321 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
322 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
323 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
324 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
325 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
326 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
327 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
328 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
329 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
330 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
331 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
332 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
333 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
334 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
335 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
336 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
337 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
338 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
339 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
340 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
341 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
342 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
343 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
344 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
345 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
346 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
347 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
348 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
349 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
350 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
351 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
352 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
353 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
354 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
355 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
356 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
357 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
358 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
359 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
360 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
361 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
362 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
363 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
364 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
365 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
366 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
367 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
368 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
369 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
370 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
371 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
372 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
373 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
374 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
375 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
376 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
377 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
378 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
379 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
380 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
381 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
382 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
383 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
384 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
385 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
386 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
387 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
388 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
389 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
390 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
391 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
392 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
393 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
394 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
395 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
396 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
397 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
398 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
399 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
400 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
401 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
402 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
403 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
404 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
405 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
406 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
407 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
408 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
409 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
410 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
411 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
412 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
413 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
414 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
415 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
416 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
417 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
418 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
419 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
420 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
421 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
422 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
423 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
424 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
425 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
426 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
427 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
428 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
429 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
430 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
431 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
432 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
433 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
434 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
435 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
436 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
437 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
438 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
439 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
440 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
441 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
442 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
443 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
444 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
445 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
446 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
447 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
448 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
449 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
450 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
451 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
452 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
453 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
454 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
455 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
456 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
457 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
458 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
459 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
460 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
461 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
462 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
463 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
464 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
465 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
466 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
467 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
468 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
469 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
470 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
471 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
472 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
473 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
474 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
475 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
476 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
477 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
478 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
479 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
480 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
481 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
482 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
483 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
484 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
485 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
486 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
487 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
488 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
489 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
490 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
491 2509276019 Ensifer aridi TW10 Isolate Nodule
492 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
493 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
494 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
495 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
496 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
497 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
498 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
499 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
500 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
501 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
502 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
503 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
504 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
505 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
506 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
507 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
508 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
509 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
510 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
511 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
512 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
513 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
514 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
515 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
516 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
517 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
518 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
519 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
520 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
521 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
522 2516143018 Ensifer sp. BR816 Isolate Nodule
523 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
524 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
525 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
526 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
527 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
528 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
529 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
530 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
531 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
532 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
533 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
534 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
535 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
536 2534681786 Brucella suis 92/29 Isolate Unclassified
537 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
538 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
539 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
540 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
541 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
542 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
543 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
544 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
545 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
546 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
547 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
548 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
549 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
550 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
551 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
552 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
553 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
554 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
555 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
556 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
557 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
558 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
559 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
560 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
561 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
562 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
563 2643221557 Ensifer sp. Root558 Isolate Unclassified
564 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
565 2643221607 Rhizobium sp. Root73 Isolate Unclassified
566 2643221610 Ensifer sp. Root74 Isolate Unclassified
567 2643221618 Ensifer sp. Root231 Isolate Unclassified
568 2643221626 Ensifer sp. Root31 Isolate Unclassified
569 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
570 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
571 2643221655 Ensifer sp. Root1252 Isolate Unclassified
572 2643221659 Ensifer sp. Root127 Isolate Unclassified
573 2643221668 Ensifer sp. Root423 Isolate Unclassified
574 2643221675 Ensifer sp. Root1298 Isolate Unclassified
575 2643221680 Ensifer sp. Root1312 Isolate Unclassified
576 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
577 2643221688 Rhizobium sp. Root482 Isolate Unclassified
578 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
579 2643221698 Ensifer sp. Root142 Isolate Unclassified
580 2643221712 Ensifer sp. Root258 Isolate Unclassified
581 2643221723 Ensifer sp. Root278 Isolate Unclassified
582 2643221726 Ensifer sp. Root954 Isolate Unclassified
583 2643221733 Bosea sp. Root381 Isolate Unclassified
584 2643221734 Bosea sp. Root670 Isolate Unclassified
585 2643221736 Bosea sp. Root483D1 Isolate Unclassified
586 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
587 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
588 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
589 2718217927 Rhizobium sp. N324 Isolate Nodule
590 2718218423 Rhizobium sp. N941 Isolate Nodule
591 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
592 2721755809 Rhizobium sp. N541 Isolate Nodule
593 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
594 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
595 2738541293 Rhizobium sp. GV031 Isolate Unclassified
596 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
597 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
598 2751185800 Brucella pituitosa AA2 Isolate Unclassified
599 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
600 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
601 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
602 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
603 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
604 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
605 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
606 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
607 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
608 2791355199
609 2791355256 Rhizobium sp. M10 Isolate Nodule
610 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
611 2791355262 Rhizobium sp. M1 Isolate Nodule
612 2791355266 Rhizobium sp. L43 Isolate Nodule
613 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
614 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
615 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
616 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
617 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
618 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
619 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
620 2802429633 Rhizobium anhuiense J3 Isolate Nodule
621 2802429634 Rhizobium anhuiense S10 Isolate Nodule
622 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
623 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
624 2802429637 Rhizobium anhuiense C15 Isolate Nodule
625 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
626 2818991467 Bosea vestrisii 3192 Isolate Unclassified
627 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
628 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
629 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
630 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
631 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
632 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
633 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
634 2841760612 Bosea sp. Tri-49 Isolate Nodule
635 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
636 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
637 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
638 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
639 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
640 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
641 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
642 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
643 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
644 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
645 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
646 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
647 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
648 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
649 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
650 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
651 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
652 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
653 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
654 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
655 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
656 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
657 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
658 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
659 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
660 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
661 2844104063 Bosea sp. Tri-39 Isolate Nodule
662 2844163670 Ensifer sp. 1H6 Isolate Unclassified
663 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
664 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
665 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
666 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
667 2851182111 Bosea sp. Tri-44 Isolate Nodule
668 2851246043 Bosea sp. Tri-54 Isolate Nodule
669 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
670 2854911287 Brucella lupini LUP21 Isolate Unclassified
671 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
672 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
673 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
674 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
675 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
676 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
677 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
678 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
679 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
680 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
681 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
682 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
683 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
684 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
685 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
686 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
687 2904699407
688 2906610324
689 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
690 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
691 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
692 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
693 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
694 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
695 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
696 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
697 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
698 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
699 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
700 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
701 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
702 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
703 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
704 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
705 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
706 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
707 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
708 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
709 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
710 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
711 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
712 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
713 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
714 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
715 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
716 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
717 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
718 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
719 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
720 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
721 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
722 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
723 2922425934
724 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
725 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
726 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
727 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
728 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
729 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
730 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
731 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
732 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
733 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
734 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
735 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
736 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
737 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
738 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
739 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
740 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
741 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
742 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
743 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
744 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
745 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
746 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
747 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
748 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
749 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
750 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
751 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
752 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
753 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
754 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
755 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
756 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
757 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
758 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
759 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
760 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
761 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
762 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
763 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
764 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
765 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
766 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
767 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
768 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
769 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
770 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
771 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
772 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
773 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
774 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
775 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
776 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
777 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
778 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
779 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
780 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
781 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
782 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
783 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
784 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
785 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
786 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
787 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
788 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
789 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
790 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
791 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
792 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
793 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
794 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
795 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
796 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
797 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
798 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
799 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
800 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
801 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
802 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
803 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
804 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
805 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
806 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
807 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
808 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
809 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
810 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
811 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
812 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
813 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
814 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
815 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
816 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
817 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
818 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
819 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
820 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
821 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
822 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
823 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
824 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
825 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
826 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
827 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
828 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
829 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
830 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
831 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
832 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
833 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
834 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
835 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
836 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
837 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
838 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
839 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
840 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
841 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
842 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
843 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
844 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
845 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
846 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
847 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
848 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
849 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
850 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
851 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
852 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
853 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
854 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
855 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
856 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
857 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
858 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
859 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
860 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
861 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
862 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
863 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
864 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
865 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
866 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
867 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
868 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
869 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
870 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
871 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
872 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
873 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
874 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
875 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
876 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
877 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
878 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
879 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
880 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
881 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
882 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
883 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
884 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
885 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
886 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
887 8005275841 Rhizobium sp. N4311 Isolate Nodule
888 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
889 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
890 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
891 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
892 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
893 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
894 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
895 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
896 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
897 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
898 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
899 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
900 8018176218 Rhizobium sp. N122 Isolate Nodule
901 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
902 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
903 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
904 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
905 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
906 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
907 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
908 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
909 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
910 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule
911 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 62.12
Metatranscriptomes 0.46
Isolates 37.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.44
Nodule 33.72
Rhizoplane 1.61
Rhizosphere 42.56
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0123341_1000001 3300009765 Bacteria 314908
2 JGI25152J39213_1001618 3300002773 Bacteria 9407
3 JGI25152J39213_1019942 3300002773 Bacteria 1209
4 JGI25150J39212_1000010 3300002774 Bacteria 236260
5 JGI25159J45721_1000006 3300002987 Bacteria 188201
6 JGI25159J45721_1000045 3300002987 Bacteria 60263
7 JGI25159J45721_1000969 3300002987 Bacteria 12464
8 JGI25159J45721_1001222 3300002987 Bacteria 10879
9 JGI25159J45721_1009708 3300002987 Bacteria 2517
10 JGI25151J46595_10000030 3300003187 Bacteria 202084
11 JGI25151J46595_10000653 3300003187 Bacteria 29531
12 JGI25151J46595_10000963 3300003187 Bacteria 21956
13 JGI25151J46595_10019784 3300003187 Bacteria 2850
14 JGI25151J46595_10035155 3300003187 Bacteria 1907
15 JGI25406J46586_10000004 3300003203 Bacteria 149772
16 JGI25406J46586_10001469 3300003203 Bacteria 11119
17 JGI25406J46586_10007336 3300003203 Bacteria 5040
18 JGI25406J46586_10018350 3300003203 Bacteria 2875
19 JGI25153J46596_10000463 3300003215 Bacteria 25957
20 JGI25153J46596_10001697 3300003215 Bacteria 13070
21 JGI25153J46596_10009347 3300003215 Bacteria 4573
22 JGI25153J46596_10012198 3300003215 Bacteria 3732
23 JGI25153J46596_10018819 3300003215 Bacteria 2667
24 JGI25160J50197_1000009 3300003354 Bacteria 282862
25 JGI25160J50197_1000019 3300003354 Bacteria 233980
26 JGI25160J50197_1005184 3300003354 Bacteria 5467
27 JGI25161J50226_1000291 3300003374 Bacteria 28212
28 JGI25161J50226_1000631 3300003374 Bacteria 14292
29 Ga0006562J51391_1016026 3300003578 Bacteria 1802
30 JGI25404J52841_10017099 3300003659 Bacteria 1573
31 JGI25404J52841_10024923 3300003659 Bacteria 1288
32 Ga0055539_1002510 3300003752 Bacteria 2767
33 Ga0055526_1000213 3300003771 Bacteria 50112
34 Ga0055526_1000382 3300003771 Bacteria 35903
35 Ga0055526_1003948 3300003771 Bacteria 9154
36 Ga0055524_1000014 3300003775 Bacteria 259417
37 Ga0055524_1001741 3300003775 Bacteria 12061
38 Ga0055524_1006759 3300003775 Bacteria 4950
39 Ga0055524_1007562 3300003775 Bacteria 4596
40 Ga0055524_1009040 3300003775 Bacteria 4089
41 Ga0055536_1000099 3300003781 Bacteria 74606
42 Ga0055536_1007245 3300003781 Bacteria 4997
43 Ga0055528_1006980 3300003790 Bacteria 5053
44 Ga0055530_10012962 3300003791 Bacteria 2875
45 Ga0055540_1020031 3300003792 Bacteria 1784
46 Ga0055531_10003009 3300003794 Bacteria 10939
47 Ga0055531_10008232 3300003794 Bacteria 5548
48 Ga0055543_1000147 3300004625 Bacteria 58621
49 Ga0055543_1000149 3300004625 Bacteria 58403
50 Ga0055543_1001457 3300004625 Bacteria 9350
51 Ga0065165_1000020 3300005262 Bacteria 265570
52 Ga0065165_1000180 3300005262 Bacteria 111768
53 Ga0065165_1000240 3300005262 Bacteria 93895
54 Ga0065165_1000667 3300005262 Bacteria 49547
55 Ga0065165_1002203 3300005262 Bacteria 17455
56 Ga0065165_1002687 3300005262 Bacteria 14319
57 Ga0065165_1006798 3300005262 Bacteria 5843
58 Ga0065712_10030785 3300005290 Bacteria 1987
59 Ga0070658_10137890 3300005327 Bacteria 2036
60 Ga0070683_100006511 3300005329 Bacteria 9806
61 Ga0070683_100007119 3300005329 Bacteria 9430
62 Ga0070683_100082577 3300005329 Bacteria 3009
63 Ga0070690_100055324 3300005330 Bacteria 2542
64 Ga0070680_100027349 3300005336 Bacteria 4567
65 Ga0070680_100056967 3300005336 Bacteria 3194
66 Ga0070680_100066890 3300005336 Bacteria 2947
67 Ga0070680_100079295 3300005336 Bacteria 2706
68 Ga0068868_100078902 3300005338 Bacteria 2636
69 Ga0070660_100005207 3300005339 Bacteria 8990
70 Ga0070689_100003670 3300005340 Bacteria 10244
71 Ga0070687_100030691 3300005343 Bacteria 2630
72 Ga0070687_100046956 3300005343 Bacteria 2213
73 Ga0070687_100146230 3300005343 Bacteria 1382
74 Ga0070668_100110244 3300005347 Bacteria 2190
75 Ga0070668_100257456 3300005347 Bacteria 1450
76 Ga0070669_100063727 3300005353 Bacteria 2713
77 Ga0070669_100073716 3300005353 Bacteria 2529
78 Ga0070669_100180985 3300005353 Bacteria 1649
79 Ga0070675_100267153 3300005354 Bacteria 1500
80 Ga0070671_100065157 3300005355 Bacteria 3034
81 Ga0070671_100172296 3300005355 Bacteria 1831
82 Ga0070671_100193348 3300005355 Bacteria 1724
83 Ga0070674_100001420 3300005356 Bacteria 12715
84 Ga0070673_100171366 3300005364 Bacteria 1853
85 Ga0070688_100023192 3300005365 Bacteria 3647
86 Ga0070659_100047822 3300005366 Bacteria 3358
87 Ga0070659_100084832 3300005366 Bacteria 2533
88 Ga0070709_10008512 3300005434 Bacteria 5636
89 Ga0070709_10057643 3300005434 Bacteria 2461
90 Ga0070709_10088806 3300005434 Bacteria 2034
91 Ga0070714_100006414 3300005435 Bacteria 9086
92 Ga0070714_100006642 3300005435 Bacteria 8952
93 Ga0070714_100055677 3300005435 Bacteria 3381
94 Ga0070714_100069870 3300005435 Bacteria 3034
95 Ga0070713_100019473 3300005436 Bacteria 5183
96 Ga0070713_100046981 3300005436 Bacteria 3546
97 Ga0070713_100060748 3300005436 Bacteria 3160
98 Ga0070710_10000919 3300005437 Bacteria 14027
99 Ga0070710_10009860 3300005437 Bacteria 4682
100 Ga0070710_10083184 3300005437 Bacteria 1872
101 Ga0070710_10192037 3300005437 Bacteria 1285
102 Ga0070711_100004484 3300005439 Bacteria 8248
103 Ga0070711_100172950 3300005439 Bacteria 1647
104 Ga0070663_100013555 3300005455 Bacteria 5204
105 Ga0070663_100018341 3300005455 Bacteria 4587
106 Ga0070663_100073326 3300005455 Bacteria 2497
107 Ga0070678_100007522 3300005456 Bacteria 6469
108 Ga0070678_100026355 3300005456 Bacteria 3928
109 Ga0070678_100129765 3300005456 Bacteria 2001
110 Ga0070685_10035186 3300005466 Bacteria 2824
111 Ga0070685_10217206 3300005466 Bacteria 1251
112 Ga0070706_100063549 3300005467 Bacteria 3411
113 Ga0070707_100075380 3300005468 Bacteria 3254
114 Ga0070698_100018103 3300005471 Bacteria 7418
115 Ga0070698_100293279 3300005471 Bacteria 1557
116 Ga0070679_100200700 3300005530 Bacteria 1961
117 Ga0070679_100272718 3300005530 Bacteria 1645
118 Ga0070684_100001614 3300005535 Bacteria 16298
119 Ga0070684_100019307 3300005535 Bacteria 5636
120 Ga0070684_100034203 3300005535 Bacteria 4344
121 Ga0070697_100093650 3300005536 Bacteria 2488
122 Ga0068853_100010713 3300005539 Bacteria 7426
123 Ga0068853_100036552 3300005539 Bacteria 4178
124 Ga0068853_100201823 3300005539 Bacteria 1810
125 Ga0070695_100002718 3300005545 Bacteria 10251
126 Ga0070696_100243452 3300005546 Bacteria 1358
127 Ga0070665_100047076 3300005548 Bacteria 4329
128 Ga0070665_100146826 3300005548 Bacteria 2361
129 Ga0070665_100224351 3300005548 Bacteria 1879
130 Ga0070665_100396584 3300005548 Bacteria 1388
131 Ga0070704_100017580 3300005549 Bacteria 4551
132 Ga0068855_100048010 3300005563 Bacteria 5040
133 Ga0070664_100293506 3300005564 Bacteria 1468
134 Ga0068857_100080227 3300005577 Bacteria 2914
135 Ga0068857_100135738 3300005577 Bacteria 2221
136 Ga0068857_100271106 3300005577 Bacteria 1560
137 Ga0068854_100147537 3300005578 Bacteria 1811
138 Ga0068854_100334718 3300005578 Bacteria 1235
139 Ga0068856_100000223 3300005614 Bacteria 61437
140 Ga0068852_100094867 3300005616 Bacteria 2678
141 Ga0068852_100251346 3300005616 Bacteria 1694
142 Ga0068859_100087029 3300005617 Bacteria 3172
143 Ga0068859_100200287 3300005617 Bacteria 2081
144 Ga0068859_100646741 3300005617 Bacteria 1149
145 Ga0068864_100260780 3300005618 Bacteria 1612
146 Ga0068864_100329914 3300005618 Bacteria 1435
147 Ga0068864_100416934 3300005618 Bacteria 1279
148 Ga0068866_10118391 3300005718 Bacteria 1488
149 Ga0068866_10118937 3300005718 Bacteria 1486
150 Ga0068861_100062480 3300005719 Bacteria 2861
151 Ga0068851_10102259 3300005834 Bacteria 1522
152 Ga0068870_10021988 3300005840 Bacteria 3129
153 Ga0068860_100340917 3300005843 Bacteria 1474
154 Ga0068862_100096452 3300005844 Bacteria 2581
155 Ga0081455_10001830 3300005937 Bacteria 25613
156 Ga0081455_10010615 3300005937 Bacteria 9320
157 Ga0081455_10012070 3300005937 Bacteria 8640
158 Ga0081455_10052751 3300005937 Bacteria 3479
159 Ga0081455_10065370 3300005937 Bacteria 3042
160 Ga0081540_1000972 3300005983 Bacteria 25862
161 Ga0081540_1001527 3300005983 Bacteria 19886
162 Ga0081540_1001974 3300005983 Bacteria 17113
163 Ga0081540_1002258 3300005983 Bacteria 15851
164 Ga0081540_1002930 3300005983 Bacteria 13738
165 Ga0081540_1015010 3300005983 Bacteria 4922
166 Ga0081540_1017616 3300005983 Bacteria 4414
167 Ga0081540_1041701 3300005983 Bacteria 2377
168 Ga0081539_10000080 3300005985 Bacteria 222745
169 Ga0081539_10000258 3300005985 Bacteria 122213
170 Ga0081539_10003064 3300005985 Bacteria 21557
171 Ga0081539_10020000 3300005985 Bacteria 4553
172 Ga0081539_10066163 3300005985 Bacteria 1960
173 Ga0075365_10006090 3300006038 Bacteria 6591
174 Ga0075365_10020998 3300006038 Bacteria 4064
175 Ga0075365_10060989 3300006038 Bacteria 2517
176 Ga0075368_10029307 3300006042 Bacteria 2128
177 Ga0075363_100002611 3300006048 Bacteria 7424
178 Ga0075363_100005534 3300006048 Bacteria 5631
179 Ga0075363_100025880 3300006048 Bacteria 2997
180 Ga0075363_100032459 3300006048 Bacteria 2712
181 Ga0075364_10002396 3300006051 Bacteria 10511
182 Ga0075364_10008960 3300006051 Bacteria 5992
183 Ga0075364_10015868 3300006051 Bacteria 4675
184 Ga0070715_10000416 3300006163 Bacteria 10869
185 Ga0070715_10012928 3300006163 Bacteria 3053
186 Ga0070716_100001459 3300006173 Bacteria 10532
187 Ga0070716_100003186 3300006173 Bacteria 7689
188 Ga0070716_100104248 3300006173 Bacteria 1745
189 Ga0070712_100053141 3300006175 Bacteria 2828
190 Ga0070712_100057281 3300006175 Bacteria 2737
191 Ga0070712_100152179 3300006175 Bacteria 1777
192 Ga0070712_100307247 3300006175 Bacteria 1285
193 Ga0075362_10003305 3300006177 Bacteria 5615
194 Ga0075362_10007951 3300006177 Bacteria 4037
195 Ga0075362_10058808 3300006177 Bacteria 1734
196 Ga0075362_10063190 3300006177 Bacteria 1678
197 Ga0075367_10000246 3300006178 Bacteria 18379
198 Ga0075367_10002336 3300006178 Bacteria 8631
199 Ga0075367_10012425 3300006178 Bacteria 4540
200 Ga0075367_10065089 3300006178 Bacteria 2182
201 Ga0075369_10000860 3300006186 Bacteria 10060
202 Ga0075369_10002532 3300006186 Bacteria 6539
203 Ga0075369_10018853 3300006186 Bacteria 2812
204 Ga0075369_10039742 3300006186 Bacteria 2010
205 Ga0075369_10076242 3300006186 Bacteria 1482
206 Ga0075366_10015183 3300006195 Bacteria 4410
207 Ga0075366_10070532 3300006195 Bacteria 2081
208 Ga0097621_100044177 3300006237 Bacteria 3595
209 Ga0097621_100250543 3300006237 Bacteria 1550
210 Ga0075370_10028688 3300006353 Bacteria 3095
211 Ga0075370_10031358 3300006353 Bacteria 2967
212 Ga0075370_10048046 3300006353 Bacteria 2417
213 Ga0075428_100044356 3300006844 Bacteria 4886
214 Ga0075428_100106482 3300006844 Bacteria 3057
215 Ga0075430_100000043 3300006846 Bacteria 66210
216 Ga0075430_100162857 3300006846 Bacteria 1857
217 Ga0075431_100020937 3300006847 Bacteria 6682
218 Ga0075431_100153569 3300006847 Bacteria 2369
219 Ga0075433_10009732 3300006852 Bacteria 7700
220 Ga0075433_10014595 3300006852 Bacteria 6422
221 Ga0075434_100003848 3300006871 Bacteria 13422
222 Ga0075434_100005388 3300006871 Bacteria 11640
223 Ga0075436_100165547 3300006914 Bacteria 1560
224 Ga0097620_100087030 3300006931 Bacteria 3172
225 Ga0097620_100200283 3300006931 Bacteria 2081
226 Ga0097620_100646710 3300006931 Bacteria 1149
227 Ga0099824_1013903 3300006942 Bacteria 8187
228 Ga0099822_1025540 3300006943 Bacteria 5114
229 Ga0099823_1014174 3300006944 Bacteria 7974
230 Ga0079104_1003210 3300006946 Bacteria 7879
231 Ga0079104_1003807 3300006946 Bacteria 6777
232 Ga0079104_1004155 3300006946 Bacteria 6328
233 Ga0079104_1012256 3300006946 Bacteria 2708
234 Ga0099794_10059255 3300007265 Bacteria 1857
235 Ga0099794_10120302 3300007265 Bacteria 1320
236 Ga0099795_10036033 3300007788 Bacteria 1733
237 Ga0105251_10074237 3300009011 Bacteria 1580
238 Ga0105240_10005693 3300009093 Bacteria 18493
239 Ga0105240_10113695 3300009093 Bacteria 3271
240 Ga0105240_10479486 3300009093 Bacteria 1387
241 Ga0111539_10030424 3300009094 Bacteria 6561
242 Ga0111539_10062755 3300009094 Bacteria 4397
243 Ga0105247_10185545 3300009101 Bacteria 1390
244 Ga0105247_10210159 3300009101 Bacteria 1312
245 Ga0114129_10006499 3300009147 Bacteria 16579
246 Ga0114129_10012033 3300009147 Bacteria 12306
247 Ga0105243_10165759 3300009148 Bacteria 1909
248 Ga0105242_10050923 3300009176 Bacteria 3373
249 Ga0105248_10129897 3300009177 Bacteria 2842
250 Ga0105237_10004882 3300009545 Bacteria 15362
251 Ga0105237_10092774 3300009545 Bacteria 3009
252 Ga0105238_10026703 3300009551 Bacteria 5887
253 Ga0105238_10257106 3300009551 Bacteria 1726
254 Ga0105249_10075662 3300009553 Bacteria 3118
255 Ga0105239_10024408 3300010375 Bacteria 6662
256 Ga0105239_10063416 3300010375 Bacteria 4057
257 Ga0105239_10135889 3300010375 Bacteria 2737
258 Ga0105239_10228536 3300010375 Bacteria 2087
259 Ga0105246_10045726 3300011119 Bacteria 2983
260 Ga0157373_10019309 3300013100 Bacteria 4964
261 Ga0157373_10110014 3300013100 Bacteria 1937
262 Ga0157370_10031900 3300013104 Bacteria 5149
263 Ga0157370_10054851 3300013104 Bacteria 3799
264 Ga0157369_10008457 3300013105 Bacteria 11804
265 Ga0157369_10011845 3300013105 Bacteria 9907
266 Ga0157369_10023767 3300013105 Bacteria 6823
267 Ga0157369_10328277 3300013105 Bacteria 1590
268 Ga0171463_1011 3300013249 Bacteria 230603
269 Ga0171462_1016 3300013250 Bacteria 164601
270 Ga0157374_10044503 3300013296 Bacteria 4103
271 Ga0157378_10005332 3300013297 Bacteria 11285
272 Ga0157378_10116584 3300013297 Bacteria 2456
273 Ga0157378_10199282 3300013297 Bacteria 1893
274 Ga0163162_10067783 3300013306 Bacteria 3619
275 Ga0163162_10402338 3300013306 Bacteria 1502
276 Ga0157375_10018792 3300013308 Bacteria 6273
277 Ga0157375_10233510 3300013308 Bacteria 1998
278 Ga0163163_10118605 3300014325 Bacteria 2679
279 Ga0163163_10132478 3300014325 Bacteria 2533
280 Ga0163163_10231021 3300014325 Bacteria 1899
281 Ga0157380_10034769 3300014326 Bacteria 3889
282 Ga0157380_10102696 3300014326 Bacteria 2384
283 Ga0182008_10039527 3300014497 Bacteria 2357
284 Ga0157376_10067746 3300014969 Bacteria 3020
285 Ga0183363_1384 3300015690 Bacteria 4345
286 Ga0163161_10097319 3300017792 Bacteria 2186
287 Ga0214544_1000002 3300021320 Bacteria 753857
288 Ga0214544_1009612 3300021320 Bacteria 14991
289 Ga0214542_1000015 3300021321 Bacteria 227912
290 Ga0214542_1001264 3300021321 Bacteria 51404
291 Ga0214542_1015309 3300021321 Bacteria 8073
292 Ga0214545_1000018 3300021324 Bacteria 172019
293 Ga0214543_1000001 3300021327 Bacteria 776921
294 Ga0214543_1000011 3300021327 Bacteria 344093
295 Ga0214543_1000032 3300021327 Bacteria 200766
296 Ga0213873_10009976 3300021358 Bacteria 1989
297 Ga0213874_10004902 3300021377 Bacteria 3093
298 Ga0213876_10005326 3300021384 Bacteria 7076
299 Ga0213875_10026571 3300021388 Bacteria 2754
300 Ga0224712_10041342 3300022467 Bacteria 1740
301 Ga0228711_1000012 3300022739 Bacteria 132594
302 Ga0228711_1000022 3300022739 Bacteria 107483
303 Ga0228710_1000006 3300022740 Bacteria 209134
304 Ga0228710_1000028 3300022740 Bacteria 102538
305 Ga0209436_100410 3300025208 Bacteria 19312
306 Ga0209436_100644 3300025208 Bacteria 14863
307 Ga0209563_103920 3300025230 Bacteria 2948
308 Ga0207425_1000010 3300025245 Bacteria 572898
309 Ga0207425_1002485 3300025245 Bacteria 6476
310 Ga0207425_1009841 3300025245 Bacteria 2356
311 Ga0209646_1004255 3300025246 Bacteria 2633
312 Ga0209677_108690 3300025253 Bacteria 1927
313 Ga0209148_1000694 3300025254 Bacteria 27288
314 Ga0209148_1007656 3300025254 Bacteria 2225
315 Ga0209129_1000034 3300025258 Bacteria 330950
316 Ga0209129_1001709 3300025258 Bacteria 11849
317 Ga0209233_1001490 3300025261 Bacteria 9208
318 Ga0209233_1003089 3300025261 Bacteria 5927
319 Ga0209233_1005043 3300025261 Bacteria 4425
320 Ga0209455_1001655 3300025272 Bacteria 9654
321 Ga0209455_1006107 3300025272 Bacteria 3615
322 Ga0209455_1007941 3300025272 Bacteria 2938
323 Ga0209673_1005940 3300025273 Bacteria 6021
324 Ga0209673_1023886 3300025273 Bacteria 2068
325 Ga0209130_1000007 3300025284 Bacteria 591584
326 Ga0209130_1000037 3300025284 Bacteria 284019
327 Ga0209130_1000061 3300025284 Bacteria 200990
328 Ga0209130_1000106 3300025284 Bacteria 134559
329 Ga0209675_1001352 3300025291 Bacteria 14469
330 Ga0209676_1000539 3300025292 Bacteria 58730
331 Ga0209676_1002523 3300025292 Bacteria 12770
332 Ga0209025_1000022 3300025294 Bacteria 574487
333 Ga0209025_1000033 3300025294 Bacteria 414511
334 Ga0209025_1000063 3300025294 Bacteria 303962
335 Ga0209025_1000468 3300025294 Bacteria 78879
336 Ga0209025_1002864 3300025294 Bacteria 17307
337 Ga0209025_1005644 3300025294 Bacteria 10089
338 Ga0209025_1053955 3300025294 Bacteria 1570
339 Ga0209564_1000023 3300025295 Bacteria 555102
340 Ga0209564_1000082 3300025295 Bacteria 261494
341 Ga0209564_1000086 3300025295 Bacteria 251385
342 Ga0209564_1000140 3300025295 Bacteria 179856
343 Ga0209564_1000195 3300025295 Bacteria 141460
344 Ga0209758_1000015 3300025297 Bacteria 851943
345 Ga0209758_1000086 3300025297 Bacteria 254778
346 Ga0209758_1001803 3300025297 Bacteria 23651
347 Ga0209758_1005084 3300025297 Bacteria 10414
348 Ga0209758_1006591 3300025297 Bacteria 8236
349 Ga0209758_1018182 3300025297 Bacteria 3460
350 Ga0209758_1045157 3300025297 Bacteria 1602
351 Ga0209050_1000563 3300025298 Bacteria 60362
352 Ga0209050_1003179 3300025298 Bacteria 12484
353 Ga0209256_1000033 3300025299 Bacteria 393924
354 Ga0209256_1000319 3300025299 Bacteria 82827
355 Ga0209256_1000444 3300025299 Bacteria 63149
356 Ga0209256_1000672 3300025299 Bacteria 46247
357 Ga0209256_1000836 3300025299 Bacteria 38702
358 Ga0209256_1003708 3300025299 Bacteria 10376
359 Ga0209256_1004564 3300025299 Bacteria 8591
360 Ga0209256_1008386 3300025299 Bacteria 4809
361 Ga0209256_1009885 3300025299 Bacteria 4098
362 Ga0209256_1043429 3300025299 Bacteria 1129
363 Ga0207426_1000048 3300025302 Bacteria 409127
364 Ga0207426_1000094 3300025302 Bacteria 275293
365 Ga0207426_1000111 3300025302 Bacteria 234032
366 Ga0207426_1012203 3300025302 Bacteria 3238
367 Ga0209051_1004093 3300025303 Bacteria 9164
368 Ga0209051_1006833 3300025303 Bacteria 6348
369 Ga0209257_1000440 3300025304 Bacteria 79182
370 Ga0209257_1002956 3300025304 Bacteria 15588
371 Ga0209257_1002957 3300025304 Bacteria 15582
372 Ga0207697_10065831 3300025315 Bacteria 1513
373 Ga0207682_10001564 3300025893 Bacteria 10520
374 Ga0207692_10000379 3300025898 Bacteria 15350
375 Ga0207692_10000525 3300025898 Bacteria 13609
376 Ga0207688_10034643 3300025901 Bacteria 2797
377 Ga0207688_10097776 3300025901 Bacteria 1692
378 Ga0207680_10059460 3300025903 Bacteria 2322
379 Ga0207699_10000287 3300025906 Bacteria 27393
380 Ga0207699_10026876 3300025906 Bacteria 3179
381 Ga0207643_10007974 3300025908 Bacteria 5684
382 Ga0207707_10000501 3300025912 Bacteria 40356
383 Ga0207707_10002504 3300025912 Bacteria 16538
384 Ga0207707_10010712 3300025912 Bacteria 7967
385 Ga0207707_10149990 3300025912 Bacteria 2039
386 Ga0207695_10000065 3300025913 Bacteria 336949
387 Ga0207695_10057467 3300025913 Bacteria 4041
388 Ga0207695_10229812 3300025913 Bacteria 1760
389 Ga0207695_10339786 3300025913 Bacteria 1389
390 Ga0207671_10008163 3300025914 Bacteria 8930
391 Ga0207671_10016419 3300025914 Bacteria 5756
392 Ga0207693_10001493 3300025915 Bacteria 20639
393 Ga0207693_10172128 3300025915 Bacteria 1705
394 Ga0207663_10000209 3300025916 Bacteria 26180
395 Ga0207663_10150760 3300025916 Bacteria 1631
396 Ga0207660_10011401 3300025917 Bacteria 5783
397 Ga0207660_10018289 3300025917 Bacteria 4668
398 Ga0207662_10099141 3300025918 Bacteria 1803
399 Ga0207657_10001475 3300025919 Bacteria 25141
400 Ga0207657_10087873 3300025919 Bacteria 2599
401 Ga0207649_10197478 3300025920 Bacteria 1419
402 Ga0207652_10002853 3300025921 Bacteria 14470
403 Ga0207652_10011281 3300025921 Bacteria 7199
404 Ga0207652_10285219 3300025921 Bacteria 1490
405 Ga0207681_10026106 3300025923 Bacteria 3765
406 Ga0207681_10092396 3300025923 Bacteria 2163
407 Ga0207681_10286835 3300025923 Bacteria 1298
408 Ga0207694_10023624 3300025924 Bacteria 4667
409 Ga0207694_10063161 3300025924 Bacteria 2885
410 Ga0207650_10055974 3300025925 Bacteria 2929
411 Ga0207659_10061268 3300025926 Bacteria 2711
412 Ga0207700_10026345 3300025928 Bacteria 4052
413 Ga0207700_10033449 3300025928 Bacteria 3679
414 Ga0207700_10038155 3300025928 Bacteria 3485
415 Ga0207664_10004282 3300025929 Bacteria 9659
416 Ga0207664_10049379 3300025929 Bacteria 3312
417 Ga0207664_10073866 3300025929 Bacteria 2753
418 Ga0207690_10222069 3300025932 Bacteria 1446
419 Ga0207706_10314145 3300025933 Bacteria 1364
420 Ga0207709_10090869 3300025935 Bacteria 1995
421 Ga0207670_10000723 3300025936 Bacteria 17406
422 Ga0207670_10177467 3300025936 Bacteria 1602
423 Ga0207669_10069230 3300025937 Bacteria 2207
424 Ga0207665_10000304 3300025939 Bacteria 34057
425 Ga0207665_10011760 3300025939 Bacteria 5753
426 Ga0207665_10033239 3300025939 Bacteria 3418
427 Ga0207665_10038848 3300025939 Bacteria 3172
428 Ga0207665_10136854 3300025939 Bacteria 1744
429 Ga0207691_10174057 3300025940 Bacteria 1883
430 Ga0207691_10268177 3300025940 Bacteria 1470
431 Ga0207711_10037529 3300025941 Bacteria 4116
432 Ga0207711_10115616 3300025941 Bacteria 2391
433 Ga0207711_10323794 3300025941 Bacteria 1425
434 Ga0207661_10002155 3300025944 Bacteria 13559
435 Ga0207661_10024063 3300025944 Bacteria 4609
436 Ga0207661_10176184 3300025944 Bacteria 1864
437 Ga0207661_10272110 3300025944 Bacteria 1512
438 Ga0207679_10107279 3300025945 Bacteria 2197
439 Ga0207679_10131474 3300025945 Bacteria 2009
440 Ga0207679_10273847 3300025945 Bacteria 1445
441 Ga0207667_10004264 3300025949 Bacteria 17552
442 Ga0207651_10092991 3300025960 Bacteria 2213
443 Ga0207651_10193416 3300025960 Bacteria 1624
444 Ga0207712_10061445 3300025961 Bacteria 2666
445 Ga0207640_10025659 3300025981 Bacteria 3570
446 Ga0207639_10077404 3300026041 Bacteria 2622
447 Ga0207639_10177343 3300026041 Bacteria 1810
448 Ga0207678_10033041 3300026067 Bacteria 4508
449 Ga0207678_10050776 3300026067 Bacteria 3583
450 Ga0207678_10089065 3300026067 Bacteria 2638
451 Ga0207678_10294063 3300026067 Bacteria 1395
452 Ga0207708_10221805 3300026075 Bacteria 1515
453 Ga0207702_10000252 3300026078 Bacteria 62099
454 Ga0207641_10121100 3300026088 Bacteria 2335
455 Ga0207641_10319547 3300026088 Bacteria 1472
456 Ga0207648_10046968 3300026089 Bacteria 3785
457 Ga0207676_10010931 3300026095 Bacteria 6478
458 Ga0207674_10262215 3300026116 Bacteria 1675
459 Ga0207675_100056838 3300026118 Bacteria 3649
460 Ga0207675_100167817 3300026118 Bacteria 2097
461 Ga0207683_10016066 3300026121 Bacteria 6369
462 Ga0207683_10272701 3300026121 Bacteria 1546
463 Ga0207698_10023811 3300026142 Bacteria 4285
464 Ga0207698_10292015 3300026142 Bacteria 1513
465 Ga0207698_10437005 3300026142 Bacteria 1260
466 Ga0209281_1000247 3300027111 Bacteria 107495
467 Ga0209281_1000268 3300027111 Bacteria 100508
468 Ga0209281_1000733 3300027111 Bacteria 32098
469 Ga0209281_1001674 3300027111 Bacteria 11676
470 Ga0209389_1000076 3300027296 Bacteria 92447
471 Ga0209389_1000128 3300027296 Bacteria 67169
472 Ga0209589_1000003 3300027357 Bacteria 629130
473 Ga0209589_1000180 3300027357 Bacteria 72900
474 Ga0209489_100003 3300027361 Bacteria 663105
475 Ga0209489_100031 3300027361 Bacteria 184074
476 Ga0209489_100416 3300027361 Bacteria 77981
477 Ga0209700_100003 3300027363 Bacteria 663105
478 Ga0209700_100014 3300027363 Bacteria 299349
479 Ga0209179_1004759 3300027512 Bacteria 2073
480 Ga0209282_1000026 3300027666 Bacteria 166272
481 Ga0209282_1000037 3300027666 Bacteria 130160
482 Ga0209588_1007876 3300027671 Bacteria 3150
483 Ga0209588_1008060 3300027671 Bacteria 3118
484 Ga0209813_10001178 3300027866 Bacteria 5830
485 Ga0209813_10031573 3300027866 Bacteria 1564
486 Ga0209813_10042130 3300027866 Bacteria 1394
487 Ga0207428_10031570 3300027907 Bacteria 4367
488 Ga0268266_10001640 3300028379 Bacteria 25958
489 Ga0268266_10019976 3300028379 Bacteria 5708
490 Ga0268266_10032441 3300028379 Bacteria 4437
491 Ga0268266_10424508 3300028379 Bacteria 1260
492 Ga0268264_10291134 3300028381 Bacteria 1534
493 Ga0265337_1001045 3300028556 Bacteria 14317
494 Ga0265334_10032065 3300028573 Bacteria 2097
495 Ga0268256_1002827 3300030500 Bacteria 8372
496 Ga0265330_10017911 3300031235 Bacteria 3257
497 Ga0265330_10019889 3300031235 Bacteria 3070
498 Ga0265330_10085635 3300031235 Bacteria 1355
499 Ga0265332_10016230 3300031238 Bacteria 3285
500 Ga0265320_10031009 3300031240 Bacteria 2749
501 Ga0265325_10001561 3300031241 Bacteria 15970
502 Ga0265325_10026316 3300031241 Bacteria 3151
503 Ga0265325_10062845 3300031241 Bacteria 1880
504 Ga0265329_10036350 3300031242 Bacteria 1588
505 Ga0265340_10004319 3300031247 Bacteria 7960
506 Ga0265340_10020020 3300031247 Bacteria 3442
507 Ga0265339_10054363 3300031249 Bacteria 2175
508 Ga0265331_10005060 3300031250 Bacteria 8060
509 Ga0307513_10008569 3300031456 Bacteria 13066
510 Ga0307509_10039174 3300031507 Bacteria 5164
511 Ga0307509_10164183 3300031507 Bacteria 2113
512 Ga0307408_100079731 3300031548 Bacteria 2444
513 Ga0307408_100096314 3300031548 Bacteria 2245
514 Ga0307408_100130565 3300031548 Bacteria 1959
515 Ga0265313_10020917 3300031595 Bacteria 3593
516 Ga0307508_10000005 3300031616 Bacteria 286511
517 Ga0307508_10008196 3300031616 Bacteria 9690
518 Ga0265314_10009410 3300031711 Bacteria 8245
519 Ga0265314_10059057 3300031711 Bacteria 2626
520 Ga0265342_10010137 3300031712 Bacteria 6567
521 Ga0265342_10020208 3300031712 Bacteria 4279
522 Ga0265342_10026486 3300031712 Bacteria 3632
523 Ga0316576_10064827 3300031727 Bacteria 2684
524 Ga0307516_10150628 3300031730 Bacteria 2087
525 Ga0307516_10189831 3300031730 Bacteria 1781
526 Ga0307516_10323880 3300031730 Bacteria 1212
527 Ga0307405_10007952 3300031731 Bacteria 5345
528 Ga0307405_10056973 3300031731 Bacteria 2453
529 Ga0307410_10057832 3300031852 Bacteria 2642
530 Ga0307406_10007182 3300031901 Bacteria 6171
531 Ga0307406_10019643 3300031901 Bacteria 3968
532 Ga0307412_10005049 3300031911 Bacteria 7378
533 Ga0307412_10077176 3300031911 Bacteria 2291
534 Ga0315914_1000002 3300031967 Bacteria 365357
535 Ga0315914_1000008 3300031967 Bacteria 209133
536 Ga0307409_100090554 3300031995 Bacteria 2504
537 Ga0307409_100101066 3300031995 Bacteria 2392
538 Ga0307409_100350863 3300031995 Bacteria 1392
539 Ga0307416_100165080 3300032002 Bacteria 2053
540 Ga0307416_100209221 3300032002 Bacteria 1859
541 Ga0307414_10080471 3300032004 Bacteria 2382
542 Ga0307414_10429123 3300032004 Bacteria 1154
543 Ga0307411_10258961 3300032005 Bacteria 1373
544 Ga0307507_10013134 3300033179 Bacteria 10112
545 Ga0307510_10001273 3300033180 Bacteria 27490
546 Ga0307510_10044488 3300033180 Bacteria 4808
547 Ga0307510_10120093 3300033180 Bacteria 2336
548 Ga0315913_1000018 3300033430 Bacteria 102535
549 Ga0315913_1000093 3300033430 Bacteria 51180
550 Ga0315915_1000005 3300033464 Bacteria 397591
551 Ga0315915_1000014 3300033464 Bacteria 171068
552 Ga0373934_0015616 3300035086 Bacteria 2882
553 Ga0373934_0105369 3300035086 Bacteria 1142
554 Ga0373940_0001670 3300035088 Bacteria 4098
555 Ga0373949_0013262 3300035090 Bacteria 1826
556 Ga0373951_0040383 3300035091 Bacteria 1124
557 Ga0373952_0011852 3300035092 Bacteria 1706
558 Ga0373923_0021657 3300035111 Bacteria 2512
559 Ga0373923_0029982 3300035111 Bacteria 2185
560 Ga0373923_0052849 3300035111 Bacteria 1708
561 Ga0373939_0007280 3300035114 Bacteria 2685
562 Ga0373945_0005389 3300035116 Bacteria 4095
563 Ga0373953_0011575 3300035117 Bacteria 3099
564 Ga0373953_0017017 3300035117 Bacteria 2665
565 Ga0373954_0000001 3300035118 Bacteria 158201
566 Ga0373954_0005038 3300035118 Bacteria 5700
567 Ga0373954_0011590 3300035118 Bacteria 3909
568 Ga0373954_0059487 3300035118 Bacteria 1801
569 Ga0373956_0004724 3300035119 Bacteria 5447
570 Ga0373957_0008691 3300035120 Bacteria 3302
571 Ga0373957_0038407 3300035120 Bacteria 1792
572 Ga0373960_0009766 3300035121 Bacteria 2332
573 Ga0373960_0027374 3300035121 Bacteria 1565
574 Ga0373943_0017743 3300035170 Bacteria 3259
575 Ga0373943_0065143 3300035170 Bacteria 1831
576 Ga0373943_0083735 3300035170 Bacteria 1640
577 Ga0373943_0103661 3300035170 Bacteria 1491
578 Ga0373943_0110905 3300035170 Bacteria 1447
579 Ga0373961_0047169 3300035241 Bacteria 1265
580 Ga0373962_0057669 3300035242 Bacteria 1134
581 Ga0373931_0012372 3300035691 Bacteria 4134
582 Ga0373931_0017975 3300035691 Bacteria 3507
583 Ga0373931_0018555 3300035691 Bacteria 3461
584 Ga0373931_0020171 3300035691 Bacteria 3332
585 Ga0373931_0080388 3300035691 Bacteria 1797
586 Ga0373935_0001895 3300035692 Bacteria 11752
587 Ga0373935_0065716 3300035692 Bacteria 2328
588 Ga0373935_0070931 3300035692 Bacteria 2247
589 Ga0373927_0000071 3300035695 Bacteria 73794
590 Ga0373927_0014048 3300035695 Bacteria 5307
591 Ga0373927_0104569 3300035695 Bacteria 1843
592 Ga0373927_0134066 3300035695 Bacteria 1618
593 Ga0373933_0000007 3300035724 Bacteria 123599
594 Ga0373933_0001958 3300035724 Bacteria 11874
595 Ga0373947_0005589 3300035725 Bacteria 7331
596 Ga0373947_0008795 3300035725 Bacteria 5806
597 Ga0373937_0017963 3300036401 Bacteria 6310
598 Ga0373937_0093445 3300036401 Bacteria 2789
599 Ga0373937_0125532 3300036401 Bacteria 2393
600 Ga0373937_0354900 3300036401 Bacteria 1389
601 Ga0373925_0001901 3300037068 Bacteria 17330
602 Ga0373925_0009036 3300037068 Bacteria 7255
603 Ga0373925_0024214 3300037068 Bacteria 4431
604 Ga0395899_0009808 3300037312 Bacteria 7347
605 Ga0395900_0000509 3300037418 Bacteria 54852
606 Ga0395900_0260401 3300037418 Bacteria 1733
607 Ga0395898_0017382 3300037466 Bacteria 7347
608 Ga0395898_0183750 3300037466 Bacteria 1998
609 Ga0395905_0010722 3300037471 Bacteria 8887
610 Ga0395905_0011914 3300037471 Bacteria 8384
611 Ga0395905_0014182 3300037471 Bacteria 7613
612 Ga0436364_0511627 3300037853 Bacteria 3250
613 Ga0436364_1537073 3300037853 Bacteria 1870
614 Ga0395901_0018881 3300038443 Bacteria 7048
615 Ga0395901_0610667 3300038443 Bacteria 1099
616 Ga0436365_0902823 3300039437 Bacteria 17556
617 Ga0436360_0258374 3300039438 Bacteria 5410
618 Ga0436360_0298343 3300039438 Bacteria 1422
619 Ga0436360_0956177 3300039438 Bacteria 1540
620 Ga0436360_1162520 3300039438 Bacteria 3772
621 Ga0436361_0261425 3300039447 Bacteria 5255
622 Ga0436361_0530724 3300039447 Bacteria 1223
623 Ga0436361_0682571 3300039447 Bacteria 5082
624 Ga0436363_0295043 3300039450 Bacteria 3155
625 Ga0436363_1236275 3300039450 Bacteria 5799
626 Ga0436362_0152346 3300039453 Bacteria 3155
627 Ga0451789_0498311 3300041443 Bacteria 1837
628 Ga0451798_0185561 3300041458 Bacteria 3664
629 Ga0451839_0475690 3300041496 Bacteria 1275
630 Ga0451853_1980618 3300041512 Bacteria 2647
631 Ga0439449_0000949 3300042007 Bacteria 11352
632 Ga0439449_0026070 3300042007 Bacteria 2182
633 Ga0439459_0015584 3300042438 Bacteria 1395
634 Ga0439460_0000575 3300042461 Bacteria 8042
635 Ga0466972_0001612 3300044658 Bacteria 11031
636 Ga0466972_0066824 3300044658 Bacteria 1718
637 Ga0466966_0030571 3300044684 Bacteria 3495
638 Ga0466961_0095136 3300044693 Bacteria 1879
639 Ga0466964_0005758 3300044706 Bacteria 4615
640 Ga0466968_0004449 3300044735 Bacteria 5244
641 Ga0466957_0021826 3300044842 Bacteria 3774
642 Ga0451576_0376975 3300045051 Bacteria 1487
643 Ga0495592_0028055 3300046454 Bacteria 4264
644 Ga0495592_0054150 3300046454 Bacteria 2973
645 Ga0495592_0062212 3300046454 Bacteria 2741
646 Ga0495592_0103607 3300046454 Bacteria 2024
647 Ga0495603_0000035 3300046455 Bacteria 57510
648 Ga0495603_0000252 3300046455 Bacteria 28096
649 Ga0495603_0007202 3300046455 Bacteria 6679
650 Ga0495603_0010202 3300046455 Bacteria 5685
651 Ga0495603_0026070 3300046455 Bacteria 3533
652 Ga0495603_0031559 3300046455 Bacteria 3189
653 Ga0495603_0132477 3300046455 Bacteria 1451
654 Ga0495629_0000081 3300046459 Bacteria 85305
655 Ga0495629_0000714 3300046459 Bacteria 26892
656 Ga0495629_0007617 3300046459 Bacteria 7976
657 Ga0495629_0023759 3300046459 Bacteria 4366
658 Ga0495629_0158381 3300046459 Bacteria 1573
659 Ga0495638_0001347 3300046460 Bacteria 22537
660 Ga0495638_0117398 3300046460 Bacteria 1575
661 Ga0495641_0000707 3300046461 Bacteria 28228
662 Ga0495641_0002095 3300046461 Bacteria 16130
663 Ga0495641_0075880 3300046461 Bacteria 1507
664 Ga0495651_0002495 3300046462 Bacteria 14229
665 Ga0495651_0006288 3300046462 Bacteria 9084
666 Ga0495651_0220796 3300046462 Bacteria 1312
667 Ga0495653_0007525 3300046463 Bacteria 8909
668 Ga0495653_0042069 3300046463 Bacteria 3561
669 Ga0495653_0118560 3300046463 Bacteria 1890
670 Ga0495580_0002693 3300046472 Bacteria 15371
671 Ga0495580_0009396 3300046472 Bacteria 7693
672 Ga0495580_0040846 3300046472 Bacteria 3311
673 Ga0495582_0000051 3300046473 Bacteria 59010
674 Ga0495582_0000370 3300046473 Bacteria 24546
675 Ga0495582_0065559 3300046473 Bacteria 2007
676 Ga0495605_0003366 3300046474 Bacteria 9555
677 Ga0495639_0000010 3300046475 Bacteria 93685
678 Ga0495639_0005124 3300046475 Bacteria 5628
679 Ga0495639_0024549 3300046475 Bacteria 2654
680 Ga0495639_0155677 3300046475 Bacteria 1104
681 Ga0495662_0000034 3300046476 Bacteria 46636
682 Ga0495662_0003732 3300046476 Bacteria 7674
683 Ga0495662_0071121 3300046476 Bacteria 1686
684 Ga0495664_0006551 3300046477 Bacteria 6433
685 Ga0495664_0015055 3300046477 Bacteria 4394
686 Ga0495584_0116502 3300046491 Bacteria 1352
687 Ga0495584_0156370 3300046491 Bacteria 1158
688 Ga0495585_0024764 3300046492 Bacteria 3440
689 Ga0495585_0052428 3300046492 Bacteria 2258
690 Ga0495585_0067895 3300046492 Bacteria 1949
691 Ga0495594_0001027 3300046499 Bacteria 14537
692 Ga0495594_0012412 3300046499 Bacteria 4437
693 Ga0495607_0012889 3300046501 Bacteria 5498
694 Ga0495583_0002986 3300046506 Bacteria 13562
695 Ga0495606_0000265 3300046507 Bacteria 92526
696 Ga0495606_0000945 3300046507 Bacteria 42787
697 Ga0495610_0016187 3300046512 Bacteria 4305
698 Ga0495610_0045563 3300046512 Bacteria 2169
699 Ga0495616_0050166 3300046513 Bacteria 2088
700 Ga0495618_0012904 3300046514 Bacteria 5079
701 Ga0495618_0035240 3300046514 Bacteria 3141
702 Ga0495618_0236261 3300046514 Bacteria 1150
703 Ga0495620_0025468 3300046515 Bacteria 2797
704 Ga0495620_0028564 3300046515 Bacteria 2592
705 Ga0495628_0020775 3300046516 Bacteria 5410
706 Ga0495628_0031694 3300046516 Bacteria 4275
707 Ga0495628_0062715 3300046516 Bacteria 2913
708 Ga0495630_0002318 3300046517 Bacteria 13232
709 Ga0495630_0005052 3300046517 Bacteria 9281
710 Ga0495630_0152196 3300046517 Bacteria 1760
711 Ga0495631_0002151 3300046518 Bacteria 11384
712 Ga0495631_0014346 3300046518 Bacteria 3827
713 Ga0495632_0033107 3300046519 Bacteria 2656
714 Ga0495644_0009542 3300046523 Bacteria 3741
715 Ga0495648_0000271 3300046524 Bacteria 58164
716 Ga0495648_0003502 3300046524 Bacteria 13762
717 Ga0495648_0005499 3300046524 Bacteria 10509
718 Ga0495663_0029799 3300046525 Bacteria 1613
719 Ga0495666_0029232 3300046526 Bacteria 2711
720 Ga0495666_0112891 3300046526 Bacteria 1276
721 Ga0495642_0011468 3300046528 Bacteria 3405
722 Ga0495652_0013767 3300046529 Bacteria 7278
723 Ga0495652_0018009 3300046529 Bacteria 6301
724 Ga0495652_0148628 3300046529 Bacteria 1833
725 Ga0495654_0002779 3300046530 Bacteria 11033
726 Ga0495654_0051102 3300046530 Bacteria 2018
727 Ga0495665_0000005 3300046531 Bacteria 86491
728 Ga0495665_0000546 3300046531 Bacteria 19092
729 Ga0495665_0117702 3300046531 Bacteria 1392
730 Ga0495640_0004617 3300046533 Bacteria 10987
731 Ga0495640_0026268 3300046533 Bacteria 4210
732 Ga0495640_0040394 3300046533 Bacteria 3267
733 Ga0495640_0042313 3300046533 Bacteria 3179
734 Ga0495640_0077123 3300046533 Bacteria 2222
735 Ga0495586_0033280 3300046535 Bacteria 2766
736 Ga0495587_0016804 3300046536 Bacteria 4549
737 Ga0495609_0103169 3300046538 Bacteria 1235
738 Ga0495597_0003588 3300046542 Bacteria 8943
739 Ga0495597_0033625 3300046542 Bacteria 2320
740 Ga0495645_0002249 3300046543 Bacteria 13134
741 Ga0495645_0009591 3300046543 Bacteria 6772
742 Ga0495645_0045009 3300046543 Bacteria 3219
743 Ga0495645_0075908 3300046543 Bacteria 2419
744 Ga0495622_0002332 3300046557 Bacteria 9240
745 Ga0495622_0007002 3300046557 Bacteria 5235
746 Ga0495622_0029904 3300046557 Bacteria 2545
747 Ga0495633_0024072 3300046558 Bacteria 3012
748 Ga0495633_0111024 3300046558 Bacteria 1271
749 Ga0495667_0002027 3300046559 Bacteria 13432
750 Ga0495667_0008367 3300046559 Bacteria 7020
751 Ga0495667_0026258 3300046559 Bacteria 3924
752 Ga0495667_0027591 3300046559 Bacteria 3824
753 Ga0495667_0031086 3300046559 Bacteria 3585
754 Ga0495656_0040911 3300046615 Bacteria 1934
755 Ga0495656_0058749 3300046615 Bacteria 1670
756 Ga0495656_0080071 3300046615 Bacteria 1472
757 Ga0495656_0091699 3300046615 Bacteria 1390
758 Ga0495668_0018871 3300046616 Bacteria 3984
759 Ga0495668_0036556 3300046616 Bacteria 2751
760 Ga0495634_0000764 3300046642 Bacteria 31101
761 Ga0495634_0002675 3300046642 Bacteria 14643
762 Ga0495634_0004980 3300046642 Bacteria 10261
763 Ga0495611_0065453 3300046648 Bacteria 1656
764 Ga0495625_0001123 3300046660 Bacteria 34651
765 Ga0495625_0047708 3300046660 Bacteria 3087
766 Ga0495625_0122740 3300046660 Bacteria 1766
767 Ga0495625_0138878 3300046660 Bacteria 1640
768 Ga0495635_0000225 3300046663 Bacteria 35748
769 Ga0495635_0000281 3300046663 Bacteria 32699
770 Ga0495659_0014448 3300046664 Bacteria 2585
771 Ga0495659_0016207 3300046664 Bacteria 2456
772 Ga0495588_0002094 3300046674 Bacteria 8558
773 Ga0495588_0027266 3300046674 Bacteria 2855
774 Ga0495588_0044205 3300046674 Bacteria 2281
775 Ga0495657_0023611 3300046675 Bacteria 4391
776 Ga0495657_0046321 3300046675 Bacteria 2945
777 Ga0495599_0011203 3300046678 Bacteria 5506
778 Ga0495599_0023885 3300046678 Bacteria 3822
779 Ga0495599_0093905 3300046678 Bacteria 1871
780 Ga0495623_0027207 3300046679 Bacteria 3677
781 Ga0495646_0010285 3300046680 Bacteria 5951
782 Ga0495646_0010554 3300046680 Bacteria 5867
783 Ga0495646_0175770 3300046680 Bacteria 1177
784 Ga0495647_0002395 3300046681 Bacteria 5907
785 Ga0495647_0005972 3300046681 Bacteria 4012
786 Ga0495658_0000367 3300046683 Bacteria 25339
787 Ga0495658_0007246 3300046683 Bacteria 5481
788 Ga0495658_0121889 3300046683 Bacteria 1578
789 Ga0495624_0000094 3300046690 Bacteria 59911
790 Ga0495624_0000398 3300046690 Bacteria 34486
791 Ga0495624_0154992 3300046690 Bacteria 1400
792 Ga0495670_0064732 3300046691 Bacteria 1842
793 Ga0495670_0068072 3300046691 Bacteria 1798
794 Ga0495671_0038293 3300046692 Bacteria 2423
795 Ga0495589_0131329 3300046794 Bacteria 1202
796 Ga0495600_0003627 3300046809 Bacteria 9103
797 Ga0495600_0012656 3300046809 Bacteria 5281
798 Ga0495581_0000018 3300047315 Bacteria 58791
799 Ga0495581_0020875 3300047315 Bacteria 3800
800 Ga0495604_0017302 3300047317 Bacteria 5769
801 Ga0495604_0086445 3300047317 Bacteria 2337
802 Ga0495674_0000134 3300047319 Bacteria 56618
803 Ga0495674_0003220 3300047319 Bacteria 15848
804 Ga0495674_0007455 3300047319 Bacteria 10453
805 Ga0495674_0044254 3300047319 Bacteria 3958
806 Ga0495672_0095561 3300047320 Bacteria 1622
807 Ga0495676_0008740 3300047321 Bacteria 9268
808 Ga0495676_0016483 3300047321 Bacteria 6556
809 Ga0495680_0007228 3300047322 Bacteria 10227
810 Ga0495680_0025171 3300047322 Bacteria 4929
811 Ga0495680_0058948 3300047322 Bacteria 2965
812 Ga0495683_0027007 3300047323 Bacteria 2937
813 Ga0495675_0008298 3300047444 Bacteria 6428
814 Ga0495675_0047573 3300047444 Bacteria 2729
815 Ga0495673_0023183 3300047469 Bacteria 3025
816 Ga0495673_0026673 3300047469 Bacteria 2759
817 Ga0495681_0054305 3300047470 Bacteria 1872
818 Ga0495684_0000134 3300047471 Bacteria 54180
819 Ga0495684_0012369 3300047471 Bacteria 6583
820 Ga0495684_0014927 3300047471 Bacteria 5983
821 Ga0495684_0021580 3300047471 Bacteria 4958
822 Ga0495684_0157685 3300047471 Bacteria 1695
823 Ga0495686_0043087 3300047472 Bacteria 2864
824 Ga0495686_0146562 3300047472 Bacteria 1389
825 Ga0495686_0198496 3300047472 Bacteria 1153
826 Ga0495593_0000084 3300047673 Bacteria 41155
827 Ga0495593_0000546 3300047673 Bacteria 21343
828 Ga0495593_0015585 3300047673 Bacteria 4301
829 Ga0495602_0011244 3300048088 Bacteria 9255
830 Ga0495602_0027361 3300048088 Bacteria 5479
831 Ga0496102_0151692 3300048905 Bacteria 2178
832 Ga0496102_0201301 3300048905 Bacteria 1877
833 Ga0496102_0294219 3300048905 Bacteria 1530
834 Ga0496104_0012673 3300048907 Bacteria 7592
835 Ga0496104_0045992 3300048907 Bacteria 4107
836 Ga0496105_0016901 3300048908 Bacteria 5838
837 Ga0496106_0002537 3300048909 Bacteria 13580
838 Ga0496106_0004905 3300048909 Bacteria 9902
839 Ga0496106_0150196 3300048909 Bacteria 1837
840 Ga0496107_0004208 3300048910 Bacteria 9723
841 Ga0496108_0024137 3300048911 Bacteria 5006
842 Ga0496108_0058211 3300048911 Bacteria 3247
843 Ga0496108_0094280 3300048911 Bacteria 2548
844 Ga0496109_0023467 3300048912 Bacteria 5477
845 Ga0496110_0135510 3300048913 Bacteria 2225
846 Ga0496111_0202569 3300048914 Bacteria 1475
847 Ga0496112_0000084 3300048915 Bacteria 61333
848 Ga0496112_0042625 3300048915 Bacteria 4440
849 Ga0496112_0191102 3300048915 Bacteria 2009
850 Ga0496115_0002185 3300048918 Bacteria 14005
851 Ga0496115_0261381 3300048918 Bacteria 1423
852 Ga0496115_0273590 3300048918 Bacteria 1387
853 Ga0496116_0014730 3300048919 Bacteria 6229
854 Ga0496116_0027959 3300048919 Bacteria 4095
855 Ga0496117_0008534 3300048920 Bacteria 9715
856 Ga0496117_0020216 3300048920 Bacteria 5436
857 Ga0496117_0110525 3300048920 Bacteria 1713
858 Ga0496118_0005404 3300048921 Bacteria 14536
859 Ga0496118_0081091 3300048921 Bacteria 2280
860 Ga0496118_0158449 3300048921 Bacteria 1404
861 Ga0496118_0171458 3300048921 Bacteria 1325
862 Ga0496119_0019984 3300048922 Bacteria 4904
863 Ga0496119_0176429 3300048922 Bacteria 1124
864 Ga0496121_0001792 3300048924 Bacteria 34718
865 Ga0496121_0006459 3300048924 Bacteria 14538
866 Ga0496121_0007926 3300048924 Bacteria 12696
867 Ga0496121_0020823 3300048924 Bacteria 6462
868 Ga0496121_0031286 3300048924 Bacteria 4864
869 Ga0496121_0033400 3300048924 Bacteria 4655
870 Ga0496121_0087378 3300048924 Bacteria 2448
871 Ga0496121_0094060 3300048924 Bacteria 2332
872 Ga0496122_0004473 3300048925 Bacteria 17287
873 Ga0496122_0012893 3300048925 Bacteria 8255
874 Ga0496123_0002939 3300048926 Bacteria 19927
875 Ga0496123_0069175 3300048926 Bacteria 2218
876 Ga0496124_0001699 3300048927 Bacteria 31131
877 Ga0496124_0003528 3300048927 Bacteria 19047
878 Ga0496124_0009869 3300048927 Bacteria 9764
879 Ga0496124_0012665 3300048927 Bacteria 8297
880 Ga0496124_0051536 3300048927 Bacteria 3502
881 Ga0496125_0000193 3300048928 Bacteria 130315
882 Ga0496125_0002061 3300048928 Bacteria 27146
883 Ga0496125_0027656 3300048928 Bacteria 5136
884 Ga0496125_0044758 3300048928 Bacteria 3736
885 Ga0496126_0003499 3300048929 Bacteria 19814
886 Ga0496126_0020494 3300048929 Bacteria 6477
887 Ga0496126_0095386 3300048929 Bacteria 2609
888 Ga0496126_0112316 3300048929 Bacteria 2373
889 Ga0496126_0126023 3300048929 Bacteria 2216
890 Ga0496126_0142113 3300048929 Bacteria 2065
891 Ga0496126_0220791 3300048929 Bacteria 1592
892 Ga0496126_0232896 3300048929 Bacteria 1542
893 Ga0495678_019920 3300049459 Bacteria 2981
894 Ga0495682_0066948 3300049460 Bacteria 1294
895 Ga0501031_0000014 3300049568 Bacteria 127199
896 Ga0501031_0007601 3300049568 Bacteria 7055
897 Ga0501031_0015537 3300049568 Bacteria 4942
898 Ga0501032_0000015 3300049569 Bacteria 176755
899 Ga0501032_0000025 3300049569 Bacteria 138521
900 Ga0501032_0023077 3300049569 Bacteria 4306
901 Ga0501033_0000023 3300049570 Bacteria 176725
902 Ga0501033_0000931 3300049570 Bacteria 26715
903 Ga0501033_0021850 3300049570 Bacteria 4828
904 Ga0501033_0027504 3300049570 Bacteria 4275
905 Ga0501033_0033122 3300049570 Bacteria 3880
906 Ga0501034_0000073 3300049571 Bacteria 176737
907 Ga0501034_0001297 3300049571 Bacteria 33813
908 Ga0501034_0027566 3300049571 Bacteria 5777
909 Ga0501034_0053282 3300049571 Bacteria 4074
910 Ga0501034_0054225 3300049571 Bacteria 4036
911 Ga0501034_0068536 3300049571 Bacteria 3557
912 Ga0501034_0074521 3300049571 Bacteria 3402
913 Ga0501034_0181944 3300049571 Bacteria 2066
914 Ga0501034_0269304 3300049571 Bacteria 1645
915 Ga0501036_0000002 3300049572 Bacteria 293106
916 Ga0501036_0003093 3300049572 Bacteria 13272
917 Ga0501036_0166554 3300049572 Bacteria 1857
918 Ga0501037_0000158 3300049573 Bacteria 63431
919 Ga0501037_0001431 3300049573 Bacteria 17511
920 Ga0501037_0090739 3300049573 Bacteria 2210
921 Ga0501038_0000002 3300049574 Bacteria 330446
922 Ga0501038_0000521 3300049574 Bacteria 33813
923 Ga0501038_0022729 3300049574 Bacteria 5614
924 Ga0501038_0029867 3300049574 Bacteria 4828
925 Ga0501039_0000002 3300049575 Bacteria 375152
926 Ga0501039_0000003 3300049575 Bacteria 357424
927 Ga0501040_0033762 3300049576 Bacteria 3468
928 Ga0501042_0078933 3300049578 Bacteria 2358
929 Ga0501043_0000140 3300049579 Bacteria 67478
930 Ga0501043_0001411 3300049579 Bacteria 20993
931 Ga0501046_0014546 3300049580 Bacteria 6634
932 Ga0501046_0024079 3300049580 Bacteria 4999
933 Ga0501046_0043381 3300049580 Bacteria 3581
934 Ga0501047_0019631 3300049581 Bacteria 6485
935 Ga0501047_0165299 3300049581 Bacteria 2083
936 Ga0501067_0063288 3300049583 Bacteria 2048
937 Ga0501067_0065099 3300049583 Bacteria 2018
938 Ga0501067_0097731 3300049583 Bacteria 1631
939 Ga0501069_0057590 3300049585 Bacteria 2167
940 Ga0501069_0068924 3300049585 Bacteria 1980
941 Ga0501070_0018750 3300049586 Bacteria 5804
942 Ga0501070_0037504 3300049586 Bacteria 4046
943 Ga0501070_0137619 3300049586 Bacteria 2016
944 Ga0501070_0193776 3300049586 Bacteria 1670
945 Ga0501071_0009317 3300049587 Bacteria 6537
946 Ga0501072_0024507 3300049588 Bacteria 4694
947 Ga0501072_0154070 3300049588 Bacteria 1833
948 Ga0501073_0015427 3300049589 Bacteria 5542
949 Ga0501073_0052327 3300049589 Bacteria 2860
950 Ga0501074_0009248 3300049590 Bacteria 7157
951 Ga0501074_0076634 3300049590 Bacteria 2400
952 Ga0501074_0114110 3300049590 Bacteria 1933
953 Ga0501074_0231070 3300049590 Bacteria 1317
954 Ga0501076_0050344 3300049592 Bacteria 3295
955 Ga0501077_0031226 3300049593 Bacteria 3389
956 Ga0501079_0017209 3300049741 Bacteria 5519
957 Ga0501035_0000022 3300049822 Bacteria 208622
958 Ga0501035_0001751 3300049822 Bacteria 21915
959 Ga0501035_0031501 3300049822 Bacteria 4828
960 Ga0501044_0000002 3300049823 Bacteria 375152
961 Ga0501044_0004669 3300049823 Bacteria 15329
962 Ga0501044_0029622 3300049823 Bacteria 5770
963 Ga0501044_0087557 3300049823 Bacteria 3145
964 Ga0501044_0105076 3300049823 Bacteria 2837
965 Ga0501044_0167857 3300049823 Bacteria 2168
966 Ga0501045_0008342 3300049824 Bacteria 7216
967 Ga0501045_0019288 3300049824 Bacteria 4859
968 nmdc:mga03683_1313_c1 3300050489 Bacteria 7347
969 nmdc:mga03683_24137_c1 3300050489 Bacteria 2376
970 nmdc:mga03683_38063_c1 3300050489 Bacteria 1963
971 nmdc:mga03n38_39675_c1 3300050490 Bacteria 2043
972 nmdc:mga03n38_44108_c1 3300050490 Bacteria 1957
973 nmdc:mga03n38_57037_c1 3300050490 Bacteria 1765
974 nmdc:mga03n38_905_c1 3300050490 Bacteria 7978
975 nmdc:mga03n38_9552_c1 3300050490 Bacteria 3535
976 nmdc:mga00v17_145042_c1 3300050491 Bacteria 1523
977 nmdc:mga00v17_178523_c1 3300050491 Bacteria 1370
978 nmdc:mga00v17_29345_c1 3300050491 Bacteria 3228
979 nmdc:mga00v17_63735_c1 3300050491 Bacteria 2271
980 nmdc:mga0yw44_1207_c1 3300050492 Bacteria 10116
981 nmdc:mga0yw44_21492_c1 3300050492 Bacteria 3601
982 nmdc:mga0yw44_41026_c1 3300050492 Bacteria 2753
983 nmdc:mga0k408_147172_c1 3300050493 Bacteria 1402
984 nmdc:mga0k408_261073_c1 3300050493 Bacteria 1034
985 nmdc:mga0k408_28184_c1 3300050493 Bacteria 3193
986 nmdc:mga0k408_60577_c1 3300050493 Bacteria 2200
987 nmdc:mga06z11_12870_c1 3300050494 Bacteria 3652
988 nmdc:mga06z11_13853_c1 3300050494 Bacteria 3555
989 nmdc:mga06z11_208164_c1 3300050494 Bacteria 1139
990 nmdc:mga06z11_23978_c1 3300050494 Bacteria 2873
991 nmdc:mga06z11_5558_c1 3300050494 Bacteria 5068
992 nmdc:mga06z11_5949_c1 3300050494 Bacteria 4929
993 nmdc:mga04h51_1408_c1 3300050495 Bacteria 5562
994 nmdc:mga04h51_53586_c1 3300050495 Bacteria 1361
995 nmdc:mga04h51_9170_c1 3300050495 Bacteria 2670
996 nmdc:mga07m45_213841_c1 3300050496 Bacteria 1121
997 nmdc:mga07m45_39768_c2 3300050496 Bacteria 2445
998 nmdc:mga07m45_39888_c1 3300050496 Bacteria 2626
999 nmdc:mga07m45_4286_c1 3300050496 Bacteria 6981
1000 nmdc:mga07m45_4857_c1 3300050496 Bacteria 6613
1001 nmdc:mga07m45_85797_c1 3300050496 Bacteria 1800
1002 nmdc:mga05p37_132010_c1 3300050507 Bacteria 3064
1003 nmdc:mga09592_190268_c1 3300050508 Bacteria 1776
1004 nmdc:mga0qj67_143950_c1 3300050509 Bacteria 1933
1005 nmdc:mga0qj67_80_c1 3300050509 Bacteria 66211
1006 nmdc:mga06r32_386391_c1 3300050510 Bacteria 1382
1007 nmdc:mga06r32_69498_c1 3300050510 Bacteria 3404
1008 nmdc:mga08y16_156295_c1 3300050511 Bacteria 2370
1009 nmdc:mga08y16_66144_c1 3300050511 Bacteria 3773
1010 nmdc:mga0n895_16529_c1 3300050512 Bacteria 6774
1011 nmdc:mga0n895_56495_c1 3300050512 Bacteria 3867
1012 nmdc:mga0a205_16737_c1 3300050515 Bacteria 6866
1013 nmdc:mga0a205_7682_c1 3300050515 Bacteria 9782
1014 nmdc:mga0sz30_16429_c1 3300050516 Bacteria 2939
1015 nmdc:mga0sz30_26767_c1 3300050516 Bacteria 2366
1016 nmdc:mga0sz30_35868_c2 3300050516 Bacteria 1763
1017 nmdc:mga0sz30_6895_c1 3300050516 Bacteria 4242
1018 nmdc:mga0sz30_82591_c1 3300050516 Bacteria 1391
1019 Ga0495601_0008691 3300053077 Bacteria 5993
1020 Ga0495601_0023512 3300053077 Bacteria 3787
1021 Ga0495601_0028032 3300053077 Bacteria 3486
1022 Ga0495601_0067995 3300053077 Bacteria 2270
1023 Ga0495612_0006612 3300053078 Bacteria 4758
1024 Ga0495655_0011254 3300053083 Bacteria 1793
1025 Ga0495595_0000892 3300053084 Bacteria 11473
1026 Ga0495595_0015333 3300053084 Bacteria 3267
1027 Ga0495595_0027513 3300053084 Bacteria 2534
1028 Ga0495595_0112307 3300053084 Bacteria 1322
1029 Ga0495619_0000733 3300053085 Bacteria 21426
1030 Ga0495619_0043765 3300053085 Bacteria 2937
1031 Ga0495619_0044395 3300053085 Bacteria 2917
1032 Ga0500578_0201951 3300053086 Bacteria 1216
1033 Ga0500643_000062 3300053087 Bacteria 122407
1034 Ga0500646_0048158 3300053090 Bacteria 1221
1035 Ga0500583_0027485 3300053092 Bacteria 2456
1036 Ga0500583_0158696 3300053092 Bacteria 1126
1037 Ga0500651_0016777 3300053093 Bacteria 4507
1038 Ga0500566_0000012 3300053094 Bacteria 117873
1039 Ga0500640_000451 3300053095 Bacteria 10028
1040 Ga0500554_001597 3300053102 Bacteria 4365
1041 Ga0500556_0039210 3300053104 Bacteria 1658
1042 Ga0500556_0093007 3300053104 Bacteria 1154
1043 Ga0500569_033562 3300053109 Bacteria 1459
1044 Ga0500591_002497 3300053115 Bacteria 7559
1045 Ga0500594_0033424 3300053118 Bacteria 1368
1046 Ga0500595_009948 3300053119 Bacteria 3804
1047 Ga0500595_019122 3300053119 Bacteria 2491
1048 Ga0500595_040260 3300053119 Bacteria 1508
1049 Ga0500614_001289 3300053123 Bacteria 6056
1050 Ga0500614_039828 3300053123 Bacteria 1190
1051 Ga0500618_009065 3300053125 Bacteria 2737
1052 Ga0500642_0058151 3300053130 Bacteria 1727
1053 Ga0500658_0004005 3300053134 Bacteria 5531
1054 Ga0500658_0049595 3300053134 Bacteria 1711
1055 Ga0500559_0003889 3300053136 Bacteria 7218
1056 Ga0500568_0000048 3300053139 Bacteria 119025
1057 Ga0500568_0000506 3300053139 Bacteria 28722
1058 Ga0500568_0009612 3300053139 Bacteria 4581
1059 Ga0500568_0030580 3300053139 Bacteria 2228
1060 Ga0500577_0000244 3300053142 Bacteria 14143
1061 Ga0500577_0001624 3300053142 Bacteria 5760
1062 Ga0500589_061893 3300053147 Bacteria 1713
1063 Ga0500603_000344 3300053150 Bacteria 12152
1064 Ga0500603_000521 3300053150 Bacteria 9730
1065 Ga0500616_0001481 3300053153 Bacteria 22313
1066 Ga0500616_0038220 3300053153 Bacteria 2593
1067 Ga0500616_0130304 3300053153 Bacteria 1189
1068 Ga0500622_0061822 3300053156 Bacteria 1908
1069 Ga0500627_0001861 3300053158 Bacteria 6035
1070 Ga0500630_002638 3300053159 Bacteria 8626
1071 Ga0500638_068459 3300053162 Bacteria 1699
1072 Ga0500638_108914 3300053162 Bacteria 1282
1073 Ga0500639_000058 3300053163 Bacteria 50219
1074 Ga0500636_0107433 3300053177 Bacteria 1580
1075 Ga0500637_0003484 3300053178 Bacteria 7276
1076 Ga0500637_0044585 3300053178 Bacteria 2513
1077 Ga0500645_004456 3300053730 Bacteria 5372
1078 Ga0500596_001233 3300053735 Bacteria 5182
1079 Ga0500601_002416 3300053737 Bacteria 2007
1080 Ga0587077_004909 3300059493 Bacteria 1792
1081 Ga0587077_007045 3300059493 Bacteria 1620
1082 Ga0587082_004781 3300059504 Bacteria 1723
1083 Ga0587101_002342 3300059623 Bacteria 1793
1084 Ga0587062_002285 3300059639 Bacteria 1800
1085 Ga0587076_002433 3300059645 Bacteria 2084
1086 Ga0501082_0078895 3300060353 Bacteria 2840
1087 Ga0530510_0068114 3300061734 Bacteria 2582
1088 2509107847 2508501122 Bacteria 6292184
1089 2509152747 2508501128 Bacteria 8613869
1090 2509376244 2509276019 Bacteria 6802256
1091 2509387107 2509276021 Bacteria 7634384
1092 2509442598 2509276033 Bacteria 7180565
1093 2510132853 2510065019 Bacteria 6903379
1094 2510307472 2510065057 Bacteria 6649661
1095 2510307520 2510065057 Bacteria 6649661
1096 2510894227 2510461076 Bacteria 8618824
1097 2510899252 2510461076 Bacteria 8618824
1098 2511501391 2511231052 Bacteria 6974333
1099 2511502788 2511231052 Bacteria 6974333
1100 2512534076 2512047086 Bacteria 6850303
1101 2512971864 2512875026 Bacteria 6861065
1102 2512974203 2512875026 Bacteria 6861065
1103 2513570058 2513237084 Bacteria 7231967
1104 2513575308 2513237085 Bacteria 7695351
1105 2513583156 2513237086 Bacteria 7265287
1106 2513584009 2513237086 Bacteria 7265287
1107 2513602191 2513237089 Bacteria 6553624
1108 2513607520 2513237089 Bacteria 6553624
1109 2513617072 2513237091 Bacteria 6900273
1110 2513617779 2513237091 Bacteria 6900273
1111 2513633002 2513237093 Bacteria 7545552
1112 2513692276 2513237101 Bacteria 7952346
1113 2513694907 2513237101 Bacteria 7952346
1114 2513710276 2513237103 Bacteria 7647401
1115 2513723886 2513237104 Bacteria 10034502
1116 2513882150 2513237140 Bacteria 7076289
1117 2513886269 2513237140 Bacteria 7076289
1118 2513890418 2513237141 Bacteria 8496279
1119 2513905472 2513237143 Bacteria 6664116
1120 2513906324 2513237143 Bacteria 6664116
1121 2513987606 2513237156 Bacteria 6402557
1122 2513988404 2513237156 Bacteria 6402557
1123 2514000302 2513237159 Bacteria 6810126
1124 2514003778 2513237160 Bacteria 6650282
1125 2514005415 2513237160 Bacteria 6650282
1126 2514019850 2513237162 Bacteria 7468464
1127 2515111805 2515075009 Bacteria 7288508
1128 2515610504 2515154107 Bacteria 6795637
1129 2515611472 2515154107 Bacteria 6795637
1130 2515639406 2515154113 Bacteria 7807172
1131 2515642137 2515154114 Bacteria 7848616
1132 2515656190 2515154116 Bacteria 7552979
1133 2515739006 2515154134 Bacteria 7220242
1134 2516209260 2516143018 Bacteria 6951533
1135 2516892670 2516653046 Bacteria 6989037
1136 2516894157 2516653046 Bacteria 6989037
1137 2517035529 2516653077 Bacteria 7555578
1138 2517075989 2516653085 Bacteria 7346596
1139 2517094728 2517093000 Bacteria 7412387
1140 2517406353 2517287029 Bacteria 6905599
1141 2517569478 2517487022 Bacteria 7227575
1142 2517570843 2517487022 Bacteria 7227575
1143 2517892855 2517572143 Bacteria 9484767
1144 2523102290 2522572158 Bacteria 6514390
1145 2524442248 2524023205 Bacteria 8918781
1146 2524443782 2524023205 Bacteria 8918781
1147 2524452891 2524023207 Bacteria 6813453
1148 2524453518 2524023207 Bacteria 6813453
1149 2524464219 2524023210 Bacteria 9029266
1150 2524466466 2524023210 Bacteria 9029266
1151 2524540740 2524023228 Bacteria 10118060
1152 2530645112 2529292951 Bacteria 6916614
1153 2535486892 2534681786 Bacteria 3308809
1154 2551674139 2551306084 Bacteria 8942552
1155 2551674661 2551306084 Bacteria 8942552
1156 2551676290 2551306084 Bacteria 8942552
1157 2551684504 2551306085 Bacteria 7347181
1158 2551689596 2551306085 Bacteria 7347181
1159 2551690397 2551306086 Bacteria 6843938
1160 2551697106 2551306086 Bacteria 6843938
1161 2551698018 2551306087 Bacteria 7351905
1162 2551698584 2551306087 Bacteria 7351905
1163 2551710483 2551306089 Bacteria 7162724
1164 2551712309 2551306089 Bacteria 7162724
1165 2551718693 2551306090 Bacteria 7953713
1166 2551722358 2551306090 Bacteria 7953713
1167 2551731033 2551306091 Bacteria 7086830
1168 2551731324 2551306091 Bacteria 7086830
1169 2551736505 2551306092 Bacteria 6992595
1170 2551738478 2551306092 Bacteria 6992595
1171 2551739993 2551306093 Bacteria 7064773
1172 2551744914 2551306093 Bacteria 7064773
1173 2558863112 2558860100 Bacteria 8458965
1174 2585168318 2582581283 Bacteria 6030556
1175 2585230067 2582581299 Bacteria 6518058
1176 2585254331 2582581304 Bacteria 5831370
1177 2585268945 2582581306 Bacteria 6450535
1178 2585389470 2582581865 Bacteria 6644329
1179 2585393916 2582581866 Bacteria 6859583
1180 2585528131 2585427526 Bacteria 7258840
1181 2585540339 2585427528 Bacteria 6842387
1182 2585838538 2585427593 Bacteria 7141551
1183 2585845747 2585427594 Bacteria 6180594
1184 2600192347 2599185352 Bacteria 7228948
1185 2600194710 2599185352 Bacteria 7228948
1186 2600375617 2600254933 Bacteria 4750527
1187 2617381621 2617270742 Bacteria 6808054
1188 2643772757 2643221550 Bacteria 4619371
1189 2643775485 2643221551 Bacteria 3750538
1190 2643793931 2643221555 Bacteria 3749717
1191 2643804007 2643221557 Bacteria 7184309
1192 2643808429 2643221557 Bacteria 7184309
1193 2643837425 2643221564 Bacteria 4193379
1194 2644049544 2643221607 Bacteria 6314006
1195 2644064809 2643221610 Bacteria 7480339
1196 2644066478 2643221610 Bacteria 7480339
1197 2644108662 2643221618 Bacteria 7717186
1198 2644109510 2643221618 Bacteria 7717186
1199 2644145194 2643221626 Bacteria 8069654
1200 2644146621 2643221626 Bacteria 8069654
1201 2644193138 2643221634 Bacteria 6705461
1202 2644204048 2643221636 Bacteria 6583769
1203 2644307775 2643221655 Bacteria 7722067
1204 2644312215 2643221655 Bacteria 7722067
1205 2644332550 2643221659 Bacteria 7890716
1206 2644333858 2643221659 Bacteria 7890716
1207 2644335841 2643221659 Bacteria 7890716
1208 2644376252 2643221668 Bacteria 7306521
1209 2644378066 2643221668 Bacteria 7306521
1210 2644415309 2643221675 Bacteria 7473456
1211 2644416482 2643221675 Bacteria 7473456
1212 2644449522 2643221680 Bacteria 7473610
1213 2644450290 2643221680 Bacteria 7473610
1214 2644482578 2643221686 Bacteria 6310811
1215 2644494702 2643221688 Bacteria 5260751
1216 2644499080 2643221689 Bacteria 6042950
1217 2644544297 2643221698 Bacteria 7756764
1218 2644546698 2643221698 Bacteria 7756764
1219 2644613864 2643221712 Bacteria 7729434
1220 2644617898 2643221712 Bacteria 7729434
1221 2644676908 2643221723 Bacteria 7095460
1222 2644677923 2643221723 Bacteria 7095460
1223 2644687842 2643221726 Bacteria 7455827
1224 2644688097 2643221726 Bacteria 7455827
1225 2644731907 2643221733 Bacteria 5690728
1226 2644737234 2643221734 Bacteria 5365412
1227 2644746970 2643221736 Bacteria 6608466
1228 2644747364 2643221736 Bacteria 6608466
1229 2657683691 2657244999 Bacteria 5946535
1230 2671117546 2667528175 Bacteria 7532676
1231 2692316416 2690316117 Bacteria 6800650
1232 2719385383 2718217927 Bacteria 6972593
1233 2721399132 2718218423 Bacteria 6438183
1234 2723845351 2721755755 Bacteria 8322773
1235 2724037945 2721755809 Bacteria 6438790
1236 2725950422 2724679232 Bacteria 7646494
1237 2728751656 2728368998 Bacteria 8720350
1238 2738799292 2738541293 Bacteria 7065685
1239 2739038264 2738541333 Bacteria 7106503
1240 2745080053 2744054633 Bacteria 8678936
1241 2753359040 2751185800 Bacteria 5467370
1242 2757571718 2757320392 Bacteria 3737298
1243 2758641278 2758568016 Bacteria 5645291
1244 2766067946 2765235942 Bacteria 7445910
1245 2778176408 2775507266 Bacteria 7392367
1246 2792581183 2791355082 Bacteria 5973319
1247 2792623190 2791355091 Bacteria 6135441
1248 2792626954 2791355092 Bacteria 6248105
1249 2792642617 2791355094 Bacteria 7011481
1250 2793068181 2791355197 Bacteria 8420563
1251 2793083451
1252 2793297124 2791355256 Bacteria 6798008
1253 2793313896 2791355259 Bacteria 7254731
1254 2793337316 2791355262 Bacteria 6774204
1255 2793360413 2791355266 Bacteria 7116587
1256 2802718065 2802428858 Bacteria 6636079
1257 2802718860 2802428858 Bacteria 6636079
1258 2802725083 2802428859 Bacteria 6667919
1259 2802726471 2802428859 Bacteria 6667919
1260 2802730793 2802428860 Bacteria 6525526
1261 2802733014 2802428860 Bacteria 6525526
1262 2802738140 2802428861 Bacteria 6534206
1263 2802738369 2802428861 Bacteria 6534206
1264 2802743991 2802428862 Bacteria 6633353
1265 2802744701 2802428862 Bacteria 6633353
1266 2802750869 2802428863 Bacteria 6410669
1267 2802751093 2802428863 Bacteria 6410669
1268 2804751872 2802429268 Bacteria 6094027
1269 2806045561 2802429633 Bacteria 7341974
1270 2806051635 2802429634 Bacteria 7083200
1271 2806061679 2802429635 Bacteria 7650140
1272 2806067860 2802429636 Bacteria 7597525
1273 2806072787 2802429637 Bacteria 7067217
1274 2819687460 2818991461 Bacteria 7026071
1275 2819719065 2818991467 Bacteria 5893227
1276 2838079339 2838074704 Bacteria 6785777
1277 2838682642 2838680041 Bacteria 6545511
1278 2838689061 2838686498 Bacteria 7807632
1279 2838697221 2838694306 Bacteria 6853137
1280 2838709546 2838707686 Bacteria 6619912
1281 2838730396 2838729681 Bacteria 7400765
1282 2838743337 2838742623 Bacteria 7396178
1283 2841762291 2841760612 Bacteria 6454112
1284 2841762568 2841760612 Bacteria 6454112
1285 2841854976 2841851746 Bacteria 7532261
1286 2841864978 2841864319 Bacteria 6742987
1287 2842077712 2842077413 Bacteria 6508645
1288 2842110955 2842110456 Bacteria 7656360
1289 2842119779 2842118031 Bacteria 7033875
1290 2842157838 2842156927 Bacteria 6894975
1291 2842165053 2842163707 Bacteria 6916235
1292 2842180578 2842180545 Bacteria 6888678
1293 2842197084 2842192696 Bacteria 6147454
1294 2842206484 2842205361 Bacteria 6340321
1295 2842220554 2842217011 Bacteria 7497767
1296 2842236273 2842229732 Bacteria 7475766
1297 2842238959 2842237096 Bacteria 6620661
1298 2842244515 2842243621 Bacteria 7421798
1299 2842258328 2842257432 Bacteria 7401195
1300 2842273081 2842271015 Bacteria 7807131
1301 2842279941 2842278818 Bacteria 6340002
1302 2842291374 2842291075 Bacteria 7076806
1303 2842309438 2842304105 Bacteria 7023636
1304 2842346970 2842341865 Bacteria 7003929
1305 2842366803 2842363717 Bacteria 6844742
1306 2842373217 2842370503 Bacteria 7038661
1307 2842377770 2842377471 Bacteria 7140707
1308 2842386289 2842384541 Bacteria 7057858
1309 2842399554 2842395702 Bacteria 6780583
1310 2842525971 2842521101 Bacteria 6569494
1311 2844109829 2844104063 Bacteria 6440972
1312 2844110106 2844104063 Bacteria 6440972
1313 2844169059 2844163670 Bacteria 7266046
1314 2844170386 2844163670 Bacteria 7266046
1315 2844459585 2844454524 Bacteria 7952546
1316 2847418515 2847417321 Bacteria 6913799
1317 2848993493 2848992105 Bacteria 6810864
1318 2850080816 2850079185 Bacteria 6848280
1319 2851183321 2851182111 Bacteria 6047226
1320 2851187017 2851182111 Bacteria 6047226
1321 2851248304 2851246043 Bacteria 6439203
1322 2851248581 2851246043 Bacteria 6439203
1323 2854902010 2854896431 Bacteria 5869725
1324 2854912672 2854911287 Bacteria 5582813
1325 2854916918 2854916844 Bacteria 5725939
1326 2855825481 2855825444 Bacteria 6785811
1327 2855826876 2855825444 Bacteria 6785811
1328 2855840859 2855839649 Bacteria 7135830
1329 2855842272 2855839649 Bacteria 7135830
1330 2855873322 2855872281 Bacteria 6964271
1331 2857522937 2857516855 Bacteria 7787325
1332 2858801402 2858800743 Bacteria 6603254
1333 2858803088 2858800743 Bacteria 6603254
1334 2874608744 2874604998 Bacteria 7834745
1335 2876767226 2876761206 Bacteria 10111113
1336 2882462972 2882456835 Bacteria 6863978
1337 2885380104 2885374607 Bacteria 8927485
1338 2889040105 2889033259 Bacteria 9099371
1339 2894773328 2894772417 Bacteria 5305674
1340 2896387006 2896384573 Bacteria 7700774
1341 2899807525 2899803654 Bacteria 5577784
1342 2903750550 2903748898 Bacteria 9972761
1343 2904696167 2904690495 Bacteria 9412302
1344 2904703036
1345 2906618088
1346 2908743283 2908739725 Bacteria 8628932
1347 2908760801 2908756301 Bacteria 8864324
1348 2913300460 2913295892 Bacteria 6333755
1349 2915651550 2915650412 Bacteria 4288180
1350 2915653391 2915650412 Bacteria 4288180
1351 2915980391 2915980308 Bacteria 6624279
1352 2915985219 2915980308 Bacteria 6624279
1353 2915987473 2915986958 Bacteria 6739310
1354 2915993148 2915986958 Bacteria 6739310
1355 2915996974 2915993759 Bacteria 7016183
1356 2915999372 2915993759 Bacteria 7016183
1357 2916003934 2916000859 Bacteria 6865702
1358 2916004561 2916000859 Bacteria 6865702
1359 2916011563 2916007675 Bacteria 6898660
1360 2916012939 2916007675 Bacteria 6898660
1361 2916015166 2916014648 Bacteria 6946486
1362 2916020874 2916014648 Bacteria 6946486
1363 2916022755 2916021584 Bacteria 6854472
1364 2916025747 2916021584 Bacteria 6854472
1365 2916030459 2916028427 Bacteria 6748433
1366 2916033484 2916028427 Bacteria 6748433
1367 2916038520 2916035215 Bacteria 6755766
1368 2916041791 2916035215 Bacteria 6755766
1369 2916046813 2916041962 Bacteria 6820487
1370 2916048061 2916041962 Bacteria 6820487
1371 2916049904 2916048683 Bacteria 6543552
1372 2916053960 2916048683 Bacteria 6543552
1373 2916057431 2916055098 Bacteria 6758838
1374 2916060175 2916055098 Bacteria 6758838
1375 2916066968 2916061851 Bacteria 6737736
1376 2916068088 2916061851 Bacteria 6737736
1377 2916070791 2916068649 Bacteria 6943657
1378 2916078299 2916076590 Bacteria 6596108
1379 2916079954 2916076590 Bacteria 6596108
1380 2917699182 2917699015 Bacteria 7043791
1381 2917699602 2917699015 Bacteria 7043791
1382 2920765591 2920760137 Bacteria 7427611
1383 2920824234 2920822456 Bacteria 6897201
1384 2920828681 2920822456 Bacteria 6897201
1385 2921201610 2921201388 Bacteria 6926299
1386 2921204995 2921201388 Bacteria 6926299
1387 2921209183 2921208531 Bacteria 6745326
1388 2921214633 2921208531 Bacteria 6745326
1389 2921238561 2921237296 Bacteria 6876710
1390 2921244173 2921237296 Bacteria 6876710
1391 2921244883 2921244191 Bacteria 6568419
1392 2921248129 2921244191 Bacteria 6568419
1393 2921252208 2921250672 Bacteria 6677771
1394 2921253024 2921250672 Bacteria 6677771
1395 2921257492 2921257292 Bacteria 6808382
1396 2921260486 2921257292 Bacteria 6808382
1397 2921267443 2921263974 Bacteria 6864552
1398 2921269071 2921263974 Bacteria 6864552
1399 2921283097 2921282425 Bacteria 6826397
1400 2921285529 2921282425 Bacteria 6826397
1401 2921292644 2921289301 Bacteria 7316391
1402 2921294482 2921289301 Bacteria 7316391
1403 2921300304 2921296804 Bacteria 7176999
1404 2921301361 2921296804 Bacteria 7176999
1405 2922363316 2922361189 Bacteria 7436256
1406 2922365103 2922361189 Bacteria 7436256
1407 2922388598 2922386360 Bacteria 7017218
1408 2922390740 2922386360 Bacteria 7017218
1409 2922429986
1410 2924145480 2924144063 Bacteria 6883928
1411 2924146434 2924144063 Bacteria 6883928
1412 2924156388 2924150972 Bacteria 7169444
1413 2924158937 2924158325 Bacteria 7188855
1414 2924160060 2924158325 Bacteria 7188855
1415 2924170263 2924165586 Bacteria 7260590
1416 2924171377 2924165586 Bacteria 7260590
1417 2924175742 2924172951 Bacteria 6749356
1418 2924178278 2924172951 Bacteria 6749356
1419 2924182445 2924179722 Bacteria 6843264
1420 2924183034 2924179722 Bacteria 6843264
1421 2924187328 2924186466 Bacteria 6876637
1422 2924189389 2924186466 Bacteria 6876637
1423 2924197240 2924193448 Bacteria 6955718
1424 2924198631 2924193448 Bacteria 6955718
1425 2924201687 2924200457 Bacteria 6757188
1426 2924202727 2924200457 Bacteria 6757188
1427 2924213559 2924207177 Bacteria 6917007
1428 2924213922 2924207177 Bacteria 6917007
1429 2924217412 2924214083 Bacteria 7080103
1430 2924219884 2924214083 Bacteria 7080103
1431 2924223137 2924221636 Bacteria 7113495
1432 2924227510 2924221636 Bacteria 7113495
1433 2924233581 2924228884 Bacteria 6633132
1434 2924234725 2924228884 Bacteria 6633132
1435 2933575788 2933570622 Bacteria 7023390
1436 2933586980 2933586486 Bacteria 7667493
1437 2935633551 2935630451 Bacteria 8169952
1438 2935898922 2935894831 Bacteria 6620579
1439 2935904888 2935901341 Bacteria 7341747
1440 2936373188 2936367885 Bacteria 7324495
1441 2936381333 2936375103 Bacteria 6652732
1442 2936997746 2936996657 Bacteria 6298727
1443 2936999882 2936996657 Bacteria 6298727
1444 2937004690 2937002841 Bacteria 6934057
1445 2937008320 2937002841 Bacteria 6934057
1446 2937011000 2937009748 Bacteria 6746052
1447 2937012533 2937009748 Bacteria 6746052
1448 2937016985 2937016420 Bacteria 6782579
1449 2937018334 2937016420 Bacteria 6782579
1450 2937025818 2937023124 Bacteria 6815156
1451 2937029227 2937023124 Bacteria 6815156
1452 2937031194 2937029754 Bacteria 6424026
1453 2937032388 2937029754 Bacteria 6424026
1454 2937036670 2937036028 Bacteria 6846469
1455 2937040860 2937036028 Bacteria 6846469
1456 2937043668 2937042894 Bacteria 6741576
1457 2937049587 2937042894 Bacteria 6741576
1458 2937051850 2937049772 Bacteria 6757901
1459 2937052131 2937049772 Bacteria 6757901
1460 2937059020 2937056579 Bacteria 7107896
1461 2937059625 2937056579 Bacteria 7107896
1462 2937065014 2937063883 Bacteria 7199456
1463 2937067034 2937063883 Bacteria 7199456
1464 2937074648 2937071275 Bacteria 6984483
1465 2937075673 2937071275 Bacteria 6984483
1466 2937078457 2937078374 Bacteria 6610289
1467 2937079988 2937078374 Bacteria 6610289
1468 2937085526 2937084907 Bacteria 6618516
1469 2937086256 2937084907 Bacteria 6618516
1470 2937097105 2937091812 Bacteria 6979387
1471 2937097613 2937091812 Bacteria 6979387
1472 2937102956 2937098957 Bacteria 7249374
1473 2937106019 2937098957 Bacteria 7249374
1474 2937110782 2937106411 Bacteria 6947143
1475 2937112896 2937106411 Bacteria 6947143
1476 2937114997 2937113482 Bacteria 6505872
1477 2937117830 2937113482 Bacteria 6505872
1478 2937121385 2937119839 Bacteria 6597547
1479 2937123146 2937119839 Bacteria 6597547
1480 2937127999 2937126314 Bacteria 6771275
1481 2937129559 2937126314 Bacteria 6771275
1482 2941499809 2941499720 Bacteria 7599444
1483 2941501876 2941499720 Bacteria 7599444
1484 2941510442 2941507105 Bacteria 8166816
1485 2941517821 2941515067 Bacteria 8166720
1486 2941525837 2941523033 Bacteria 8169134
1487 2957378283 2957375807 Bacteria 6425588
1488 2957378586 2957375807 Bacteria 6425588
1489 2957384502 2957382221 Bacteria 6737050
1490 2957385911 2957382221 Bacteria 6737050
1491 2957389715 2957388812 Bacteria 6778072
1492 2957389997 2957388812 Bacteria 6778072
1493 2957397358 2957395598 Bacteria 6822399
1494 2957399315 2957395598 Bacteria 6822399
1495 2957404708 2957402308 Bacteria 6741770
1496 2957405922 2957402308 Bacteria 6741770
1497 2957409176 2957408893 Bacteria 6558585
1498 2957411229 2957408893 Bacteria 6558585
1499 2957416856 2957415311 Bacteria 6991633
1500 2957417644 2957415311 Bacteria 6991633
1501 2957427908 2957422303 Bacteria 7172205
1502 2957428305 2957422303 Bacteria 7172205
1503 2957433527 2957430029 Bacteria 7022557
1504 2957434245 2957430029 Bacteria 7022557
1505 2957437214 2957437181 Bacteria 6568994
1506 2957437891 2957437181 Bacteria 6568994
1507 2957448673 2957443900 Bacteria 6869977
1508 2957449388 2957443900 Bacteria 6869977
1509 2957452377 2957450854 Bacteria 6765715
1510 2957456734 2957450854 Bacteria 6765715
1511 2957461559 2957457609 Bacteria 6967680
1512 2957462491 2957457609 Bacteria 6967680
1513 2957467299 2957464669 Bacteria 6568877
1514 2957467925 2957464669 Bacteria 6568877
1515 2957473654 2957471148 Bacteria 6797643
1516 2957476179 2957471148 Bacteria 6797643
1517 2957480255 2957478035 Bacteria 6756658
1518 2957482971 2957478035 Bacteria 6756658
1519 2957485049 2957484790 Bacteria 6703082
1520 2957487956 2957484790 Bacteria 6703082
1521 2957495081 2957491536 Bacteria 6695180
1522 2957495653 2957491536 Bacteria 6695180
1523 2957499424 2957498199 Bacteria 7126688
1524 2957504478 2957498199 Bacteria 7126688
1525 2957511803 2957505466 Bacteria 7253085
1526 2957511915 2957505466 Bacteria 7253085
1527 2960586396 2960584000 Bacteria 6864594
1528 2960590814 2960584000 Bacteria 6864594
1529 2960591105 2960591022 Bacteria 6622873
1530 2960596154 2960591022 Bacteria 6622873
1531 2960600435 2960597568 Bacteria 6550735
1532 2960603262 2960597568 Bacteria 6550735
1533 2960607225 2960603979 Bacteria 6898737
1534 2960608610 2960603979 Bacteria 6898737
1535 2960612910 2960610863 Bacteria 6691244
1536 2960616302 2960610863 Bacteria 6691244
1537 2960623130 2960617483 Bacteria 6727748
1538 2960623386 2960617483 Bacteria 6727748
1539 2960624620 2960624210 Bacteria 6875384
1540 2960625150 2960624210 Bacteria 6875384
1541 2960635770 2960631154 Bacteria 6732508
1542 2960637256 2960631154 Bacteria 6732508
1543 2960641980 2960637947 Bacteria 7296468
1544 2960643635 2960637947 Bacteria 7296468
1545 2960650783 2960645483 Bacteria 7211087
1546 2960651237 2960645483 Bacteria 7211087
1547 2960658699 2960652885 Bacteria 7083688
1548 2960664402 2960660292 Bacteria 7041660
1549 2960666693 2960660292 Bacteria 7041660
1550 2960669872 2960667422 Bacteria 6763020
1551 2960671986 2960667422 Bacteria 6763020
1552 2960678557 2960674078 Bacteria 6609048
1553 2960680125 2960674078 Bacteria 6609048
1554 2960682473 2960680706 Bacteria 6624464
1555 2960686850 2960680706 Bacteria 6624464
1556 2960689608 2960687367 Bacteria 6535474
1557 2960692252 2960687367 Bacteria 6535474
1558 2960695972 2960693952 Bacteria 6749742
1559 2960697237 2960693952 Bacteria 6749742
1560 2964609101 2964607997 Bacteria 7101408
1561 2964611158 2964607997 Bacteria 7101408
1562 2964617480 2964615318 Bacteria 6809089
1563 2964619038 2964615318 Bacteria 6809089
1564 2964624026 2964621998 Bacteria 6834995
1565 2964628267 2964621998 Bacteria 6834995
1566 2964631013 2964628898 Bacteria 7083044
1567 2964633892 2964628898 Bacteria 7083044
1568 2964637046 2964636051 Bacteria 7091832
1569 2964640606 2964636051 Bacteria 7091832
1570 2964644792 2964643177 Bacteria 6820887
1571 2964646008 2964643177 Bacteria 6820887
1572 2964651473 2964649959 Bacteria 6675118
1573 2964655769 2964649959 Bacteria 6675118
1574 2964657543 2964656573 Bacteria 7100150
1575 2964660062 2964656573 Bacteria 7100150
1576 2964664977 2964663802 Bacteria 7019362
1577 2964666504 2964663802 Bacteria 7019362
1578 2964672867 2964670856 Bacteria 6851364
1579 2964677377 2964670856 Bacteria 6851364
1580 2964680733 2964678106 Bacteria 6792020
1581 2964682183 2964678106 Bacteria 6792020
1582 2964687300 2964685014 Bacteria 6839111
1583 2964691263 2964685014 Bacteria 6839111
1584 2964693723 2964691889 Bacteria 6802758
1585 2964696315 2964691889 Bacteria 6802758
1586 2964701500 2964698721 Bacteria 6765331
1587 2964702061 2964698721 Bacteria 6765331
1588 2964708541 2964705432 Bacteria 7114648
1589 2964709216 2964705432 Bacteria 7114648
1590 2964716833 2964712639 Bacteria 6695970
1591 2964718565 2964712639 Bacteria 6695970
1592 2964721769 2964719344 Bacteria 7286602
1593 2964724508 2964719344 Bacteria 7286602
1594 2967668094 2967664464 Bacteria 6948836
1595 2967670756 2967664464 Bacteria 6948836
1596 2967674578 2967671571 Bacteria 7021409
1597 2967674834 2967671571 Bacteria 7021409
1598 2967683781 2967678726 Bacteria 7264382
1599 2967684135 2967678726 Bacteria 7264382
1600 2967687350 2967686174 Bacteria 6678622
1601 2967687644 2967686174 Bacteria 6678622
1602 2967693628 2967693043 Bacteria 6804451
1603 2967696366 2967693043 Bacteria 6804451
1604 2967701678 2967699805 Bacteria 6854538
1605 2967706349 2967699805 Bacteria 6854538
1606 2967710466 2967706974 Bacteria 7186053
1607 2967711992 2967706974 Bacteria 7186053
1608 2967719891 2967714385 Bacteria 7000047
1609 2967720330 2967714385 Bacteria 7000047
1610 2967722987 2967721400 Bacteria 7073753
1611 2967728187 2967721400 Bacteria 7073753
1612 2967729572 2967728569 Bacteria 6641507
1613 2967734291 2967728569 Bacteria 6641507
1614 2967735227 2967735183 Bacteria 6827012
1615 2967741207 2967735183 Bacteria 6827012
1616 2967743126 2967742019 Bacteria 6794534
1617 2967744987 2967742019 Bacteria 6794534
1618 2967750080 2967748971 Bacteria 6733771
1619 2967752483 2967748971 Bacteria 6733771
1620 2967758023 2967755722 Bacteria 6814706
1621 2967760136 2967755722 Bacteria 6814706
1622 2967763482 2967762386 Bacteria 6923502
1623 2967764124 2967762386 Bacteria 6923502
1624 2967770596 2967769361 Bacteria 6587838
1625 2967771596 2967769361 Bacteria 6587838
1626 2967778254 2967775926 Bacteria 6738189
1627 2967778791 2967775926 Bacteria 6738189
1628 2970020074 2970019648 Bacteria 7072033
1629 2970021621 2970019648 Bacteria 7072033
1630 2970030965 2970026789 Bacteria 6785236
1631 2970033408 2970026789 Bacteria 6785236
1632 2970036804 2970033650 Bacteria 7118744
1633 2970038207 2970033650 Bacteria 7118744
1634 2970042433 2970040964 Bacteria 6731123
1635 2970047189 2970040964 Bacteria 6731123
1636 2970051431 2970047711 Bacteria 7088379
1637 2970053911 2970047711 Bacteria 7088379
1638 2970056123 2970054988 Bacteria 6611507
1639 2970061417 2970054988 Bacteria 6611507
1640 2970065534 2970061556 Bacteria 7099761
1641 2970067561 2970061556 Bacteria 7099761
1642 2970072287 2970068827 Bacteria 7123112
1643 2970072353 2970068827 Bacteria 7123112
1644 2970077445 2970076120 Bacteria 6697332
1645 2970080137 2970076120 Bacteria 6697332
1646 2970083160 2970082768 Bacteria 6183754
1647 2970084794 2970082768 Bacteria 6183754
1648 2970089218 2970088815 Bacteria 6933825
1649 2970095282 2970088815 Bacteria 6933825
1650 2970097997 2970095765 Bacteria 6936963
1651 2970099416 2970095765 Bacteria 6936963
1652 2970103679 2970102677 Bacteria 6812532
1653 2970103727 2970102677 Bacteria 6812532
1654 2970112054 2970109326 Bacteria 6863976
1655 2970114378 2970109326 Bacteria 6863976
1656 2970116760 2970116247 Bacteria 6501857
1657 2970121189 2970116247 Bacteria 6501857
1658 2970124715 2970122695 Bacteria 6625855
1659 2970128732 2970122695 Bacteria 6625855
1660 2970130062 2970129317 Bacteria 6806560
1661 2970130327 2970129317 Bacteria 6806560
1662 2970141070 2970136068 Bacteria 7207982
1663 2970141135 2970136068 Bacteria 7207982
1664 2970145528 2970143518 Bacteria 6446480
1665 2970146460 2970143518 Bacteria 6446480
1666 2970151485 2970149975 Bacteria 6779706
1667 2970155249 2970149975 Bacteria 6779706
1668 2970158868 2970156795 Bacteria 7168044
1669 2970162773 2970156795 Bacteria 7168044
1670 2970167076 2970164137 Bacteria 6861252
1671 2970170561 2970164137 Bacteria 6861252
1672 2970171975 2970170962 Bacteria 6876229
1673 2970173541 2970170962 Bacteria 6876229
1674 2970181182 2970177841 Bacteria 6768001
1675 2970181378 2970177841 Bacteria 6768001
1676 2970185431 2970184632 Bacteria 7054431
1677 2970190396 2970184632 Bacteria 7054431
1678 2970195355 2970191845 Bacteria 7032787
1679 2970196948 2970191845 Bacteria 7032787
1680 2977518008 2977516862 Bacteria 6940108
1681 2977521217 2977516862 Bacteria 6940108
1682 2977526551 2977523885 Bacteria 6960446
1683 2977528739 2977523885 Bacteria 6960446
1684 2977533851 2977530762 Bacteria 6951399
1685 2977534182 2977530762 Bacteria 6951399
1686 2977540264 2977537788 Bacteria 6929320
1687 2977542264 2977537788 Bacteria 6929320
1688 2977547343 2977544691 Bacteria 6875412
1689 2977547611 2977544691 Bacteria 6875412
1690 2977552283 2977551784 Bacteria 7125765
1691 2977554856 2977551784 Bacteria 7125765
1692 2977560130 2977558990 Bacteria 6863948
1693 2977564575 2977558990 Bacteria 6863948
1694 2977568350 2977565890 Bacteria 6901543
1695 2977569734 2977565890 Bacteria 6901543
1696 2977574921 2977572785 Bacteria 6763888
1697 2977575536 2977572785 Bacteria 6763888
1698 2977579907 2977579622 Bacteria 6772100
1699 2977585231 2977579622 Bacteria 6772100
1700 2989350966 2989349275 Bacteria 6349068
1701 2996338206 2996336353 Bacteria 5511628
1702 3003933532 3003930520 Bacteria 5667563
1703 3005447196 3005445848 Bacteria 6906074
1704 3005479751 3005474847 Bacteria 9259049
1705 3005724950 3005718088 Bacteria 8283608
1706 639648088 639633055 Bacteria 7751309
1707 643592422 643348564 Bacteria 8839022
1708 643825521 643692032 Bacteria 6891900
1709 648735995 648276728 Bacteria 6968865
1710 648740155 648276728 Bacteria 6968865
1711 8003993356 8003992118 Bacteria 7266902
1712 8003994785 8003992118 Bacteria 7266902
1713 8004000607 8003999396 Bacteria 7063185
1714 8004002446 8003999396 Bacteria 7063185
1715 8005280151 8005275841 Bacteria 6929066
1716 8005314606 8005307578 Bacteria 7395396
1717 8005378731 8005376324 Bacteria 6590079
1718 8005462463 8005460587 Bacteria 7157962
1719 8005558164 8005556819 Bacteria 6908598
1720 8005569342 8005563573 Bacteria 7153261
1721 8005575384 8005570704 Bacteria 6957481
1722 8005696227 8005695170 Bacteria 6912330
1723 8006941358 8006933436 Bacteria 10410654
1724 8006965493 8006964411 Bacteria 8966052
1725 8006980996 8006973647 Bacteria 10679141
1726 8007000530 8006994254 Bacteria 8309700
1727 8018168047 8018163183 Bacteria 7277977
1728 8018180300 8018176218 Bacteria 6896178
1729 8019557276 8019555841 Bacteria 9642137
1730 8019568025 8019565922 Bacteria 9639779
1731 8023680925 8023680758 Bacteria 7729763
1732 8024485696 8024479707 Bacteria 6954785
1733 8049294406 8049293176 Bacteria 6128433
1734 8054562848 8054558443 Bacteria 5204801
1735 8056674117 8056673599 Bacteria 7871253
1736 8056677744 8056673599 Bacteria 7871253
1737 8056688169 8056681323 Bacteria 8472857
1738 8056693734 8056689827 Bacteria 6712655
1739 8057535372 8057529695 Bacteria 6306553
1740 8057535553 8057529695 Bacteria 6306553
1741 8057875545 8057874678 Bacteria 7494653
1742 Ga0123341_1000001
1743 JGI25152J39213_1001618
1744 JGI25152J39213_1019942
1745 JGI25150J39212_1000010
1746 JGI25159J45721_1000006
1747 JGI25159J45721_1000045
1748 JGI25159J45721_1000969
1749 JGI25159J45721_1001222
1750 JGI25159J45721_1009708
1751 JGI25151J46595_10000030
1752 JGI25151J46595_10000653
1753 JGI25151J46595_10000963
1754 JGI25151J46595_10019784
1755 JGI25151J46595_10035155
1756 JGI25406J46586_10000004
1757 JGI25406J46586_10001469
1758 JGI25406J46586_10007336
1759 JGI25406J46586_10018350
1760 JGI25153J46596_10000463
1761 JGI25153J46596_10001697
1762 JGI25153J46596_10009347
1763 JGI25153J46596_10012198
1764 JGI25153J46596_10018819
1765 JGI25160J50197_1000009
1766 JGI25160J50197_1000019
1767 JGI25160J50197_1005184
1768 JGI25161J50226_1000291
1769 JGI25161J50226_1000631
1770 Ga0006562J51391_1016026
1771 JGI25404J52841_10017099
1772 JGI25404J52841_10024923
1773 Ga0055539_1002510
1774 Ga0055526_1000213
1775 Ga0055526_1000382
1776 Ga0055526_1003948
1777 Ga0055524_1000014
1778 Ga0055524_1001741
1779 Ga0055524_1006759
1780 Ga0055524_1007562
1781 Ga0055524_1009040
1782 Ga0055536_1000099
1783 Ga0055536_1007245
1784 Ga0055528_1006980
1785 Ga0055530_10012962
1786 Ga0055540_1020031
1787 Ga0055531_10003009
1788 Ga0055531_10008232
1789 Ga0055543_1000147
1790 Ga0055543_1000149
1791 Ga0055543_1001457
1792 Ga0065165_1000020
1793 Ga0065165_1000180
1794 Ga0065165_1000240
1795 Ga0065165_1000667
1796 Ga0065165_1002203
1797 Ga0065165_1002687
1798 Ga0065165_1006798
1799 Ga0065712_10030785
1800 Ga0070658_10137890
1801 Ga0070683_100006511
1802 Ga0070683_100007119
1803 Ga0070683_100082577
1804 Ga0070690_100055324
1805 Ga0070680_100027349
1806 Ga0070680_100056967
1807 Ga0070680_100066890
1808 Ga0070680_100079295
1809 Ga0068868_100078902
1810 Ga0070660_100005207
1811 Ga0070689_100003670
1812 Ga0070687_100030691
1813 Ga0070687_100046956
1814 Ga0070687_100146230
1815 Ga0070668_100110244
1816 Ga0070668_100257456
1817 Ga0070669_100063727
1818 Ga0070669_100073716
1819 Ga0070669_100180985
1820 Ga0070675_100267153
1821 Ga0070671_100065157
1822 Ga0070671_100172296
1823 Ga0070671_100193348
1824 Ga0070674_100001420
1825 Ga0070673_100171366
1826 Ga0070688_100023192
1827 Ga0070659_100047822
1828 Ga0070659_100084832
1829 Ga0070709_10008512
1830 Ga0070709_10057643
1831 Ga0070709_10088806
1832 Ga0070714_100006414
1833 Ga0070714_100006642
1834 Ga0070714_100055677
1835 Ga0070714_100069870
1836 Ga0070713_100019473
1837 Ga0070713_100046981
1838 Ga0070713_100060748
1839 Ga0070710_10000919
1840 Ga0070710_10009860
1841 Ga0070710_10083184
1842 Ga0070710_10192037
1843 Ga0070711_100004484
1844 Ga0070711_100172950
1845 Ga0070663_100013555
1846 Ga0070663_100018341
1847 Ga0070663_100073326
1848 Ga0070678_100007522
1849 Ga0070678_100026355
1850 Ga0070678_100129765
1851 Ga0070685_10035186
1852 Ga0070685_10217206
1853 Ga0070706_100063549
1854 Ga0070707_100075380
1855 Ga0070698_100018103
1856 Ga0070698_100293279
1857 Ga0070679_100200700
1858 Ga0070679_100272718
1859 Ga0070684_100001614
1860 Ga0070684_100019307
1861 Ga0070684_100034203
1862 Ga0070697_100093650
1863 Ga0068853_100010713
1864 Ga0068853_100036552
1865 Ga0068853_100201823
1866 Ga0070695_100002718
1867 Ga0070696_100243452
1868 Ga0070665_100047076
1869 Ga0070665_100146826
1870 Ga0070665_100224351
1871 Ga0070665_100396584
1872 Ga0070704_100017580
1873 Ga0068855_100048010
1874 Ga0070664_100293506
1875 Ga0068857_100080227
1876 Ga0068857_100135738
1877 Ga0068857_100271106
1878 Ga0068854_100147537
1879 Ga0068854_100334718
1880 Ga0068856_100000223
1881 Ga0068852_100094867
1882 Ga0068852_100251346
1883 Ga0068859_100087029
1884 Ga0068859_100200287
1885 Ga0068859_100646741
1886 Ga0068864_100260780
1887 Ga0068864_100329914
1888 Ga0068864_100416934
1889 Ga0068866_10118391
1890 Ga0068866_10118937
1891 Ga0068861_100062480
1892 Ga0068851_10102259
1893 Ga0068870_10021988
1894 Ga0068860_100340917
1895 Ga0068862_100096452
1896 Ga0081455_10001830
1897 Ga0081455_10010615
1898 Ga0081455_10012070
1899 Ga0081455_10052751
1900 Ga0081455_10065370
1901 Ga0081540_1000972
1902 Ga0081540_1001527
1903 Ga0081540_1001974
1904 Ga0081540_1002258
1905 Ga0081540_1002930
1906 Ga0081540_1015010
1907 Ga0081540_1017616
1908 Ga0081540_1041701
1909 Ga0081539_10000080
1910 Ga0081539_10000258
1911 Ga0081539_10003064
1912 Ga0081539_10020000
1913 Ga0081539_10066163
1914 Ga0075365_10006090
1915 Ga0075365_10020998
1916 Ga0075365_10060989
1917 Ga0075368_10029307
1918 Ga0075363_100002611
1919 Ga0075363_100005534
1920 Ga0075363_100025880
1921 Ga0075363_100032459
1922 Ga0075364_10002396
1923 Ga0075364_10008960
1924 Ga0075364_10015868
1925 Ga0070715_10000416
1926 Ga0070715_10012928
1927 Ga0070716_100001459
1928 Ga0070716_100003186
1929 Ga0070716_100104248
1930 Ga0070712_100053141
1931 Ga0070712_100057281
1932 Ga0070712_100152179
1933 Ga0070712_100307247
1934 Ga0075362_10003305
1935 Ga0075362_10007951
1936 Ga0075362_10058808
1937 Ga0075362_10063190
1938 Ga0075367_10000246
1939 Ga0075367_10002336
1940 Ga0075367_10012425
1941 Ga0075367_10065089
1942 Ga0075369_10000860
1943 Ga0075369_10002532
1944 Ga0075369_10018853
1945 Ga0075369_10039742
1946 Ga0075369_10076242
1947 Ga0075366_10015183
1948 Ga0075366_10070532
1949 Ga0097621_100044177
1950 Ga0097621_100250543
1951 Ga0075370_10028688
1952 Ga0075370_10031358
1953 Ga0075370_10048046
1954 Ga0075428_100044356
1955 Ga0075428_100106482
1956 Ga0075430_100000043
1957 Ga0075430_100162857
1958 Ga0075431_100020937
1959 Ga0075431_100153569
1960 Ga0075433_10009732
1961 Ga0075433_10014595
1962 Ga0075434_100003848
1963 Ga0075434_100005388
1964 Ga0075436_100165547
1965 Ga0097620_100087030
1966 Ga0097620_100200283
1967 Ga0097620_100646710
1968 Ga0099824_1013903
1969 Ga0099822_1025540
1970 Ga0099823_1014174
1971 Ga0079104_1003210
1972 Ga0079104_1003807
1973 Ga0079104_1004155
1974 Ga0079104_1012256
1975 Ga0099794_10059255
1976 Ga0099794_10120302
1977 Ga0099795_10036033
1978 Ga0105251_10074237
1979 Ga0105240_10005693
1980 Ga0105240_10113695
1981 Ga0105240_10479486
1982 Ga0111539_10030424
1983 Ga0111539_10062755
1984 Ga0105247_10185545
1985 Ga0105247_10210159
1986 Ga0114129_10006499
1987 Ga0114129_10012033
1988 Ga0105243_10165759
1989 Ga0105242_10050923
1990 Ga0105248_10129897
1991 Ga0105237_10004882
1992 Ga0105237_10092774
1993 Ga0105238_10026703
1994 Ga0105238_10257106
1995 Ga0105249_10075662
1996 Ga0105239_10024408
1997 Ga0105239_10063416
1998 Ga0105239_10135889
1999 Ga0105239_10228536
2000 Ga0105246_10045726
2001 Ga0157373_10019309
2002 Ga0157373_10110014
2003 Ga0157370_10031900
2004 Ga0157370_10054851
2005 Ga0157369_10008457
2006 Ga0157369_10011845
2007 Ga0157369_10023767
2008 Ga0157369_10328277
2009 Ga0171463_1011
2010 Ga0171462_1016
2011 Ga0157374_10044503
2012 Ga0157378_10005332
2013 Ga0157378_10116584
2014 Ga0157378_10199282
2015 Ga0163162_10067783
2016 Ga0163162_10402338
2017 Ga0157375_10018792
2018 Ga0157375_10233510
2019 Ga0163163_10118605
2020 Ga0163163_10132478
2021 Ga0163163_10231021
2022 Ga0157380_10034769
2023 Ga0157380_10102696
2024 Ga0182008_10039527
2025 Ga0157376_10067746
2026 Ga0183363_1384
2027 Ga0163161_10097319
2028 Ga0214544_1000002
2029 Ga0214544_1009612
2030 Ga0214542_1000015
2031 Ga0214542_1001264
2032 Ga0214542_1015309
2033 Ga0214545_1000018
2034 Ga0214543_1000001
2035 Ga0214543_1000011
2036 Ga0214543_1000032
2037 Ga0213873_10009976
2038 Ga0213874_10004902
2039 Ga0213876_10005326
2040 Ga0213875_10026571
2041 Ga0224712_10041342
2042 Ga0228711_1000012
2043 Ga0228711_1000022
2044 Ga0228710_1000006
2045 Ga0228710_1000028
2046 Ga0209436_100410
2047 Ga0209436_100644
2048 Ga0209563_103920
2049 Ga0207425_1000010
2050 Ga0207425_1002485
2051 Ga0207425_1009841
2052 Ga0209646_1004255
2053 Ga0209677_108690
2054 Ga0209148_1000694
2055 Ga0209148_1007656
2056 Ga0209129_1000034
2057 Ga0209129_1001709
2058 Ga0209233_1001490
2059 Ga0209233_1003089
2060 Ga0209233_1005043
2061 Ga0209455_1001655
2062 Ga0209455_1006107
2063 Ga0209455_1007941
2064 Ga0209673_1005940
2065 Ga0209673_1023886
2066 Ga0209130_1000007
2067 Ga0209130_1000037
2068 Ga0209130_1000061
2069 Ga0209130_1000106
2070 Ga0209675_1001352
2071 Ga0209676_1000539
2072 Ga0209676_1002523
2073 Ga0209025_1000022
2074 Ga0209025_1000033
2075 Ga0209025_1000063
2076 Ga0209025_1000468
2077 Ga0209025_1002864
2078 Ga0209025_1005644
2079 Ga0209025_1053955
2080 Ga0209564_1000023
2081 Ga0209564_1000082
2082 Ga0209564_1000086
2083 Ga0209564_1000140
2084 Ga0209564_1000195
2085 Ga0209758_1000015
2086 Ga0209758_1000086
2087 Ga0209758_1001803
2088 Ga0209758_1005084
2089 Ga0209758_1006591
2090 Ga0209758_1018182
2091 Ga0209758_1045157
2092 Ga0209050_1000563
2093 Ga0209050_1003179
2094 Ga0209256_1000033
2095 Ga0209256_1000319
2096 Ga0209256_1000444
2097 Ga0209256_1000672
2098 Ga0209256_1000836
2099 Ga0209256_1003708
2100 Ga0209256_1004564
2101 Ga0209256_1008386
2102 Ga0209256_1009885
2103 Ga0209256_1043429
2104 Ga0207426_1000048
2105 Ga0207426_1000094
2106 Ga0207426_1000111
2107 Ga0207426_1012203
2108 Ga0209051_1004093
2109 Ga0209051_1006833
2110 Ga0209257_1000440
2111 Ga0209257_1002956
2112 Ga0209257_1002957
2113 Ga0207697_10065831
2114 Ga0207682_10001564
2115 Ga0207692_10000379
2116 Ga0207692_10000525
2117 Ga0207688_10034643
2118 Ga0207688_10097776
2119 Ga0207680_10059460
2120 Ga0207699_10000287
2121 Ga0207699_10026876
2122 Ga0207643_10007974
2123 Ga0207707_10000501
2124 Ga0207707_10002504
2125 Ga0207707_10010712
2126 Ga0207707_10149990
2127 Ga0207695_10000065
2128 Ga0207695_10057467
2129 Ga0207695_10229812
2130 Ga0207695_10339786
2131 Ga0207671_10008163
2132 Ga0207671_10016419
2133 Ga0207693_10001493
2134 Ga0207693_10172128
2135 Ga0207663_10000209
2136 Ga0207663_10150760
2137 Ga0207660_10011401
2138 Ga0207660_10018289
2139 Ga0207662_10099141
2140 Ga0207657_10001475
2141 Ga0207657_10087873
2142 Ga0207649_10197478
2143 Ga0207652_10002853
2144 Ga0207652_10011281
2145 Ga0207652_10285219
2146 Ga0207681_10026106
2147 Ga0207681_10092396
2148 Ga0207681_10286835
2149 Ga0207694_10023624
2150 Ga0207694_10063161
2151 Ga0207650_10055974
2152 Ga0207659_10061268
2153 Ga0207700_10026345
2154 Ga0207700_10033449
2155 Ga0207700_10038155
2156 Ga0207664_10004282
2157 Ga0207664_10049379
2158 Ga0207664_10073866
2159 Ga0207690_10222069
2160 Ga0207706_10314145
2161 Ga0207709_10090869
2162 Ga0207670_10000723
2163 Ga0207670_10177467
2164 Ga0207669_10069230
2165 Ga0207665_10000304
2166 Ga0207665_10011760
2167 Ga0207665_10033239
2168 Ga0207665_10038848
2169 Ga0207665_10136854
2170 Ga0207691_10174057
2171 Ga0207691_10268177
2172 Ga0207711_10037529
2173 Ga0207711_10115616
2174 Ga0207711_10323794
2175 Ga0207661_10002155
2176 Ga0207661_10024063
2177 Ga0207661_10176184
2178 Ga0207661_10272110
2179 Ga0207679_10107279
2180 Ga0207679_10131474
2181 Ga0207679_10273847
2182 Ga0207667_10004264
2183 Ga0207651_10092991
2184 Ga0207651_10193416
2185 Ga0207712_10061445
2186 Ga0207640_10025659
2187 Ga0207639_10077404
2188 Ga0207639_10177343
2189 Ga0207678_10033041
2190 Ga0207678_10050776
2191 Ga0207678_10089065
2192 Ga0207678_10294063
2193 Ga0207708_10221805
2194 Ga0207702_10000252
2195 Ga0207641_10121100
2196 Ga0207641_10319547
2197 Ga0207648_10046968
2198 Ga0207676_10010931
2199 Ga0207674_10262215
2200 Ga0207675_100056838
2201 Ga0207675_100167817
2202 Ga0207683_10016066
2203 Ga0207683_10272701
2204 Ga0207698_10023811
2205 Ga0207698_10292015
2206 Ga0207698_10437005
2207 Ga0209281_1000247
2208 Ga0209281_1000268
2209 Ga0209281_1000733
2210 Ga0209281_1001674
2211 Ga0209389_1000076
2212 Ga0209389_1000128
2213 Ga0209589_1000003
2214 Ga0209589_1000180
2215 Ga0209489_100003
2216 Ga0209489_100031
2217 Ga0209489_100416
2218 Ga0209700_100003
2219 Ga0209700_100014
2220 Ga0209179_1004759
2221 Ga0209282_1000026
2222 Ga0209282_1000037
2223 Ga0209588_1007876
2224 Ga0209588_1008060
2225 Ga0209813_10001178
2226 Ga0209813_10031573
2227 Ga0209813_10042130
2228 Ga0207428_10031570
2229 Ga0268266_10001640
2230 Ga0268266_10019976
2231 Ga0268266_10032441
2232 Ga0268266_10424508
2233 Ga0268264_10291134
2234 Ga0265337_1001045
2235 Ga0265334_10032065
2236 Ga0268256_1002827
2237 Ga0265330_10017911
2238 Ga0265330_10019889
2239 Ga0265330_10085635
2240 Ga0265332_10016230
2241 Ga0265320_10031009
2242 Ga0265325_10001561
2243 Ga0265325_10026316
2244 Ga0265325_10062845
2245 Ga0265329_10036350
2246 Ga0265340_10004319
2247 Ga0265340_10020020
2248 Ga0265339_10054363
2249 Ga0265331_10005060
2250 Ga0307513_10008569
2251 Ga0307509_10039174
2252 Ga0307509_10164183
2253 Ga0307408_100079731
2254 Ga0307408_100096314
2255 Ga0307408_100130565
2256 Ga0265313_10020917
2257 Ga0307508_10000005
2258 Ga0307508_10008196
2259 Ga0265314_10009410
2260 Ga0265314_10059057
2261 Ga0265342_10010137
2262 Ga0265342_10020208
2263 Ga0265342_10026486
2264 Ga0316576_10064827
2265 Ga0307516_10150628
2266 Ga0307516_10189831
2267 Ga0307516_10323880
2268 Ga0307405_10007952
2269 Ga0307405_10056973
2270 Ga0307410_10057832
2271 Ga0307406_10007182
2272 Ga0307406_10019643
2273 Ga0307412_10005049
2274 Ga0307412_10077176
2275 Ga0315914_1000002
2276 Ga0315914_1000008
2277 Ga0307409_100090554
2278 Ga0307409_100101066
2279 Ga0307409_100350863
2280 Ga0307416_100165080
2281 Ga0307416_100209221
2282 Ga0307414_10080471
2283 Ga0307414_10429123
2284 Ga0307411_10258961
2285 Ga0307507_10013134
2286 Ga0307510_10001273
2287 Ga0307510_10044488
2288 Ga0307510_10120093
2289 Ga0315913_1000018
2290 Ga0315913_1000093
2291 Ga0315915_1000005
2292 Ga0315915_1000014
2293 Ga0373934_0015616
2294 Ga0373934_0105369
2295 Ga0373940_0001670
2296 Ga0373949_0013262
2297 Ga0373951_0040383
2298 Ga0373952_0011852
2299 Ga0373923_0021657
2300 Ga0373923_0029982
2301 Ga0373923_0052849
2302 Ga0373939_0007280
2303 Ga0373945_0005389
2304 Ga0373953_0011575
2305 Ga0373953_0017017
2306 Ga0373954_0000001
2307 Ga0373954_0005038
2308 Ga0373954_0011590
2309 Ga0373954_0059487
2310 Ga0373956_0004724
2311 Ga0373957_0008691
2312 Ga0373957_0038407
2313 Ga0373960_0009766
2314 Ga0373960_0027374
2315 Ga0373943_0017743
2316 Ga0373943_0065143
2317 Ga0373943_0083735
2318 Ga0373943_0103661
2319 Ga0373943_0110905
2320 Ga0373961_0047169
2321 Ga0373962_0057669
2322 Ga0373931_0012372
2323 Ga0373931_0017975
2324 Ga0373931_0018555
2325 Ga0373931_0020171
2326 Ga0373931_0080388
2327 Ga0373935_0001895
2328 Ga0373935_0065716
2329 Ga0373935_0070931
2330 Ga0373927_0000071
2331 Ga0373927_0014048
2332 Ga0373927_0104569
2333 Ga0373927_0134066
2334 Ga0373933_0000007
2335 Ga0373933_0001958
2336 Ga0373947_0005589
2337 Ga0373947_0008795
2338 Ga0373937_0017963
2339 Ga0373937_0093445
2340 Ga0373937_0125532
2341 Ga0373937_0354900
2342 Ga0373925_0001901
2343 Ga0373925_0009036
2344 Ga0373925_0024214
2345 Ga0395899_0009808
2346 Ga0395900_0000509
2347 Ga0395900_0260401
2348 Ga0395898_0017382
2349 Ga0395898_0183750
2350 Ga0395905_0010722
2351 Ga0395905_0011914
2352 Ga0395905_0014182
2353 Ga0436364_0511627
2354 Ga0436364_1537073
2355 Ga0395901_0018881
2356 Ga0395901_0610667
2357 Ga0436365_0902823
2358 Ga0436360_0258374
2359 Ga0436360_0298343
2360 Ga0436360_0956177
2361 Ga0436360_1162520
2362 Ga0436361_0261425
2363 Ga0436361_0530724
2364 Ga0436361_0682571
2365 Ga0436363_0295043
2366 Ga0436363_1236275
2367 Ga0436362_0152346
2368 Ga0451789_0498311
2369 Ga0451798_0185561
2370 Ga0451839_0475690
2371 Ga0451853_1980618
2372 Ga0439449_0000949
2373 Ga0439449_0026070
2374 Ga0439459_0015584
2375 Ga0439460_0000575
2376 Ga0466972_0001612
2377 Ga0466972_0066824
2378 Ga0466966_0030571
2379 Ga0466961_0095136
2380 Ga0466964_0005758
2381 Ga0466968_0004449
2382 Ga0466957_0021826
2383 Ga0451576_0376975
2384 Ga0495592_0028055
2385 Ga0495592_0054150
2386 Ga0495592_0062212
2387 Ga0495592_0103607
2388 Ga0495603_0000035
2389 Ga0495603_0000252
2390 Ga0495603_0007202
2391 Ga0495603_0010202
2392 Ga0495603_0026070
2393 Ga0495603_0031559
2394 Ga0495603_0132477
2395 Ga0495629_0000081
2396 Ga0495629_0000714
2397 Ga0495629_0007617
2398 Ga0495629_0023759
2399 Ga0495629_0158381
2400 Ga0495638_0001347
2401 Ga0495638_0117398
2402 Ga0495641_0000707
2403 Ga0495641_0002095
2404 Ga0495641_0075880
2405 Ga0495651_0002495
2406 Ga0495651_0006288
2407 Ga0495651_0220796
2408 Ga0495653_0007525
2409 Ga0495653_0042069
2410 Ga0495653_0118560
2411 Ga0495580_0002693
2412 Ga0495580_0009396
2413 Ga0495580_0040846
2414 Ga0495582_0000051
2415 Ga0495582_0000370
2416 Ga0495582_0065559
2417 Ga0495605_0003366
2418 Ga0495639_0000010
2419 Ga0495639_0005124
2420 Ga0495639_0024549
2421 Ga0495639_0155677
2422 Ga0495662_0000034
2423 Ga0495662_0003732
2424 Ga0495662_0071121
2425 Ga0495664_0006551
2426 Ga0495664_0015055
2427 Ga0495584_0116502
2428 Ga0495584_0156370
2429 Ga0495585_0024764
2430 Ga0495585_0052428
2431 Ga0495585_0067895
2432 Ga0495594_0001027
2433 Ga0495594_0012412
2434 Ga0495607_0012889
2435 Ga0495583_0002986
2436 Ga0495606_0000265
2437 Ga0495606_0000945
2438 Ga0495610_0016187
2439 Ga0495610_0045563
2440 Ga0495616_0050166
2441 Ga0495618_0012904
2442 Ga0495618_0035240
2443 Ga0495618_0236261
2444 Ga0495620_0025468
2445 Ga0495620_0028564
2446 Ga0495628_0020775
2447 Ga0495628_0031694
2448 Ga0495628_0062715
2449 Ga0495630_0002318
2450 Ga0495630_0005052
2451 Ga0495630_0152196
2452 Ga0495631_0002151
2453 Ga0495631_0014346
2454 Ga0495632_0033107
2455 Ga0495644_0009542
2456 Ga0495648_0000271
2457 Ga0495648_0003502
2458 Ga0495648_0005499
2459 Ga0495663_0029799
2460 Ga0495666_0029232
2461 Ga0495666_0112891
2462 Ga0495642_0011468
2463 Ga0495652_0013767
2464 Ga0495652_0018009
2465 Ga0495652_0148628
2466 Ga0495654_0002779
2467 Ga0495654_0051102
2468 Ga0495665_0000005
2469 Ga0495665_0000546
2470 Ga0495665_0117702
2471 Ga0495640_0004617
2472 Ga0495640_0026268
2473 Ga0495640_0040394
2474 Ga0495640_0042313
2475 Ga0495640_0077123
2476 Ga0495586_0033280
2477 Ga0495587_0016804
2478 Ga0495609_0103169
2479 Ga0495597_0003588
2480 Ga0495597_0033625
2481 Ga0495645_0002249
2482 Ga0495645_0009591
2483 Ga0495645_0045009
2484 Ga0495645_0075908
2485 Ga0495622_0002332
2486 Ga0495622_0007002
2487 Ga0495622_0029904
2488 Ga0495633_0024072
2489 Ga0495633_0111024
2490 Ga0495667_0002027
2491 Ga0495667_0008367
2492 Ga0495667_0026258
2493 Ga0495667_0027591
2494 Ga0495667_0031086
2495 Ga0495656_0040911
2496 Ga0495656_0058749
2497 Ga0495656_0080071
2498 Ga0495656_0091699
2499 Ga0495668_0018871
2500 Ga0495668_0036556
2501 Ga0495634_0000764
2502 Ga0495634_0002675
2503 Ga0495634_0004980
2504 Ga0495611_0065453
2505 Ga0495625_0001123
2506 Ga0495625_0047708
2507 Ga0495625_0122740
2508 Ga0495625_0138878
2509 Ga0495635_0000225
2510 Ga0495635_0000281
2511 Ga0495659_0014448
2512 Ga0495659_0016207
2513 Ga0495588_0002094
2514 Ga0495588_0027266
2515 Ga0495588_0044205
2516 Ga0495657_0023611
2517 Ga0495657_0046321
2518 Ga0495599_0011203
2519 Ga0495599_0023885
2520 Ga0495599_0093905
2521 Ga0495623_0027207
2522 Ga0495646_0010285
2523 Ga0495646_0010554
2524 Ga0495646_0175770
2525 Ga0495647_0002395
2526 Ga0495647_0005972
2527 Ga0495658_0000367
2528 Ga0495658_0007246
2529 Ga0495658_0121889
2530 Ga0495624_0000094
2531 Ga0495624_0000398
2532 Ga0495624_0154992
2533 Ga0495670_0064732
2534 Ga0495670_0068072
2535 Ga0495671_0038293
2536 Ga0495589_0131329
2537 Ga0495600_0003627
2538 Ga0495600_0012656
2539 Ga0495581_0000018
2540 Ga0495581_0020875
2541 Ga0495604_0017302
2542 Ga0495604_0086445
2543 Ga0495674_0000134
2544 Ga0495674_0003220
2545 Ga0495674_0007455
2546 Ga0495674_0044254
2547 Ga0495672_0095561
2548 Ga0495676_0008740
2549 Ga0495676_0016483
2550 Ga0495680_0007228
2551 Ga0495680_0025171
2552 Ga0495680_0058948
2553 Ga0495683_0027007
2554 Ga0495675_0008298
2555 Ga0495675_0047573
2556 Ga0495673_0023183
2557 Ga0495673_0026673
2558 Ga0495681_0054305
2559 Ga0495684_0000134
2560 Ga0495684_0012369
2561 Ga0495684_0014927
2562 Ga0495684_0021580
2563 Ga0495684_0157685
2564 Ga0495686_0043087
2565 Ga0495686_0146562
2566 Ga0495686_0198496
2567 Ga0495593_0000084
2568 Ga0495593_0000546
2569 Ga0495593_0015585
2570 Ga0495602_0011244
2571 Ga0495602_0027361
2572 Ga0496102_0151692
2573 Ga0496102_0201301
2574 Ga0496102_0294219
2575 Ga0496104_0012673
2576 Ga0496104_0045992
2577 Ga0496105_0016901
2578 Ga0496106_0002537
2579 Ga0496106_0004905
2580 Ga0496106_0150196
2581 Ga0496107_0004208
2582 Ga0496108_0024137
2583 Ga0496108_0058211
2584 Ga0496108_0094280
2585 Ga0496109_0023467
2586 Ga0496110_0135510
2587 Ga0496111_0202569
2588 Ga0496112_0000084
2589 Ga0496112_0042625
2590 Ga0496112_0191102
2591 Ga0496115_0002185
2592 Ga0496115_0261381
2593 Ga0496115_0273590
2594 Ga0496116_0014730
2595 Ga0496116_0027959
2596 Ga0496117_0008534
2597 Ga0496117_0020216
2598 Ga0496117_0110525
2599 Ga0496118_0005404
2600 Ga0496118_0081091
2601 Ga0496118_0158449
2602 Ga0496118_0171458
2603 Ga0496119_0019984
2604 Ga0496119_0176429
2605 Ga0496121_0001792
2606 Ga0496121_0006459
2607 Ga0496121_0007926
2608 Ga0496121_0020823
2609 Ga0496121_0031286
2610 Ga0496121_0033400
2611 Ga0496121_0087378
2612 Ga0496121_0094060
2613 Ga0496122_0004473
2614 Ga0496122_0012893
2615 Ga0496123_0002939
2616 Ga0496123_0069175
2617 Ga0496124_0001699
2618 Ga0496124_0003528
2619 Ga0496124_0009869
2620 Ga0496124_0012665
2621 Ga0496124_0051536
2622 Ga0496125_0000193
2623 Ga0496125_0002061
2624 Ga0496125_0027656
2625 Ga0496125_0044758
2626 Ga0496126_0003499
2627 Ga0496126_0020494
2628 Ga0496126_0095386
2629 Ga0496126_0112316
2630 Ga0496126_0126023
2631 Ga0496126_0142113
2632 Ga0496126_0220791
2633 Ga0496126_0232896
2634 Ga0495678_019920
2635 Ga0495682_0066948
2636 Ga0501031_0000014
2637 Ga0501031_0007601
2638 Ga0501031_0015537
2639 Ga0501032_0000015
2640 Ga0501032_0000025
2641 Ga0501032_0023077
2642 Ga0501033_0000023
2643 Ga0501033_0000931
2644 Ga0501033_0021850
2645 Ga0501033_0027504
2646 Ga0501033_0033122
2647 Ga0501034_0000073
2648 Ga0501034_0001297
2649 Ga0501034_0027566
2650 Ga0501034_0053282
2651 Ga0501034_0054225
2652 Ga0501034_0068536
2653 Ga0501034_0074521
2654 Ga0501034_0181944
2655 Ga0501034_0269304
2656 Ga0501036_0000002
2657 Ga0501036_0003093
2658 Ga0501036_0166554
2659 Ga0501037_0000158
2660 Ga0501037_0001431
2661 Ga0501037_0090739
2662 Ga0501038_0000002
2663 Ga0501038_0000521
2664 Ga0501038_0022729
2665 Ga0501038_0029867
2666 Ga0501039_0000002
2667 Ga0501039_0000003
2668 Ga0501040_0033762
2669 Ga0501042_0078933
2670 Ga0501043_0000140
2671 Ga0501043_0001411
2672 Ga0501046_0014546
2673 Ga0501046_0024079
2674 Ga0501046_0043381
2675 Ga0501047_0019631
2676 Ga0501047_0165299
2677 Ga0501067_0063288
2678 Ga0501067_0065099
2679 Ga0501067_0097731
2680 Ga0501069_0057590
2681 Ga0501069_0068924
2682 Ga0501070_0018750
2683 Ga0501070_0037504
2684 Ga0501070_0137619
2685 Ga0501070_0193776
2686 Ga0501071_0009317
2687 Ga0501072_0024507
2688 Ga0501072_0154070
2689 Ga0501073_0015427
2690 Ga0501073_0052327
2691 Ga0501074_0009248
2692 Ga0501074_0076634
2693 Ga0501074_0114110
2694 Ga0501074_0231070
2695 Ga0501076_0050344
2696 Ga0501077_0031226
2697 Ga0501079_0017209
2698 Ga0501035_0000022
2699 Ga0501035_0001751
2700 Ga0501035_0031501
2701 Ga0501044_0000002
2702 Ga0501044_0004669
2703 Ga0501044_0029622
2704 Ga0501044_0087557
2705 Ga0501044_0105076
2706 Ga0501044_0167857
2707 Ga0501045_0008342
2708 Ga0501045_0019288
2709 nmdc:mga03683_1313_c1
2710 nmdc:mga03683_24137_c1
2711 nmdc:mga03683_38063_c1
2712 nmdc:mga03n38_39675_c1
2713 nmdc:mga03n38_44108_c1
2714 nmdc:mga03n38_57037_c1
2715 nmdc:mga03n38_905_c1
2716 nmdc:mga03n38_9552_c1
2717 nmdc:mga00v17_145042_c1
2718 nmdc:mga00v17_178523_c1
2719 nmdc:mga00v17_29345_c1
2720 nmdc:mga00v17_63735_c1
2721 nmdc:mga0yw44_1207_c1
2722 nmdc:mga0yw44_21492_c1
2723 nmdc:mga0yw44_41026_c1
2724 nmdc:mga0k408_147172_c1
2725 nmdc:mga0k408_261073_c1
2726 nmdc:mga0k408_28184_c1
2727 nmdc:mga0k408_60577_c1
2728 nmdc:mga06z11_12870_c1
2729 nmdc:mga06z11_13853_c1
2730 nmdc:mga06z11_208164_c1
2731 nmdc:mga06z11_23978_c1
2732 nmdc:mga06z11_5558_c1
2733 nmdc:mga06z11_5949_c1
2734 nmdc:mga04h51_1408_c1
2735 nmdc:mga04h51_53586_c1
2736 nmdc:mga04h51_9170_c1
2737 nmdc:mga07m45_213841_c1
2738 nmdc:mga07m45_39768_c2
2739 nmdc:mga07m45_39888_c1
2740 nmdc:mga07m45_4286_c1
2741 nmdc:mga07m45_4857_c1
2742 nmdc:mga07m45_85797_c1
2743 nmdc:mga05p37_132010_c1
2744 nmdc:mga09592_190268_c1
2745 nmdc:mga0qj67_143950_c1
2746 nmdc:mga0qj67_80_c1
2747 nmdc:mga06r32_386391_c1
2748 nmdc:mga06r32_69498_c1
2749 nmdc:mga08y16_156295_c1
2750 nmdc:mga08y16_66144_c1
2751 nmdc:mga0n895_16529_c1
2752 nmdc:mga0n895_56495_c1
2753 nmdc:mga0a205_16737_c1
2754 nmdc:mga0a205_7682_c1
2755 nmdc:mga0sz30_16429_c1
2756 nmdc:mga0sz30_26767_c1
2757 nmdc:mga0sz30_35868_c2
2758 nmdc:mga0sz30_6895_c1
2759 nmdc:mga0sz30_82591_c1
2760 Ga0495601_0008691
2761 Ga0495601_0023512
2762 Ga0495601_0028032
2763 Ga0495601_0067995
2764 Ga0495612_0006612
2765 Ga0495655_0011254
2766 Ga0495595_0000892
2767 Ga0495595_0015333
2768 Ga0495595_0027513
2769 Ga0495595_0112307
2770 Ga0495619_0000733
2771 Ga0495619_0043765
2772 Ga0495619_0044395
2773 Ga0500578_0201951
2774 Ga0500643_000062
2775 Ga0500646_0048158
2776 Ga0500583_0027485
2777 Ga0500583_0158696
2778 Ga0500651_0016777
2779 Ga0500566_0000012
2780 Ga0500640_000451
2781 Ga0500554_001597
2782 Ga0500556_0039210
2783 Ga0500556_0093007
2784 Ga0500569_033562
2785 Ga0500591_002497
2786 Ga0500594_0033424
2787 Ga0500595_009948
2788 Ga0500595_019122
2789 Ga0500595_040260
2790 Ga0500614_001289
2791 Ga0500614_039828
2792 Ga0500618_009065
2793 Ga0500642_0058151
2794 Ga0500658_0004005
2795 Ga0500658_0049595
2796 Ga0500559_0003889
2797 Ga0500568_0000048
2798 Ga0500568_0000506
2799 Ga0500568_0009612
2800 Ga0500568_0030580
2801 Ga0500577_0000244
2802 Ga0500577_0001624
2803 Ga0500589_061893
2804 Ga0500603_000344
2805 Ga0500603_000521
2806 Ga0500616_0001481
2807 Ga0500616_0038220
2808 Ga0500616_0130304
2809 Ga0500622_0061822
2810 Ga0500627_0001861
2811 Ga0500630_002638
2812 Ga0500638_068459
2813 Ga0500638_108914
2814 Ga0500639_000058
2815 Ga0500636_0107433
2816 Ga0500637_0003484
2817 Ga0500637_0044585
2818 Ga0500645_004456
2819 Ga0500596_001233
2820 Ga0500601_002416
2821 Ga0587077_004909
2822 Ga0587077_007045
2823 Ga0587082_004781
2824 Ga0587101_002342
2825 Ga0587062_002285
2826 Ga0587076_002433
2827 Ga0501082_0078895
2828 Ga0530510_0068114
2829 2509107847
2830 2509152747
2831 2509376244
2832 2509387107
2833 2509442598
2834 2510132853
2835 2510307472
2836 2510307520
2837 2510894227
2838 2510899252
2839 2511501391
2840 2511502788
2841 2512534076
2842 2512971864
2843 2512974203
2844 2513570058
2845 2513575308
2846 2513583156
2847 2513584009
2848 2513602191
2849 2513607520
2850 2513617072
2851 2513617779
2852 2513633002
2853 2513692276
2854 2513694907
2855 2513710276
2856 2513723886
2857 2513882150
2858 2513886269
2859 2513890418
2860 2513905472
2861 2513906324
2862 2513987606
2863 2513988404
2864 2514000302
2865 2514003778
2866 2514005415
2867 2514019850
2868 2515111805
2869 2515610504
2870 2515611472
2871 2515639406
2872 2515642137
2873 2515656190
2874 2515739006
2875 2516209260
2876 2516892670
2877 2516894157
2878 2517035529
2879 2517075989
2880 2517094728
2881 2517406353
2882 2517569478
2883 2517570843
2884 2517892855
2885 2523102290
2886 2524442248
2887 2524443782
2888 2524452891
2889 2524453518
2890 2524464219
2891 2524466466
2892 2524540740
2893 2530645112
2894 2535486892
2895 2551674139
2896 2551674661
2897 2551676290
2898 2551684504
2899 2551689596
2900 2551690397
2901 2551697106
2902 2551698018
2903 2551698584
2904 2551710483
2905 2551712309
2906 2551718693
2907 2551722358
2908 2551731033
2909 2551731324
2910 2551736505
2911 2551738478
2912 2551739993
2913 2551744914
2914 2558863112
2915 2585168318
2916 2585230067
2917 2585254331
2918 2585268945
2919 2585389470
2920 2585393916
2921 2585528131
2922 2585540339
2923 2585838538
2924 2585845747
2925 2600192347
2926 2600194710
2927 2600375617
2928 2617381621
2929 2643772757
2930 2643775485
2931 2643793931
2932 2643804007
2933 2643808429
2934 2643837425
2935 2644049544
2936 2644064809
2937 2644066478
2938 2644108662
2939 2644109510
2940 2644145194
2941 2644146621
2942 2644193138
2943 2644204048
2944 2644307775
2945 2644312215
2946 2644332550
2947 2644333858
2948 2644335841
2949 2644376252
2950 2644378066
2951 2644415309
2952 2644416482
2953 2644449522
2954 2644450290
2955 2644482578
2956 2644494702
2957 2644499080
2958 2644544297
2959 2644546698
2960 2644613864
2961 2644617898
2962 2644676908
2963 2644677923
2964 2644687842
2965 2644688097
2966 2644731907
2967 2644737234
2968 2644746970
2969 2644747364
2970 2657683691
2971 2671117546
2972 2692316416
2973 2719385383
2974 2721399132
2975 2723845351
2976 2724037945
2977 2725950422
2978 2728751656
2979 2738799292
2980 2739038264
2981 2745080053
2982 2753359040
2983 2757571718
2984 2758641278
2985 2766067946
2986 2778176408
2987 2792581183
2988 2792623190
2989 2792626954
2990 2792642617
2991 2793068181
2992 2793083451
2993 2793297124
2994 2793313896
2995 2793337316
2996 2793360413
2997 2802718065
2998 2802718860
2999 2802725083
3000 2802726471
3001 2802730793
3002 2802733014
3003 2802738140
3004 2802738369
3005 2802743991
3006 2802744701
3007 2802750869
3008 2802751093
3009 2804751872
3010 2806045561
3011 2806051635
3012 2806061679
3013 2806067860
3014 2806072787
3015 2819687460
3016 2819719065
3017 2838079339
3018 2838682642
3019 2838689061
3020 2838697221
3021 2838709546
3022 2838730396
3023 2838743337
3024 2841762291
3025 2841762568
3026 2841854976
3027 2841864978
3028 2842077712
3029 2842110955
3030 2842119779
3031 2842157838
3032 2842165053
3033 2842180578
3034 2842197084
3035 2842206484
3036 2842220554
3037 2842236273
3038 2842238959
3039 2842244515
3040 2842258328
3041 2842273081
3042 2842279941
3043 2842291374
3044 2842309438
3045 2842346970
3046 2842366803
3047 2842373217
3048 2842377770
3049 2842386289
3050 2842399554
3051 2842525971
3052 2844109829
3053 2844110106
3054 2844169059
3055 2844170386
3056 2844459585
3057 2847418515
3058 2848993493
3059 2850080816
3060 2851183321
3061 2851187017
3062 2851248304
3063 2851248581
3064 2854902010
3065 2854912672
3066 2854916918
3067 2855825481
3068 2855826876
3069 2855840859
3070 2855842272
3071 2855873322
3072 2857522937
3073 2858801402
3074 2858803088
3075 2874608744
3076 2876767226
3077 2882462972
3078 2885380104
3079 2889040105
3080 2894773328
3081 2896387006
3082 2899807525
3083 2903750550
3084 2904696167
3085 2904703036
3086 2906618088
3087 2908743283
3088 2908760801
3089 2913300460
3090 2915651550
3091 2915653391
3092 2915980391
3093 2915985219
3094 2915987473
3095 2915993148
3096 2915996974
3097 2915999372
3098 2916003934
3099 2916004561
3100 2916011563
3101 2916012939
3102 2916015166
3103 2916020874
3104 2916022755
3105 2916025747
3106 2916030459
3107 2916033484
3108 2916038520
3109 2916041791
3110 2916046813
3111 2916048061
3112 2916049904
3113 2916053960
3114 2916057431
3115 2916060175
3116 2916066968
3117 2916068088
3118 2916070791
3119 2916078299
3120 2916079954
3121 2917699182
3122 2917699602
3123 2920765591
3124 2920824234
3125 2920828681
3126 2921201610
3127 2921204995
3128 2921209183
3129 2921214633
3130 2921238561
3131 2921244173
3132 2921244883
3133 2921248129
3134 2921252208
3135 2921253024
3136 2921257492
3137 2921260486
3138 2921267443
3139 2921269071
3140 2921283097
3141 2921285529
3142 2921292644
3143 2921294482
3144 2921300304
3145 2921301361
3146 2922363316
3147 2922365103
3148 2922388598
3149 2922390740
3150 2922429986
3151 2924145480
3152 2924146434
3153 2924156388
3154 2924158937
3155 2924160060
3156 2924170263
3157 2924171377
3158 2924175742
3159 2924178278
3160 2924182445
3161 2924183034
3162 2924187328
3163 2924189389
3164 2924197240
3165 2924198631
3166 2924201687
3167 2924202727
3168 2924213559
3169 2924213922
3170 2924217412
3171 2924219884
3172 2924223137
3173 2924227510
3174 2924233581
3175 2924234725
3176 2933575788
3177 2933586980
3178 2935633551
3179 2935898922
3180 2935904888
3181 2936373188
3182 2936381333
3183 2936997746
3184 2936999882
3185 2937004690
3186 2937008320
3187 2937011000
3188 2937012533
3189 2937016985
3190 2937018334
3191 2937025818
3192 2937029227
3193 2937031194
3194 2937032388
3195 2937036670
3196 2937040860
3197 2937043668
3198 2937049587
3199 2937051850
3200 2937052131
3201 2937059020
3202 2937059625
3203 2937065014
3204 2937067034
3205 2937074648
3206 2937075673
3207 2937078457
3208 2937079988
3209 2937085526
3210 2937086256
3211 2937097105
3212 2937097613
3213 2937102956
3214 2937106019
3215 2937110782
3216 2937112896
3217 2937114997
3218 2937117830
3219 2937121385
3220 2937123146
3221 2937127999
3222 2937129559
3223 2941499809
3224 2941501876
3225 2941510442
3226 2941517821
3227 2941525837
3228 2957378283
3229 2957378586
3230 2957384502
3231 2957385911
3232 2957389715
3233 2957389997
3234 2957397358
3235 2957399315
3236 2957404708
3237 2957405922
3238 2957409176
3239 2957411229
3240 2957416856
3241 2957417644
3242 2957427908
3243 2957428305
3244 2957433527
3245 2957434245
3246 2957437214
3247 2957437891
3248 2957448673
3249 2957449388
3250 2957452377
3251 2957456734
3252 2957461559
3253 2957462491
3254 2957467299
3255 2957467925
3256 2957473654
3257 2957476179
3258 2957480255
3259 2957482971
3260 2957485049
3261 2957487956
3262 2957495081
3263 2957495653
3264 2957499424
3265 2957504478
3266 2957511803
3267 2957511915
3268 2960586396
3269 2960590814
3270 2960591105
3271 2960596154
3272 2960600435
3273 2960603262
3274 2960607225
3275 2960608610
3276 2960612910
3277 2960616302
3278 2960623130
3279 2960623386
3280 2960624620
3281 2960625150
3282 2960635770
3283 2960637256
3284 2960641980
3285 2960643635
3286 2960650783
3287 2960651237
3288 2960658699
3289 2960664402
3290 2960666693
3291 2960669872
3292 2960671986
3293 2960678557
3294 2960680125
3295 2960682473
3296 2960686850
3297 2960689608
3298 2960692252
3299 2960695972
3300 2960697237
3301 2964609101
3302 2964611158
3303 2964617480
3304 2964619038
3305 2964624026
3306 2964628267
3307 2964631013
3308 2964633892
3309 2964637046
3310 2964640606
3311 2964644792
3312 2964646008
3313 2964651473
3314 2964655769
3315 2964657543
3316 2964660062
3317 2964664977
3318 2964666504
3319 2964672867
3320 2964677377
3321 2964680733
3322 2964682183
3323 2964687300
3324 2964691263
3325 2964693723
3326 2964696315
3327 2964701500
3328 2964702061
3329 2964708541
3330 2964709216
3331 2964716833
3332 2964718565
3333 2964721769
3334 2964724508
3335 2967668094
3336 2967670756
3337 2967674578
3338 2967674834
3339 2967683781
3340 2967684135
3341 2967687350
3342 2967687644
3343 2967693628
3344 2967696366
3345 2967701678
3346 2967706349
3347 2967710466
3348 2967711992
3349 2967719891
3350 2967720330
3351 2967722987
3352 2967728187
3353 2967729572
3354 2967734291
3355 2967735227
3356 2967741207
3357 2967743126
3358 2967744987
3359 2967750080
3360 2967752483
3361 2967758023
3362 2967760136
3363 2967763482
3364 2967764124
3365 2967770596
3366 2967771596
3367 2967778254
3368 2967778791
3369 2970020074
3370 2970021621
3371 2970030965
3372 2970033408
3373 2970036804
3374 2970038207
3375 2970042433
3376 2970047189
3377 2970051431
3378 2970053911
3379 2970056123
3380 2970061417
3381 2970065534
3382 2970067561
3383 2970072287
3384 2970072353
3385 2970077445
3386 2970080137
3387 2970083160
3388 2970084794
3389 2970089218
3390 2970095282
3391 2970097997
3392 2970099416
3393 2970103679
3394 2970103727
3395 2970112054
3396 2970114378
3397 2970116760
3398 2970121189
3399 2970124715
3400 2970128732
3401 2970130062
3402 2970130327
3403 2970141070
3404 2970141135
3405 2970145528
3406 2970146460
3407 2970151485
3408 2970155249
3409 2970158868
3410 2970162773
3411 2970167076
3412 2970170561
3413 2970171975
3414 2970173541
3415 2970181182
3416 2970181378
3417 2970185431
3418 2970190396
3419 2970195355
3420 2970196948
3421 2977518008
3422 2977521217
3423 2977526551
3424 2977528739
3425 2977533851
3426 2977534182
3427 2977540264
3428 2977542264
3429 2977547343
3430 2977547611
3431 2977552283
3432 2977554856
3433 2977560130
3434 2977564575
3435 2977568350
3436 2977569734
3437 2977574921
3438 2977575536
3439 2977579907
3440 2977585231
3441 2989350966
3442 2996338206
3443 3003933532
3444 3005447196
3445 3005479751
3446 3005724950
3447 639648088
3448 643592422
3449 643825521
3450 648735995
3451 648740155
3452 8003993356
3453 8003994785
3454 8004000607
3455 8004002446
3456 8005280151
3457 8005314606
3458 8005378731
3459 8005462463
3460 8005558164
3461 8005569342
3462 8005575384
3463 8005696227
3464 8006941358
3465 8006965493
3466 8006980996
3467 8007000530
3468 8018168047
3469 8018180300
3470 8019557276
3471 8019568025
3472 8023680925
3473 8024485696
3474 8049294406
3475 8054562848
3476 8056674117
3477 8056677744
3478 8056688169
3479 8056693734
3480 8057535372
3481 8057535553
3482 8057875545

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00497

SBP_bac_3

Bacterial extracellular solute-binding proteins, family 3

60

282

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
4z9n-assembly3.cif.gz_C abc transporter / periplasmic binding protein from brucella ovis with glutathione bound 0.9898 25 341
4z9n-assembly3.cif.gz_C abc transporter / periplasmic binding protein from brucella ovis with glutathione bound 0.9775 25 341
7a99-assembly1.cif.gz_A crystal structure of the phe57trp mutant of the arginine-bound form of domain 1 from tmargbp 0.8858 27 123
6q3u-assembly1.cif.gz_A gly52ala mutant of arginine-bound argbp from t. maritima 0.8856 27 245
8ovo-assembly1.cif.gz_B x-ray structure of the sf-iglusnfr-s72a in complex with l-aspartate 0.8835 25 252
ID Description Score Start End Superfamily
2yjpA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9058 24 125 3.40.190.10
2v25B02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8935 123 224 3.40.190.10
5eyfA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8917 27 121 3.40.190.10
af_P96257_184_272_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8909 128 222 3.40.190.10
2ia4B02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.889 128 222 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A4Q8QMC4-F1-model_v4 Amino acid ABC transporter substrate-bindnig protein 0.9942 29 341 GO:0006865
AF-A0A7S7Q2N8-F1-model_v4 Amino acid ABC transporter substrate-binding protein 0.9935 25 341 GO:0006865
AF-A0A3S2B3J7-F1-model_v4 Amino acid ABC transporter substrate-binding protein 0.9917 56 341 GO:0006865
AF-F2IXB3-F1-model_v4 Amino acid ABC transporter, periplasmic amino acid-binding protein 0.9886 40 341 GO:0006865
AF-A0A4Q8QMC4-F1-model_v4 Amino acid ABC transporter substrate-bindnig protein 0.9879 29 341 GO:0006865

Map