F495604
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1759 | 699 | 3518 | 400 |
Family's Representative Sequence
| Representative Sequence | 3300048915|Ga0496112_0044614|Ga0496112_0044614_1799_3163 |
| Length | 440 |
| Sequence | VSERVVLAYSGGLDTSVAIGWIAEETGAEVIAVAADVGQGGEDLDAIRERALACGAVESLVLDLKEEYAEEYCLPALKANALYLDRYPLVSALSRPVIVKHLVEAARYHGASTVAHGCTGKGNDQVRFEVGIGALAPDIRVLAPVRDSGMSRDKAIAFAEEKGLPIDVTKKSPYSIDQNLWGRAVETGFLEDIWNAPIEDVYDYTADPAVPRDADEVVITFDRGAPVAIDGRPVSVLQAVLELNKRAGAQGVGRLDLVEDRLVGIKSREVYEAPGAIALITAHQELENVTVERDLARFKRPVEQRWGELVYDGLWFSPLKRALDGFVEEANAHVSGDIRLTLHGGRAVVSGRRSQSALYEYEMATYDSGDAFDQSLAKGFVELWGLPSKMAARRDHRVATTQPRRPRMAGVWVLCEASVPGNVPTHLPYVVELNRRMIEA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 2 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 5 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 6 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 7 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 8 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 9 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 10 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 11 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 12 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 13 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 14 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 16 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 22 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 26 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 38 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 54 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 59 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 60 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 67 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 69 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 70 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 71 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 73 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 74 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 75 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 76 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 77 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 78 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 79 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 80 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 81 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 82 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 83 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 84 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 85 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 86 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 87 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 89 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 90 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 91 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 92 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 93 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 94 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 95 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 96 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 97 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 98 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 99 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 100 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 101 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 102 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 103 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 104 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 105 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 106 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 107 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 108 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 110 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 141 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 142 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 143 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 144 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 148 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 150 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 218 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 222 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 223 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 224 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 225 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 226 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 227 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 228 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 229 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 230 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 231 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 232 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 233 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 234 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 235 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 236 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 237 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 238 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 239 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 240 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 241 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 242 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 243 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 244 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 245 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 246 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 247 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 248 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 249 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 250 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 251 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 252 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 253 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 254 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 255 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 256 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 257 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 258 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 259 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 260 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 261 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 262 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 263 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 264 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 265 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 266 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 267 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 268 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 269 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 270 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 271 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 272 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 273 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 274 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 275 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 276 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 277 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 278 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 279 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 280 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 281 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 282 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 283 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 284 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 285 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 286 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 287 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 288 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 289 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 290 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 291 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 292 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 293 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 294 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 295 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 296 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 297 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 298 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 299 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 300 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 301 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 302 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 303 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 304 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 305 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 306 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 307 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 308 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 309 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 310 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 311 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 312 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 313 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 314 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 385 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 386 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 387 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 388 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 389 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 390 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 391 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 392 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 393 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 394 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 395 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 396 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 397 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 398 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 399 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 400 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 401 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 402 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 403 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 404 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 405 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 406 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 407 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 408 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 409 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 410 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 411 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 412 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 413 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 414 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 415 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 416 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 417 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 418 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 419 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 420 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 421 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 422 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 423 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 424 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 425 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 426 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 427 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 428 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 429 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 430 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 431 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 432 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 433 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 434 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 435 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 436 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 437 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 438 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 439 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 440 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 441 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 442 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 443 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 444 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 445 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 446 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 447 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 448 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 449 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 450 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 451 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 452 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 453 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 454 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 455 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 456 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 457 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 458 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 459 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 462 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 464 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 465 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 466 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 467 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 468 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 469 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 470 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 471 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 472 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 473 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 474 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 475 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 476 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 477 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 478 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 479 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 480 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 481 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 482 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 483 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 484 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 485 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 486 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 487 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 488 | 2501939600 | Micromonospora sp. L5 | Isolate | Unclassified |
| 489 | 2506783011 | Frankia datiscae Dg1 | Isolate | Nodule |
| 490 | 2515154088 | Salinispora arenicola CNT800 | Isolate | Rhizosphere |
| 491 | 2515154129 | Salinispora pacifica CNS103 | Isolate | Rhizosphere |
| 492 | 2515154137 | Salinispora arenicola CNX482 | Isolate | Rhizosphere |
| 493 | 2515154155 | Actinopolymorpha alba DSM 45243 | Isolate | Rhizosphere |
| 494 | 2515154202 | Salinispora pacifica CNT084 | Isolate | Rhizosphere |
| 495 | 2515154203 | Salinispora arenicola CNR921 | Isolate | Rhizosphere |
| 496 | 2523231044 | Gordonia rhizosphera NBRC 16068 | Isolate | Rhizosphere |
| 497 | 2527291627 | Frankia casuarinae Thr | Isolate | Nodule |
| 498 | 2527291629 | Frankia sp. BMG5.23 | Isolate | Nodule |
| 499 | 2546825537 | Frankia sp. CcI6 | Isolate | Rhizoplane |
| 500 | 2547132424 | Nocardia nova SH22a | Isolate | Unclassified |
| 501 | 2551306166 | Nocardia tenerifensis NBRC 101015 | Isolate | Rhizosphere |
| 502 | 2554235005 | Streptomyces violaceusniger SPC6 | Isolate | Rhizosphere |
| 503 | 2558860112 | Pseudonocardia acaciae DSM 45401 | Isolate | Unclassified |
| 504 | 2565956761 | Rhodococcus qingshengii BKS 20-40 | Isolate | Rhizosphere |
| 505 | 2576861822 | Frankia sp. CeD | Isolate | Nodule |
| 506 | 2579778521 | Frankia torreyi CpI1-S | Isolate | Unclassified |
| 507 | 2582581312 | Streptomyces atratus OK008 | Isolate | Rhizosphere |
| 508 | 2582581314 | Streptomyces mirabilis YR139 | Isolate | Rhizosphere |
| 509 | 2616644814 | Streptomyces mirabilis OK461 | Isolate | Rhizosphere |
| 510 | 2619618881 | Frankia sp. ACN1ag | Isolate | Unclassified |
| 511 | 2619619003 | Frankia sp. CpI1-P | Isolate | Nodule |
| 512 | 2622736605 | Geodermatophilus ruber DSM 45317 | Isolate | Rhizosphere |
| 513 | 2622736626 | Micromonospora rhizosphaerae DSM 45431 | Isolate | Rhizosphere |
| 514 | 2626541554 | Frankia sp. AvcI.1 | Isolate | Nodule |
| 515 | 2643221578 | Streptomyces sp. Root63 | Isolate | Unclassified |
| 516 | 2643221601 | Kitasatospora sp. Root187 | Isolate | Unclassified |
| 517 | 2643221616 | Leifsonia sp. Root227 | Isolate | Unclassified |
| 518 | 2643221631 | Kitasatospora sp. Root107 | Isolate | Unclassified |
| 519 | 2643221673 | Streptomyces sp. Root1295 | Isolate | Unclassified |
| 520 | 2643221687 | Mycobacterium sp. Root135 | Isolate | Unclassified |
| 521 | 2643221690 | Cellulomonas sp. Root485 | Isolate | Unclassified |
| 522 | 2643221692 | Nocardia sp. Root136 | Isolate | Unclassified |
| 523 | 2643221694 | Cellulomonas sp. Root137 | Isolate | Unclassified |
| 524 | 2643221715 | Mycobacterium sp. Root265 | Isolate | Unclassified |
| 525 | 2643221722 | Cellulomonas sp. Root930 | Isolate | Unclassified |
| 526 | 2671180195 | Frankia sp. CcI49 | Isolate | Nodule |
| 527 | 2675903058 | Actinopolymorpha cephalotaxi CPCC 202808 | Isolate | Rhizosphere |
| 528 | 2675903059 | Asanoa hainanensis CGMCC 4.5593 | Isolate | Rhizosphere |
| 529 | 2684623035 | Frankia sp. NRRL B-16219 | Isolate | Rhizosphere |
| 530 | 2684623036 | Frankia sp. CgIM4 | Isolate | Nodule |
| 531 | 2687453743 | Frankia colletiae Cc1.17 | Isolate | Nodule |
| 532 | 2710264753 | Frankia sp. KB5 | Isolate | Nodule |
| 533 | 2731639228 | Motilibacter peucedani DSM 45328 | Isolate | Rhizosphere |
| 534 | 2738541264 | Mycobacterium sp. OK889 | Isolate | Unclassified |
| 535 | 2738541274 | Mycobacterium sp. YR708 | Isolate | Unclassified |
| 536 | 2738541308 | Rhodococcus sp. OK551 | Isolate | Unclassified |
| 537 | 2738541356 | Mycobacterium sp. OK887 | Isolate | Unclassified |
| 538 | 2738543005 | Rhodococcus sp. OK519 | Isolate | Unclassified |
| 539 | 2738543011 | Rhodococcus sp. OK611 | Isolate | Unclassified |
| 540 | 2738543028 | Mycobacterium sp. YR782 | Isolate | Unclassified |
| 541 | 2744054611 | Aldersonia kunmingensis DSM 45001 | Isolate | Rhizosphere |
| 542 | 2751185734 | Saccharothrix sp. NRRL B-16314 | Isolate | Rhizosphere |
| 543 | 2751185788 | Curtobacterium pusillum AA3 | Isolate | Unclassified |
| 544 | 2773857922 | Frankia sp. CcI49 | Isolate | Nodule |
| 545 | 2773857924 | Frankia sp. CgIS1 | Isolate | Nodule |
| 546 | 2773857933 | Frankia sp. BMG5.30 | Isolate | Nodule |
| 547 | 2775506925 | Saccharopolyspora phatthalungensis NRRL B-24798 | Isolate | Rhizosphere |
| 548 | 2791355406 | Streptomyces rhizosphaericus NRRL B-24304 | Isolate | Unclassified |
| 549 | 2808606370 | Arthrobacter sp. SLBN-100 | Isolate | Unclassified |
| 550 | 2808606700 | Arthrobacter agilis UMCV2 | Isolate | Rhizosphere |
| 551 | 2808606982 | Streptomyces sp. SLBN-118 | Isolate | Unclassified |
| 552 | 2811994880 | Cellulomonas sp. SLBN-39 | Isolate | Unclassified |
| 553 | 2811994917 | Streptomyces sp. SLBN-134 | Isolate | Unclassified |
| 554 | 2818991472 | Kitasatospora viridis DSM 44826 | Isolate | Rhizosphere |
| 555 | 2827628540 | Actinopolymorpha cephalotaxi DSM 45117 | Isolate | Rhizosphere |
| 556 | 2837183177 | Egibacter rhizosphaerae EGI 80759 | Isolate | Unclassified |
| 557 | 2839986021 | Cellulosimicrobium cellulans JZ5 | Isolate | Unclassified |
| 558 | 2842134933 | Mycolicibacterium obuense SEMIA 442 | Isolate | Nodule |
| 559 | 2844849076 | Arthrobacter cupressi DSM 24664 | Isolate | Rhizosphere |
| 560 | 2844852863 | Herbiconiux flava DSM 26474 | Isolate | Rhizosphere |
| 561 | 2855676851 | Micromonospora saelicesensis GAR05 | Isolate | Unclassified |
| 562 | 2855683550 | Micromonospora sp. RP3T | Isolate | Unclassified |
| 563 | 2856858025 | Micromonospora aurantiaca 110B(2018) | Isolate | Unclassified |
| 564 | 2857288857 | Micromonospora noduli ONO23 | Isolate | Unclassified |
| 565 | 2857737099 | Lysinimonas sp. R-73066 | Isolate | Unclassified |
| 566 | 2857740372 | Paenarthrobacter sp. R-74611 | Isolate | Unclassified |
| 567 | 2858848962 | Micromonospora saelicesensis GAR06 | Isolate | Unclassified |
| 568 | 2858868258 | Micromonospora sp. MH33 | Isolate | Unclassified |
| 569 | 2858882152 | Micromonospora noduli MED15 | Isolate | Nodule |
| 570 | 2858888857 | Micromonospora saelicesensis Lupac 06 | Isolate | Unclassified |
| 571 | 2858895516 | Micromonospora saelicesensis PSN13 | Isolate | Unclassified |
| 572 | 2858902515 | Micromonospora sp. MW-13 | Isolate | Rhizosphere |
| 573 | 2861520306 | Phytomonospora endophytica DSM 45386 | Isolate | Unclassified |
| 574 | 2862507626 | Streptomyces sp. NWU339 | Isolate | Unclassified |
| 575 | 2862705112 | Streptomyces triticirhizae NEAU-YY642 | Isolate | Rhizosphere |
| 576 | 2863067949 | Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) | Isolate | Rhizosphere |
| 577 | 2867302475 | Micromonospora globbae WPS1-2 | Isolate | Unclassified |
| 578 | 2867312974 | Micromonospora musae NGC1-4 | Isolate | Unclassified |
| 579 | 2867319477 | Micromonospora musae MS1-9 | Isolate | Unclassified |
| 580 | 2867346516 | Streptomyces radicis AZ1-7 | Isolate | Unclassified |
| 581 | 2867369537 | Streptomyces sp. Z26 | Isolate | Unclassified |
| 582 | 2867475112 | Streptomyces sp. TM32 | Isolate | Unclassified |
| 583 | 2868088558 | Phytoactinopolyspora endophytica EGI 60009 | Isolate | Unclassified |
| 584 | 2869048445 | Micromonospora saelicesensis PSN01 | Isolate | Unclassified |
| 585 | 2869061728 | Micromonospora noduli ONO86 | Isolate | Unclassified |
| 586 | 2869068681 | Micromonospora noduli GUI43 | Isolate | Unclassified |
| 587 | 2870622029 | Conyzicola lurida DSM 105784 | Isolate | Unclassified |
| 588 | 2870721527 | Saccharothrix ecbatanensis DSM 45486 | Isolate | Rhizosphere |
| 589 | 2875391855 | Streptomyces cavourensis 1AS2a | Isolate | Rhizosphere |
| 590 | 2880489317 | Micromonospora ureilytica DSM 101692 | Isolate | Unclassified |
| 591 | 2880495981 | Micromonospora vinacea DSM 101695 | Isolate | Unclassified |
| 592 | 2884763398 | Leifsonia sp. PS1209 | Isolate | Stem Tuber |
| 593 | 2884994152 | Cellulomonas sp. H30R-01 | Isolate | Rhizosphere |
| 594 | 2889300758 | Rhodococcus sp. PvR099 | Isolate | Rhizosphere |
| 595 | 2891326441 | Actinokineospora pegani TRM65233 | Isolate | Unclassified |
| 596 | 2895427314 | Nonomuraea sp. PA05 | Isolate | Unclassified |
| 597 | 2895880812 | Frankia sp. BMG5.11 | Isolate | Unclassified |
| 598 | 2899359706 | Amycolatopsis anabasis EGI 650086 | Isolate | Unclassified |
| 599 | 2899370129 | Amycolatopsis alkalitolerans SYSUP0005 | Isolate | Stem Tuber |
| 600 | 2902582711 | Micromonospora sp. AP08 | Isolate | Unclassified |
| 601 | 2902792274 | Mycolicibacterium sp. P9-64 | Isolate | Unclassified |
| 602 | 2902799365 | Mycolicibacterium sp. P1-5 | Isolate | Unclassified |
| 603 | 2902810491 | Mycolicibacterium sp. P9-22 | Isolate | Unclassified |
| 604 | 2902837492 | Mycolicibacterium sp. P1-18 | Isolate | Unclassified |
| 605 | 2904497146 | Arthrobacter sp. 1276 | Isolate | Rhizosphere |
| 606 | 2904535858 | Rhodococcus erythropolis 2017 | Isolate | Unclassified |
| 607 | 2904765812 | Rhodococcus fascians 1590 | Isolate | Rhizosphere |
| 608 | 2904770941 | Rhodococcus fascians 1339 | Isolate | Rhizosphere |
| 609 | 2904776348 | Paenarthrobacter sp. 1092 | Isolate | Rhizosphere |
| 610 | 2905926851 | Arthrobacter sedimenti MIC A30 | Isolate | Rhizosphere |
| 611 | 2908811453 | Rhodococcus sp. 1R11 | Isolate | Unclassified |
| 612 | 2910809715 | Paenarthrobacter sp. CM16 | Isolate | Unclassified |
| 613 | 2912715099 | Streptomyces sp. Z423-1 | Isolate | Rhizosphere |
| 614 | 2912723979 | Streptomyces sp. NEAU-sy36 | Isolate | Rhizosphere |
| 615 | 2912757875 | Streptomyces sp. S4.7 | Isolate | Rhizosphere |
| 616 | 2919034639 | Paenarthrobacter nitroguajacolicus 247 | Isolate | Rhizosphere |
| 617 | 2919042368 | Curtobacterium sp. 320 | Isolate | Rhizosphere |
| 618 | 2919051321 | Sinomonas atrocyanea 1003 | Isolate | Rhizosphere |
| 619 | 2919059106 | Arthrobacter sp. 1088 | Isolate | Rhizosphere |
| 620 | 2919391150 | Arthrobacter ipis 2973 | Isolate | Unclassified |
| 621 | 2919420072 | Rhodococcus fascians 3241 | Isolate | Rhizosphere |
| 622 | 2919432681 | Rhodococcus sp. 3258 | Isolate | Rhizosphere |
| 623 | 2919538618 | Paenarthrobacter nitroguajacolicus 3945 | Isolate | Unclassified |
| 624 | 2919713450 | Nocardia kruczakiae 4272 | Isolate | Rhizosphere |
| 625 | 2922554459 | Rhodococcus sp. 66b | Isolate | Unclassified |
| 626 | 2928104781 | Curtobacterium sp. 1544 | Isolate | Rhizosphere |
| 627 | 2928142448 | Prescottella equi DPS 2018 | Isolate | Unclassified |
| 628 | 2929212328 | Mycolicibacterium sp. R-73050 Hybrid assembly | Isolate | Unclassified |
| 629 | 2929219909 | Micromonospora sp. R-75348 Hybrid assembly | Isolate | Unclassified |
| 630 | 2929226422 | Micromonospora sp. R-74116 Hybrid assembly | Isolate | Unclassified |
| 631 | 2932398195 | Dietzia sp. 2505 | Isolate | Rhizosphere |
| 632 | 2932426870 | Paenarthrobacter sp. 4246 | Isolate | Rhizosphere |
| 633 | 2932431166 | Cellulosimicrobium sp. 4261 | Isolate | Rhizosphere |
| 634 | 2933418574 | Jeotgalibacillus campisalis 4120 | Isolate | Rhizosphere |
| 635 | 2935390628 | Streptomyces sp. PvR034 | Isolate | Rhizosphere |
| 636 | 2939582691 | Mycolicibacterium sp. 624 | Isolate | Rhizosphere |
| 637 | 2939647034 | Arthrobacter sp. 2762 | Isolate | Rhizosphere |
| 638 | 2939660829 | Mycetocola sp. 2940 | Isolate | Rhizosphere |
| 639 | 2939674588 | Arthrobacter bambusae 3552 | Isolate | Rhizosphere |
| 640 | 2939743619 | Rhodococcus sp. PvR044 | Isolate | Rhizosphere |
| 641 | 2945920336 | Pseudarthrobacter siccitolerans W1I3 | Isolate | Rhizosphere |
| 642 | 2945941187 | Arthrobacter pascens W1I14 | Isolate | Rhizosphere |
| 643 | 2945956166 | Arthrobacter globiformus W2I3 | Isolate | Rhizosphere |
| 644 | 2946003308 | Arthrobacter agilis W3I6 | Isolate | Rhizosphere |
| 645 | 2946037020 | Arthrobacter sp. W4I7 | Isolate | Rhizosphere |
| 646 | 2946045630 | Streptomyces sp. W4I9-2 | Isolate | Rhizosphere |
| 647 | 2947224130 | Streptomyces afghaniensis W1I20 | Isolate | Rhizosphere |
| 648 | 2953998280 | Pseudarthrobacter sp. W1I19 | Isolate | Rhizosphere |
| 649 | 2954002825 | Streptomyces turgidiscabies W2I16 | Isolate | Rhizosphere |
| 650 | 2956939328 | Lolliginicoccus suaedae LNNU 331112 | Isolate | Rhizosphere |
| 651 | 2966924647 | Frigoribacterium sp. 2355 | Isolate | Rhizosphere |
| 652 | 2974302888 | Pseudarthrobacter sp. SORGH_AS 212 | Isolate | Unclassified |
| 653 | 2984523437 | Rhodococcus sp. SORGH_AS303 | Isolate | Aerial Root |
| 654 | 2984551494 | Curtobacterium sp. SORGH_AS776 | Isolate | Aerial Root |
| 655 | 2990044586 | Streptomyces sedi JCM 16909 | Isolate | Unclassified |
| 656 | 2990059506 | Streptomyces sp. CAP261 | Isolate | Unclassified |
| 657 | 2990088156 | Streptomyces albidus CAP 215 | Isolate | Unclassified |
| 658 | 2995463766 | Streptacidiphilus fuscans NEAU-YB345 | Isolate | Unclassified |
| 659 | 2996221748 | Micromonospora veneta CAP181 | Isolate | Unclassified |
| 660 | 2997451912 | Streptomyces piniterrae jys28 | Isolate | Rhizosphere |
| 661 | 2997600082 | Streptomyces coffeae CA1R205 | Isolate | Unclassified |
| 662 | 3001119090 | Lolliginicoccus lacisalsi G463 | Isolate | Rhizosphere |
| 663 | 3002998708 | Actinomadura barringtoniae GKU 128 | Isolate | Unclassified |
| 664 | 3006321560 | Actinacidiphila epipremni PRB2-1 | Isolate | Unclassified |
| 665 | 3006393351 | Streptomyces sp. SID4985 | Isolate | Unclassified |
| 666 | 3006425503 | Streptomyces zingiberis PLAI1-29 | Isolate | Unclassified |
| 667 | 3006486233 | Streptomyces sp. BR123 | Isolate | Rhizosphere |
| 668 | 637000116 | Frankia casuarinae CcI3 | Isolate | Nodule |
| 669 | 649633069 | Micromonospora sp. L5 | Isolate | Unclassified |
| 670 | 8003830390 | Micromonospora parastrephiae STR1_7 | Isolate | Rhizosphere |
| 671 | 8003856774 | Micromonospora echinofusca MPMI6 | Isolate | Unclassified |
| 672 | 8004025490 | Arthrobacter wenxiniae AETb3-4 | Isolate | Rhizosphere |
| 673 | 8008485437 | Streptomyces mimosae 3MP-10 | Isolate | Unclassified |
| 674 | 8008574985 | Streptomyces sp. Jing01 | Isolate | Rhizosphere |
| 675 | 8025478263 | Streptomyces telluris AA8 | Isolate | Rhizosphere |
| 676 | 8025524527 | Streptomyces sp. 3MP-14 | Isolate | Unclassified |
| 677 | 8025530807 | Streptomyces sp. 4R-3d | Isolate | Unclassified |
| 678 | 8033684223 | Streptomyces phytophilus PIP175 | Isolate | Unclassified |
| 679 | 8047893842 | Streptomyces cangkringensis DSM 41769 | Isolate | Rhizosphere |
| 680 | 8048127548 | Streptomyces samsunensis DSM 42010 | Isolate | Rhizosphere |
| 681 | 8048356638 | Streptomyces rhizosphaericus DSM 41760 | Isolate | Rhizosphere |
| 682 | 8048369669 | Streptomyces indonesiensis DSM 41759 | Isolate | Rhizoplane |
| 683 | 8048379754 | Streptomyces asiaticus DSM 41761 | Isolate | Rhizosphere |
| 684 | 8053945823 | Actinomadura terrae OS3-83 | Isolate | Rhizosphere |
| 685 | 8054107350 | Arthrobacter rhizosphaerae CCNWLXL 1-35 | Isolate | Rhizosphere |
| 686 | 8054704163 | Micromonospora trifolii NIE79 | Isolate | Nodule |
| 687 | 8054727385 | Micromonospora alfalfae MED01 | Isolate | Nodule |
| 688 | 8054734606 | Micromonospora hortensis NIE111 | Isolate | Nodule |
| 689 | 8054913762 | Frankia gtarii Agncl-10 | Isolate | Nodule |
| 690 | 8054920844 | Frankia tisae Agncl-8 | Isolate | Nodule |
| 691 | 8055066027 | Sphaerisporangium corydalis NEAU-YHS15 | Isolate | Unclassified |
| 692 | 8055157932 | Frankia umida Ag45/Mut15 | Isolate | Nodule |
| 693 | 8055172936 | Sphaerisporangium perillae NEAU-ZS1 | Isolate | Unclassified |
| 694 | 8055412473 | Micromonospora phytophila DSM 105363 | Isolate | Nodule |
| 695 | 8056060235 | Nocardiopsis endophytica RSe5-2 | Isolate | Unclassified |
| 696 | 8056447290 | Streptomyces huiliensis SCA2-4 | Isolate | Rhizosphere |
| 697 | 8056667051 | Streptomyces sichuanensis SCA3-4 | Isolate | Rhizosphere |
| 698 | 8056829672 | Streptomyces barringtoniae JA03 | Isolate | Rhizosphere |
| 699 | 8057568493 | Actinorhabdospora filicis NBRC 111898 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 87.72 |
| Metatranscriptomes | 0.11 |
| Isolates | 12.17 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.11 |
| Bulb | 0 |
| Endosphere | 5.69 |
| Nodule | 1.31 |
| Rhizoplane | 6.31 |
| Rhizosphere | 75.72 |
| Stem | 0 |
| Stem Tuber | 0.11 |
| Unclassified | 0.06 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0496112_0044614 | 3300048915 | Bacteria | 4345 |
| 2 | JGI24746J21847_1000536 | 3300001977 | Bacteria | 5692 |
| 3 | JGI24737J22298_10021667 | 3300001990 | Bacteria | 2047 |
| 4 | JGI24745J21846_1000370 | 3300002073 | Bacteria | 3926 |
| 5 | JGI24749J21850_1007903 | 3300002076 | Bacteria | 1480 |
| 6 | JGI24744J21845_10000965 | 3300002077 | Bacteria | 5488 |
| 7 | JGI24034J26672_10008906 | 3300002239 | Bacteria | 1474 |
| 8 | JGI24742J22300_10001394 | 3300002244 | Bacteria | 3810 |
| 9 | JGI25164J39214_1000515 | 3300002772 | Bacteria | 18519 |
| 10 | JGI25152J39213_1000980 | 3300002773 | Bacteria | 13874 |
| 11 | JGI25151J46595_10031792 | 3300003187 | Bacteria | 2056 |
| 12 | JGI25165J46597_1000044 | 3300003214 | Bacteria | 263289 |
| 13 | Ga0055540_1000211 | 3300003792 | Bacteria | 55318 |
| 14 | Ga0055540_1004259 | 3300003792 | Bacteria | 6554 |
| 15 | Ga0055540_1006714 | 3300003792 | Bacteria | 4508 |
| 16 | Ga0065714_10010605 | 3300005288 | Bacteria | 2082 |
| 17 | Ga0065712_10022902 | 3300005290 | Bacteria | 1739 |
| 18 | Ga0070658_10000155 | 3300005327 | Bacteria | 60553 |
| 19 | Ga0070658_10002940 | 3300005327 | Bacteria | 14124 |
| 20 | Ga0070658_10078060 | 3300005327 | Bacteria | 2717 |
| 21 | Ga0070658_10112230 | 3300005327 | Bacteria | 2259 |
| 22 | Ga0070658_10241926 | 3300005327 | Bacteria | 1530 |
| 23 | Ga0070676_10113118 | 3300005328 | Bacteria | 1693 |
| 24 | Ga0070683_100002759 | 3300005329 | Bacteria | 14036 |
| 25 | Ga0070683_100008046 | 3300005329 | Bacteria | 8952 |
| 26 | Ga0070683_100133817 | 3300005329 | Bacteria | 2347 |
| 27 | Ga0070683_100140430 | 3300005329 | Bacteria | 2289 |
| 28 | Ga0070690_100027643 | 3300005330 | Bacteria | 3507 |
| 29 | Ga0070690_100074970 | 3300005330 | Bacteria | 2205 |
| 30 | Ga0070670_100052841 | 3300005331 | Bacteria | 3489 |
| 31 | Ga0068869_100011022 | 3300005334 | Bacteria | 5921 |
| 32 | Ga0068869_100018593 | 3300005334 | Bacteria | 4732 |
| 33 | Ga0068869_100030573 | 3300005334 | Bacteria | 3781 |
| 34 | Ga0070666_10012208 | 3300005335 | Bacteria | 5413 |
| 35 | Ga0070666_10073071 | 3300005335 | Bacteria | 2336 |
| 36 | Ga0070680_100001962 | 3300005336 | Bacteria | 15137 |
| 37 | Ga0070680_100021263 | 3300005336 | Bacteria | 5155 |
| 38 | Ga0070680_100045036 | 3300005336 | Bacteria | 3586 |
| 39 | Ga0070682_100003447 | 3300005337 | Bacteria | 8762 |
| 40 | Ga0070682_100054024 | 3300005337 | Bacteria | 2519 |
| 41 | Ga0070682_100165205 | 3300005337 | Bacteria | 1533 |
| 42 | Ga0068868_100000794 | 3300005338 | Bacteria | 21371 |
| 43 | Ga0068868_100013822 | 3300005338 | Bacteria | 5933 |
| 44 | Ga0068868_100014864 | 3300005338 | Bacteria | 5745 |
| 45 | Ga0068868_100178949 | 3300005338 | Bacteria | 1758 |
| 46 | Ga0068868_100254829 | 3300005338 | Bacteria | 1478 |
| 47 | Ga0070660_100011330 | 3300005339 | Bacteria | 6329 |
| 48 | Ga0070660_100103520 | 3300005339 | Bacteria | 2258 |
| 49 | Ga0070689_100053548 | 3300005340 | Bacteria | 3123 |
| 50 | Ga0070691_10002291 | 3300005341 | Bacteria | 8472 |
| 51 | Ga0070691_10006343 | 3300005341 | Bacteria | 5405 |
| 52 | Ga0070661_100047797 | 3300005344 | Bacteria | 3131 |
| 53 | Ga0070692_10003769 | 3300005345 | Bacteria | 6232 |
| 54 | Ga0070692_10007565 | 3300005345 | Bacteria | 4791 |
| 55 | Ga0070668_100000964 | 3300005347 | Bacteria | 20121 |
| 56 | Ga0070668_100001978 | 3300005347 | Bacteria | 14972 |
| 57 | Ga0070668_100014132 | 3300005347 | Bacteria | 5967 |
| 58 | Ga0070668_100016742 | 3300005347 | Bacteria | 5481 |
| 59 | Ga0070668_100017923 | 3300005347 | Bacteria | 5311 |
| 60 | Ga0070668_100068032 | 3300005347 | Bacteria | 2768 |
| 61 | Ga0070669_100027727 | 3300005353 | Bacteria | 4077 |
| 62 | Ga0070669_100057955 | 3300005353 | Bacteria | 2843 |
| 63 | Ga0070675_100000432 | 3300005354 | Bacteria | 28465 |
| 64 | Ga0070675_100018048 | 3300005354 | Bacteria | 5616 |
| 65 | Ga0070675_100024819 | 3300005354 | Bacteria | 4802 |
| 66 | Ga0070675_100245660 | 3300005354 | Bacteria | 1565 |
| 67 | Ga0070671_100000370 | 3300005355 | Bacteria | 31140 |
| 68 | Ga0070671_100041360 | 3300005355 | Bacteria | 3831 |
| 69 | Ga0070671_100087577 | 3300005355 | Bacteria | 2606 |
| 70 | Ga0070674_100042205 | 3300005356 | Bacteria | 3097 |
| 71 | Ga0070674_100090614 | 3300005356 | Bacteria | 2206 |
| 72 | Ga0070674_100185527 | 3300005356 | Bacteria | 1596 |
| 73 | Ga0070673_100031422 | 3300005364 | Bacteria | 3984 |
| 74 | Ga0070688_100010888 | 3300005365 | Bacteria | 5034 |
| 75 | Ga0070659_100006799 | 3300005366 | Bacteria | 8278 |
| 76 | Ga0070659_100105731 | 3300005366 | Bacteria | 2268 |
| 77 | Ga0070667_100000562 | 3300005367 | Bacteria | 36767 |
| 78 | Ga0070667_100001312 | 3300005367 | Bacteria | 22360 |
| 79 | Ga0070667_100006829 | 3300005367 | Bacteria | 9479 |
| 80 | Ga0070667_100014813 | 3300005367 | Bacteria | 6442 |
| 81 | Ga0070667_100092326 | 3300005367 | Bacteria | 2604 |
| 82 | Ga0070709_10006919 | 3300005434 | Bacteria | 6192 |
| 83 | Ga0070714_100000045 | 3300005435 | Bacteria | 113749 |
| 84 | Ga0070714_100048774 | 3300005435 | Bacteria | 3602 |
| 85 | Ga0070714_100064441 | 3300005435 | Bacteria | 3154 |
| 86 | Ga0070714_100068199 | 3300005435 | Bacteria | 3068 |
| 87 | Ga0070714_100120606 | 3300005435 | Bacteria | 2332 |
| 88 | Ga0070714_100123813 | 3300005435 | Bacteria | 2302 |
| 89 | Ga0070714_100289252 | 3300005435 | Bacteria | 1525 |
| 90 | Ga0070713_100001944 | 3300005436 | Bacteria | 13338 |
| 91 | Ga0070713_100007682 | 3300005436 | Bacteria | 7590 |
| 92 | Ga0070713_100093894 | 3300005436 | Bacteria | 2585 |
| 93 | Ga0070713_100105853 | 3300005436 | Bacteria | 2444 |
| 94 | Ga0070713_100172511 | 3300005436 | Bacteria | 1938 |
| 95 | Ga0070710_10001141 | 3300005437 | Bacteria | 12594 |
| 96 | Ga0070710_10004138 | 3300005437 | Bacteria | 6884 |
| 97 | Ga0070710_10010958 | 3300005437 | Bacteria | 4467 |
| 98 | Ga0070710_10018959 | 3300005437 | Bacteria | 3548 |
| 99 | Ga0070710_10115985 | 3300005437 | Bacteria | 1615 |
| 100 | Ga0070701_10058009 | 3300005438 | Bacteria | 2031 |
| 101 | Ga0070711_100001916 | 3300005439 | Bacteria | 11636 |
| 102 | Ga0070711_100004625 | 3300005439 | Bacteria | 8147 |
| 103 | Ga0070711_100081123 | 3300005439 | Bacteria | 2311 |
| 104 | Ga0070705_100017002 | 3300005440 | Bacteria | 3790 |
| 105 | Ga0070700_100000094 | 3300005441 | Bacteria | 60178 |
| 106 | Ga0070700_100007945 | 3300005441 | Bacteria | 5757 |
| 107 | Ga0070700_100008853 | 3300005441 | Bacteria | 5501 |
| 108 | Ga0070700_100025985 | 3300005441 | Bacteria | 3453 |
| 109 | Ga0070700_100035573 | 3300005441 | Bacteria | 3015 |
| 110 | Ga0070708_100022408 | 3300005445 | Bacteria | 5358 |
| 111 | Ga0070663_100009639 | 3300005455 | Bacteria | 5989 |
| 112 | Ga0070663_100014886 | 3300005455 | Bacteria | 5002 |
| 113 | Ga0070663_100035622 | 3300005455 | Bacteria | 3453 |
| 114 | Ga0070663_100067628 | 3300005455 | Bacteria | 2592 |
| 115 | Ga0070663_100201281 | 3300005455 | Bacteria | 1554 |
| 116 | Ga0070678_100003103 | 3300005456 | Bacteria | 9209 |
| 117 | Ga0070678_100011769 | 3300005456 | Bacteria | 5410 |
| 118 | Ga0070678_100027420 | 3300005456 | Bacteria | 3867 |
| 119 | Ga0070678_100050196 | 3300005456 | Bacteria | 3016 |
| 120 | Ga0070678_100135038 | 3300005456 | Bacteria | 1966 |
| 121 | Ga0070678_100144904 | 3300005456 | Bacteria | 1905 |
| 122 | Ga0070678_100146363 | 3300005456 | Bacteria | 1897 |
| 123 | Ga0070662_100002734 | 3300005457 | Bacteria | 10898 |
| 124 | Ga0070662_100070790 | 3300005457 | Bacteria | 2570 |
| 125 | Ga0070662_100092533 | 3300005457 | Bacteria | 2273 |
| 126 | Ga0070681_10000504 | 3300005458 | Bacteria | 31959 |
| 127 | Ga0070681_10009194 | 3300005458 | Bacteria | 9713 |
| 128 | Ga0070681_10033991 | 3300005458 | Bacteria | 5120 |
| 129 | Ga0070681_10100015 | 3300005458 | Bacteria | 2846 |
| 130 | Ga0068867_100002956 | 3300005459 | Bacteria | 11971 |
| 131 | Ga0070685_10006635 | 3300005466 | Bacteria | 5906 |
| 132 | Ga0070685_10019605 | 3300005466 | Bacteria | 3652 |
| 133 | Ga0070685_10022713 | 3300005466 | Bacteria | 3424 |
| 134 | Ga0070706_100027267 | 3300005467 | Bacteria | 5256 |
| 135 | Ga0070706_100032645 | 3300005467 | Bacteria | 4803 |
| 136 | Ga0070707_100003790 | 3300005468 | Bacteria | 14265 |
| 137 | Ga0070707_100039640 | 3300005468 | Bacteria | 4503 |
| 138 | Ga0070707_100366908 | 3300005468 | Bacteria | 1399 |
| 139 | Ga0070698_100006733 | 3300005471 | Bacteria | 12461 |
| 140 | Ga0070698_100075451 | 3300005471 | Bacteria | 3376 |
| 141 | Ga0070679_100000687 | 3300005530 | Bacteria | 29007 |
| 142 | Ga0070679_100001838 | 3300005530 | Bacteria | 19103 |
| 143 | Ga0070679_100005358 | 3300005530 | Bacteria | 11869 |
| 144 | Ga0070679_100063294 | 3300005530 | Bacteria | 3687 |
| 145 | Ga0070679_100088386 | 3300005530 | Bacteria | 3086 |
| 146 | Ga0068853_100008631 | 3300005539 | Bacteria | 8194 |
| 147 | Ga0068853_100026901 | 3300005539 | Bacteria | 4833 |
| 148 | Ga0068853_100028554 | 3300005539 | Bacteria | 4693 |
| 149 | Ga0068853_100047185 | 3300005539 | Bacteria | 3696 |
| 150 | Ga0068853_100127831 | 3300005539 | Bacteria | 2272 |
| 151 | Ga0068853_100233417 | 3300005539 | Bacteria | 1683 |
| 152 | Ga0070672_100104720 | 3300005543 | Bacteria | 2299 |
| 153 | Ga0070695_100023511 | 3300005545 | Bacteria | 3788 |
| 154 | Ga0070696_100006572 | 3300005546 | Bacteria | 7761 |
| 155 | Ga0070696_100088676 | 3300005546 | Bacteria | 2199 |
| 156 | Ga0070693_100004975 | 3300005547 | Bacteria | 6346 |
| 157 | Ga0070693_100005567 | 3300005547 | Bacteria | 6063 |
| 158 | Ga0070693_100052400 | 3300005547 | Bacteria | 2339 |
| 159 | Ga0070665_100001805 | 3300005548 | Bacteria | 24264 |
| 160 | Ga0070665_100019654 | 3300005548 | Bacteria | 6780 |
| 161 | Ga0070665_100054549 | 3300005548 | Bacteria | 4009 |
| 162 | Ga0070665_100061354 | 3300005548 | Bacteria | 3769 |
| 163 | Ga0070665_100063798 | 3300005548 | Bacteria | 3694 |
| 164 | Ga0070665_100067128 | 3300005548 | Bacteria | 3597 |
| 165 | Ga0070704_100005363 | 3300005549 | Bacteria | 7466 |
| 166 | Ga0070704_100029852 | 3300005549 | Bacteria | 3645 |
| 167 | Ga0070704_100076065 | 3300005549 | Bacteria | 2454 |
| 168 | Ga0068855_100012387 | 3300005563 | Bacteria | 10301 |
| 169 | Ga0068855_100027492 | 3300005563 | Bacteria | 6802 |
| 170 | Ga0068855_100034580 | 3300005563 | Bacteria | 6024 |
| 171 | Ga0068855_100039520 | 3300005563 | Bacteria | 5602 |
| 172 | Ga0068855_100164286 | 3300005563 | Bacteria | 2518 |
| 173 | Ga0070664_100001189 | 3300005564 | Bacteria | 20725 |
| 174 | Ga0070664_100366178 | 3300005564 | Bacteria | 1313 |
| 175 | Ga0068857_100012484 | 3300005577 | Bacteria | 7399 |
| 176 | Ga0068857_100054554 | 3300005577 | Bacteria | 3547 |
| 177 | Ga0068857_100186618 | 3300005577 | Bacteria | 1888 |
| 178 | Ga0068854_100002196 | 3300005578 | Bacteria | 11999 |
| 179 | Ga0068856_100031138 | 3300005614 | Bacteria | 5218 |
| 180 | Ga0068856_100032411 | 3300005614 | Bacteria | 5115 |
| 181 | Ga0068856_100050005 | 3300005614 | Bacteria | 4120 |
| 182 | Ga0068856_100177027 | 3300005614 | Bacteria | 2146 |
| 183 | Ga0068856_100188635 | 3300005614 | Bacteria | 2075 |
| 184 | Ga0068856_100227229 | 3300005614 | Bacteria | 1882 |
| 185 | Ga0070702_100000252 | 3300005615 | Bacteria | 18230 |
| 186 | Ga0070702_100019881 | 3300005615 | Bacteria | 3510 |
| 187 | Ga0070702_100038061 | 3300005615 | Bacteria | 2675 |
| 188 | Ga0070702_100156110 | 3300005615 | Bacteria | 1470 |
| 189 | Ga0068852_100018879 | 3300005616 | Bacteria | 5444 |
| 190 | Ga0068852_100047617 | 3300005616 | Bacteria | 3658 |
| 191 | Ga0068852_100191948 | 3300005616 | Bacteria | 1928 |
| 192 | Ga0068859_100001857 | 3300005617 | Bacteria | 21468 |
| 193 | Ga0068859_100019700 | 3300005617 | Bacteria | 6776 |
| 194 | Ga0068859_100030262 | 3300005617 | Bacteria | 5432 |
| 195 | Ga0068859_100038886 | 3300005617 | Bacteria | 4772 |
| 196 | Ga0068859_100063907 | 3300005617 | Bacteria | 3712 |
| 197 | Ga0068864_100055401 | 3300005618 | Bacteria | 3423 |
| 198 | Ga0068864_100184358 | 3300005618 | Bacteria | 1910 |
| 199 | Ga0068866_10002581 | 3300005718 | Bacteria | 7476 |
| 200 | Ga0068866_10010288 | 3300005718 | Bacteria | 4005 |
| 201 | Ga0068861_100009286 | 3300005719 | Bacteria | 6787 |
| 202 | Ga0068861_100053137 | 3300005719 | Bacteria | 3081 |
| 203 | Ga0068861_100082531 | 3300005719 | Bacteria | 2519 |
| 204 | Ga0068861_100088673 | 3300005719 | Bacteria | 2436 |
| 205 | Ga0068861_100106931 | 3300005719 | Bacteria | 2236 |
| 206 | Ga0068851_10000124 | 3300005834 | Bacteria | 41585 |
| 207 | Ga0068870_10001152 | 3300005840 | Bacteria | 10575 |
| 208 | Ga0068863_100015607 | 3300005841 | Bacteria | 7297 |
| 209 | Ga0068863_100034697 | 3300005841 | Bacteria | 4804 |
| 210 | Ga0068863_100040994 | 3300005841 | Bacteria | 4402 |
| 211 | Ga0068863_100048819 | 3300005841 | Bacteria | 4012 |
| 212 | Ga0068863_100055479 | 3300005841 | Bacteria | 3752 |
| 213 | Ga0068863_100077002 | 3300005841 | Bacteria | 3156 |
| 214 | Ga0068863_100156177 | 3300005841 | Bacteria | 2184 |
| 215 | Ga0068863_100390572 | 3300005841 | Bacteria | 1360 |
| 216 | Ga0068858_100000032 | 3300005842 | Bacteria | 142794 |
| 217 | Ga0068858_100000175 | 3300005842 | Bacteria | 68239 |
| 218 | Ga0068858_100121712 | 3300005842 | Bacteria | 2441 |
| 219 | Ga0068858_100121732 | 3300005842 | Bacteria | 2440 |
| 220 | Ga0068860_100000085 | 3300005843 | Bacteria | 166269 |
| 221 | Ga0068860_100000112 | 3300005843 | Bacteria | 130953 |
| 222 | Ga0068860_100023080 | 3300005843 | Bacteria | 6017 |
| 223 | Ga0068860_100056291 | 3300005843 | Bacteria | 3739 |
| 224 | Ga0068862_100001577 | 3300005844 | Bacteria | 20769 |
| 225 | Ga0068862_100102490 | 3300005844 | Bacteria | 2505 |
| 226 | Ga0068862_100130004 | 3300005844 | Bacteria | 2226 |
| 227 | Ga0068862_100283589 | 3300005844 | Bacteria | 1519 |
| 228 | Ga0081455_10001891 | 3300005937 | Bacteria | 25187 |
| 229 | Ga0081455_10005347 | 3300005937 | Bacteria | 14103 |
| 230 | Ga0081455_10007359 | 3300005937 | Bacteria | 11605 |
| 231 | Ga0081455_10090029 | 3300005937 | Bacteria | 2489 |
| 232 | Ga0081455_10142666 | 3300005937 | Bacteria | 1858 |
| 233 | Ga0081538_10001227 | 3300005981 | Bacteria | 26904 |
| 234 | Ga0081538_10038909 | 3300005981 | Bacteria | 3058 |
| 235 | Ga0081540_1003275 | 3300005983 | Bacteria | 12878 |
| 236 | Ga0081540_1005254 | 3300005983 | Bacteria | 9691 |
| 237 | Ga0081540_1010341 | 3300005983 | Bacteria | 6328 |
| 238 | Ga0081539_10001305 | 3300005985 | Bacteria | 43590 |
| 239 | Ga0081539_10001973 | 3300005985 | Bacteria | 31246 |
| 240 | Ga0081539_10020787 | 3300005985 | Bacteria | 4416 |
| 241 | Ga0070717_10055531 | 3300006028 | Bacteria | 3268 |
| 242 | Ga0070717_10096763 | 3300006028 | Bacteria | 2500 |
| 243 | Ga0070717_10274918 | 3300006028 | Bacteria | 1492 |
| 244 | Ga0070717_10338763 | 3300006028 | Bacteria | 1343 |
| 245 | Ga0075365_10002419 | 3300006038 | Bacteria | 9147 |
| 246 | Ga0075365_10018831 | 3300006038 | Bacteria | 4252 |
| 247 | Ga0075365_10035009 | 3300006038 | Bacteria | 3246 |
| 248 | Ga0075365_10038497 | 3300006038 | Bacteria | 3109 |
| 249 | Ga0075365_10043570 | 3300006038 | Bacteria | 2938 |
| 250 | Ga0075365_10213262 | 3300006038 | Bacteria | 1354 |
| 251 | Ga0075368_10054756 | 3300006042 | Bacteria | 1590 |
| 252 | Ga0075363_100000882 | 3300006048 | Bacteria | 10552 |
| 253 | Ga0075363_100002130 | 3300006048 | Bacteria | 7956 |
| 254 | Ga0075363_100009173 | 3300006048 | Bacteria | 4645 |
| 255 | Ga0075363_100014328 | 3300006048 | Bacteria | 3870 |
| 256 | Ga0075363_100017745 | 3300006048 | Bacteria | 3534 |
| 257 | Ga0075364_10003955 | 3300006051 | Bacteria | 8503 |
| 258 | Ga0075364_10004377 | 3300006051 | Bacteria | 8113 |
| 259 | Ga0075364_10007221 | 3300006051 | Bacteria | 6583 |
| 260 | Ga0075364_10019257 | 3300006051 | Bacteria | 4282 |
| 261 | Ga0075364_10020109 | 3300006051 | Bacteria | 4198 |
| 262 | Ga0075364_10030027 | 3300006051 | Bacteria | 3487 |
| 263 | Ga0075364_10091633 | 3300006051 | Bacteria | 2017 |
| 264 | Ga0075432_10031113 | 3300006058 | Bacteria | 1847 |
| 265 | Ga0070715_10001858 | 3300006163 | Bacteria | 6315 |
| 266 | Ga0070715_10010123 | 3300006163 | Bacteria | 3350 |
| 267 | Ga0070715_10037487 | 3300006163 | Bacteria | 2006 |
| 268 | Ga0070716_100001032 | 3300006173 | Bacteria | 12191 |
| 269 | Ga0070716_100007759 | 3300006173 | Bacteria | 5297 |
| 270 | Ga0070716_100023759 | 3300006173 | Bacteria | 3255 |
| 271 | Ga0070712_100021261 | 3300006175 | Bacteria | 4259 |
| 272 | Ga0070712_100024582 | 3300006175 | Bacteria | 3994 |
| 273 | Ga0070712_100132874 | 3300006175 | Bacteria | 1888 |
| 274 | Ga0075367_10002786 | 3300006178 | Bacteria | 8101 |
| 275 | Ga0075367_10040651 | 3300006178 | Bacteria | 2716 |
| 276 | Ga0075367_10096811 | 3300006178 | Bacteria | 1800 |
| 277 | Ga0075369_10001816 | 3300006186 | Bacteria | 7442 |
| 278 | Ga0075369_10004962 | 3300006186 | Bacteria | 4953 |
| 279 | Ga0075369_10032463 | 3300006186 | Bacteria | 2209 |
| 280 | Ga0075369_10070535 | 3300006186 | Bacteria | 1537 |
| 281 | Ga0075370_10018399 | 3300006353 | Bacteria | 3791 |
| 282 | Ga0075370_10058776 | 3300006353 | Bacteria | 2187 |
| 283 | Ga0068871_100292839 | 3300006358 | Bacteria | 1427 |
| 284 | Ga0075428_100000416 | 3300006844 | Bacteria | 42412 |
| 285 | Ga0075428_100000630 | 3300006844 | Bacteria | 36085 |
| 286 | Ga0075428_100008931 | 3300006844 | Bacteria | 11121 |
| 287 | Ga0075428_100016382 | 3300006844 | Bacteria | 8190 |
| 288 | Ga0075428_100307936 | 3300006844 | Bacteria | 1703 |
| 289 | Ga0075430_100000876 | 3300006846 | Bacteria | 23636 |
| 290 | Ga0075430_100001812 | 3300006846 | Bacteria | 17488 |
| 291 | Ga0075430_100004627 | 3300006846 | Bacteria | 11575 |
| 292 | Ga0075430_100053863 | 3300006846 | Bacteria | 3387 |
| 293 | Ga0075431_100001436 | 3300006847 | Bacteria | 21935 |
| 294 | Ga0075431_100002862 | 3300006847 | Bacteria | 16694 |
| 295 | Ga0075431_100143546 | 3300006847 | Bacteria | 2460 |
| 296 | Ga0075433_10003068 | 3300006852 | Bacteria | 12833 |
| 297 | Ga0075433_10046700 | 3300006852 | Bacteria | 3767 |
| 298 | Ga0075433_10073782 | 3300006852 | Bacteria | 3002 |
| 299 | Ga0075433_10189043 | 3300006852 | Archaea | 1832 |
| 300 | Ga0075434_100003178 | 3300006871 | Bacteria | 14645 |
| 301 | Ga0075434_100311857 | 3300006871 | Bacteria | 1593 |
| 302 | Ga0075429_100000244 | 3300006880 | Bacteria | 37496 |
| 303 | Ga0075429_100006508 | 3300006880 | Bacteria | 10119 |
| 304 | Ga0075429_100020851 | 3300006880 | Bacteria | 5688 |
| 305 | Ga0068865_100000680 | 3300006881 | Bacteria | 19178 |
| 306 | Ga0068865_100019322 | 3300006881 | Bacteria | 4408 |
| 307 | Ga0075436_100010015 | 3300006914 | Bacteria | 6484 |
| 308 | Ga0075436_100085986 | 3300006914 | Bacteria | 2184 |
| 309 | Ga0075436_100095390 | 3300006914 | Bacteria | 2069 |
| 310 | Ga0097620_100001857 | 3300006931 | Bacteria | 21468 |
| 311 | Ga0097620_100019700 | 3300006931 | Bacteria | 6776 |
| 312 | Ga0097620_100030263 | 3300006931 | Bacteria | 5432 |
| 313 | Ga0097620_100038886 | 3300006931 | Bacteria | 4772 |
| 314 | Ga0097620_100063914 | 3300006931 | Bacteria | 3712 |
| 315 | Ga0075435_100004538 | 3300007076 | Bacteria | 9545 |
| 316 | Ga0075435_100189592 | 3300007076 | Unclassified | 1740 |
| 317 | Ga0105251_10015488 | 3300009011 | Bacteria | 4165 |
| 318 | Ga0105251_10057996 | 3300009011 | Bacteria | 1829 |
| 319 | Ga0105244_10004000 | 3300009036 | Bacteria | 10314 |
| 320 | Ga0105240_10023577 | 3300009093 | Bacteria | 8133 |
| 321 | Ga0105240_10033631 | 3300009093 | Bacteria | 6620 |
| 322 | Ga0111539_10053176 | 3300009094 | Bacteria | 4820 |
| 323 | Ga0111539_10452066 | 3300009094 | Bacteria | 1496 |
| 324 | Ga0105245_10001865 | 3300009098 | Bacteria | 19158 |
| 325 | Ga0105245_10030109 | 3300009098 | Bacteria | 4799 |
| 326 | Ga0105245_10040683 | 3300009098 | Bacteria | 4142 |
| 327 | Ga0105245_10042678 | 3300009098 | Bacteria | 4046 |
| 328 | Ga0105245_10083844 | 3300009098 | Bacteria | 2918 |
| 329 | Ga0105245_10225790 | 3300009098 | Bacteria | 1809 |
| 330 | Ga0105245_10296646 | 3300009098 | Bacteria | 1584 |
| 331 | Ga0105247_10000007 | 3300009101 | Bacteria | 409490 |
| 332 | Ga0105247_10000164 | 3300009101 | Bacteria | 64953 |
| 333 | Ga0105247_10001456 | 3300009101 | Bacteria | 17102 |
| 334 | Ga0105247_10004913 | 3300009101 | Bacteria | 8501 |
| 335 | Ga0105247_10013514 | 3300009101 | Bacteria | 4896 |
| 336 | Ga0105247_10038821 | 3300009101 | Bacteria | 2908 |
| 337 | Ga0114129_10000723 | 3300009147 | Bacteria | 41902 |
| 338 | Ga0114129_10006158 | 3300009147 | Bacteria | 17018 |
| 339 | Ga0114129_10009646 | 3300009147 | Bacteria | 13775 |
| 340 | Ga0114129_10012498 | 3300009147 | Bacteria | 12087 |
| 341 | Ga0114129_10018283 | 3300009147 | Bacteria | 9983 |
| 342 | Ga0114129_10032957 | 3300009147 | Bacteria | 7321 |
| 343 | Ga0114129_10074178 | 3300009147 | Bacteria | 4739 |
| 344 | Ga0114129_10178042 | 3300009147 | Bacteria | 2895 |
| 345 | Ga0105243_10002145 | 3300009148 | Bacteria | 16675 |
| 346 | Ga0105243_10003603 | 3300009148 | Bacteria | 12482 |
| 347 | Ga0105243_10019596 | 3300009148 | Bacteria | 5128 |
| 348 | Ga0105243_10053995 | 3300009148 | Bacteria | 3188 |
| 349 | Ga0105243_10083040 | 3300009148 | Bacteria | 2620 |
| 350 | Ga0105241_10000211 | 3300009174 | Bacteria | 43844 |
| 351 | Ga0105241_10004546 | 3300009174 | Bacteria | 10265 |
| 352 | Ga0105241_10107752 | 3300009174 | Bacteria | 2226 |
| 353 | Ga0105241_10117969 | 3300009174 | Bacteria | 2133 |
| 354 | Ga0105242_10013158 | 3300009176 | Bacteria | 6385 |
| 355 | Ga0105242_10057362 | 3300009176 | Bacteria | 3189 |
| 356 | Ga0105248_10002480 | 3300009177 | Bacteria | 20511 |
| 357 | Ga0105248_10003147 | 3300009177 | Bacteria | 18262 |
| 358 | Ga0105248_10007605 | 3300009177 | Bacteria | 11903 |
| 359 | Ga0105248_10013762 | 3300009177 | Bacteria | 8906 |
| 360 | Ga0105248_10018635 | 3300009177 | Bacteria | 7675 |
| 361 | Ga0105248_10025426 | 3300009177 | Bacteria | 6583 |
| 362 | Ga0105248_10059757 | 3300009177 | Bacteria | 4282 |
| 363 | Ga0105248_10070636 | 3300009177 | Bacteria | 3921 |
| 364 | Ga0105248_10092277 | 3300009177 | Bacteria | 3410 |
| 365 | Ga0105237_10002337 | 3300009545 | Bacteria | 23560 |
| 366 | Ga0105237_10048489 | 3300009545 | Bacteria | 4270 |
| 367 | Ga0105237_10175054 | 3300009545 | Bacteria | 2146 |
| 368 | Ga0105237_10247190 | 3300009545 | Bacteria | 1786 |
| 369 | Ga0105238_10029500 | 3300009551 | Bacteria | 5588 |
| 370 | Ga0105238_10199854 | 3300009551 | Bacteria | 1974 |
| 371 | Ga0105238_10318583 | 3300009551 | Bacteria | 1541 |
| 372 | Ga0105249_10000001 | 3300009553 | Bacteria | 504948 |
| 373 | Ga0105249_10001870 | 3300009553 | Bacteria | 18265 |
| 374 | Ga0105249_10016303 | 3300009553 | Bacteria | 6590 |
| 375 | Ga0105249_10028646 | 3300009553 | Bacteria | 5027 |
| 376 | Ga0105249_10122582 | 3300009553 | Bacteria | 2472 |
| 377 | Ga0105239_10037404 | 3300010375 | Bacteria | 5321 |
| 378 | Ga0105239_10037820 | 3300010375 | Bacteria | 5288 |
| 379 | Ga0105239_10213248 | 3300010375 | Bacteria | 2165 |
| 380 | Ga0105239_10221394 | 3300010375 | Bacteria | 2122 |
| 381 | Ga0105246_10016299 | 3300011119 | Bacteria | 4704 |
| 382 | Ga0105246_10020035 | 3300011119 | Bacteria | 4287 |
| 383 | Ga0157371_10063256 | 3300013102 | Bacteria | 2623 |
| 384 | Ga0157370_10010594 | 3300013104 | Bacteria | 9706 |
| 385 | Ga0157370_10024520 | 3300013104 | Bacteria | 5973 |
| 386 | Ga0157370_10069579 | 3300013104 | Bacteria | 3323 |
| 387 | Ga0157370_10297806 | 3300013104 | Bacteria | 1489 |
| 388 | Ga0157369_10003546 | 3300013105 | Bacteria | 18533 |
| 389 | Ga0157369_10003610 | 3300013105 | Bacteria | 18383 |
| 390 | Ga0157369_10013234 | 3300013105 | Bacteria | 9333 |
| 391 | Ga0157369_10015580 | 3300013105 | Bacteria | 8566 |
| 392 | Ga0157369_10095834 | 3300013105 | Bacteria | 3166 |
| 393 | Ga0157369_10101407 | 3300013105 | Bacteria | 3067 |
| 394 | Ga0157369_10156750 | 3300013105 | Bacteria | 2405 |
| 395 | Ga0157369_10179918 | 3300013105 | Bacteria | 2225 |
| 396 | Ga0157369_10228215 | 3300013105 | Bacteria | 1947 |
| 397 | Ga0157374_10022265 | 3300013296 | Bacteria | 5651 |
| 398 | Ga0157374_10105285 | 3300013296 | Bacteria | 2709 |
| 399 | Ga0157374_10161367 | 3300013296 | Bacteria | 2183 |
| 400 | Ga0157374_10186409 | 3300013296 | Bacteria | 2028 |
| 401 | Ga0157374_10191161 | 3300013296 | Bacteria | 2002 |
| 402 | Ga0157378_10009029 | 3300013297 | Bacteria | 8678 |
| 403 | Ga0157378_10035250 | 3300013297 | Bacteria | 4425 |
| 404 | Ga0163162_10016133 | 3300013306 | Bacteria | 7302 |
| 405 | Ga0163162_10020493 | 3300013306 | Bacteria | 6498 |
| 406 | Ga0163162_10145440 | 3300013306 | Bacteria | 2486 |
| 407 | Ga0157372_10002203 | 3300013307 | Bacteria | 21158 |
| 408 | Ga0157372_10003317 | 3300013307 | Bacteria | 17389 |
| 409 | Ga0157372_10305276 | 3300013307 | Bacteria | 1852 |
| 410 | Ga0157372_10465758 | 3300013307 | Bacteria | 1473 |
| 411 | Ga0157375_10011217 | 3300013308 | Bacteria | 7907 |
| 412 | Ga0157375_10049534 | 3300013308 | Bacteria | 4117 |
| 413 | Ga0157375_10109831 | 3300013308 | Bacteria | 2854 |
| 414 | Ga0157375_10153028 | 3300013308 | Bacteria | 2443 |
| 415 | Ga0163163_10009670 | 3300014325 | Bacteria | 8626 |
| 416 | Ga0163163_10016347 | 3300014325 | Bacteria | 6890 |
| 417 | Ga0163163_10109690 | 3300014325 | Bacteria | 2787 |
| 418 | Ga0163163_10126143 | 3300014325 | Bacteria | 2597 |
| 419 | Ga0163163_10137611 | 3300014325 | Bacteria | 2483 |
| 420 | Ga0163163_10366663 | 3300014325 | Bacteria | 1497 |
| 421 | Ga0157380_10030521 | 3300014326 | Bacteria | 4129 |
| 422 | Ga0157380_10049854 | 3300014326 | Bacteria | 3304 |
| 423 | Ga0157377_10026431 | 3300014745 | Bacteria | 3106 |
| 424 | Ga0157377_10031449 | 3300014745 | Bacteria | 2884 |
| 425 | Ga0157379_10000802 | 3300014968 | Bacteria | 25461 |
| 426 | Ga0157379_10012652 | 3300014968 | Bacteria | 7375 |
| 427 | Ga0157379_10021056 | 3300014968 | Bacteria | 5771 |
| 428 | Ga0157379_10075892 | 3300014968 | Bacteria | 3010 |
| 429 | Ga0157379_10199641 | 3300014968 | Bacteria | 1809 |
| 430 | Ga0157379_10202568 | 3300014968 | Bacteria | 1795 |
| 431 | Ga0157376_10056950 | 3300014969 | Bacteria | 3268 |
| 432 | Ga0157376_10101412 | 3300014969 | Bacteria | 2516 |
| 433 | Ga0157376_10179127 | 3300014969 | Bacteria | 1936 |
| 434 | Ga0163161_10007436 | 3300017792 | Bacteria | 7568 |
| 435 | Ga0163161_10010399 | 3300017792 | Bacteria | 6443 |
| 436 | Ga0163161_10038113 | 3300017792 | Bacteria | 3447 |
| 437 | Ga0206353_11145561 | 3300020082 | Bacteria | 2999 |
| 438 | Ga0213873_10000096 | 3300021358 | Bacteria | 17586 |
| 439 | Ga0213876_10008265 | 3300021384 | Bacteria | 5631 |
| 440 | Ga0213876_10020805 | 3300021384 | Bacteria | 3469 |
| 441 | Ga0213875_10000455 | 3300021388 | Bacteria | 35424 |
| 442 | Ga0213875_10011610 | 3300021388 | Bacteria | 4377 |
| 443 | Ga0213875_10035249 | 3300021388 | Bacteria | 2361 |
| 444 | Ga0207427_100126 | 3300025231 | Bacteria | 95170 |
| 445 | Ga0209437_100585 | 3300025233 | Bacteria | 23238 |
| 446 | Ga0209148_1004143 | 3300025254 | Bacteria | 3651 |
| 447 | Ga0209129_1000079 | 3300025258 | Bacteria | 187308 |
| 448 | Ga0209233_1000014 | 3300025261 | Bacteria | 996641 |
| 449 | Ga0209673_1006798 | 3300025273 | Bacteria | 5432 |
| 450 | Ga0209025_1001940 | 3300025294 | Bacteria | 23871 |
| 451 | Ga0209051_1000011 | 3300025303 | Bacteria | 610828 |
| 452 | Ga0209051_1000795 | 3300025303 | Bacteria | 33193 |
| 453 | Ga0209051_1002312 | 3300025303 | Bacteria | 13876 |
| 454 | Ga0209051_1017900 | 3300025303 | Bacteria | 3153 |
| 455 | Ga0207656_10000001 | 3300025321 | Bacteria | 1323684 |
| 456 | Ga0207656_10000003 | 3300025321 | Bacteria | 771644 |
| 457 | Ga0207655_1005143 | 3300025728 | Bacteria | 9004 |
| 458 | Ga0207655_1049401 | 3300025728 | Bacteria | 1718 |
| 459 | Ga0207713_1012442 | 3300025735 | Bacteria | 4547 |
| 460 | Ga0207682_10007444 | 3300025893 | Bacteria | 4364 |
| 461 | Ga0207692_10001723 | 3300025898 | Bacteria | 8283 |
| 462 | Ga0207692_10003209 | 3300025898 | Bacteria | 6361 |
| 463 | Ga0207692_10007932 | 3300025898 | Bacteria | 4375 |
| 464 | Ga0207642_10002272 | 3300025899 | Bacteria | 5982 |
| 465 | Ga0207710_10000013 | 3300025900 | Bacteria | 409402 |
| 466 | Ga0207710_10000082 | 3300025900 | Bacteria | 138091 |
| 467 | Ga0207710_10000178 | 3300025900 | Bacteria | 64962 |
| 468 | Ga0207710_10001332 | 3300025900 | Bacteria | 12412 |
| 469 | Ga0207710_10018838 | 3300025900 | Bacteria | 2939 |
| 470 | Ga0207710_10051974 | 3300025900 | Bacteria | 1842 |
| 471 | Ga0207688_10001000 | 3300025901 | Bacteria | 14400 |
| 472 | Ga0207688_10002930 | 3300025901 | Bacteria | 9278 |
| 473 | Ga0207688_10003558 | 3300025901 | Bacteria | 8503 |
| 474 | Ga0207680_10055045 | 3300025903 | Bacteria | 2396 |
| 475 | Ga0207680_10065139 | 3300025903 | Bacteria | 2236 |
| 476 | Ga0207647_10031084 | 3300025904 | Bacteria | 3439 |
| 477 | Ga0207647_10067875 | 3300025904 | Bacteria | 2159 |
| 478 | Ga0207685_10006158 | 3300025905 | Bacteria | 3241 |
| 479 | Ga0207699_10003242 | 3300025906 | Bacteria | 7750 |
| 480 | Ga0207699_10008552 | 3300025906 | Bacteria | 5059 |
| 481 | Ga0207699_10044092 | 3300025906 | Bacteria | 2595 |
| 482 | Ga0207645_10011165 | 3300025907 | Bacteria | 6144 |
| 483 | Ga0207645_10067665 | 3300025907 | Bacteria | 2283 |
| 484 | Ga0207643_10000642 | 3300025908 | Bacteria | 21849 |
| 485 | Ga0207643_10053204 | 3300025908 | Bacteria | 2300 |
| 486 | Ga0207705_10000595 | 3300025909 | Bacteria | 30272 |
| 487 | Ga0207705_10015540 | 3300025909 | Bacteria | 5462 |
| 488 | Ga0207705_10015936 | 3300025909 | Bacteria | 5396 |
| 489 | Ga0207705_10036392 | 3300025909 | Bacteria | 3523 |
| 490 | Ga0207705_10050987 | 3300025909 | Bacteria | 2979 |
| 491 | Ga0207705_10242994 | 3300025909 | Bacteria | 1372 |
| 492 | Ga0207684_10011027 | 3300025910 | Bacteria | 7921 |
| 493 | Ga0207684_10085908 | 3300025910 | Bacteria | 2680 |
| 494 | Ga0207684_10110326 | 3300025910 | Bacteria | 2355 |
| 495 | Ga0207684_10299946 | 3300025910 | Bacteria | 1385 |
| 496 | Ga0207654_10000003 | 3300025911 | Bacteria | 1030378 |
| 497 | Ga0207654_10021949 | 3300025911 | Bacteria | 3400 |
| 498 | Ga0207654_10081089 | 3300025911 | Bacteria | 1953 |
| 499 | Ga0207654_10107808 | 3300025911 | Bacteria | 1727 |
| 500 | Ga0207707_10016166 | 3300025912 | Bacteria | 6510 |
| 501 | Ga0207707_10021899 | 3300025912 | Bacteria | 5586 |
| 502 | Ga0207707_10022717 | 3300025912 | Bacteria | 5485 |
| 503 | Ga0207707_10026215 | 3300025912 | Bacteria | 5095 |
| 504 | Ga0207695_10005261 | 3300025913 | Bacteria | 17262 |
| 505 | Ga0207695_10009600 | 3300025913 | Bacteria | 11949 |
| 506 | Ga0207695_10035988 | 3300025913 | Bacteria | 5358 |
| 507 | Ga0207695_10113003 | 3300025913 | Bacteria | 2693 |
| 508 | Ga0207671_10000001 | 3300025914 | Bacteria | 1318881 |
| 509 | Ga0207671_10047284 | 3300025914 | Bacteria | 3184 |
| 510 | Ga0207693_10000420 | 3300025915 | Bacteria | 38541 |
| 511 | Ga0207693_10002493 | 3300025915 | Bacteria | 16014 |
| 512 | Ga0207693_10006587 | 3300025915 | Bacteria | 9613 |
| 513 | Ga0207693_10011553 | 3300025915 | Bacteria | 7141 |
| 514 | Ga0207693_10031552 | 3300025915 | Bacteria | 4187 |
| 515 | Ga0207663_10005192 | 3300025916 | Bacteria | 6552 |
| 516 | Ga0207663_10005313 | 3300025916 | Bacteria | 6484 |
| 517 | Ga0207663_10013983 | 3300025916 | Bacteria | 4380 |
| 518 | Ga0207663_10071693 | 3300025916 | Bacteria | 2236 |
| 519 | Ga0207660_10009254 | 3300025917 | Bacteria | 6377 |
| 520 | Ga0207660_10147980 | 3300025917 | Bacteria | 1802 |
| 521 | Ga0207657_10018543 | 3300025919 | Bacteria | 6636 |
| 522 | Ga0207657_10021331 | 3300025919 | Bacteria | 6100 |
| 523 | Ga0207657_10038028 | 3300025919 | Bacteria | 4289 |
| 524 | Ga0207649_10003700 | 3300025920 | Bacteria | 8343 |
| 525 | Ga0207649_10030705 | 3300025920 | Bacteria | 3185 |
| 526 | Ga0207649_10110283 | 3300025920 | Bacteria | 1837 |
| 527 | Ga0207652_10001493 | 3300025921 | Bacteria | 20662 |
| 528 | Ga0207652_10010256 | 3300025921 | Bacteria | 7540 |
| 529 | Ga0207652_10011363 | 3300025921 | Bacteria | 7175 |
| 530 | Ga0207652_10047865 | 3300025921 | Bacteria | 3653 |
| 531 | Ga0207652_10126575 | 3300025921 | Bacteria | 2276 |
| 532 | Ga0207652_10190258 | 3300025921 | Bacteria | 1846 |
| 533 | Ga0207652_10203646 | 3300025921 | Bacteria | 1781 |
| 534 | Ga0207646_10004909 | 3300025922 | Bacteria | 14315 |
| 535 | Ga0207646_10224067 | 3300025922 | Bacteria | 1699 |
| 536 | Ga0207681_10001110 | 3300025923 | Bacteria | 17448 |
| 537 | Ga0207681_10032269 | 3300025923 | Bacteria | 3428 |
| 538 | Ga0207694_10005422 | 3300025924 | Bacteria | 9817 |
| 539 | Ga0207694_10055020 | 3300025924 | Bacteria | 3089 |
| 540 | Ga0207694_10257031 | 3300025924 | Bacteria | 1430 |
| 541 | Ga0207650_10032659 | 3300025925 | Bacteria | 3765 |
| 542 | Ga0207659_10027257 | 3300025926 | Bacteria | 3866 |
| 543 | Ga0207687_10001526 | 3300025927 | Bacteria | 15874 |
| 544 | Ga0207687_10004349 | 3300025927 | Bacteria | 9453 |
| 545 | Ga0207687_10011308 | 3300025927 | Bacteria | 5833 |
| 546 | Ga0207687_10015347 | 3300025927 | Bacteria | 5021 |
| 547 | Ga0207687_10024987 | 3300025927 | Bacteria | 3996 |
| 548 | Ga0207687_10040902 | 3300025927 | Bacteria | 3180 |
| 549 | Ga0207687_10070166 | 3300025927 | Bacteria | 2501 |
| 550 | Ga0207687_10238274 | 3300025927 | Bacteria | 1440 |
| 551 | Ga0207700_10004533 | 3300025928 | Bacteria | 8207 |
| 552 | Ga0207700_10005586 | 3300025928 | Bacteria | 7547 |
| 553 | Ga0207700_10056479 | 3300025928 | Bacteria | 2955 |
| 554 | Ga0207700_10070499 | 3300025928 | Bacteria | 2687 |
| 555 | Ga0207700_10209218 | 3300025928 | Bacteria | 1648 |
| 556 | Ga0207700_10248327 | 3300025928 | Bacteria | 1519 |
| 557 | Ga0207664_10000063 | 3300025929 | Bacteria | 113763 |
| 558 | Ga0207664_10003992 | 3300025929 | Bacteria | 9941 |
| 559 | Ga0207664_10006346 | 3300025929 | Bacteria | 8125 |
| 560 | Ga0207664_10018596 | 3300025929 | Bacteria | 5119 |
| 561 | Ga0207664_10054555 | 3300025929 | Bacteria | 3167 |
| 562 | Ga0207644_10033273 | 3300025931 | Bacteria | 3601 |
| 563 | Ga0207690_10018486 | 3300025932 | Bacteria | 4275 |
| 564 | Ga0207690_10045554 | 3300025932 | Bacteria | 2898 |
| 565 | Ga0207706_10002446 | 3300025933 | Bacteria | 18131 |
| 566 | Ga0207706_10015108 | 3300025933 | Bacteria | 6988 |
| 567 | Ga0207706_10051457 | 3300025933 | Bacteria | 3637 |
| 568 | Ga0207706_10129662 | 3300025933 | Bacteria | 2218 |
| 569 | Ga0207709_10010193 | 3300025935 | Bacteria | 5176 |
| 570 | Ga0207709_10012673 | 3300025935 | Bacteria | 4648 |
| 571 | Ga0207709_10032863 | 3300025935 | Bacteria | 3042 |
| 572 | Ga0207709_10114899 | 3300025935 | Bacteria | 1807 |
| 573 | Ga0207670_10034938 | 3300025936 | Bacteria | 3255 |
| 574 | Ga0207670_10074152 | 3300025936 | Bacteria | 2361 |
| 575 | Ga0207669_10000932 | 3300025937 | Bacteria | 12361 |
| 576 | Ga0207669_10042240 | 3300025937 | Bacteria | 2660 |
| 577 | Ga0207669_10242228 | 3300025937 | Bacteria | 1337 |
| 578 | Ga0207704_10067588 | 3300025938 | Bacteria | 2249 |
| 579 | Ga0207665_10001654 | 3300025939 | Bacteria | 14998 |
| 580 | Ga0207665_10003273 | 3300025939 | Bacteria | 10848 |
| 581 | Ga0207665_10004483 | 3300025939 | Bacteria | 9267 |
| 582 | Ga0207665_10009362 | 3300025939 | Bacteria | 6430 |
| 583 | Ga0207665_10013756 | 3300025939 | Bacteria | 5322 |
| 584 | Ga0207691_10001332 | 3300025940 | Bacteria | 24657 |
| 585 | Ga0207691_10227457 | 3300025940 | Bacteria | 1616 |
| 586 | Ga0207711_10001465 | 3300025941 | Bacteria | 22000 |
| 587 | Ga0207711_10001834 | 3300025941 | Bacteria | 19368 |
| 588 | Ga0207711_10005962 | 3300025941 | Bacteria | 10300 |
| 589 | Ga0207711_10129430 | 3300025941 | Bacteria | 2262 |
| 590 | Ga0207711_10203309 | 3300025941 | Bacteria | 1808 |
| 591 | Ga0207711_10253167 | 3300025941 | Bacteria | 1617 |
| 592 | Ga0207689_10000187 | 3300025942 | Bacteria | 53919 |
| 593 | Ga0207689_10002944 | 3300025942 | Bacteria | 15736 |
| 594 | Ga0207689_10006655 | 3300025942 | Bacteria | 10192 |
| 595 | Ga0207689_10015723 | 3300025942 | Bacteria | 6407 |
| 596 | Ga0207689_10023181 | 3300025942 | Bacteria | 5211 |
| 597 | Ga0207661_10001731 | 3300025944 | Bacteria | 14929 |
| 598 | Ga0207661_10005113 | 3300025944 | Bacteria | 9208 |
| 599 | Ga0207661_10056083 | 3300025944 | Bacteria | 3162 |
| 600 | Ga0207661_10107587 | 3300025944 | Bacteria | 2353 |
| 601 | Ga0207661_10123319 | 3300025944 | Bacteria | 2209 |
| 602 | Ga0207679_10007877 | 3300025945 | Bacteria | 6767 |
| 603 | Ga0207667_10005915 | 3300025949 | Bacteria | 14898 |
| 604 | Ga0207667_10012713 | 3300025949 | Bacteria | 9671 |
| 605 | Ga0207667_10027190 | 3300025949 | Bacteria | 6234 |
| 606 | Ga0207667_10027909 | 3300025949 | Bacteria | 6136 |
| 607 | Ga0207667_10038335 | 3300025949 | Bacteria | 5120 |
| 608 | Ga0207667_10137161 | 3300025949 | Bacteria | 2519 |
| 609 | Ga0207712_10000006 | 3300025961 | Bacteria | 573204 |
| 610 | Ga0207712_10011671 | 3300025961 | Bacteria | 5600 |
| 611 | Ga0207712_10233252 | 3300025961 | Bacteria | 1478 |
| 612 | Ga0207668_10001742 | 3300025972 | Bacteria | 12748 |
| 613 | Ga0207640_10004946 | 3300025981 | Bacteria | 7242 |
| 614 | Ga0207640_10016616 | 3300025981 | Bacteria | 4286 |
| 615 | Ga0207640_10042940 | 3300025981 | Bacteria | 2886 |
| 616 | Ga0207658_10000970 | 3300025986 | Bacteria | 23684 |
| 617 | Ga0207658_10009505 | 3300025986 | Bacteria | 6600 |
| 618 | Ga0207658_10057863 | 3300025986 | Bacteria | 2882 |
| 619 | Ga0207658_10176404 | 3300025986 | Bacteria | 1765 |
| 620 | Ga0207677_10042913 | 3300026023 | Bacteria | 3003 |
| 621 | Ga0207677_10048470 | 3300026023 | Bacteria | 2861 |
| 622 | Ga0207677_10052078 | 3300026023 | Bacteria | 2779 |
| 623 | Ga0207677_10067825 | 3300026023 | Bacteria | 2500 |
| 624 | Ga0207677_10143290 | 3300026023 | Bacteria | 1833 |
| 625 | Ga0207677_10225495 | 3300026023 | Bacteria | 1506 |
| 626 | Ga0207703_10000015 | 3300026035 | Bacteria | 287079 |
| 627 | Ga0207703_10000131 | 3300026035 | Bacteria | 90186 |
| 628 | Ga0207703_10013056 | 3300026035 | Bacteria | 6473 |
| 629 | Ga0207703_10021554 | 3300026035 | Bacteria | 5045 |
| 630 | Ga0207703_10218624 | 3300026035 | Bacteria | 1702 |
| 631 | Ga0207639_10005218 | 3300026041 | Bacteria | 8764 |
| 632 | Ga0207639_10019729 | 3300026041 | Bacteria | 4813 |
| 633 | Ga0207639_10130697 | 3300026041 | Bacteria | 2078 |
| 634 | Ga0207678_10002354 | 3300026067 | Bacteria | 17155 |
| 635 | Ga0207678_10011889 | 3300026067 | Bacteria | 7643 |
| 636 | Ga0207678_10019054 | 3300026067 | Bacteria | 6027 |
| 637 | Ga0207678_10032883 | 3300026067 | Bacteria | 4520 |
| 638 | Ga0207678_10037802 | 3300026067 | Bacteria | 4198 |
| 639 | Ga0207678_10075426 | 3300026067 | Bacteria | 2889 |
| 640 | Ga0207708_10000123 | 3300026075 | Bacteria | 60071 |
| 641 | Ga0207708_10008837 | 3300026075 | Bacteria | 7456 |
| 642 | Ga0207708_10019476 | 3300026075 | Bacteria | 5116 |
| 643 | Ga0207708_10084696 | 3300026075 | Bacteria | 2438 |
| 644 | Ga0207702_10004958 | 3300026078 | Bacteria | 11692 |
| 645 | Ga0207702_10019652 | 3300026078 | Bacteria | 5592 |
| 646 | Ga0207702_10044872 | 3300026078 | Bacteria | 3716 |
| 647 | Ga0207702_10118513 | 3300026078 | Bacteria | 2365 |
| 648 | Ga0207702_10171037 | 3300026078 | Bacteria | 1992 |
| 649 | Ga0207702_10174634 | 3300026078 | Bacteria | 1973 |
| 650 | Ga0207641_10022729 | 3300026088 | Bacteria | 5163 |
| 651 | Ga0207641_10031413 | 3300026088 | Bacteria | 4404 |
| 652 | Ga0207641_10041605 | 3300026088 | Bacteria | 3851 |
| 653 | Ga0207641_10126696 | 3300026088 | Bacteria | 2287 |
| 654 | Ga0207648_10009571 | 3300026089 | Bacteria | 9270 |
| 655 | Ga0207648_10023728 | 3300026089 | Bacteria | 5489 |
| 656 | Ga0207648_10058974 | 3300026089 | Bacteria | 3347 |
| 657 | Ga0207676_10001957 | 3300026095 | Bacteria | 15009 |
| 658 | Ga0207674_10009940 | 3300026116 | Bacteria | 10823 |
| 659 | Ga0207674_10020299 | 3300026116 | Bacteria | 7181 |
| 660 | Ga0207674_10049467 | 3300026116 | Bacteria | 4299 |
| 661 | Ga0207675_100004425 | 3300026118 | Bacteria | 13581 |
| 662 | Ga0207675_100036517 | 3300026118 | Bacteria | 4583 |
| 663 | Ga0207675_100086914 | 3300026118 | Bacteria | 2936 |
| 664 | Ga0207675_100146475 | 3300026118 | Bacteria | 2245 |
| 665 | Ga0207675_100192367 | 3300026118 | Bacteria | 1957 |
| 666 | Ga0207675_100219272 | 3300026118 | Bacteria | 1832 |
| 667 | Ga0207683_10003430 | 3300026121 | Bacteria | 13814 |
| 668 | Ga0207683_10010756 | 3300026121 | Bacteria | 7801 |
| 669 | Ga0207683_10024562 | 3300026121 | Bacteria | 5192 |
| 670 | Ga0207683_10115208 | 3300026121 | Bacteria | 2409 |
| 671 | Ga0207683_10125260 | 3300026121 | Bacteria | 2308 |
| 672 | Ga0207683_10178115 | 3300026121 | Bacteria | 1927 |
| 673 | Ga0207683_10305466 | 3300026121 | Bacteria | 1456 |
| 674 | Ga0207698_10003180 | 3300026142 | Bacteria | 9852 |
| 675 | Ga0207698_10023505 | 3300026142 | Bacteria | 4307 |
| 676 | Ga0207698_10079070 | 3300026142 | Bacteria | 2644 |
| 677 | Ga0207698_10080506 | 3300026142 | Bacteria | 2624 |
| 678 | Ga0207698_10154594 | 3300026142 | Bacteria | 1996 |
| 679 | Ga0207428_10068649 | 3300027907 | Bacteria | 2788 |
| 680 | Ga0207428_10079774 | 3300027907 | Bacteria | 2558 |
| 681 | Ga0207428_10099720 | 3300027907 | Bacteria | 2245 |
| 682 | Ga0268266_10007851 | 3300028379 | Bacteria | 9561 |
| 683 | Ga0268266_10024077 | 3300028379 | Bacteria | 5181 |
| 684 | Ga0268266_10031295 | 3300028379 | Bacteria | 4518 |
| 685 | Ga0268266_10064306 | 3300028379 | Bacteria | 3169 |
| 686 | Ga0268266_10068211 | 3300028379 | Bacteria | 3079 |
| 687 | Ga0268265_10000016 | 3300028380 | Bacteria | 299380 |
| 688 | Ga0268265_10084439 | 3300028380 | Bacteria | 2517 |
| 689 | Ga0268265_10273693 | 3300028380 | Bacteria | 1507 |
| 690 | Ga0268264_10000026 | 3300028381 | Bacteria | 459088 |
| 691 | Ga0268264_10000031 | 3300028381 | Bacteria | 409525 |
| 692 | Ga0268264_10012141 | 3300028381 | Bacteria | 7092 |
| 693 | Ga0268264_10052844 | 3300028381 | Bacteria | 3388 |
| 694 | Ga0268264_10145580 | 3300028381 | Bacteria | 2118 |
| 695 | Ga0265334_10000839 | 3300028573 | Bacteria | 15353 |
| 696 | Ga0307515_10014277 | 3300028794 | Bacteria | 14747 |
| 697 | Ga0307515_10021795 | 3300028794 | Bacteria | 11336 |
| 698 | Ga0307515_10022335 | 3300028794 | Bacteria | 11156 |
| 699 | Ga0307511_10106788 | 3300030521 | Bacteria | 1805 |
| 700 | Ga0307512_10005170 | 3300030522 | Bacteria | 13762 |
| 701 | Ga0307512_10009276 | 3300030522 | Bacteria | 9496 |
| 702 | Ga0307512_10020281 | 3300030522 | Bacteria | 6024 |
| 703 | Ga0307512_10047890 | 3300030522 | Bacteria | 3468 |
| 704 | Ga0265340_10035175 | 3300031247 | Bacteria | 2488 |
| 705 | Ga0265340_10040806 | 3300031247 | Bacteria | 2284 |
| 706 | Ga0265327_10000041 | 3300031251 | Bacteria | 288506 |
| 707 | Ga0265327_10001529 | 3300031251 | Bacteria | 28541 |
| 708 | Ga0265327_10008570 | 3300031251 | Bacteria | 7589 |
| 709 | Ga0265327_10029384 | 3300031251 | Bacteria | 3128 |
| 710 | Ga0307513_10000001 | 3300031456 | Bacteria | 1660464 |
| 711 | Ga0307513_10015478 | 3300031456 | Bacteria | 9246 |
| 712 | Ga0307513_10022497 | 3300031456 | Bacteria | 7404 |
| 713 | Ga0307408_100019307 | 3300031548 | Bacteria | 4588 |
| 714 | Ga0307408_100022759 | 3300031548 | Bacteria | 4262 |
| 715 | Ga0307408_100035646 | 3300031548 | Bacteria | 3492 |
| 716 | Ga0307408_100064742 | 3300031548 | Bacteria | 2679 |
| 717 | Ga0307408_100325912 | 3300031548 | Bacteria | 1295 |
| 718 | Ga0265313_10035630 | 3300031595 | Bacteria | 2504 |
| 719 | Ga0265313_10040218 | 3300031595 | Bacteria | 2313 |
| 720 | Ga0307508_10001163 | 3300031616 | Bacteria | 30276 |
| 721 | Ga0307508_10007864 | 3300031616 | Bacteria | 9897 |
| 722 | Ga0307508_10024539 | 3300031616 | Bacteria | 5472 |
| 723 | Ga0307508_10074409 | 3300031616 | Bacteria | 2972 |
| 724 | Ga0307514_10040454 | 3300031649 | Bacteria | 3675 |
| 725 | Ga0307514_10082332 | 3300031649 | Bacteria | 2375 |
| 726 | Ga0316575_10063963 | 3300031665 | Bacteria | 1472 |
| 727 | Ga0265314_10057721 | 3300031711 | Bacteria | 2663 |
| 728 | Ga0265342_10041432 | 3300031712 | Bacteria | 2789 |
| 729 | Ga0265342_10118549 | 3300031712 | Bacteria | 1492 |
| 730 | Ga0316576_10000511 | 3300031727 | Bacteria | 18233 |
| 731 | Ga0316576_10017182 | 3300031727 | Bacteria | 4908 |
| 732 | Ga0316576_10017551 | 3300031727 | Bacteria | 4866 |
| 733 | Ga0316576_10048395 | 3300031727 | Bacteria | 3084 |
| 734 | Ga0316576_10140041 | 3300031727 | Bacteria | 1821 |
| 735 | Ga0316578_10036615 | 3300031728 | Bacteria | 2824 |
| 736 | Ga0316578_10081290 | 3300031728 | Bacteria | 1928 |
| 737 | Ga0316578_10105522 | 3300031728 | Bacteria | 1690 |
| 738 | Ga0307516_10003100 | 3300031730 | Bacteria | 21615 |
| 739 | Ga0316577_10056287 | 3300031733 | Bacteria | 2194 |
| 740 | Ga0307413_10042245 | 3300031824 | Bacteria | 2677 |
| 741 | Ga0307518_10048571 | 3300031838 | Bacteria | 3085 |
| 742 | Ga0307410_10024068 | 3300031852 | Bacteria | 3798 |
| 743 | Ga0307410_10024166 | 3300031852 | Bacteria | 3792 |
| 744 | Ga0307410_10057129 | 3300031852 | Bacteria | 2656 |
| 745 | Ga0307410_10068104 | 3300031852 | Bacteria | 2457 |
| 746 | Ga0307410_10109058 | 3300031852 | Bacteria | 2000 |
| 747 | Ga0307410_10155605 | 3300031852 | Bacteria | 1707 |
| 748 | Ga0307406_10068534 | 3300031901 | Bacteria | 2316 |
| 749 | Ga0307406_10083514 | 3300031901 | Bacteria | 2130 |
| 750 | Ga0307406_10093638 | 3300031901 | Bacteria | 2029 |
| 751 | Ga0307406_10093771 | 3300031901 | Bacteria | 2028 |
| 752 | Ga0307407_10080026 | 3300031903 | Bacteria | 1973 |
| 753 | Ga0307407_10173283 | 3300031903 | Bacteria | 1423 |
| 754 | Ga0307412_10029765 | 3300031911 | Bacteria | 3429 |
| 755 | Ga0307409_100008616 | 3300031995 | Bacteria | 6202 |
| 756 | Ga0307409_100021231 | 3300031995 | Bacteria | 4448 |
| 757 | Ga0307409_100058000 | 3300031995 | Bacteria | 3004 |
| 758 | Ga0307409_100107967 | 3300031995 | Bacteria | 2326 |
| 759 | Ga0307409_100276950 | 3300031995 | Bacteria | 1548 |
| 760 | Ga0307409_100385132 | 3300031995 | Bacteria | 1334 |
| 761 | Ga0307416_100015187 | 3300032002 | Bacteria | 5307 |
| 762 | Ga0307416_100039444 | 3300032002 | Bacteria | 3657 |
| 763 | Ga0307416_100133681 | 3300032002 | Bacteria | 2239 |
| 764 | Ga0307416_100232592 | 3300032002 | Bacteria | 1778 |
| 765 | Ga0307416_100240066 | 3300032002 | Bacteria | 1755 |
| 766 | Ga0307416_100270491 | 3300032002 | Archaea | 1668 |
| 767 | Ga0307416_100424511 | 3300032002 | Bacteria | 1375 |
| 768 | Ga0307414_10107423 | 3300032004 | Bacteria | 2115 |
| 769 | Ga0307414_10268980 | 3300032004 | Bacteria | 1426 |
| 770 | Ga0307411_10001113 | 3300032005 | Bacteria | 10472 |
| 771 | Ga0307411_10248123 | 3300032005 | Bacteria | 1398 |
| 772 | Ga0307415_100005815 | 3300032126 | Bacteria | 6592 |
| 773 | Ga0307415_100023748 | 3300032126 | Bacteria | 3814 |
| 774 | Ga0307415_100032681 | 3300032126 | Bacteria | 3368 |
| 775 | Ga0307415_100037663 | 3300032126 | Bacteria | 3180 |
| 776 | Ga0307415_100052500 | 3300032126 | Bacteria | 2773 |
| 777 | Ga0307415_100114408 | 3300032126 | Bacteria | 2008 |
| 778 | Ga0307415_100315876 | 3300032126 | Bacteria | 1300 |
| 779 | Ga0316583_10010209 | 3300032133 | Bacteria | 3383 |
| 780 | Ga0316580_10016328 | 3300032139 | Bacteria | 2278 |
| 781 | Ga0307510_10008263 | 3300033180 | Bacteria | 12404 |
| 782 | Ga0373930_0002591 | 3300034816 | Bacteria | 2807 |
| 783 | Ga0373948_0001069 | 3300034817 | Bacteria | 3702 |
| 784 | Ga0373934_0000014 | 3300035086 | Bacteria | 59312 |
| 785 | Ga0373934_0019070 | 3300035086 | Bacteria | 2630 |
| 786 | Ga0373949_0013828 | 3300035090 | Bacteria | 1793 |
| 787 | Ga0373951_0000127 | 3300035091 | Bacteria | 28693 |
| 788 | Ga0373951_0004369 | 3300035091 | Bacteria | 3362 |
| 789 | Ga0373951_0019293 | 3300035091 | Bacteria | 1554 |
| 790 | Ga0373932_0003524 | 3300035112 | Bacteria | 3752 |
| 791 | Ga0373953_0001755 | 3300035117 | Bacteria | 6402 |
| 792 | Ga0373953_0046502 | 3300035117 | Bacteria | 1742 |
| 793 | Ga0373954_0001669 | 3300035118 | Bacteria | 9091 |
| 794 | Ga0373954_0034701 | 3300035118 | Bacteria | 2337 |
| 795 | Ga0373956_0001414 | 3300035119 | Bacteria | 9923 |
| 796 | Ga0373956_0007651 | 3300035119 | Bacteria | 4354 |
| 797 | Ga0373957_0000846 | 3300035120 | Bacteria | 8012 |
| 798 | Ga0373957_0001048 | 3300035120 | Bacteria | 7302 |
| 799 | Ga0373943_0015990 | 3300035170 | Bacteria | 3416 |
| 800 | Ga0373946_0040136 | 3300035171 | Bacteria | 1913 |
| 801 | Ga0373955_0000040 | 3300035172 | Bacteria | 51762 |
| 802 | Ga0373955_0003554 | 3300035172 | Bacteria | 6861 |
| 803 | Ga0373961_0019195 | 3300035241 | Bacteria | 1793 |
| 804 | Ga0316574_0006815 | 3300035398 | Bacteria | 6208 |
| 805 | Ga0316574_0031353 | 3300035398 | Bacteria | 3224 |
| 806 | Ga0316574_0040647 | 3300035398 | Bacteria | 2864 |
| 807 | Ga0316574_0140967 | 3300035398 | Bacteria | 1553 |
| 808 | Ga0373924_0001593 | 3300035410 | Bacteria | 7428 |
| 809 | Ga0373924_0038344 | 3300035410 | Bacteria | 1954 |
| 810 | Ga0373931_0019275 | 3300035691 | Bacteria | 3404 |
| 811 | Ga0373935_0013523 | 3300035692 | Bacteria | 4925 |
| 812 | Ga0373933_0000085 | 3300035724 | Bacteria | 59115 |
| 813 | Ga0373937_0000197 | 3300036401 | Bacteria | 59124 |
| 814 | Ga0373937_0121631 | 3300036401 | Bacteria | 2432 |
| 815 | Ga0373937_0123043 | 3300036401 | Bacteria | 2419 |
| 816 | Ga0316584_0011739 | 3300036712 | Bacteria | 6165 |
| 817 | Ga0316584_0033039 | 3300036712 | Bacteria | 3830 |
| 818 | Ga0316584_0052838 | 3300036712 | Bacteria | 3039 |
| 819 | Ga0316584_0075219 | 3300036712 | Bacteria | 2531 |
| 820 | Ga0316584_0090142 | 3300036712 | Bacteria | 2295 |
| 821 | Ga0395899_0002958 | 3300037312 | Bacteria | 13596 |
| 822 | Ga0395899_0004671 | 3300037312 | Bacteria | 10692 |
| 823 | Ga0395899_0035839 | 3300037312 | Bacteria | 3723 |
| 824 | Ga0395899_0046758 | 3300037312 | Bacteria | 3223 |
| 825 | Ga0395899_0049908 | 3300037312 | Bacteria | 3109 |
| 826 | Ga0395899_0114071 | 3300037312 | Bacteria | 1940 |
| 827 | Ga0395900_0005127 | 3300037418 | Bacteria | 13760 |
| 828 | Ga0395900_0006397 | 3300037418 | Bacteria | 12279 |
| 829 | Ga0395900_0010840 | 3300037418 | Bacteria | 9325 |
| 830 | Ga0395900_0019678 | 3300037418 | Bacteria | 6882 |
| 831 | Ga0395900_0025509 | 3300037418 | Bacteria | 6052 |
| 832 | Ga0395900_0079080 | 3300037418 | Bacteria | 3379 |
| 833 | Ga0395900_0102449 | 3300037418 | Bacteria | 2941 |
| 834 | Ga0395900_0197109 | 3300037418 | Bacteria | 2039 |
| 835 | Ga0395898_0006003 | 3300037466 | Bacteria | 13040 |
| 836 | Ga0395898_0006892 | 3300037466 | Bacteria | 12089 |
| 837 | Ga0395898_0013311 | 3300037466 | Bacteria | 8471 |
| 838 | Ga0395898_0017536 | 3300037466 | Bacteria | 7309 |
| 839 | Ga0395898_0029723 | 3300037466 | Bacteria | 5470 |
| 840 | Ga0395898_0057223 | 3300037466 | Bacteria | 3800 |
| 841 | Ga0395898_0077820 | 3300037466 | Bacteria | 3201 |
| 842 | Ga0395898_0083918 | 3300037466 | Bacteria | 3070 |
| 843 | Ga0395898_0112966 | 3300037466 | Bacteria | 2603 |
| 844 | Ga0395898_0115035 | 3300037466 | Bacteria | 2577 |
| 845 | Ga0395898_0324087 | 3300037466 | Bacteria | 1469 |
| 846 | Ga0395898_0348124 | 3300037466 | Bacteria | 1413 |
| 847 | Ga0395905_0001026 | 3300037471 | Bacteria | 35609 |
| 848 | Ga0395905_0009643 | 3300037471 | Bacteria | 9423 |
| 849 | Ga0395905_0303095 | 3300037471 | Bacteria | 1485 |
| 850 | Ga0395905_0405009 | 3300037471 | Bacteria | 1259 |
| 851 | Ga0436364_0113323 | 3300037853 | Bacteria | 5330 |
| 852 | Ga0436364_0238472 | 3300037853 | Bacteria | 35445 |
| 853 | Ga0436364_0418931 | 3300037853 | Bacteria | 2257 |
| 854 | Ga0436364_0453470 | 3300037853 | Bacteria | 6660 |
| 855 | Ga0436364_0647082 | 3300037853 | Bacteria | 2287 |
| 856 | Ga0436364_1255815 | 3300037853 | Bacteria | 13267 |
| 857 | Ga0436364_1390545 | 3300037853 | Bacteria | 3659 |
| 858 | Ga0395901_0003412 | 3300038443 | Bacteria | 16006 |
| 859 | Ga0395901_0021006 | 3300038443 | Bacteria | 6687 |
| 860 | Ga0395901_0032994 | 3300038443 | Bacteria | 5342 |
| 861 | Ga0395901_0054233 | 3300038443 | Bacteria | 4166 |
| 862 | Ga0395901_0113011 | 3300038443 | Bacteria | 2852 |
| 863 | Ga0395901_0161745 | 3300038443 | Bacteria | 2351 |
| 864 | Ga0395901_0209072 | 3300038443 | Bacteria | 2043 |
| 865 | Ga0436365_0613236 | 3300039437 | Bacteria | 5826 |
| 866 | Ga0436365_0885952 | 3300039437 | Bacteria | 25510 |
| 867 | Ga0436365_1214067 | 3300039437 | Bacteria | 31173 |
| 868 | Ga0436363_0076260 | 3300039450 | Bacteria | 2214 |
| 869 | Ga0436363_0265210 | 3300039450 | Bacteria | 3170 |
| 870 | Ga0436363_0330623 | 3300039450 | Bacteria | 4938 |
| 871 | Ga0436362_0604249 | 3300039453 | Bacteria | 12950 |
| 872 | Ga0439439_0003804 | 3300041406 | Bacteria | 3352 |
| 873 | Ga0439447_010755 | 3300041407 | Bacteria | 2702 |
| 874 | Ga0439466_0020498 | 3300041411 | Bacteria | 2355 |
| 875 | Ga0439466_0030633 | 3300041411 | Bacteria | 1843 |
| 876 | Ga0439465_0008353 | 3300041413 | Bacteria | 3268 |
| 877 | Ga0439465_0010651 | 3300041413 | Bacteria | 2885 |
| 878 | Ga0439465_0011796 | 3300041413 | Bacteria | 2737 |
| 879 | Ga0439465_0031545 | 3300041413 | Bacteria | 1688 |
| 880 | Ga0451802_0335608 | 3300041460 | Bacteria | 1320 |
| 881 | Ga0451802_1677789 | 3300041460 | Bacteria | 1996 |
| 882 | Ga0451853_0988203 | 3300041512 | Bacteria | 1841 |
| 883 | Ga0451853_2451760 | 3300041512 | Bacteria | 3750 |
| 884 | Ga0439431_0000706 | 3300041997 | Bacteria | 7181 |
| 885 | Ga0439433_0000016 | 3300041999 | Bacteria | 22353 |
| 886 | Ga0439433_0005084 | 3300041999 | Bacteria | 2824 |
| 887 | Ga0439442_000124 | 3300042002 | Bacteria | 19456 |
| 888 | Ga0439442_000483 | 3300042002 | Bacteria | 9062 |
| 889 | Ga0439442_006494 | 3300042002 | Bacteria | 2348 |
| 890 | Ga0439442_007840 | 3300042002 | Bacteria | 2155 |
| 891 | Ga0439442_012154 | 3300042002 | Bacteria | 1758 |
| 892 | Ga0439432_027337 | 3300042006 | Bacteria | 1863 |
| 893 | Ga0439449_0000123 | 3300042007 | Bacteria | 25838 |
| 894 | Ga0439449_0044932 | 3300042007 | Bacteria | 1637 |
| 895 | Ga0439452_008147 | 3300042010 | Bacteria | 3170 |
| 896 | Ga0439452_027059 | 3300042010 | Bacteria | 1443 |
| 897 | Ga0439463_026533 | 3300042016 | Bacteria | 1455 |
| 898 | Ga0450920_001002 | 3300042122 | Bacteria | 4624 |
| 899 | Ga0450920_008485 | 3300042122 | Bacteria | 1878 |
| 900 | Ga0450907_000606 | 3300042146 | Bacteria | 9518 |
| 901 | Ga0439434_0000220 | 3300042435 | Bacteria | 15927 |
| 902 | Ga0439434_0018559 | 3300042435 | Bacteria | 2083 |
| 903 | Ga0466969_0031467 | 3300044656 | Bacteria | 2701 |
| 904 | Ga0466972_0017406 | 3300044658 | Bacteria | 3597 |
| 905 | Ga0466972_0102840 | 3300044658 | Bacteria | 1351 |
| 906 | Ga0466965_0008270 | 3300044683 | Bacteria | 4808 |
| 907 | Ga0466965_0010455 | 3300044683 | Bacteria | 4329 |
| 908 | Ga0466965_0014794 | 3300044683 | Bacteria | 3696 |
| 909 | Ga0466965_0027934 | 3300044683 | Bacteria | 2739 |
| 910 | Ga0466966_0003105 | 3300044684 | Bacteria | 10934 |
| 911 | Ga0466966_0006470 | 3300044684 | Bacteria | 7752 |
| 912 | Ga0466966_0012176 | 3300044684 | Bacteria | 5698 |
| 913 | Ga0466966_0030188 | 3300044684 | Bacteria | 3521 |
| 914 | Ga0466966_0074689 | 3300044684 | Bacteria | 2118 |
| 915 | Ga0466966_0076601 | 3300044684 | Bacteria | 2088 |
| 916 | Ga0466966_0078802 | 3300044684 | Bacteria | 2054 |
| 917 | Ga0466966_0143115 | 3300044684 | Bacteria | 1460 |
| 918 | Ga0466961_0000223 | 3300044693 | Bacteria | 38608 |
| 919 | Ga0466961_0005237 | 3300044693 | Bacteria | 8166 |
| 920 | Ga0466961_0014413 | 3300044693 | Bacteria | 5074 |
| 921 | Ga0466961_0016492 | 3300044693 | Bacteria | 4746 |
| 922 | Ga0466961_0019719 | 3300044693 | Bacteria | 4339 |
| 923 | Ga0466961_0035925 | 3300044693 | Bacteria | 3181 |
| 924 | Ga0466961_0049608 | 3300044693 | Bacteria | 2682 |
| 925 | Ga0466961_0050180 | 3300044693 | Bacteria | 2665 |
| 926 | Ga0466961_0052631 | 3300044693 | Bacteria | 2598 |
| 927 | Ga0466961_0103753 | 3300044693 | Bacteria | 1790 |
| 928 | Ga0466961_0107930 | 3300044693 | Bacteria | 1752 |
| 929 | Ga0466961_0162785 | 3300044693 | Bacteria | 1390 |
| 930 | Ga0466963_0000604 | 3300044694 | Bacteria | 17169 |
| 931 | Ga0466963_0002782 | 3300044694 | Bacteria | 9861 |
| 932 | Ga0466963_0104315 | 3300044694 | Bacteria | 1942 |
| 933 | Ga0466964_0068658 | 3300044706 | Bacteria | 1493 |
| 934 | Ga0466971_0000354 | 3300044719 | Bacteria | 17531 |
| 935 | Ga0466971_0019022 | 3300044719 | Bacteria | 3048 |
| 936 | Ga0466971_0023917 | 3300044719 | Bacteria | 2724 |
| 937 | Ga0466971_0083518 | 3300044719 | Bacteria | 1458 |
| 938 | Ga0466968_0001034 | 3300044735 | Bacteria | 9823 |
| 939 | Ga0466968_0014236 | 3300044735 | Bacteria | 3141 |
| 940 | Ga0466968_0046781 | 3300044735 | Bacteria | 1838 |
| 941 | Ga0466970_0001205 | 3300044765 | Bacteria | 12557 |
| 942 | Ga0466970_0007113 | 3300044765 | Bacteria | 5600 |
| 943 | Ga0466970_0007660 | 3300044765 | Bacteria | 5414 |
| 944 | Ga0466970_0026731 | 3300044765 | Bacteria | 3025 |
| 945 | Ga0466970_0034538 | 3300044765 | Bacteria | 2677 |
| 946 | Ga0466970_0050609 | 3300044765 | Bacteria | 2216 |
| 947 | Ga0466957_0000283 | 3300044842 | Bacteria | 24756 |
| 948 | Ga0466957_0004553 | 3300044842 | Bacteria | 7742 |
| 949 | Ga0466957_0010194 | 3300044842 | Bacteria | 5382 |
| 950 | Ga0466957_0012679 | 3300044842 | Bacteria | 4883 |
| 951 | Ga0466957_0024790 | 3300044842 | Bacteria | 3552 |
| 952 | Ga0466957_0043592 | 3300044842 | Bacteria | 2717 |
| 953 | Ga0466957_0066258 | 3300044842 | Bacteria | 2226 |
| 954 | Ga0466960_0002656 | 3300044901 | Bacteria | 6742 |
| 955 | Ga0466960_0004820 | 3300044901 | Bacteria | 5301 |
| 956 | Ga0466960_0005643 | 3300044901 | Bacteria | 4966 |
| 957 | Ga0466960_0019496 | 3300044901 | Bacteria | 2991 |
| 958 | Ga0466960_0025646 | 3300044901 | Bacteria | 2669 |
| 959 | Ga0466960_0150487 | 3300044901 | Bacteria | 1243 |
| 960 | Ga0466959_0009115 | 3300045049 | Bacteria | 7046 |
| 961 | Ga0466959_0013261 | 3300045049 | Bacteria | 5969 |
| 962 | Ga0466959_0014077 | 3300045049 | Bacteria | 5807 |
| 963 | Ga0466959_0017810 | 3300045049 | Bacteria | 5210 |
| 964 | Ga0466959_0022208 | 3300045049 | Bacteria | 4688 |
| 965 | Ga0466959_0032930 | 3300045049 | Bacteria | 3836 |
| 966 | Ga0466959_0040799 | 3300045049 | Bacteria | 3428 |
| 967 | Ga0466959_0045121 | 3300045049 | Bacteria | 3246 |
| 968 | Ga0466958_0000114 | 3300045836 | Bacteria | 25940 |
| 969 | Ga0466958_0000748 | 3300045836 | Bacteria | 14254 |
| 970 | Ga0466958_0005582 | 3300045836 | Bacteria | 6784 |
| 971 | Ga0466958_0007421 | 3300045836 | Bacteria | 6031 |
| 972 | Ga0466958_0020417 | 3300045836 | Bacteria | 3862 |
| 973 | Ga0466958_0032227 | 3300045836 | Bacteria | 3117 |
| 974 | Ga0466958_0035027 | 3300045836 | Bacteria | 2998 |
| 975 | Ga0466958_0075985 | 3300045836 | Bacteria | 2061 |
| 976 | Ga0466958_0098160 | 3300045836 | Bacteria | 1818 |
| 977 | Ga0466967_0001120 | 3300045976 | Bacteria | 14881 |
| 978 | Ga0466967_0006791 | 3300045976 | Bacteria | 8156 |
| 979 | Ga0466967_0019688 | 3300045976 | Bacteria | 5434 |
| 980 | Ga0466967_0024332 | 3300045976 | Bacteria | 4977 |
| 981 | Ga0466967_0025471 | 3300045976 | Bacteria | 4879 |
| 982 | Ga0466967_0027636 | 3300045976 | Bacteria | 4722 |
| 983 | Ga0466967_0031995 | 3300045976 | Bacteria | 4437 |
| 984 | Ga0466967_0075584 | 3300045976 | Bacteria | 3028 |
| 985 | Ga0466967_0119314 | 3300045976 | Bacteria | 2434 |
| 986 | Ga0466967_0364757 | 3300045976 | Bacteria | 1400 |
| 987 | Ga0495627_039472 | 3300046453 | Bacteria | 1456 |
| 988 | Ga0495627_046758 | 3300046453 | Bacteria | 1314 |
| 989 | Ga0495592_0000157 | 3300046454 | Bacteria | 59697 |
| 990 | Ga0495592_0064496 | 3300046454 | Bacteria | 2685 |
| 991 | Ga0495603_0000552 | 3300046455 | Bacteria | 20921 |
| 992 | Ga0495603_0013090 | 3300046455 | Bacteria | 5014 |
| 993 | Ga0495603_0054857 | 3300046455 | Bacteria | 2361 |
| 994 | Ga0495590_0000484 | 3300046457 | Bacteria | 19640 |
| 995 | Ga0495629_0001111 | 3300046459 | Bacteria | 21303 |
| 996 | Ga0495629_0001228 | 3300046459 | Bacteria | 20123 |
| 997 | Ga0495629_0006771 | 3300046459 | Bacteria | 8470 |
| 998 | Ga0495629_0014332 | 3300046459 | Bacteria | 5704 |
| 999 | Ga0495638_0001596 | 3300046460 | Bacteria | 20236 |
| 1000 | Ga0495638_0040952 | 3300046460 | Bacteria | 2933 |
| 1001 | Ga0495638_0059658 | 3300046460 | Bacteria | 2362 |
| 1002 | Ga0495641_0008500 | 3300046461 | Bacteria | 6245 |
| 1003 | Ga0495641_0051617 | 3300046461 | Bacteria | 1876 |
| 1004 | Ga0495651_0000115 | 3300046462 | Bacteria | 59129 |
| 1005 | Ga0495651_0006516 | 3300046462 | Bacteria | 8919 |
| 1006 | Ga0495651_0035816 | 3300046462 | Bacteria | 3863 |
| 1007 | Ga0495653_0011549 | 3300046463 | Bacteria | 7210 |
| 1008 | Ga0495653_0068042 | 3300046463 | Bacteria | 2672 |
| 1009 | Ga0495580_0003950 | 3300046472 | Bacteria | 12508 |
| 1010 | Ga0495582_0005171 | 3300046473 | Bacteria | 7297 |
| 1011 | Ga0495605_0004092 | 3300046474 | Bacteria | 8603 |
| 1012 | Ga0495639_0002427 | 3300046475 | Bacteria | 8141 |
| 1013 | Ga0495639_0016313 | 3300046475 | Bacteria | 3224 |
| 1014 | Ga0495639_0029477 | 3300046475 | Bacteria | 2436 |
| 1015 | Ga0495664_0001861 | 3300046477 | Bacteria | 11208 |
| 1016 | Ga0495664_0030935 | 3300046477 | Bacteria | 3136 |
| 1017 | Ga0495585_0024459 | 3300046492 | Bacteria | 3463 |
| 1018 | Ga0495594_0000581 | 3300046499 | Bacteria | 18807 |
| 1019 | Ga0495607_0035772 | 3300046501 | Bacteria | 3000 |
| 1020 | Ga0495583_0039585 | 3300046506 | Bacteria | 2219 |
| 1021 | Ga0495608_0003716 | 3300046511 | Bacteria | 10963 |
| 1022 | Ga0495616_0007512 | 3300046513 | Bacteria | 6525 |
| 1023 | Ga0495618_0076007 | 3300046514 | Bacteria | 2139 |
| 1024 | Ga0495628_0000492 | 3300046516 | Bacteria | 36145 |
| 1025 | Ga0495628_0030926 | 3300046516 | Bacteria | 4331 |
| 1026 | Ga0495630_0219288 | 3300046517 | Bacteria | 1452 |
| 1027 | Ga0495631_0028018 | 3300046518 | Bacteria | 2572 |
| 1028 | Ga0495632_0023354 | 3300046519 | Bacteria | 3303 |
| 1029 | Ga0495632_0105050 | 3300046519 | Bacteria | 1329 |
| 1030 | Ga0495637_0034811 | 3300046520 | Bacteria | 2203 |
| 1031 | Ga0495643_0003144 | 3300046522 | Bacteria | 12292 |
| 1032 | Ga0495643_0060299 | 3300046522 | Bacteria | 2014 |
| 1033 | Ga0495648_0018440 | 3300046524 | Bacteria | 4939 |
| 1034 | Ga0495648_0057527 | 3300046524 | Bacteria | 2331 |
| 1035 | Ga0495666_0019999 | 3300046526 | Bacteria | 3320 |
| 1036 | Ga0495666_0043441 | 3300046526 | Bacteria | 2171 |
| 1037 | Ga0495652_0007274 | 3300046529 | Bacteria | 10216 |
| 1038 | Ga0495652_0022385 | 3300046529 | Bacteria | 5606 |
| 1039 | Ga0495652_0060817 | 3300046529 | Bacteria | 3190 |
| 1040 | Ga0495652_0073275 | 3300046529 | Bacteria | 2852 |
| 1041 | Ga0495665_0030387 | 3300046531 | Bacteria | 2890 |
| 1042 | Ga0495640_0026843 | 3300046533 | Bacteria | 4156 |
| 1043 | Ga0495586_0002370 | 3300046535 | Bacteria | 10227 |
| 1044 | Ga0495586_0015897 | 3300046535 | Bacteria | 4003 |
| 1045 | Ga0495586_0092857 | 3300046535 | Bacteria | 1668 |
| 1046 | Ga0495587_0000123 | 3300046536 | Bacteria | 59101 |
| 1047 | Ga0495587_0002547 | 3300046536 | Bacteria | 12188 |
| 1048 | Ga0495609_0011345 | 3300046538 | Bacteria | 4245 |
| 1049 | Ga0495645_0001555 | 3300046543 | Bacteria | 15530 |
| 1050 | Ga0495645_0019225 | 3300046543 | Bacteria | 4918 |
| 1051 | Ga0495645_0027772 | 3300046543 | Bacteria | 4112 |
| 1052 | Ga0495645_0034357 | 3300046543 | Bacteria | 3699 |
| 1053 | Ga0495645_0155719 | 3300046543 | Bacteria | 1583 |
| 1054 | Ga0495622_0008572 | 3300046557 | Bacteria | 4739 |
| 1055 | Ga0495622_0019863 | 3300046557 | Bacteria | 3127 |
| 1056 | Ga0495622_0058800 | 3300046557 | Bacteria | 1780 |
| 1057 | Ga0495633_0006910 | 3300046558 | Bacteria | 6641 |
| 1058 | Ga0495667_0000107 | 3300046559 | Bacteria | 60366 |
| 1059 | Ga0495667_0001041 | 3300046559 | Bacteria | 18008 |
| 1060 | Ga0495667_0007253 | 3300046559 | Bacteria | 7522 |
| 1061 | Ga0495668_0002662 | 3300046616 | Bacteria | 14339 |
| 1062 | Ga0495634_0020569 | 3300046642 | Bacteria | 4678 |
| 1063 | Ga0495611_0016203 | 3300046648 | Bacteria | 3186 |
| 1064 | Ga0495635_0028622 | 3300046663 | Bacteria | 3872 |
| 1065 | Ga0495588_0040447 | 3300046674 | Bacteria | 2378 |
| 1066 | Ga0495657_0000169 | 3300046675 | Bacteria | 59112 |
| 1067 | Ga0495657_0011577 | 3300046675 | Bacteria | 6591 |
| 1068 | Ga0495657_0029164 | 3300046675 | Bacteria | 3872 |
| 1069 | Ga0495657_0036625 | 3300046675 | Bacteria | 3389 |
| 1070 | Ga0495599_0002521 | 3300046678 | Bacteria | 10653 |
| 1071 | Ga0495599_0037427 | 3300046678 | Bacteria | 3048 |
| 1072 | Ga0495599_0042368 | 3300046678 | Bacteria | 2856 |
| 1073 | Ga0495623_0000166 | 3300046679 | Bacteria | 41152 |
| 1074 | Ga0495623_0033496 | 3300046679 | Bacteria | 3296 |
| 1075 | Ga0495623_0050024 | 3300046679 | Bacteria | 2648 |
| 1076 | Ga0495646_0059942 | 3300046680 | Bacteria | 2271 |
| 1077 | Ga0495646_0111000 | 3300046680 | Bacteria | 1561 |
| 1078 | Ga0495658_0116082 | 3300046683 | Bacteria | 1614 |
| 1079 | Ga0495658_0154287 | 3300046683 | Bacteria | 1412 |
| 1080 | Ga0495613_0009856 | 3300046689 | Bacteria | 7106 |
| 1081 | Ga0495613_0015671 | 3300046689 | Bacteria | 5641 |
| 1082 | Ga0495613_0027353 | 3300046689 | Bacteria | 4244 |
| 1083 | Ga0495613_0032534 | 3300046689 | Bacteria | 3874 |
| 1084 | Ga0495624_0058068 | 3300046690 | Bacteria | 2431 |
| 1085 | Ga0495624_0169833 | 3300046690 | Bacteria | 1330 |
| 1086 | Ga0495589_0032868 | 3300046794 | Bacteria | 2607 |
| 1087 | Ga0495600_0005572 | 3300046809 | Bacteria | 7601 |
| 1088 | Ga0495600_0009464 | 3300046809 | Bacteria | 6020 |
| 1089 | Ga0495600_0017124 | 3300046809 | Bacteria | 4607 |
| 1090 | Ga0495581_0009107 | 3300047315 | Bacteria | 5742 |
| 1091 | Ga0495581_0027592 | 3300047315 | Bacteria | 3292 |
| 1092 | Ga0495581_0043604 | 3300047315 | Bacteria | 2594 |
| 1093 | Ga0495604_0000161 | 3300047317 | Bacteria | 59093 |
| 1094 | Ga0495604_0003057 | 3300047317 | Bacteria | 13372 |
| 1095 | Ga0495604_0027138 | 3300047317 | Bacteria | 4556 |
| 1096 | Ga0495604_0038371 | 3300047317 | Bacteria | 3768 |
| 1097 | Ga0495604_0052981 | 3300047317 | Bacteria | 3139 |
| 1098 | Ga0495636_0026434 | 3300047318 | Bacteria | 2361 |
| 1099 | Ga0495674_0012623 | 3300047319 | Bacteria | 7960 |
| 1100 | Ga0495674_0018404 | 3300047319 | Bacteria | 6504 |
| 1101 | Ga0495674_0101431 | 3300047319 | Bacteria | 2448 |
| 1102 | Ga0495672_0003416 | 3300047320 | Bacteria | 13614 |
| 1103 | Ga0495672_0041435 | 3300047320 | Bacteria | 2785 |
| 1104 | Ga0495672_0041850 | 3300047320 | Bacteria | 2767 |
| 1105 | Ga0495676_0000233 | 3300047321 | Bacteria | 44485 |
| 1106 | Ga0495676_0005210 | 3300047321 | Bacteria | 11893 |
| 1107 | Ga0495676_0017972 | 3300047321 | Bacteria | 6239 |
| 1108 | Ga0495676_0200323 | 3300047321 | Bacteria | 1387 |
| 1109 | Ga0495680_0007013 | 3300047322 | Bacteria | 10389 |
| 1110 | Ga0495680_0023511 | 3300047322 | Bacteria | 5122 |
| 1111 | Ga0495680_0030600 | 3300047322 | Bacteria | 4394 |
| 1112 | Ga0495683_0002632 | 3300047323 | Bacteria | 10723 |
| 1113 | Ga0495683_0041213 | 3300047323 | Bacteria | 2330 |
| 1114 | Ga0495687_000581 | 3300047443 | Bacteria | 42904 |
| 1115 | Ga0495687_030957 | 3300047443 | Bacteria | 2460 |
| 1116 | Ga0495675_0002978 | 3300047444 | Bacteria | 10167 |
| 1117 | Ga0495675_0011761 | 3300047444 | Bacteria | 5499 |
| 1118 | Ga0495675_0015106 | 3300047444 | Bacteria | 4882 |
| 1119 | Ga0495675_0022673 | 3300047444 | Bacteria | 4003 |
| 1120 | Ga0495677_0036674 | 3300047445 | Bacteria | 1791 |
| 1121 | Ga0495685_012532 | 3300047447 | Bacteria | 2872 |
| 1122 | Ga0495684_0050867 | 3300047471 | Bacteria | 3162 |
| 1123 | Ga0495684_0122680 | 3300047471 | Bacteria | 1956 |
| 1124 | Ga0495686_0092934 | 3300047472 | Bacteria | 1829 |
| 1125 | Ga0495593_0017119 | 3300047673 | Bacteria | 4079 |
| 1126 | Ga0495593_0047132 | 3300047673 | Bacteria | 2293 |
| 1127 | Ga0495602_0000182 | 3300048088 | Bacteria | 59124 |
| 1128 | Ga0495602_0075152 | 3300048088 | Bacteria | 2868 |
| 1129 | Ga0495614_0006858 | 3300048089 | Bacteria | 5094 |
| 1130 | Ga0496100_0000335 | 3300048903 | Bacteria | 22955 |
| 1131 | Ga0496100_0003473 | 3300048903 | Bacteria | 8222 |
| 1132 | Ga0496100_0018499 | 3300048903 | Bacteria | 4134 |
| 1133 | Ga0496100_0067268 | 3300048903 | Bacteria | 2379 |
| 1134 | Ga0496100_0125109 | 3300048903 | Bacteria | 1803 |
| 1135 | Ga0496101_0000193 | 3300048904 | Bacteria | 47493 |
| 1136 | Ga0496101_0001504 | 3300048904 | Bacteria | 13952 |
| 1137 | Ga0496101_0001767 | 3300048904 | Bacteria | 12973 |
| 1138 | Ga0496101_0015785 | 3300048904 | Bacteria | 5097 |
| 1139 | Ga0496101_0031811 | 3300048904 | Bacteria | 3711 |
| 1140 | Ga0496101_0038237 | 3300048904 | Bacteria | 3408 |
| 1141 | Ga0496101_0056663 | 3300048904 | Bacteria | 2833 |
| 1142 | Ga0496101_0215633 | 3300048904 | Bacteria | 1488 |
| 1143 | Ga0496102_0000403 | 3300048905 | Bacteria | 50292 |
| 1144 | Ga0496102_0000750 | 3300048905 | Bacteria | 31716 |
| 1145 | Ga0496102_0021913 | 3300048905 | Bacteria | 5657 |
| 1146 | Ga0496102_0031975 | 3300048905 | Bacteria | 4724 |
| 1147 | Ga0496102_0032948 | 3300048905 | Bacteria | 4656 |
| 1148 | Ga0496102_0139973 | 3300048905 | Bacteria | 2269 |
| 1149 | Ga0496102_0147261 | 3300048905 | Bacteria | 2210 |
| 1150 | Ga0496102_0198432 | 3300048905 | Bacteria | 1891 |
| 1151 | Ga0496102_0202009 | 3300048905 | Bacteria | 1874 |
| 1152 | Ga0496102_0284190 | 3300048905 | Bacteria | 1559 |
| 1153 | Ga0496103_0000284 | 3300048906 | Bacteria | 47531 |
| 1154 | Ga0496103_0001055 | 3300048906 | Bacteria | 19218 |
| 1155 | Ga0496103_0002082 | 3300048906 | Bacteria | 12781 |
| 1156 | Ga0496103_0042265 | 3300048906 | Bacteria | 2804 |
| 1157 | Ga0496104_0012811 | 3300048907 | Bacteria | 7552 |
| 1158 | Ga0496104_0025727 | 3300048907 | Bacteria | 5427 |
| 1159 | Ga0496104_0039321 | 3300048907 | Bacteria | 4429 |
| 1160 | Ga0496104_0059938 | 3300048907 | Bacteria | 3604 |
| 1161 | Ga0496104_0093139 | 3300048907 | Bacteria | 2881 |
| 1162 | Ga0496105_0002855 | 3300048908 | Bacteria | 12645 |
| 1163 | Ga0496105_0021733 | 3300048908 | Bacteria | 5193 |
| 1164 | Ga0496105_0036004 | 3300048908 | Bacteria | 4076 |
| 1165 | Ga0496105_0050189 | 3300048908 | Bacteria | 3446 |
| 1166 | Ga0496105_0062054 | 3300048908 | Bacteria | 3085 |
| 1167 | Ga0496105_0069758 | 3300048908 | Bacteria | 2904 |
| 1168 | Ga0496105_0187822 | 3300048908 | Bacteria | 1691 |
| 1169 | Ga0496106_0000199 | 3300048909 | Bacteria | 42320 |
| 1170 | Ga0496106_0005688 | 3300048909 | Bacteria | 9219 |
| 1171 | Ga0496106_0008646 | 3300048909 | Bacteria | 7536 |
| 1172 | Ga0496106_0014818 | 3300048909 | Bacteria | 5764 |
| 1173 | Ga0496106_0017751 | 3300048909 | Bacteria | 5263 |
| 1174 | Ga0496106_0058154 | 3300048909 | Bacteria | 2926 |
| 1175 | Ga0496106_0163455 | 3300048909 | Bacteria | 1761 |
| 1176 | Ga0496107_0001353 | 3300048910 | Bacteria | 15069 |
| 1177 | Ga0496107_0003743 | 3300048910 | Bacteria | 10216 |
| 1178 | Ga0496107_0013481 | 3300048910 | Bacteria | 5715 |
| 1179 | Ga0496107_0014415 | 3300048910 | Bacteria | 5535 |
| 1180 | Ga0496107_0067460 | 3300048910 | Bacteria | 2596 |
| 1181 | Ga0496107_0202652 | 3300048910 | Bacteria | 1475 |
| 1182 | Ga0496108_0000966 | 3300048911 | Bacteria | 22375 |
| 1183 | Ga0496108_0006263 | 3300048911 | Bacteria | 9640 |
| 1184 | Ga0496108_0012159 | 3300048911 | Bacteria | 6999 |
| 1185 | Ga0496108_0022651 | 3300048911 | Bacteria | 5166 |
| 1186 | Ga0496108_0045925 | 3300048911 | Bacteria | 3648 |
| 1187 | Ga0496108_0051511 | 3300048911 | Bacteria | 3449 |
| 1188 | Ga0496108_0060482 | 3300048911 | Bacteria | 3187 |
| 1189 | Ga0496108_0125407 | 3300048911 | Bacteria | 2204 |
| 1190 | Ga0496109_0001398 | 3300048912 | Bacteria | 19996 |
| 1191 | Ga0496109_0008976 | 3300048912 | Bacteria | 8514 |
| 1192 | Ga0496109_0013820 | 3300048912 | Bacteria | 7014 |
| 1193 | Ga0496109_0038853 | 3300048912 | Bacteria | 4305 |
| 1194 | Ga0496109_0053536 | 3300048912 | Bacteria | 3681 |
| 1195 | Ga0496109_0066894 | 3300048912 | Bacteria | 3291 |
| 1196 | Ga0496109_0078672 | 3300048912 | Bacteria | 3036 |
| 1197 | Ga0496109_0114351 | 3300048912 | Bacteria | 2511 |
| 1198 | Ga0496109_0171944 | 3300048912 | Bacteria | 2033 |
| 1199 | Ga0496109_0257216 | 3300048912 | Bacteria | 1644 |
| 1200 | Ga0496110_0003627 | 3300048913 | Bacteria | 11876 |
| 1201 | Ga0496110_0010603 | 3300048913 | Bacteria | 7502 |
| 1202 | Ga0496110_0020318 | 3300048913 | Bacteria | 5607 |
| 1203 | Ga0496110_0028522 | 3300048913 | Bacteria | 4795 |
| 1204 | Ga0496110_0032924 | 3300048913 | Bacteria | 4480 |
| 1205 | Ga0496110_0056148 | 3300048913 | Bacteria | 3465 |
| 1206 | Ga0496110_0071762 | 3300048913 | Bacteria | 3071 |
| 1207 | Ga0496110_0080305 | 3300048913 | Bacteria | 2906 |
| 1208 | Ga0496111_0045908 | 3300048914 | Bacteria | 3144 |
| 1209 | Ga0496111_0057655 | 3300048914 | Bacteria | 2812 |
| 1210 | Ga0496111_0095915 | 3300048914 | Bacteria | 2176 |
| 1211 | Ga0496111_0218902 | 3300048914 | Bacteria | 1414 |
| 1212 | Ga0496111_0256606 | 3300048914 | Bacteria | 1297 |
| 1213 | Ga0496112_0002892 | 3300048915 | Bacteria | 13979 |
| 1214 | Ga0496112_0017061 | 3300048915 | Bacteria | 6816 |
| 1215 | Ga0496112_0018635 | 3300048915 | Bacteria | 6540 |
| 1216 | Ga0496112_0066522 | 3300048915 | Bacteria | 3556 |
| 1217 | Ga0496112_0181212 | 3300048915 | Bacteria | 2070 |
| 1218 | Ga0496112_0197097 | 3300048915 | Bacteria | 1974 |
| 1219 | Ga0496113_0006724 | 3300048916 | Bacteria | 7325 |
| 1220 | Ga0496113_0007107 | 3300048916 | Bacteria | 7166 |
| 1221 | Ga0496113_0122804 | 3300048916 | Bacteria | 2032 |
| 1222 | Ga0496113_0297112 | 3300048916 | Bacteria | 1293 |
| 1223 | Ga0496114_0000559 | 3300048917 | Bacteria | 27624 |
| 1224 | Ga0496114_0001803 | 3300048917 | Bacteria | 16262 |
| 1225 | Ga0496114_0008348 | 3300048917 | Bacteria | 8205 |
| 1226 | Ga0496114_0015343 | 3300048917 | Bacteria | 6159 |
| 1227 | Ga0496114_0017869 | 3300048917 | Bacteria | 5732 |
| 1228 | Ga0496115_0003426 | 3300048918 | Bacteria | 11391 |
| 1229 | Ga0496115_0010823 | 3300048918 | Bacteria | 6822 |
| 1230 | Ga0496115_0019920 | 3300048918 | Bacteria | 5169 |
| 1231 | Ga0496115_0020283 | 3300048918 | Bacteria | 5126 |
| 1232 | Ga0496115_0059407 | 3300048918 | Bacteria | 3079 |
| 1233 | Ga0496115_0101116 | 3300048918 | Bacteria | 2363 |
| 1234 | Ga0496115_0124763 | 3300048918 | Bacteria | 2120 |
| 1235 | Ga0496115_0151615 | 3300048918 | Bacteria | 1915 |
| 1236 | Ga0496116_0000059 | 3300048919 | Bacteria | 274491 |
| 1237 | Ga0496116_0031324 | 3300048919 | Bacteria | 3809 |
| 1238 | Ga0496117_0000055 | 3300048920 | Bacteria | 274518 |
| 1239 | Ga0496117_0002301 | 3300048920 | Bacteria | 24585 |
| 1240 | Ga0496117_0003028 | 3300048920 | Bacteria | 20155 |
| 1241 | Ga0496117_0029473 | 3300048920 | Bacteria | 4230 |
| 1242 | Ga0496117_0034361 | 3300048920 | Bacteria | 3820 |
| 1243 | Ga0496117_0057954 | 3300048920 | Bacteria | 2686 |
| 1244 | Ga0496118_0000398 | 3300048921 | Bacteria | 73344 |
| 1245 | Ga0496118_0000879 | 3300048921 | Bacteria | 47364 |
| 1246 | Ga0496118_0002102 | 3300048921 | Bacteria | 27974 |
| 1247 | Ga0496118_0009080 | 3300048921 | Bacteria | 10128 |
| 1248 | Ga0496118_0045956 | 3300048921 | Bacteria | 3401 |
| 1249 | Ga0496118_0072819 | 3300048921 | Bacteria | 2465 |
| 1250 | Ga0496118_0099499 | 3300048921 | Bacteria | 1970 |
| 1251 | Ga0496119_0000375 | 3300048922 | Bacteria | 61774 |
| 1252 | Ga0496119_0010507 | 3300048922 | Bacteria | 7781 |
| 1253 | Ga0496119_0016974 | 3300048922 | Bacteria | 5505 |
| 1254 | Ga0496119_0018886 | 3300048922 | Bacteria | 5106 |
| 1255 | Ga0496120_0000453 | 3300048923 | Bacteria | 64868 |
| 1256 | Ga0496120_0004273 | 3300048923 | Bacteria | 12140 |
| 1257 | Ga0496120_0011458 | 3300048923 | Bacteria | 6095 |
| 1258 | Ga0496120_0016566 | 3300048923 | Bacteria | 4813 |
| 1259 | Ga0496120_0016881 | 3300048923 | Bacteria | 4753 |
| 1260 | Ga0496120_0089304 | 3300048923 | Bacteria | 1650 |
| 1261 | Ga0496121_0000433 | 3300048924 | Bacteria | 82438 |
| 1262 | Ga0496121_0001114 | 3300048924 | Bacteria | 47347 |
| 1263 | Ga0496121_0011354 | 3300048924 | Bacteria | 9901 |
| 1264 | Ga0496121_0043764 | 3300048924 | Bacteria | 3872 |
| 1265 | Ga0496122_0001536 | 3300048925 | Bacteria | 36713 |
| 1266 | Ga0496122_0008484 | 3300048925 | Bacteria | 11066 |
| 1267 | Ga0496122_0009000 | 3300048925 | Bacteria | 10611 |
| 1268 | Ga0496122_0099743 | 3300048925 | Bacteria | 1946 |
| 1269 | Ga0496123_0001055 | 3300048926 | Bacteria | 41698 |
| 1270 | Ga0496123_0054573 | 3300048926 | Bacteria | 2629 |
| 1271 | Ga0496123_0088077 | 3300048926 | Bacteria | 1855 |
| 1272 | Ga0496124_0000015 | 3300048927 | Bacteria | 460700 |
| 1273 | Ga0496124_0000198 | 3300048927 | Bacteria | 119277 |
| 1274 | Ga0496124_0007726 | 3300048927 | Bacteria | 11368 |
| 1275 | Ga0496124_0007779 | 3300048927 | Bacteria | 11324 |
| 1276 | Ga0496125_0000021 | 3300048928 | Bacteria | 460688 |
| 1277 | Ga0496125_0000172 | 3300048928 | Bacteria | 144915 |
| 1278 | Ga0496125_0003069 | 3300048928 | Bacteria | 20857 |
| 1279 | Ga0496125_0020233 | 3300048928 | Bacteria | 6250 |
| 1280 | Ga0496125_0051644 | 3300048928 | Bacteria | 3389 |
| 1281 | Ga0496125_0210415 | 3300048928 | Bacteria | 1263 |
| 1282 | Ga0496126_0000015 | 3300048929 | Bacteria | 663212 |
| 1283 | Ga0496126_0000676 | 3300048929 | Bacteria | 62750 |
| 1284 | Ga0496126_0005915 | 3300048929 | Bacteria | 13791 |
| 1285 | Ga0496126_0008414 | 3300048929 | Bacteria | 11132 |
| 1286 | Ga0496126_0009487 | 3300048929 | Bacteria | 10325 |
| 1287 | Ga0496126_0064670 | 3300048929 | Bacteria | 3276 |
| 1288 | Ga0496126_0084982 | 3300048929 | Bacteria | 2790 |
| 1289 | Ga0496126_0217689 | 3300048929 | Bacteria | 1606 |
| 1290 | Ga0501306_006485 | 3300049127 | Bacteria | 1374 |
| 1291 | Ga0501031_0005824 | 3300049568 | Bacteria | 8029 |
| 1292 | Ga0501031_0089703 | 3300049568 | Bacteria | 2005 |
| 1293 | Ga0501032_0001836 | 3300049569 | Bacteria | 16790 |
| 1294 | Ga0501032_0005443 | 3300049569 | Bacteria | 9450 |
| 1295 | Ga0501032_0008992 | 3300049569 | Bacteria | 7264 |
| 1296 | Ga0501032_0013197 | 3300049569 | Bacteria | 5879 |
| 1297 | Ga0501033_0027710 | 3300049570 | Bacteria | 4259 |
| 1298 | Ga0501033_0034053 | 3300049570 | Bacteria | 3822 |
| 1299 | Ga0501033_0110295 | 3300049570 | Bacteria | 2003 |
| 1300 | Ga0501033_0130203 | 3300049570 | Bacteria | 1823 |
| 1301 | Ga0501034_0000015 | 3300049571 | Bacteria | 296163 |
| 1302 | Ga0501034_0000543 | 3300049571 | Bacteria | 60025 |
| 1303 | Ga0501034_0005064 | 3300049571 | Bacteria | 14478 |
| 1304 | Ga0501034_0018586 | 3300049571 | Bacteria | 7125 |
| 1305 | Ga0501034_0022037 | 3300049571 | Bacteria | 6490 |
| 1306 | Ga0501034_0065426 | 3300049571 | Bacteria | 3648 |
| 1307 | Ga0501034_0071162 | 3300049571 | Bacteria | 3488 |
| 1308 | Ga0501034_0080618 | 3300049571 | Bacteria | 3258 |
| 1309 | Ga0501034_0098570 | 3300049571 | Bacteria | 2918 |
| 1310 | Ga0501034_0123536 | 3300049571 | Bacteria | 2574 |
| 1311 | Ga0501034_0123811 | 3300049571 | Bacteria | 2571 |
| 1312 | Ga0501034_0124822 | 3300049571 | Bacteria | 2559 |
| 1313 | Ga0501034_0171816 | 3300049571 | Bacteria | 2134 |
| 1314 | Ga0501034_0303310 | 3300049571 | Bacteria | 1533 |
| 1315 | Ga0501034_0417429 | 3300049571 | Bacteria | 1263 |
| 1316 | Ga0501036_0002530 | 3300049572 | Bacteria | 14358 |
| 1317 | Ga0501036_0003852 | 3300049572 | Bacteria | 12037 |
| 1318 | Ga0501036_0015135 | 3300049572 | Bacteria | 6442 |
| 1319 | Ga0501036_0024970 | 3300049572 | Bacteria | 5040 |
| 1320 | Ga0501036_0149485 | 3300049572 | Bacteria | 1970 |
| 1321 | Ga0501036_0165471 | 3300049572 | Bacteria | 1864 |
| 1322 | Ga0501037_0001123 | 3300049573 | Bacteria | 19813 |
| 1323 | Ga0501037_0013330 | 3300049573 | Bacteria | 6058 |
| 1324 | Ga0501037_0047486 | 3300049573 | Bacteria | 3146 |
| 1325 | Ga0501037_0068478 | 3300049573 | Bacteria | 2584 |
| 1326 | Ga0501037_0126288 | 3300049573 | Bacteria | 1836 |
| 1327 | Ga0501038_0006115 | 3300049574 | Bacteria | 11140 |
| 1328 | Ga0501038_0007725 | 3300049574 | Bacteria | 9916 |
| 1329 | Ga0501038_0017810 | 3300049574 | Bacteria | 6418 |
| 1330 | Ga0501038_0061692 | 3300049574 | Bacteria | 3205 |
| 1331 | Ga0501038_0099827 | 3300049574 | Bacteria | 2419 |
| 1332 | Ga0501038_0144817 | 3300049574 | Bacteria | 1941 |
| 1333 | Ga0501038_0197175 | 3300049574 | Bacteria | 1618 |
| 1334 | Ga0501039_0001048 | 3300049575 | Bacteria | 20241 |
| 1335 | Ga0501039_0006498 | 3300049575 | Bacteria | 8890 |
| 1336 | Ga0501039_0009678 | 3300049575 | Bacteria | 7346 |
| 1337 | Ga0501040_0022837 | 3300049576 | Bacteria | 4191 |
| 1338 | Ga0501040_0087038 | 3300049576 | Bacteria | 2169 |
| 1339 | Ga0501041_0000703 | 3300049577 | Bacteria | 17796 |
| 1340 | Ga0501041_0043969 | 3300049577 | Bacteria | 2715 |
| 1341 | Ga0501041_0071309 | 3300049577 | Bacteria | 2133 |
| 1342 | Ga0501042_0045990 | 3300049578 | Bacteria | 3111 |
| 1343 | Ga0501042_0058123 | 3300049578 | Bacteria | 2760 |
| 1344 | Ga0501042_0067621 | 3300049578 | Bacteria | 2554 |
| 1345 | Ga0501042_0110801 | 3300049578 | Bacteria | 1976 |
| 1346 | Ga0501043_0000606 | 3300049579 | Bacteria | 31710 |
| 1347 | Ga0501043_0009509 | 3300049579 | Bacteria | 7621 |
| 1348 | Ga0501043_0013569 | 3300049579 | Bacteria | 6374 |
| 1349 | Ga0501043_0016803 | 3300049579 | Bacteria | 5735 |
| 1350 | Ga0501043_0024460 | 3300049579 | Bacteria | 4740 |
| 1351 | Ga0501043_0036812 | 3300049579 | Bacteria | 3850 |
| 1352 | Ga0501043_0043569 | 3300049579 | Bacteria | 3527 |
| 1353 | Ga0501043_0046336 | 3300049579 | Bacteria | 3419 |
| 1354 | Ga0501043_0052392 | 3300049579 | Bacteria | 3205 |
| 1355 | Ga0501043_0117528 | 3300049579 | Bacteria | 2086 |
| 1356 | Ga0501043_0172766 | 3300049579 | Bacteria | 1686 |
| 1357 | Ga0501046_0001735 | 3300049580 | Bacteria | 20794 |
| 1358 | Ga0501046_0002135 | 3300049580 | Bacteria | 18685 |
| 1359 | Ga0501046_0003857 | 3300049580 | Bacteria | 13713 |
| 1360 | Ga0501046_0006220 | 3300049580 | Bacteria | 10599 |
| 1361 | Ga0501047_0000107 | 3300049581 | Bacteria | 102041 |
| 1362 | Ga0501047_0000268 | 3300049581 | Bacteria | 60315 |
| 1363 | Ga0501047_0002183 | 3300049581 | Bacteria | 18725 |
| 1364 | Ga0501047_0008765 | 3300049581 | Bacteria | 9545 |
| 1365 | Ga0501047_0013070 | 3300049581 | Bacteria | 7863 |
| 1366 | Ga0501047_0027020 | 3300049581 | Bacteria | 5528 |
| 1367 | Ga0501047_0087040 | 3300049581 | Bacteria | 3002 |
| 1368 | Ga0501048_0003331 | 3300049582 | Bacteria | 12228 |
| 1369 | Ga0501048_0143518 | 3300049582 | Bacteria | 1688 |
| 1370 | Ga0501048_0164294 | 3300049582 | Bacteria | 1572 |
| 1371 | Ga0501048_0251248 | 3300049582 | Bacteria | 1255 |
| 1372 | Ga0501067_0008668 | 3300049583 | Bacteria | 5637 |
| 1373 | Ga0501067_0032390 | 3300049583 | Bacteria | 2901 |
| 1374 | Ga0501068_0017903 | 3300049584 | Bacteria | 4102 |
| 1375 | Ga0501068_0106361 | 3300049584 | Bacteria | 1742 |
| 1376 | Ga0501069_0006022 | 3300049585 | Bacteria | 6328 |
| 1377 | Ga0501069_0038097 | 3300049585 | Bacteria | 2654 |
| 1378 | Ga0501069_0066513 | 3300049585 | Bacteria | 2015 |
| 1379 | Ga0501070_0000925 | 3300049586 | Bacteria | 26486 |
| 1380 | Ga0501070_0002491 | 3300049586 | Bacteria | 16128 |
| 1381 | Ga0501070_0004541 | 3300049586 | Bacteria | 11911 |
| 1382 | Ga0501070_0008759 | 3300049586 | Bacteria | 8555 |
| 1383 | Ga0501070_0042137 | 3300049586 | Bacteria | 3802 |
| 1384 | Ga0501070_0043498 | 3300049586 | Bacteria | 3737 |
| 1385 | Ga0501070_0047700 | 3300049586 | Bacteria | 3559 |
| 1386 | Ga0501070_0068120 | 3300049586 | Bacteria | 2946 |
| 1387 | Ga0501070_0095453 | 3300049586 | Bacteria | 2460 |
| 1388 | Ga0501071_0000938 | 3300049587 | Bacteria | 15841 |
| 1389 | Ga0501071_0032295 | 3300049587 | Bacteria | 3717 |
| 1390 | Ga0501072_0006940 | 3300049588 | Bacteria | 8598 |
| 1391 | Ga0501072_0072579 | 3300049588 | Bacteria | 2720 |
| 1392 | Ga0501072_0161295 | 3300049588 | Bacteria | 1789 |
| 1393 | Ga0501072_0161952 | 3300049588 | Bacteria | 1785 |
| 1394 | Ga0501072_0192834 | 3300049588 | Bacteria | 1625 |
| 1395 | Ga0501073_0000024 | 3300049589 | Bacteria | 128851 |
| 1396 | Ga0501073_0016913 | 3300049589 | Bacteria | 5282 |
| 1397 | Ga0501073_0024223 | 3300049589 | Bacteria | 4358 |
| 1398 | Ga0501073_0072087 | 3300049589 | Bacteria | 2406 |
| 1399 | Ga0501073_0183129 | 3300049589 | Bacteria | 1450 |
| 1400 | Ga0501074_0001157 | 3300049590 | Bacteria | 17270 |
| 1401 | Ga0501074_0002652 | 3300049590 | Bacteria | 12537 |
| 1402 | Ga0501074_0018015 | 3300049590 | Bacteria | 5130 |
| 1403 | Ga0501074_0090092 | 3300049590 | Bacteria | 2197 |
| 1404 | Ga0501076_0001496 | 3300049592 | Bacteria | 15672 |
| 1405 | Ga0501076_0022476 | 3300049592 | Bacteria | 4846 |
| 1406 | Ga0501076_0201480 | 3300049592 | Bacteria | 1625 |
| 1407 | Ga0501077_0014871 | 3300049593 | Bacteria | 4891 |
| 1408 | Ga0501079_0003055 | 3300049741 | Bacteria | 12245 |
| 1409 | Ga0501079_0011446 | 3300049741 | Bacteria | 6772 |
| 1410 | Ga0501080_0001035 | 3300049742 | Bacteria | 22914 |
| 1411 | Ga0501080_0006153 | 3300049742 | Bacteria | 10769 |
| 1412 | Ga0501080_0016596 | 3300049742 | Bacteria | 6802 |
| 1413 | Ga0501080_0022823 | 3300049742 | Bacteria | 5799 |
| 1414 | Ga0501080_0091423 | 3300049742 | Bacteria | 2827 |
| 1415 | Ga0501080_0258973 | 3300049742 | Bacteria | 1585 |
| 1416 | Ga0501081_0006271 | 3300049743 | Bacteria | 7710 |
| 1417 | Ga0501081_0011062 | 3300049743 | Bacteria | 5901 |
| 1418 | Ga0501083_0005406 | 3300049744 | Bacteria | 9042 |
| 1419 | Ga0501083_0186096 | 3300049744 | Bacteria | 1356 |
| 1420 | Ga0501035_0003186 | 3300049822 | Bacteria | 15726 |
| 1421 | Ga0501035_0014479 | 3300049822 | Bacteria | 7279 |
| 1422 | Ga0501035_0014942 | 3300049822 | Bacteria | 7164 |
| 1423 | Ga0501035_0019336 | 3300049822 | Bacteria | 6266 |
| 1424 | Ga0501035_0023019 | 3300049822 | Bacteria | 5718 |
| 1425 | Ga0501035_0023206 | 3300049822 | Bacteria | 5691 |
| 1426 | Ga0501044_0001612 | 3300049823 | Bacteria | 26422 |
| 1427 | Ga0501044_0005882 | 3300049823 | Bacteria | 13589 |
| 1428 | Ga0501044_0006459 | 3300049823 | Bacteria | 12950 |
| 1429 | Ga0501044_0007748 | 3300049823 | Bacteria | 11806 |
| 1430 | Ga0501044_0015647 | 3300049823 | Bacteria | 8170 |
| 1431 | Ga0501044_0035143 | 3300049823 | Bacteria | 5250 |
| 1432 | Ga0501044_0043045 | 3300049823 | Bacteria | 4692 |
| 1433 | Ga0501044_0066591 | 3300049823 | Bacteria | 3672 |
| 1434 | Ga0501044_0089672 | 3300049823 | Bacteria | 3103 |
| 1435 | Ga0501045_0039028 | 3300049824 | Bacteria | 3455 |
| 1436 | nmdc:mga03683_17583_c1 | 3300050489 | Bacteria | 2708 |
| 1437 | nmdc:mga03n38_1081_c1 | 3300050490 | Bacteria | 7519 |
| 1438 | nmdc:mga03n38_2844_c1 | 3300050490 | Bacteria | 5447 |
| 1439 | nmdc:mga03n38_38141_c1 | 3300050490 | Bacteria | 2077 |
| 1440 | nmdc:mga00v17_10006_c1 | 3300050491 | Bacteria | 5159 |
| 1441 | nmdc:mga00v17_16972_c1 | 3300050491 | Bacteria | 4112 |
| 1442 | nmdc:mga00v17_3299_c1 | 3300050491 | Bacteria | 8322 |
| 1443 | nmdc:mga00v17_3766_c1 | 3300050491 | Bacteria | 7829 |
| 1444 | nmdc:mga00v17_37721_c1 | 3300050491 | Bacteria | 2887 |
| 1445 | nmdc:mga00v17_72057_c1 | 3300050491 | Bacteria | 2143 |
| 1446 | nmdc:mga00v17_9193_c1 | 3300050491 | Bacteria | 5338 |
| 1447 | nmdc:mga0yw44_2056_c1 | 3300050492 | Bacteria | 8398 |
| 1448 | nmdc:mga0yw44_4555_c1 | 3300050492 | Bacteria | 6382 |
| 1449 | nmdc:mga06z11_11779_c1 | 3300050494 | Bacteria | 3781 |
| 1450 | nmdc:mga07m45_113737_c1 | 3300050496 | Bacteria | 1560 |
| 1451 | nmdc:mga07m45_18278_c1 | 3300050496 | Bacteria | 3781 |
| 1452 | nmdc:mga07m45_3115_c1 | 3300050496 | Bacteria | 7939 |
| 1453 | nmdc:mga07m45_41926_c1 | 3300050496 | Bacteria | 2564 |
| 1454 | nmdc:mga07m45_47346_c1 | 3300050496 | Bacteria | 2417 |
| 1455 | nmdc:mga07m45_7793_c1 | 3300050496 | Bacteria | 5480 |
| 1456 | nmdc:mga05p37_11899_c1 | 3300050507 | Bacteria | 10376 |
| 1457 | nmdc:mga05p37_172547_c1 | 3300050507 | Bacteria | 2637 |
| 1458 | nmdc:mga05p37_2128_c1 | 3300050507 | Bacteria | 23129 |
| 1459 | nmdc:mga05p37_46755_c1 | 3300050507 | Bacteria | 5321 |
| 1460 | nmdc:mga05p37_59920_c1 | 3300050507 | Bacteria | 4687 |
| 1461 | nmdc:mga09592_1737_c1 | 3300050508 | Bacteria | 17543 |
| 1462 | nmdc:mga09592_199312_c1 | 3300050508 | Bacteria | 1733 |
| 1463 | nmdc:mga0qj67_193_c1 | 3300050509 | Bacteria | 41569 |
| 1464 | nmdc:mga0qj67_3435_c1 | 3300050509 | Bacteria | 11415 |
| 1465 | nmdc:mga0qj67_36297_c1 | 3300050509 | Bacteria | 3856 |
| 1466 | nmdc:mga0qj67_695_c1 | 3300050509 | Bacteria | 22912 |
| 1467 | nmdc:mga06r32_111190_c1 | 3300050510 | Bacteria | 2696 |
| 1468 | nmdc:mga06r32_15489_c1 | 3300050510 | Bacteria | 6922 |
| 1469 | nmdc:mga06r32_1594_c1 | 3300050510 | Bacteria | 20429 |
| 1470 | nmdc:mga06r32_198_c1 | 3300050510 | Bacteria | 26154 |
| 1471 | nmdc:mga06r32_261812_c1 | 3300050510 | Bacteria | 1717 |
| 1472 | nmdc:mga06r32_275_c1 | 3300050510 | Bacteria | 42703 |
| 1473 | nmdc:mga06r32_77316_c1 | 3300050510 | Bacteria | 3233 |
| 1474 | nmdc:mga08y16_5920_c1 | 3300050511 | Bacteria | 12821 |
| 1475 | nmdc:mga08y16_85139_c1 | 3300050511 | Bacteria | 3294 |
| 1476 | nmdc:mga08y16_92314_c1 | 3300050511 | Bacteria | 3155 |
| 1477 | nmdc:mga0n895_41320_c1 | 3300050512 | Bacteria | 4482 |
| 1478 | nmdc:mga0n895_7027_c1 | 3300050512 | Bacteria | 9616 |
| 1479 | nmdc:mga0n895_93647_c1 | 3300050512 | Bacteria | 3008 |
| 1480 | nmdc:mga0n895_99740_c1 | 3300050512 | Bacteria | 2913 |
| 1481 | nmdc:mga0rr50_41993_c1 | 3300050513 | Bacteria | 3337 |
| 1482 | nmdc:mga0rr50_64626_c1 | 3300050513 | Bacteria | 2769 |
| 1483 | nmdc:mga08x19_6450_c1 | 3300050514 | Bacteria | 6947 |
| 1484 | nmdc:mga0a205_109248_c1 | 3300050515 | Bacteria | 2664 |
| 1485 | nmdc:mga0a205_38254_c1 | 3300050515 | Bacteria | 4615 |
| 1486 | nmdc:mga0a205_56142_c1 | 3300050515 | Bacteria | 3803 |
| 1487 | nmdc:mga0a205_8625_c2 | 3300050515 | Bacteria | 7926 |
| 1488 | nmdc:mga0sz30_4791_c1 | 3300050516 | Bacteria | 4922 |
| 1489 | nmdc:mga0sz30_65576_c1 | 3300050516 | Bacteria | 1557 |
| 1490 | nmdc:mga0sz30_656_c1 | 3300050516 | Bacteria | 12820 |
| 1491 | nmdc:mga0sz30_8114_c1 | 3300050516 | Bacteria | 3956 |
| 1492 | Ga0495601_0125810 | 3300053077 | Bacteria | 1667 |
| 1493 | Ga0495612_0000472 | 3300053078 | Bacteria | 16204 |
| 1494 | Ga0495612_0029687 | 3300053078 | Bacteria | 2203 |
| 1495 | Ga0495612_0043180 | 3300053078 | Bacteria | 1841 |
| 1496 | Ga0495595_0006267 | 3300053084 | Bacteria | 4845 |
| 1497 | Ga0495595_0017594 | 3300053084 | Bacteria | 3077 |
| 1498 | Ga0495619_0061541 | 3300053085 | Bacteria | 2498 |
| 1499 | Ga0495619_0077770 | 3300053085 | Bacteria | 2229 |
| 1500 | Ga0495619_0103658 | 3300053085 | Bacteria | 1938 |
| 1501 | Ga0500643_000189 | 3300053087 | Bacteria | 58813 |
| 1502 | Ga0500643_000352 | 3300053087 | Bacteria | 36502 |
| 1503 | Ga0500646_0000612 | 3300053090 | Bacteria | 10209 |
| 1504 | Ga0500651_0001689 | 3300053093 | Bacteria | 11274 |
| 1505 | Ga0500651_0131400 | 3300053093 | Bacteria | 1514 |
| 1506 | Ga0500641_0035450 | 3300053096 | Bacteria | 1991 |
| 1507 | Ga0500554_006511 | 3300053102 | Bacteria | 2624 |
| 1508 | Ga0500556_0000062 | 3300053104 | Bacteria | 110818 |
| 1509 | Ga0500593_035358 | 3300053117 | Bacteria | 2236 |
| 1510 | Ga0500594_0004228 | 3300053118 | Bacteria | 3167 |
| 1511 | Ga0500652_058759 | 3300053131 | Bacteria | 1580 |
| 1512 | Ga0500658_0039444 | 3300053134 | Bacteria | 1888 |
| 1513 | Ga0500559_0000868 | 3300053136 | Bacteria | 19392 |
| 1514 | Ga0500559_0002901 | 3300053136 | Bacteria | 8631 |
| 1515 | Ga0500559_0020640 | 3300053136 | Bacteria | 2786 |
| 1516 | Ga0500568_0000060 | 3300053139 | Bacteria | 107901 |
| 1517 | Ga0500568_0000124 | 3300053139 | Bacteria | 68924 |
| 1518 | Ga0500568_0002651 | 3300053139 | Bacteria | 10388 |
| 1519 | Ga0500568_0019851 | 3300053139 | Bacteria | 2914 |
| 1520 | Ga0500568_0033263 | 3300053139 | Bacteria | 2117 |
| 1521 | Ga0500573_0000007 | 3300053140 | Bacteria | 272970 |
| 1522 | Ga0500588_0003567 | 3300053146 | Bacteria | 3297 |
| 1523 | Ga0500589_052185 | 3300053147 | Bacteria | 1895 |
| 1524 | Ga0500590_001918 | 3300053148 | Bacteria | 8895 |
| 1525 | Ga0500600_0068994 | 3300053149 | Bacteria | 1944 |
| 1526 | Ga0500604_0013291 | 3300053151 | Bacteria | 2229 |
| 1527 | Ga0500616_0002004 | 3300053153 | Bacteria | 18042 |
| 1528 | Ga0500616_0064516 | 3300053153 | Bacteria | 1886 |
| 1529 | Ga0500620_000387 | 3300053155 | Bacteria | 8152 |
| 1530 | Ga0500645_000128 | 3300053730 | Bacteria | 59444 |
| 1531 | Ga0501084_0002094 | 3300054114 | Bacteria | 15945 |
| 1532 | Ga0501084_0028238 | 3300054114 | Bacteria | 4689 |
| 1533 | Ga0501084_0052351 | 3300054114 | Bacteria | 3416 |
| 1534 | Ga0501084_0053198 | 3300054114 | Bacteria | 3387 |
| 1535 | Ga0501084_0063808 | 3300054114 | Bacteria | 3084 |
| 1536 | Ga0501084_0126504 | 3300054114 | Bacteria | 2150 |
| 1537 | Ga0501084_0237061 | 3300054114 | Bacteria | 1540 |
| 1538 | Ga0590075_004557 | 3300059424 | Bacteria | 3284 |
| 1539 | Ga0501082_0013306 | 3300060353 | Bacteria | 7074 |
| 1540 | Ga0501082_0064397 | 3300060353 | Bacteria | 3157 |
| 1541 | Ga0466962_0000302 | 3300061719 | Bacteria | 21145 |
| 1542 | Ga0466962_0003093 | 3300061719 | Bacteria | 7915 |
| 1543 | Ga0466962_0004408 | 3300061719 | Bacteria | 6749 |
| 1544 | Ga0466962_0006025 | 3300061719 | Bacteria | 5830 |
| 1545 | Ga0466962_0028426 | 3300061719 | Bacteria | 2679 |
| 1546 | 2501942824 | 2501939600 | Bacteria | 6907073 |
| 1547 | 2506867832 | 2506783011 | Bacteria | 5323186 |
| 1548 | 2515494912 | 2515154088 | Bacteria | 5526283 |
| 1549 | 2515718916 | 2515154129 | Bacteria | 5584369 |
| 1550 | 2515755575 | 2515154137 | Bacteria | 5711575 |
| 1551 | 2515851904 | 2515154155 | Bacteria | 7985436 |
| 1552 | 2516083128 | 2515154202 | Bacteria | 5471270 |
| 1553 | 2516090214 | 2515154203 | Bacteria | 5458536 |
| 1554 | 2523383290 | 2523231044 | Bacteria | 6434991 |
| 1555 | 2528205551 | 2527291627 | Bacteria | 5309833 |
| 1556 | 2528214972 | 2527291629 | Bacteria | 5267418 |
| 1557 | 2546950328 | 2546825537 | Bacteria | 5389291 |
| 1558 | 2548694814 | 2547132424 | Bacteria | 8348532 |
| 1559 | 2552107491 | 2551306166 | Bacteria | 9731570 |
| 1560 | 2554259472 | 2554235005 | Bacteria | 6457341 |
| 1561 | 2558914157 | 2558860112 | Bacteria | 9931328 |
| 1562 | 2566997442 | 2565956761 | Bacteria | 6601618 |
| 1563 | 2579750244 | 2576861822 | Bacteria | 5004595 |
| 1564 | 2579856475 | 2579778521 | Bacteria | 7624758 |
| 1565 | 2585302008 | 2582581312 | Bacteria | 7308206 |
| 1566 | 2585321075 | 2582581314 | Bacteria | 11452267 |
| 1567 | 2616695704 | 2616644814 | Bacteria | 11555299 |
| 1568 | 2619858079 | 2619618881 | Bacteria | 7521104 |
| 1569 | 2620352616 | 2619619003 | Bacteria | 7619552 |
| 1570 | 2623501119 | 2622736605 | Bacteria | 4992138 |
| 1571 | 2623588025 | 2622736626 | Bacteria | 7181580 |
| 1572 | 2626639665 | 2626541554 | Bacteria | 7741902 |
| 1573 | 2643904555 | 2643221578 | Bacteria | 9213798 |
| 1574 | 2644019206 | 2643221601 | Bacteria | 7493239 |
| 1575 | 2644095148 | 2643221616 | Bacteria | 4066575 |
| 1576 | 2644174112 | 2643221631 | Bacteria | 8168043 |
| 1577 | 2644406179 | 2643221673 | Bacteria | 9196637 |
| 1578 | 2644488693 | 2643221687 | Bacteria | 6500351 |
| 1579 | 2644506432 | 2643221690 | Bacteria | 4654705 |
| 1580 | 2644518138 | 2643221692 | Bacteria | 7282860 |
| 1581 | 2644526650 | 2643221694 | Bacteria | 4392972 |
| 1582 | 2644636685 | 2643221715 | Bacteria | 6671032 |
| 1583 | 2644671316 | 2643221722 | Bacteria | 4247614 |
| 1584 | 2671839072 | 2671180195 | Bacteria | 9757215 |
| 1585 | 2676476047 | 2675903058 | Bacteria | 6822861 |
| 1586 | 2676487337 | 2675903059 | Bacteria | 8644972 |
| 1587 | 2686537797 | 2684623035 | Bacteria | 8032739 |
| 1588 | 2686543134 | 2684623036 | Bacteria | 5199090 |
| 1589 | 2689991648 | 2687453743 | Bacteria | 8361025 |
| 1590 | 2710603810 | 2710264753 | Bacteria | 5455564 |
| 1591 | 2731907033 | 2731639228 | Bacteria | 4187555 |
| 1592 | 2738664986 | 2738541264 | Bacteria | 5935393 |
| 1593 | 2738708135 | 2738541274 | Bacteria | 6909446 |
| 1594 | 2738886690 | 2738541308 | Bacteria | 7020677 |
| 1595 | 2739144120 | 2738541356 | Bacteria | 5935017 |
| 1596 | 2739203829 | 2738543005 | Bacteria | 5278128 |
| 1597 | 2739239384 | 2738543011 | Bacteria | 5731169 |
| 1598 | 2739334712 | 2738543028 | Bacteria | 6917070 |
| 1599 | 2744954612 | 2744054611 | Bacteria | 5611514 |
| 1600 | 2753076170 | 2751185734 | Bacteria | 8863695 |
| 1601 | 2753303407 | 2751185788 | Bacteria | 4541048 |
| 1602 | 2774857228 | 2773857922 | Bacteria | 9757215 |
| 1603 | 2774866103 | 2773857924 | Bacteria | 5256821 |
| 1604 | 2774904260 | 2773857933 | Bacteria | 5818019 |
| 1605 | 2776370698 | 2775506925 | Bacteria | 7237746 |
| 1606 | 2793983469 | 2791355406 | Bacteria | 11364898 |
| 1607 | 2808890684 | 2808606370 | Bacteria | 4942454 |
| 1608 | 2810363513 | 2808606700 | Bacteria | 3482157 |
| 1609 | 2811847040 | 2808606982 | Bacteria | 7791042 |
| 1610 | 2812365412 | 2811994880 | Bacteria | 4147780 |
| 1611 | 2812482300 | 2811994917 | Bacteria | 7761064 |
| 1612 | 2819739146 | 2818991472 | Bacteria | 10089953 |
| 1613 | 2827630609 | 2827628540 | Bacteria | 6858585 |
| 1614 | 2837187228 | 2837183177 | Bacteria | 4637169 |
| 1615 | 2839989531 | 2839986021 | Bacteria | 3685650 |
| 1616 | 2842137806 | 2842134933 | Bacteria | 5847019 |
| 1617 | 2844852307 | 2844849076 | Bacteria | 4091819 |
| 1618 | 2844856559 | 2844852863 | Bacteria | 3849151 |
| 1619 | 2855681951 | 2855676851 | Bacteria | 7063653 |
| 1620 | 2855686874 | 2855683550 | Bacteria | 7134265 |
| 1621 | 2856862049 | 2856858025 | Bacteria | 7255264 |
| 1622 | 2857289182 | 2857288857 | Bacteria | 7189066 |
| 1623 | 2857740182 | 2857737099 | Bacteria | 3104305 |
| 1624 | 2857743804 | 2857740372 | Bacteria | 4782044 |
| 1625 | 2858850004 | 2858848962 | Bacteria | 6963058 |
| 1626 | 2858874904 | 2858868258 | Bacteria | 7683772 |
| 1627 | 2858883484 | 2858882152 | Bacteria | 7230291 |
| 1628 | 2858891979 | 2858888857 | Bacteria | 7060307 |
| 1629 | 2858899339 | 2858895516 | Bacteria | 7378898 |
| 1630 | 2858907845 | 2858902515 | Bacteria | 7086037 |
| 1631 | 2861527631 | 2861520306 | Bacteria | 8348283 |
| 1632 | 2862510485 | 2862507626 | Bacteria | 9425308 |
| 1633 | 2862706808 | 2862705112 | Bacteria | 6563286 |
| 1634 | 2863072248 | 2863067949 | Bacteria | 8541735 |
| 1635 | 2867307773 | 2867302475 | Bacteria | 7087181 |
| 1636 | 2867319094 | 2867312974 | Bacteria | 7058875 |
| 1637 | 2867320099 | 2867319477 | Bacteria | 7069771 |
| 1638 | 2867346895 | 2867346516 | Bacteria | 7608576 |
| 1639 | 2867369926 | 2867369537 | Bacteria | 6501581 |
| 1640 | 2867480854 | 2867475112 | Bacteria | 6909112 |
| 1641 | 2868094364 | 2868088558 | Bacteria | 7609351 |
| 1642 | 2869051888 | 2869048445 | Bacteria | 6875584 |
| 1643 | 2869067946 | 2869061728 | Bacteria | 7112407 |
| 1644 | 2869073443 | 2869068681 | Bacteria | 7205615 |
| 1645 | 2870622737 | 2870622029 | Bacteria | 3643329 |
| 1646 | 2870726152 | 2870721527 | Bacteria | 9689237 |
| 1647 | 2875392761 | 2875391855 | Bacteria | 7600475 |
| 1648 | 2880492030 | 2880489317 | Bacteria | 7096270 |
| 1649 | 2880500262 | 2880495981 | Bacteria | 7340502 |
| 1650 | 2884764545 | 2884763398 | Bacteria | 4091164 |
| 1651 | 2884995185 | 2884994152 | Bacteria | 4492978 |
| 1652 | 2889301981 | 2889300758 | Bacteria | 5690814 |
| 1653 | 2891327154 | 2891326441 | Bacteria | 6439512 |
| 1654 | 2895429234 | 2895427314 | Bacteria | 13147766 |
| 1655 | 2895888739 | 2895880812 | Bacteria | 11255272 |
| 1656 | 2899368037 | 2899359706 | Bacteria | 10940472 |
| 1657 | 2899375434 | 2899370129 | Bacteria | 6781179 |
| 1658 | 2902586652 | 2902582711 | Bacteria | 6187705 |
| 1659 | 2902795775 | 2902792274 | Bacteria | 7270173 |
| 1660 | 2902803821 | 2902799365 | Bacteria | 5419524 |
| 1661 | 2902811851 | 2902810491 | Bacteria | 6794147 |
| 1662 | 2902838577 | 2902837492 | Bacteria | 6697721 |
| 1663 | 2904499703 | 2904497146 | Bacteria | 4731781 |
| 1664 | 2904540346 | 2904535858 | Bacteria | 6308016 |
| 1665 | 2904769221 | 2904765812 | Bacteria | 5369154 |
| 1666 | 2904776331 | 2904770941 | Bacteria | 5580202 |
| 1667 | 2904780360 | 2904776348 | Bacteria | 4658726 |
| 1668 | 2905927707 | 2905926851 | Bacteria | 4423176 |
| 1669 | 2905929264 | 2905926851 | Bacteria | 4423176 |
| 1670 | 2905930281 | 2905926851 | Bacteria | 4423176 |
| 1671 | 2908814417 | 2908811453 | Bacteria | 5478616 |
| 1672 | 2910814860 | 2910809715 | Bacteria | 4982797 |
| 1673 | 2912722325 | 2912715099 | Bacteria | 9460473 |
| 1674 | 2912726037 | 2912723979 | Bacteria | 8557534 |
| 1675 | 2912758959 | 2912757875 | Bacteria | 7940295 |
| 1676 | 2919036156 | 2919034639 | Bacteria | 4763403 |
| 1677 | 2919046180 | 2919042368 | Bacteria | 3905917 |
| 1678 | 2919053168 | 2919051321 | Bacteria | 4210889 |
| 1679 | 2919060871 | 2919059106 | Bacteria | 4991624 |
| 1680 | 2919392436 | 2919391150 | Bacteria | 4884741 |
| 1681 | 2919422858 | 2919420072 | Bacteria | 5390363 |
| 1682 | 2919434889 | 2919432681 | Bacteria | 5390474 |
| 1683 | 2919538626 | 2919538618 | Bacteria | 4677069 |
| 1684 | 2919718922 | 2919713450 | Bacteria | 7431245 |
| 1685 | 2922556375 | 2922554459 | Bacteria | 6683962 |
| 1686 | 2928106968 | 2928104781 | Bacteria | 3877447 |
| 1687 | 2928147267 | 2928142448 | Bacteria | 5288925 |
| 1688 | 2929215655 | 2929212328 | Bacteria | 7708288 |
| 1689 | 2929222155 | 2929219909 | Bacteria | 6984360 |
| 1690 | 2929228820 | 2929226422 | Bacteria | 7248583 |
| 1691 | 2932398928 | 2932398195 | Bacteria | 3847976 |
| 1692 | 2932431103 | 2932426870 | Bacteria | 4547726 |
| 1693 | 2932433655 | 2932431166 | Bacteria | 4215299 |
| 1694 | 2933419213 | 2933418574 | Bacteria | 4476724 |
| 1695 | 2935394777 | 2935390628 | Bacteria | 7043367 |
| 1696 | 2939589358 | 2939582691 | Bacteria | 7088898 |
| 1697 | 2939647868 | 2939647034 | Bacteria | 4681660 |
| 1698 | 2939663719 | 2939660829 | Bacteria | 3784848 |
| 1699 | 2939679070 | 2939674588 | Bacteria | 4844420 |
| 1700 | 2939748198 | 2939743619 | Bacteria | 5762299 |
| 1701 | 2945924525 | 2945920336 | Bacteria | 4501603 |
| 1702 | 2945943739 | 2945941187 | Bacteria | 4682474 |
| 1703 | 2945958072 | 2945956166 | Bacteria | 5110334 |
| 1704 | 2946004070 | 2946003308 | Bacteria | 3857229 |
| 1705 | 2946039708 | 2946037020 | Bacteria | 4900426 |
| 1706 | 2946051954 | 2946045630 | Bacteria | 8527308 |
| 1707 | 2947231749 | 2947224130 | Bacteria | 9938529 |
| 1708 | 2954000932 | 2953998280 | Bacteria | 4812144 |
| 1709 | 2954011001 | 2954002825 | Bacteria | 9173742 |
| 1710 | 2956941213 | 2956939328 | Bacteria | 3474458 |
| 1711 | 2966927682 | 2966924647 | Bacteria | 3268643 |
| 1712 | 2974303208 | 2974302888 | Bacteria | 4369871 |
| 1713 | 2984526003 | 2984523437 | Bacteria | 4508481 |
| 1714 | 2984551711 | 2984551494 | Bacteria | 3877562 |
| 1715 | 2990050098 | 2990044586 | Bacteria | 6603797 |
| 1716 | 2990061429 | 2990059506 | Bacteria | 9321252 |
| 1717 | 2990092041 | 2990088156 | Bacteria | 6657676 |
| 1718 | 2995469292 | 2995463766 | Bacteria | 8577691 |
| 1719 | 2996227977 | 2996221748 | Bacteria | 6799777 |
| 1720 | 2997454832 | 2997451912 | Bacteria | 8492419 |
| 1721 | 2997605605 | 2997600082 | Bacteria | 9896405 |
| 1722 | 3001120351 | 3001119090 | Bacteria | 3449530 |
| 1723 | 3003002251 | 3002998708 | Bacteria | 11715108 |
| 1724 | 3006327930 | 3006321560 | Bacteria | 8247479 |
| 1725 | 3006399468 | 3006393351 | Bacteria | 6615579 |
| 1726 | 3006430613 | 3006425503 | Bacteria | 6491253 |
| 1727 | 3006491715 | 3006486233 | Bacteria | 8157040 |
| 1728 | 637880493 | 637000116 | Bacteria | 5433628 |
| 1729 | 649812648 | 649633069 | Bacteria | 6962533 |
| 1730 | 8003835703 | 8003830390 | Bacteria | 6541657 |
| 1731 | 8003858503 | 8003856774 | Bacteria | 7675274 |
| 1732 | 8004026160 | 8004025490 | Bacteria | 4327753 |
| 1733 | 8008486503 | 8008485437 | Bacteria | 7198341 |
| 1734 | 8008580681 | 8008574985 | Bacteria | 7815457 |
| 1735 | 8025481225 | 8025478263 | Bacteria | 8209203 |
| 1736 | 8025525572 | 8025524527 | Bacteria | 7197316 |
| 1737 | 8025531020 | 8025530807 | Bacteria | 8495698 |
| 1738 | 8033688272 | 8033684223 | Bacteria | 6906479 |
| 1739 | 8047894932 | 8047893842 | Bacteria | 11723082 |
| 1740 | 8048130482 | 8048127548 | Bacteria | 11053136 |
| 1741 | 8048364118 | 8048356638 | Bacteria | 11044339 |
| 1742 | 8048371950 | 8048369669 | Bacteria | 11666822 |
| 1743 | 8048380884 | 8048379754 | Bacteria | 11877923 |
| 1744 | 8053947878 | 8053945823 | Bacteria | 8962862 |
| 1745 | 8054110003 | 8054107350 | Bacteria | 5022511 |
| 1746 | 8054706813 | 8054704163 | Bacteria | 7247792 |
| 1747 | 8054730850 | 8054727385 | Bacteria | 7558670 |
| 1748 | 8054738895 | 8054734606 | Bacteria | 6947278 |
| 1749 | 8054914099 | 8054913762 | Bacteria | 7713009 |
| 1750 | 8054922895 | 8054920844 | Bacteria | 7068637 |
| 1751 | 8055068480 | 8055066027 | Bacteria | 9479577 |
| 1752 | 8055162372 | 8055157932 | Bacteria | 6429399 |
| 1753 | 8055181034 | 8055172936 | Bacteria | 9305943 |
| 1754 | 8055412800 | 8055412473 | Bacteria | 6257500 |
| 1755 | 8056066074 | 8056060235 | Bacteria | 7259403 |
| 1756 | 8056449305 | 8056447290 | Bacteria | 7680491 |
| 1757 | 8056670177 | 8056667051 | Bacteria | 6953971 |
| 1758 | 8056835631 | 8056829672 | Bacteria | 9045328 |
| 1759 | 8057568517 | 8057568493 | Bacteria | 7221719 |
| 1760 | Ga0496112_0044614 | |||
| 1761 | JGI24746J21847_1000536 | |||
| 1762 | JGI24737J22298_10021667 | |||
| 1763 | JGI24745J21846_1000370 | |||
| 1764 | JGI24749J21850_1007903 | |||
| 1765 | JGI24744J21845_10000965 | |||
| 1766 | JGI24034J26672_10008906 | |||
| 1767 | JGI24742J22300_10001394 | |||
| 1768 | JGI25164J39214_1000515 | |||
| 1769 | JGI25152J39213_1000980 | |||
| 1770 | JGI25151J46595_10031792 | |||
| 1771 | JGI25165J46597_1000044 | |||
| 1772 | Ga0055540_1000211 | |||
| 1773 | Ga0055540_1004259 | |||
| 1774 | Ga0055540_1006714 | |||
| 1775 | Ga0065714_10010605 | |||
| 1776 | Ga0065712_10022902 | |||
| 1777 | Ga0070658_10000155 | |||
| 1778 | Ga0070658_10002940 | |||
| 1779 | Ga0070658_10078060 | |||
| 1780 | Ga0070658_10112230 | |||
| 1781 | Ga0070658_10241926 | |||
| 1782 | Ga0070676_10113118 | |||
| 1783 | Ga0070683_100002759 | |||
| 1784 | Ga0070683_100008046 | |||
| 1785 | Ga0070683_100133817 | |||
| 1786 | Ga0070683_100140430 | |||
| 1787 | Ga0070690_100027643 | |||
| 1788 | Ga0070690_100074970 | |||
| 1789 | Ga0070670_100052841 | |||
| 1790 | Ga0068869_100011022 | |||
| 1791 | Ga0068869_100018593 | |||
| 1792 | Ga0068869_100030573 | |||
| 1793 | Ga0070666_10012208 | |||
| 1794 | Ga0070666_10073071 | |||
| 1795 | Ga0070680_100001962 | |||
| 1796 | Ga0070680_100021263 | |||
| 1797 | Ga0070680_100045036 | |||
| 1798 | Ga0070682_100003447 | |||
| 1799 | Ga0070682_100054024 | |||
| 1800 | Ga0070682_100165205 | |||
| 1801 | Ga0068868_100000794 | |||
| 1802 | Ga0068868_100013822 | |||
| 1803 | Ga0068868_100014864 | |||
| 1804 | Ga0068868_100178949 | |||
| 1805 | Ga0068868_100254829 | |||
| 1806 | Ga0070660_100011330 | |||
| 1807 | Ga0070660_100103520 | |||
| 1808 | Ga0070689_100053548 | |||
| 1809 | Ga0070691_10002291 | |||
| 1810 | Ga0070691_10006343 | |||
| 1811 | Ga0070661_100047797 | |||
| 1812 | Ga0070692_10003769 | |||
| 1813 | Ga0070692_10007565 | |||
| 1814 | Ga0070668_100000964 | |||
| 1815 | Ga0070668_100001978 | |||
| 1816 | Ga0070668_100014132 | |||
| 1817 | Ga0070668_100016742 | |||
| 1818 | Ga0070668_100017923 | |||
| 1819 | Ga0070668_100068032 | |||
| 1820 | Ga0070669_100027727 | |||
| 1821 | Ga0070669_100057955 | |||
| 1822 | Ga0070675_100000432 | |||
| 1823 | Ga0070675_100018048 | |||
| 1824 | Ga0070675_100024819 | |||
| 1825 | Ga0070675_100245660 | |||
| 1826 | Ga0070671_100000370 | |||
| 1827 | Ga0070671_100041360 | |||
| 1828 | Ga0070671_100087577 | |||
| 1829 | Ga0070674_100042205 | |||
| 1830 | Ga0070674_100090614 | |||
| 1831 | Ga0070674_100185527 | |||
| 1832 | Ga0070673_100031422 | |||
| 1833 | Ga0070688_100010888 | |||
| 1834 | Ga0070659_100006799 | |||
| 1835 | Ga0070659_100105731 | |||
| 1836 | Ga0070667_100000562 | |||
| 1837 | Ga0070667_100001312 | |||
| 1838 | Ga0070667_100006829 | |||
| 1839 | Ga0070667_100014813 | |||
| 1840 | Ga0070667_100092326 | |||
| 1841 | Ga0070709_10006919 | |||
| 1842 | Ga0070714_100000045 | |||
| 1843 | Ga0070714_100048774 | |||
| 1844 | Ga0070714_100064441 | |||
| 1845 | Ga0070714_100068199 | |||
| 1846 | Ga0070714_100120606 | |||
| 1847 | Ga0070714_100123813 | |||
| 1848 | Ga0070714_100289252 | |||
| 1849 | Ga0070713_100001944 | |||
| 1850 | Ga0070713_100007682 | |||
| 1851 | Ga0070713_100093894 | |||
| 1852 | Ga0070713_100105853 | |||
| 1853 | Ga0070713_100172511 | |||
| 1854 | Ga0070710_10001141 | |||
| 1855 | Ga0070710_10004138 | |||
| 1856 | Ga0070710_10010958 | |||
| 1857 | Ga0070710_10018959 | |||
| 1858 | Ga0070710_10115985 | |||
| 1859 | Ga0070701_10058009 | |||
| 1860 | Ga0070711_100001916 | |||
| 1861 | Ga0070711_100004625 | |||
| 1862 | Ga0070711_100081123 | |||
| 1863 | Ga0070705_100017002 | |||
| 1864 | Ga0070700_100000094 | |||
| 1865 | Ga0070700_100007945 | |||
| 1866 | Ga0070700_100008853 | |||
| 1867 | Ga0070700_100025985 | |||
| 1868 | Ga0070700_100035573 | |||
| 1869 | Ga0070708_100022408 | |||
| 1870 | Ga0070663_100009639 | |||
| 1871 | Ga0070663_100014886 | |||
| 1872 | Ga0070663_100035622 | |||
| 1873 | Ga0070663_100067628 | |||
| 1874 | Ga0070663_100201281 | |||
| 1875 | Ga0070678_100003103 | |||
| 1876 | Ga0070678_100011769 | |||
| 1877 | Ga0070678_100027420 | |||
| 1878 | Ga0070678_100050196 | |||
| 1879 | Ga0070678_100135038 | |||
| 1880 | Ga0070678_100144904 | |||
| 1881 | Ga0070678_100146363 | |||
| 1882 | Ga0070662_100002734 | |||
| 1883 | Ga0070662_100070790 | |||
| 1884 | Ga0070662_100092533 | |||
| 1885 | Ga0070681_10000504 | |||
| 1886 | Ga0070681_10009194 | |||
| 1887 | Ga0070681_10033991 | |||
| 1888 | Ga0070681_10100015 | |||
| 1889 | Ga0068867_100002956 | |||
| 1890 | Ga0070685_10006635 | |||
| 1891 | Ga0070685_10019605 | |||
| 1892 | Ga0070685_10022713 | |||
| 1893 | Ga0070706_100027267 | |||
| 1894 | Ga0070706_100032645 | |||
| 1895 | Ga0070707_100003790 | |||
| 1896 | Ga0070707_100039640 | |||
| 1897 | Ga0070707_100366908 | |||
| 1898 | Ga0070698_100006733 | |||
| 1899 | Ga0070698_100075451 | |||
| 1900 | Ga0070679_100000687 | |||
| 1901 | Ga0070679_100001838 | |||
| 1902 | Ga0070679_100005358 | |||
| 1903 | Ga0070679_100063294 | |||
| 1904 | Ga0070679_100088386 | |||
| 1905 | Ga0068853_100008631 | |||
| 1906 | Ga0068853_100026901 | |||
| 1907 | Ga0068853_100028554 | |||
| 1908 | Ga0068853_100047185 | |||
| 1909 | Ga0068853_100127831 | |||
| 1910 | Ga0068853_100233417 | |||
| 1911 | Ga0070672_100104720 | |||
| 1912 | Ga0070695_100023511 | |||
| 1913 | Ga0070696_100006572 | |||
| 1914 | Ga0070696_100088676 | |||
| 1915 | Ga0070693_100004975 | |||
| 1916 | Ga0070693_100005567 | |||
| 1917 | Ga0070693_100052400 | |||
| 1918 | Ga0070665_100001805 | |||
| 1919 | Ga0070665_100019654 | |||
| 1920 | Ga0070665_100054549 | |||
| 1921 | Ga0070665_100061354 | |||
| 1922 | Ga0070665_100063798 | |||
| 1923 | Ga0070665_100067128 | |||
| 1924 | Ga0070704_100005363 | |||
| 1925 | Ga0070704_100029852 | |||
| 1926 | Ga0070704_100076065 | |||
| 1927 | Ga0068855_100012387 | |||
| 1928 | Ga0068855_100027492 | |||
| 1929 | Ga0068855_100034580 | |||
| 1930 | Ga0068855_100039520 | |||
| 1931 | Ga0068855_100164286 | |||
| 1932 | Ga0070664_100001189 | |||
| 1933 | Ga0070664_100366178 | |||
| 1934 | Ga0068857_100012484 | |||
| 1935 | Ga0068857_100054554 | |||
| 1936 | Ga0068857_100186618 | |||
| 1937 | Ga0068854_100002196 | |||
| 1938 | Ga0068856_100031138 | |||
| 1939 | Ga0068856_100032411 | |||
| 1940 | Ga0068856_100050005 | |||
| 1941 | Ga0068856_100177027 | |||
| 1942 | Ga0068856_100188635 | |||
| 1943 | Ga0068856_100227229 | |||
| 1944 | Ga0070702_100000252 | |||
| 1945 | Ga0070702_100019881 | |||
| 1946 | Ga0070702_100038061 | |||
| 1947 | Ga0070702_100156110 | |||
| 1948 | Ga0068852_100018879 | |||
| 1949 | Ga0068852_100047617 | |||
| 1950 | Ga0068852_100191948 | |||
| 1951 | Ga0068859_100001857 | |||
| 1952 | Ga0068859_100019700 | |||
| 1953 | Ga0068859_100030262 | |||
| 1954 | Ga0068859_100038886 | |||
| 1955 | Ga0068859_100063907 | |||
| 1956 | Ga0068864_100055401 | |||
| 1957 | Ga0068864_100184358 | |||
| 1958 | Ga0068866_10002581 | |||
| 1959 | Ga0068866_10010288 | |||
| 1960 | Ga0068861_100009286 | |||
| 1961 | Ga0068861_100053137 | |||
| 1962 | Ga0068861_100082531 | |||
| 1963 | Ga0068861_100088673 | |||
| 1964 | Ga0068861_100106931 | |||
| 1965 | Ga0068851_10000124 | |||
| 1966 | Ga0068870_10001152 | |||
| 1967 | Ga0068863_100015607 | |||
| 1968 | Ga0068863_100034697 | |||
| 1969 | Ga0068863_100040994 | |||
| 1970 | Ga0068863_100048819 | |||
| 1971 | Ga0068863_100055479 | |||
| 1972 | Ga0068863_100077002 | |||
| 1973 | Ga0068863_100156177 | |||
| 1974 | Ga0068863_100390572 | |||
| 1975 | Ga0068858_100000032 | |||
| 1976 | Ga0068858_100000175 | |||
| 1977 | Ga0068858_100121712 | |||
| 1978 | Ga0068858_100121732 | |||
| 1979 | Ga0068860_100000085 | |||
| 1980 | Ga0068860_100000112 | |||
| 1981 | Ga0068860_100023080 | |||
| 1982 | Ga0068860_100056291 | |||
| 1983 | Ga0068862_100001577 | |||
| 1984 | Ga0068862_100102490 | |||
| 1985 | Ga0068862_100130004 | |||
| 1986 | Ga0068862_100283589 | |||
| 1987 | Ga0081455_10001891 | |||
| 1988 | Ga0081455_10005347 | |||
| 1989 | Ga0081455_10007359 | |||
| 1990 | Ga0081455_10090029 | |||
| 1991 | Ga0081455_10142666 | |||
| 1992 | Ga0081538_10001227 | |||
| 1993 | Ga0081538_10038909 | |||
| 1994 | Ga0081540_1003275 | |||
| 1995 | Ga0081540_1005254 | |||
| 1996 | Ga0081540_1010341 | |||
| 1997 | Ga0081539_10001305 | |||
| 1998 | Ga0081539_10001973 | |||
| 1999 | Ga0081539_10020787 | |||
| 2000 | Ga0070717_10055531 | |||
| 2001 | Ga0070717_10096763 | |||
| 2002 | Ga0070717_10274918 | |||
| 2003 | Ga0070717_10338763 | |||
| 2004 | Ga0075365_10002419 | |||
| 2005 | Ga0075365_10018831 | |||
| 2006 | Ga0075365_10035009 | |||
| 2007 | Ga0075365_10038497 | |||
| 2008 | Ga0075365_10043570 | |||
| 2009 | Ga0075365_10213262 | |||
| 2010 | Ga0075368_10054756 | |||
| 2011 | Ga0075363_100000882 | |||
| 2012 | Ga0075363_100002130 | |||
| 2013 | Ga0075363_100009173 | |||
| 2014 | Ga0075363_100014328 | |||
| 2015 | Ga0075363_100017745 | |||
| 2016 | Ga0075364_10003955 | |||
| 2017 | Ga0075364_10004377 | |||
| 2018 | Ga0075364_10007221 | |||
| 2019 | Ga0075364_10019257 | |||
| 2020 | Ga0075364_10020109 | |||
| 2021 | Ga0075364_10030027 | |||
| 2022 | Ga0075364_10091633 | |||
| 2023 | Ga0075432_10031113 | |||
| 2024 | Ga0070715_10001858 | |||
| 2025 | Ga0070715_10010123 | |||
| 2026 | Ga0070715_10037487 | |||
| 2027 | Ga0070716_100001032 | |||
| 2028 | Ga0070716_100007759 | |||
| 2029 | Ga0070716_100023759 | |||
| 2030 | Ga0070712_100021261 | |||
| 2031 | Ga0070712_100024582 | |||
| 2032 | Ga0070712_100132874 | |||
| 2033 | Ga0075367_10002786 | |||
| 2034 | Ga0075367_10040651 | |||
| 2035 | Ga0075367_10096811 | |||
| 2036 | Ga0075369_10001816 | |||
| 2037 | Ga0075369_10004962 | |||
| 2038 | Ga0075369_10032463 | |||
| 2039 | Ga0075369_10070535 | |||
| 2040 | Ga0075370_10018399 | |||
| 2041 | Ga0075370_10058776 | |||
| 2042 | Ga0068871_100292839 | |||
| 2043 | Ga0075428_100000416 | |||
| 2044 | Ga0075428_100000630 | |||
| 2045 | Ga0075428_100008931 | |||
| 2046 | Ga0075428_100016382 | |||
| 2047 | Ga0075428_100307936 | |||
| 2048 | Ga0075430_100000876 | |||
| 2049 | Ga0075430_100001812 | |||
| 2050 | Ga0075430_100004627 | |||
| 2051 | Ga0075430_100053863 | |||
| 2052 | Ga0075431_100001436 | |||
| 2053 | Ga0075431_100002862 | |||
| 2054 | Ga0075431_100143546 | |||
| 2055 | Ga0075433_10003068 | |||
| 2056 | Ga0075433_10046700 | |||
| 2057 | Ga0075433_10073782 | |||
| 2058 | Ga0075433_10189043 | |||
| 2059 | Ga0075434_100003178 | |||
| 2060 | Ga0075434_100311857 | |||
| 2061 | Ga0075429_100000244 | |||
| 2062 | Ga0075429_100006508 | |||
| 2063 | Ga0075429_100020851 | |||
| 2064 | Ga0068865_100000680 | |||
| 2065 | Ga0068865_100019322 | |||
| 2066 | Ga0075436_100010015 | |||
| 2067 | Ga0075436_100085986 | |||
| 2068 | Ga0075436_100095390 | |||
| 2069 | Ga0097620_100001857 | |||
| 2070 | Ga0097620_100019700 | |||
| 2071 | Ga0097620_100030263 | |||
| 2072 | Ga0097620_100038886 | |||
| 2073 | Ga0097620_100063914 | |||
| 2074 | Ga0075435_100004538 | |||
| 2075 | Ga0075435_100189592 | |||
| 2076 | Ga0105251_10015488 | |||
| 2077 | Ga0105251_10057996 | |||
| 2078 | Ga0105244_10004000 | |||
| 2079 | Ga0105240_10023577 | |||
| 2080 | Ga0105240_10033631 | |||
| 2081 | Ga0111539_10053176 | |||
| 2082 | Ga0111539_10452066 | |||
| 2083 | Ga0105245_10001865 | |||
| 2084 | Ga0105245_10030109 | |||
| 2085 | Ga0105245_10040683 | |||
| 2086 | Ga0105245_10042678 | |||
| 2087 | Ga0105245_10083844 | |||
| 2088 | Ga0105245_10225790 | |||
| 2089 | Ga0105245_10296646 | |||
| 2090 | Ga0105247_10000007 | |||
| 2091 | Ga0105247_10000164 | |||
| 2092 | Ga0105247_10001456 | |||
| 2093 | Ga0105247_10004913 | |||
| 2094 | Ga0105247_10013514 | |||
| 2095 | Ga0105247_10038821 | |||
| 2096 | Ga0114129_10000723 | |||
| 2097 | Ga0114129_10006158 | |||
| 2098 | Ga0114129_10009646 | |||
| 2099 | Ga0114129_10012498 | |||
| 2100 | Ga0114129_10018283 | |||
| 2101 | Ga0114129_10032957 | |||
| 2102 | Ga0114129_10074178 | |||
| 2103 | Ga0114129_10178042 | |||
| 2104 | Ga0105243_10002145 | |||
| 2105 | Ga0105243_10003603 | |||
| 2106 | Ga0105243_10019596 | |||
| 2107 | Ga0105243_10053995 | |||
| 2108 | Ga0105243_10083040 | |||
| 2109 | Ga0105241_10000211 | |||
| 2110 | Ga0105241_10004546 | |||
| 2111 | Ga0105241_10107752 | |||
| 2112 | Ga0105241_10117969 | |||
| 2113 | Ga0105242_10013158 | |||
| 2114 | Ga0105242_10057362 | |||
| 2115 | Ga0105248_10002480 | |||
| 2116 | Ga0105248_10003147 | |||
| 2117 | Ga0105248_10007605 | |||
| 2118 | Ga0105248_10013762 | |||
| 2119 | Ga0105248_10018635 | |||
| 2120 | Ga0105248_10025426 | |||
| 2121 | Ga0105248_10059757 | |||
| 2122 | Ga0105248_10070636 | |||
| 2123 | Ga0105248_10092277 | |||
| 2124 | Ga0105237_10002337 | |||
| 2125 | Ga0105237_10048489 | |||
| 2126 | Ga0105237_10175054 | |||
| 2127 | Ga0105237_10247190 | |||
| 2128 | Ga0105238_10029500 | |||
| 2129 | Ga0105238_10199854 | |||
| 2130 | Ga0105238_10318583 | |||
| 2131 | Ga0105249_10000001 | |||
| 2132 | Ga0105249_10001870 | |||
| 2133 | Ga0105249_10016303 | |||
| 2134 | Ga0105249_10028646 | |||
| 2135 | Ga0105249_10122582 | |||
| 2136 | Ga0105239_10037404 | |||
| 2137 | Ga0105239_10037820 | |||
| 2138 | Ga0105239_10213248 | |||
| 2139 | Ga0105239_10221394 | |||
| 2140 | Ga0105246_10016299 | |||
| 2141 | Ga0105246_10020035 | |||
| 2142 | Ga0157371_10063256 | |||
| 2143 | Ga0157370_10010594 | |||
| 2144 | Ga0157370_10024520 | |||
| 2145 | Ga0157370_10069579 | |||
| 2146 | Ga0157370_10297806 | |||
| 2147 | Ga0157369_10003546 | |||
| 2148 | Ga0157369_10003610 | |||
| 2149 | Ga0157369_10013234 | |||
| 2150 | Ga0157369_10015580 | |||
| 2151 | Ga0157369_10095834 | |||
| 2152 | Ga0157369_10101407 | |||
| 2153 | Ga0157369_10156750 | |||
| 2154 | Ga0157369_10179918 | |||
| 2155 | Ga0157369_10228215 | |||
| 2156 | Ga0157374_10022265 | |||
| 2157 | Ga0157374_10105285 | |||
| 2158 | Ga0157374_10161367 | |||
| 2159 | Ga0157374_10186409 | |||
| 2160 | Ga0157374_10191161 | |||
| 2161 | Ga0157378_10009029 | |||
| 2162 | Ga0157378_10035250 | |||
| 2163 | Ga0163162_10016133 | |||
| 2164 | Ga0163162_10020493 | |||
| 2165 | Ga0163162_10145440 | |||
| 2166 | Ga0157372_10002203 | |||
| 2167 | Ga0157372_10003317 | |||
| 2168 | Ga0157372_10305276 | |||
| 2169 | Ga0157372_10465758 | |||
| 2170 | Ga0157375_10011217 | |||
| 2171 | Ga0157375_10049534 | |||
| 2172 | Ga0157375_10109831 | |||
| 2173 | Ga0157375_10153028 | |||
| 2174 | Ga0163163_10009670 | |||
| 2175 | Ga0163163_10016347 | |||
| 2176 | Ga0163163_10109690 | |||
| 2177 | Ga0163163_10126143 | |||
| 2178 | Ga0163163_10137611 | |||
| 2179 | Ga0163163_10366663 | |||
| 2180 | Ga0157380_10030521 | |||
| 2181 | Ga0157380_10049854 | |||
| 2182 | Ga0157377_10026431 | |||
| 2183 | Ga0157377_10031449 | |||
| 2184 | Ga0157379_10000802 | |||
| 2185 | Ga0157379_10012652 | |||
| 2186 | Ga0157379_10021056 | |||
| 2187 | Ga0157379_10075892 | |||
| 2188 | Ga0157379_10199641 | |||
| 2189 | Ga0157379_10202568 | |||
| 2190 | Ga0157376_10056950 | |||
| 2191 | Ga0157376_10101412 | |||
| 2192 | Ga0157376_10179127 | |||
| 2193 | Ga0163161_10007436 | |||
| 2194 | Ga0163161_10010399 | |||
| 2195 | Ga0163161_10038113 | |||
| 2196 | Ga0206353_11145561 | |||
| 2197 | Ga0213873_10000096 | |||
| 2198 | Ga0213876_10008265 | |||
| 2199 | Ga0213876_10020805 | |||
| 2200 | Ga0213875_10000455 | |||
| 2201 | Ga0213875_10011610 | |||
| 2202 | Ga0213875_10035249 | |||
| 2203 | Ga0207427_100126 | |||
| 2204 | Ga0209437_100585 | |||
| 2205 | Ga0209148_1004143 | |||
| 2206 | Ga0209129_1000079 | |||
| 2207 | Ga0209233_1000014 | |||
| 2208 | Ga0209673_1006798 | |||
| 2209 | Ga0209025_1001940 | |||
| 2210 | Ga0209051_1000011 | |||
| 2211 | Ga0209051_1000795 | |||
| 2212 | Ga0209051_1002312 | |||
| 2213 | Ga0209051_1017900 | |||
| 2214 | Ga0207656_10000001 | |||
| 2215 | Ga0207656_10000003 | |||
| 2216 | Ga0207655_1005143 | |||
| 2217 | Ga0207655_1049401 | |||
| 2218 | Ga0207713_1012442 | |||
| 2219 | Ga0207682_10007444 | |||
| 2220 | Ga0207692_10001723 | |||
| 2221 | Ga0207692_10003209 | |||
| 2222 | Ga0207692_10007932 | |||
| 2223 | Ga0207642_10002272 | |||
| 2224 | Ga0207710_10000013 | |||
| 2225 | Ga0207710_10000082 | |||
| 2226 | Ga0207710_10000178 | |||
| 2227 | Ga0207710_10001332 | |||
| 2228 | Ga0207710_10018838 | |||
| 2229 | Ga0207710_10051974 | |||
| 2230 | Ga0207688_10001000 | |||
| 2231 | Ga0207688_10002930 | |||
| 2232 | Ga0207688_10003558 | |||
| 2233 | Ga0207680_10055045 | |||
| 2234 | Ga0207680_10065139 | |||
| 2235 | Ga0207647_10031084 | |||
| 2236 | Ga0207647_10067875 | |||
| 2237 | Ga0207685_10006158 | |||
| 2238 | Ga0207699_10003242 | |||
| 2239 | Ga0207699_10008552 | |||
| 2240 | Ga0207699_10044092 | |||
| 2241 | Ga0207645_10011165 | |||
| 2242 | Ga0207645_10067665 | |||
| 2243 | Ga0207643_10000642 | |||
| 2244 | Ga0207643_10053204 | |||
| 2245 | Ga0207705_10000595 | |||
| 2246 | Ga0207705_10015540 | |||
| 2247 | Ga0207705_10015936 | |||
| 2248 | Ga0207705_10036392 | |||
| 2249 | Ga0207705_10050987 | |||
| 2250 | Ga0207705_10242994 | |||
| 2251 | Ga0207684_10011027 | |||
| 2252 | Ga0207684_10085908 | |||
| 2253 | Ga0207684_10110326 | |||
| 2254 | Ga0207684_10299946 | |||
| 2255 | Ga0207654_10000003 | |||
| 2256 | Ga0207654_10021949 | |||
| 2257 | Ga0207654_10081089 | |||
| 2258 | Ga0207654_10107808 | |||
| 2259 | Ga0207707_10016166 | |||
| 2260 | Ga0207707_10021899 | |||
| 2261 | Ga0207707_10022717 | |||
| 2262 | Ga0207707_10026215 | |||
| 2263 | Ga0207695_10005261 | |||
| 2264 | Ga0207695_10009600 | |||
| 2265 | Ga0207695_10035988 | |||
| 2266 | Ga0207695_10113003 | |||
| 2267 | Ga0207671_10000001 | |||
| 2268 | Ga0207671_10047284 | |||
| 2269 | Ga0207693_10000420 | |||
| 2270 | Ga0207693_10002493 | |||
| 2271 | Ga0207693_10006587 | |||
| 2272 | Ga0207693_10011553 | |||
| 2273 | Ga0207693_10031552 | |||
| 2274 | Ga0207663_10005192 | |||
| 2275 | Ga0207663_10005313 | |||
| 2276 | Ga0207663_10013983 | |||
| 2277 | Ga0207663_10071693 | |||
| 2278 | Ga0207660_10009254 | |||
| 2279 | Ga0207660_10147980 | |||
| 2280 | Ga0207657_10018543 | |||
| 2281 | Ga0207657_10021331 | |||
| 2282 | Ga0207657_10038028 | |||
| 2283 | Ga0207649_10003700 | |||
| 2284 | Ga0207649_10030705 | |||
| 2285 | Ga0207649_10110283 | |||
| 2286 | Ga0207652_10001493 | |||
| 2287 | Ga0207652_10010256 | |||
| 2288 | Ga0207652_10011363 | |||
| 2289 | Ga0207652_10047865 | |||
| 2290 | Ga0207652_10126575 | |||
| 2291 | Ga0207652_10190258 | |||
| 2292 | Ga0207652_10203646 | |||
| 2293 | Ga0207646_10004909 | |||
| 2294 | Ga0207646_10224067 | |||
| 2295 | Ga0207681_10001110 | |||
| 2296 | Ga0207681_10032269 | |||
| 2297 | Ga0207694_10005422 | |||
| 2298 | Ga0207694_10055020 | |||
| 2299 | Ga0207694_10257031 | |||
| 2300 | Ga0207650_10032659 | |||
| 2301 | Ga0207659_10027257 | |||
| 2302 | Ga0207687_10001526 | |||
| 2303 | Ga0207687_10004349 | |||
| 2304 | Ga0207687_10011308 | |||
| 2305 | Ga0207687_10015347 | |||
| 2306 | Ga0207687_10024987 | |||
| 2307 | Ga0207687_10040902 | |||
| 2308 | Ga0207687_10070166 | |||
| 2309 | Ga0207687_10238274 | |||
| 2310 | Ga0207700_10004533 | |||
| 2311 | Ga0207700_10005586 | |||
| 2312 | Ga0207700_10056479 | |||
| 2313 | Ga0207700_10070499 | |||
| 2314 | Ga0207700_10209218 | |||
| 2315 | Ga0207700_10248327 | |||
| 2316 | Ga0207664_10000063 | |||
| 2317 | Ga0207664_10003992 | |||
| 2318 | Ga0207664_10006346 | |||
| 2319 | Ga0207664_10018596 | |||
| 2320 | Ga0207664_10054555 | |||
| 2321 | Ga0207644_10033273 | |||
| 2322 | Ga0207690_10018486 | |||
| 2323 | Ga0207690_10045554 | |||
| 2324 | Ga0207706_10002446 | |||
| 2325 | Ga0207706_10015108 | |||
| 2326 | Ga0207706_10051457 | |||
| 2327 | Ga0207706_10129662 | |||
| 2328 | Ga0207709_10010193 | |||
| 2329 | Ga0207709_10012673 | |||
| 2330 | Ga0207709_10032863 | |||
| 2331 | Ga0207709_10114899 | |||
| 2332 | Ga0207670_10034938 | |||
| 2333 | Ga0207670_10074152 | |||
| 2334 | Ga0207669_10000932 | |||
| 2335 | Ga0207669_10042240 | |||
| 2336 | Ga0207669_10242228 | |||
| 2337 | Ga0207704_10067588 | |||
| 2338 | Ga0207665_10001654 | |||
| 2339 | Ga0207665_10003273 | |||
| 2340 | Ga0207665_10004483 | |||
| 2341 | Ga0207665_10009362 | |||
| 2342 | Ga0207665_10013756 | |||
| 2343 | Ga0207691_10001332 | |||
| 2344 | Ga0207691_10227457 | |||
| 2345 | Ga0207711_10001465 | |||
| 2346 | Ga0207711_10001834 | |||
| 2347 | Ga0207711_10005962 | |||
| 2348 | Ga0207711_10129430 | |||
| 2349 | Ga0207711_10203309 | |||
| 2350 | Ga0207711_10253167 | |||
| 2351 | Ga0207689_10000187 | |||
| 2352 | Ga0207689_10002944 | |||
| 2353 | Ga0207689_10006655 | |||
| 2354 | Ga0207689_10015723 | |||
| 2355 | Ga0207689_10023181 | |||
| 2356 | Ga0207661_10001731 | |||
| 2357 | Ga0207661_10005113 | |||
| 2358 | Ga0207661_10056083 | |||
| 2359 | Ga0207661_10107587 | |||
| 2360 | Ga0207661_10123319 | |||
| 2361 | Ga0207679_10007877 | |||
| 2362 | Ga0207667_10005915 | |||
| 2363 | Ga0207667_10012713 | |||
| 2364 | Ga0207667_10027190 | |||
| 2365 | Ga0207667_10027909 | |||
| 2366 | Ga0207667_10038335 | |||
| 2367 | Ga0207667_10137161 | |||
| 2368 | Ga0207712_10000006 | |||
| 2369 | Ga0207712_10011671 | |||
| 2370 | Ga0207712_10233252 | |||
| 2371 | Ga0207668_10001742 | |||
| 2372 | Ga0207640_10004946 | |||
| 2373 | Ga0207640_10016616 | |||
| 2374 | Ga0207640_10042940 | |||
| 2375 | Ga0207658_10000970 | |||
| 2376 | Ga0207658_10009505 | |||
| 2377 | Ga0207658_10057863 | |||
| 2378 | Ga0207658_10176404 | |||
| 2379 | Ga0207677_10042913 | |||
| 2380 | Ga0207677_10048470 | |||
| 2381 | Ga0207677_10052078 | |||
| 2382 | Ga0207677_10067825 | |||
| 2383 | Ga0207677_10143290 | |||
| 2384 | Ga0207677_10225495 | |||
| 2385 | Ga0207703_10000015 | |||
| 2386 | Ga0207703_10000131 | |||
| 2387 | Ga0207703_10013056 | |||
| 2388 | Ga0207703_10021554 | |||
| 2389 | Ga0207703_10218624 | |||
| 2390 | Ga0207639_10005218 | |||
| 2391 | Ga0207639_10019729 | |||
| 2392 | Ga0207639_10130697 | |||
| 2393 | Ga0207678_10002354 | |||
| 2394 | Ga0207678_10011889 | |||
| 2395 | Ga0207678_10019054 | |||
| 2396 | Ga0207678_10032883 | |||
| 2397 | Ga0207678_10037802 | |||
| 2398 | Ga0207678_10075426 | |||
| 2399 | Ga0207708_10000123 | |||
| 2400 | Ga0207708_10008837 | |||
| 2401 | Ga0207708_10019476 | |||
| 2402 | Ga0207708_10084696 | |||
| 2403 | Ga0207702_10004958 | |||
| 2404 | Ga0207702_10019652 | |||
| 2405 | Ga0207702_10044872 | |||
| 2406 | Ga0207702_10118513 | |||
| 2407 | Ga0207702_10171037 | |||
| 2408 | Ga0207702_10174634 | |||
| 2409 | Ga0207641_10022729 | |||
| 2410 | Ga0207641_10031413 | |||
| 2411 | Ga0207641_10041605 | |||
| 2412 | Ga0207641_10126696 | |||
| 2413 | Ga0207648_10009571 | |||
| 2414 | Ga0207648_10023728 | |||
| 2415 | Ga0207648_10058974 | |||
| 2416 | Ga0207676_10001957 | |||
| 2417 | Ga0207674_10009940 | |||
| 2418 | Ga0207674_10020299 | |||
| 2419 | Ga0207674_10049467 | |||
| 2420 | Ga0207675_100004425 | |||
| 2421 | Ga0207675_100036517 | |||
| 2422 | Ga0207675_100086914 | |||
| 2423 | Ga0207675_100146475 | |||
| 2424 | Ga0207675_100192367 | |||
| 2425 | Ga0207675_100219272 | |||
| 2426 | Ga0207683_10003430 | |||
| 2427 | Ga0207683_10010756 | |||
| 2428 | Ga0207683_10024562 | |||
| 2429 | Ga0207683_10115208 | |||
| 2430 | Ga0207683_10125260 | |||
| 2431 | Ga0207683_10178115 | |||
| 2432 | Ga0207683_10305466 | |||
| 2433 | Ga0207698_10003180 | |||
| 2434 | Ga0207698_10023505 | |||
| 2435 | Ga0207698_10079070 | |||
| 2436 | Ga0207698_10080506 | |||
| 2437 | Ga0207698_10154594 | |||
| 2438 | Ga0207428_10068649 | |||
| 2439 | Ga0207428_10079774 | |||
| 2440 | Ga0207428_10099720 | |||
| 2441 | Ga0268266_10007851 | |||
| 2442 | Ga0268266_10024077 | |||
| 2443 | Ga0268266_10031295 | |||
| 2444 | Ga0268266_10064306 | |||
| 2445 | Ga0268266_10068211 | |||
| 2446 | Ga0268265_10000016 | |||
| 2447 | Ga0268265_10084439 | |||
| 2448 | Ga0268265_10273693 | |||
| 2449 | Ga0268264_10000026 | |||
| 2450 | Ga0268264_10000031 | |||
| 2451 | Ga0268264_10012141 | |||
| 2452 | Ga0268264_10052844 | |||
| 2453 | Ga0268264_10145580 | |||
| 2454 | Ga0265334_10000839 | |||
| 2455 | Ga0307515_10014277 | |||
| 2456 | Ga0307515_10021795 | |||
| 2457 | Ga0307515_10022335 | |||
| 2458 | Ga0307511_10106788 | |||
| 2459 | Ga0307512_10005170 | |||
| 2460 | Ga0307512_10009276 | |||
| 2461 | Ga0307512_10020281 | |||
| 2462 | Ga0307512_10047890 | |||
| 2463 | Ga0265340_10035175 | |||
| 2464 | Ga0265340_10040806 | |||
| 2465 | Ga0265327_10000041 | |||
| 2466 | Ga0265327_10001529 | |||
| 2467 | Ga0265327_10008570 | |||
| 2468 | Ga0265327_10029384 | |||
| 2469 | Ga0307513_10000001 | |||
| 2470 | Ga0307513_10015478 | |||
| 2471 | Ga0307513_10022497 | |||
| 2472 | Ga0307408_100019307 | |||
| 2473 | Ga0307408_100022759 | |||
| 2474 | Ga0307408_100035646 | |||
| 2475 | Ga0307408_100064742 | |||
| 2476 | Ga0307408_100325912 | |||
| 2477 | Ga0265313_10035630 | |||
| 2478 | Ga0265313_10040218 | |||
| 2479 | Ga0307508_10001163 | |||
| 2480 | Ga0307508_10007864 | |||
| 2481 | Ga0307508_10024539 | |||
| 2482 | Ga0307508_10074409 | |||
| 2483 | Ga0307514_10040454 | |||
| 2484 | Ga0307514_10082332 | |||
| 2485 | Ga0316575_10063963 | |||
| 2486 | Ga0265314_10057721 | |||
| 2487 | Ga0265342_10041432 | |||
| 2488 | Ga0265342_10118549 | |||
| 2489 | Ga0316576_10000511 | |||
| 2490 | Ga0316576_10017182 | |||
| 2491 | Ga0316576_10017551 | |||
| 2492 | Ga0316576_10048395 | |||
| 2493 | Ga0316576_10140041 | |||
| 2494 | Ga0316578_10036615 | |||
| 2495 | Ga0316578_10081290 | |||
| 2496 | Ga0316578_10105522 | |||
| 2497 | Ga0307516_10003100 | |||
| 2498 | Ga0316577_10056287 | |||
| 2499 | Ga0307413_10042245 | |||
| 2500 | Ga0307518_10048571 | |||
| 2501 | Ga0307410_10024068 | |||
| 2502 | Ga0307410_10024166 | |||
| 2503 | Ga0307410_10057129 | |||
| 2504 | Ga0307410_10068104 | |||
| 2505 | Ga0307410_10109058 | |||
| 2506 | Ga0307410_10155605 | |||
| 2507 | Ga0307406_10068534 | |||
| 2508 | Ga0307406_10083514 | |||
| 2509 | Ga0307406_10093638 | |||
| 2510 | Ga0307406_10093771 | |||
| 2511 | Ga0307407_10080026 | |||
| 2512 | Ga0307407_10173283 | |||
| 2513 | Ga0307412_10029765 | |||
| 2514 | Ga0307409_100008616 | |||
| 2515 | Ga0307409_100021231 | |||
| 2516 | Ga0307409_100058000 | |||
| 2517 | Ga0307409_100107967 | |||
| 2518 | Ga0307409_100276950 | |||
| 2519 | Ga0307409_100385132 | |||
| 2520 | Ga0307416_100015187 | |||
| 2521 | Ga0307416_100039444 | |||
| 2522 | Ga0307416_100133681 | |||
| 2523 | Ga0307416_100232592 | |||
| 2524 | Ga0307416_100240066 | |||
| 2525 | Ga0307416_100270491 | |||
| 2526 | Ga0307416_100424511 | |||
| 2527 | Ga0307414_10107423 | |||
| 2528 | Ga0307414_10268980 | |||
| 2529 | Ga0307411_10001113 | |||
| 2530 | Ga0307411_10248123 | |||
| 2531 | Ga0307415_100005815 | |||
| 2532 | Ga0307415_100023748 | |||
| 2533 | Ga0307415_100032681 | |||
| 2534 | Ga0307415_100037663 | |||
| 2535 | Ga0307415_100052500 | |||
| 2536 | Ga0307415_100114408 | |||
| 2537 | Ga0307415_100315876 | |||
| 2538 | Ga0316583_10010209 | |||
| 2539 | Ga0316580_10016328 | |||
| 2540 | Ga0307510_10008263 | |||
| 2541 | Ga0373930_0002591 | |||
| 2542 | Ga0373948_0001069 | |||
| 2543 | Ga0373934_0000014 | |||
| 2544 | Ga0373934_0019070 | |||
| 2545 | Ga0373949_0013828 | |||
| 2546 | Ga0373951_0000127 | |||
| 2547 | Ga0373951_0004369 | |||
| 2548 | Ga0373951_0019293 | |||
| 2549 | Ga0373932_0003524 | |||
| 2550 | Ga0373953_0001755 | |||
| 2551 | Ga0373953_0046502 | |||
| 2552 | Ga0373954_0001669 | |||
| 2553 | Ga0373954_0034701 | |||
| 2554 | Ga0373956_0001414 | |||
| 2555 | Ga0373956_0007651 | |||
| 2556 | Ga0373957_0000846 | |||
| 2557 | Ga0373957_0001048 | |||
| 2558 | Ga0373943_0015990 | |||
| 2559 | Ga0373946_0040136 | |||
| 2560 | Ga0373955_0000040 | |||
| 2561 | Ga0373955_0003554 | |||
| 2562 | Ga0373961_0019195 | |||
| 2563 | Ga0316574_0006815 | |||
| 2564 | Ga0316574_0031353 | |||
| 2565 | Ga0316574_0040647 | |||
| 2566 | Ga0316574_0140967 | |||
| 2567 | Ga0373924_0001593 | |||
| 2568 | Ga0373924_0038344 | |||
| 2569 | Ga0373931_0019275 | |||
| 2570 | Ga0373935_0013523 | |||
| 2571 | Ga0373933_0000085 | |||
| 2572 | Ga0373937_0000197 | |||
| 2573 | Ga0373937_0121631 | |||
| 2574 | Ga0373937_0123043 | |||
| 2575 | Ga0316584_0011739 | |||
| 2576 | Ga0316584_0033039 | |||
| 2577 | Ga0316584_0052838 | |||
| 2578 | Ga0316584_0075219 | |||
| 2579 | Ga0316584_0090142 | |||
| 2580 | Ga0395899_0002958 | |||
| 2581 | Ga0395899_0004671 | |||
| 2582 | Ga0395899_0035839 | |||
| 2583 | Ga0395899_0046758 | |||
| 2584 | Ga0395899_0049908 | |||
| 2585 | Ga0395899_0114071 | |||
| 2586 | Ga0395900_0005127 | |||
| 2587 | Ga0395900_0006397 | |||
| 2588 | Ga0395900_0010840 | |||
| 2589 | Ga0395900_0019678 | |||
| 2590 | Ga0395900_0025509 | |||
| 2591 | Ga0395900_0079080 | |||
| 2592 | Ga0395900_0102449 | |||
| 2593 | Ga0395900_0197109 | |||
| 2594 | Ga0395898_0006003 | |||
| 2595 | Ga0395898_0006892 | |||
| 2596 | Ga0395898_0013311 | |||
| 2597 | Ga0395898_0017536 | |||
| 2598 | Ga0395898_0029723 | |||
| 2599 | Ga0395898_0057223 | |||
| 2600 | Ga0395898_0077820 | |||
| 2601 | Ga0395898_0083918 | |||
| 2602 | Ga0395898_0112966 | |||
| 2603 | Ga0395898_0115035 | |||
| 2604 | Ga0395898_0324087 | |||
| 2605 | Ga0395898_0348124 | |||
| 2606 | Ga0395905_0001026 | |||
| 2607 | Ga0395905_0009643 | |||
| 2608 | Ga0395905_0303095 | |||
| 2609 | Ga0395905_0405009 | |||
| 2610 | Ga0436364_0113323 | |||
| 2611 | Ga0436364_0238472 | |||
| 2612 | Ga0436364_0418931 | |||
| 2613 | Ga0436364_0453470 | |||
| 2614 | Ga0436364_0647082 | |||
| 2615 | Ga0436364_1255815 | |||
| 2616 | Ga0436364_1390545 | |||
| 2617 | Ga0395901_0003412 | |||
| 2618 | Ga0395901_0021006 | |||
| 2619 | Ga0395901_0032994 | |||
| 2620 | Ga0395901_0054233 | |||
| 2621 | Ga0395901_0113011 | |||
| 2622 | Ga0395901_0161745 | |||
| 2623 | Ga0395901_0209072 | |||
| 2624 | Ga0436365_0613236 | |||
| 2625 | Ga0436365_0885952 | |||
| 2626 | Ga0436365_1214067 | |||
| 2627 | Ga0436363_0076260 | |||
| 2628 | Ga0436363_0265210 | |||
| 2629 | Ga0436363_0330623 | |||
| 2630 | Ga0436362_0604249 | |||
| 2631 | Ga0439439_0003804 | |||
| 2632 | Ga0439447_010755 | |||
| 2633 | Ga0439466_0020498 | |||
| 2634 | Ga0439466_0030633 | |||
| 2635 | Ga0439465_0008353 | |||
| 2636 | Ga0439465_0010651 | |||
| 2637 | Ga0439465_0011796 | |||
| 2638 | Ga0439465_0031545 | |||
| 2639 | Ga0451802_0335608 | |||
| 2640 | Ga0451802_1677789 | |||
| 2641 | Ga0451853_0988203 | |||
| 2642 | Ga0451853_2451760 | |||
| 2643 | Ga0439431_0000706 | |||
| 2644 | Ga0439433_0000016 | |||
| 2645 | Ga0439433_0005084 | |||
| 2646 | Ga0439442_000124 | |||
| 2647 | Ga0439442_000483 | |||
| 2648 | Ga0439442_006494 | |||
| 2649 | Ga0439442_007840 | |||
| 2650 | Ga0439442_012154 | |||
| 2651 | Ga0439432_027337 | |||
| 2652 | Ga0439449_0000123 | |||
| 2653 | Ga0439449_0044932 | |||
| 2654 | Ga0439452_008147 | |||
| 2655 | Ga0439452_027059 | |||
| 2656 | Ga0439463_026533 | |||
| 2657 | Ga0450920_001002 | |||
| 2658 | Ga0450920_008485 | |||
| 2659 | Ga0450907_000606 | |||
| 2660 | Ga0439434_0000220 | |||
| 2661 | Ga0439434_0018559 | |||
| 2662 | Ga0466969_0031467 | |||
| 2663 | Ga0466972_0017406 | |||
| 2664 | Ga0466972_0102840 | |||
| 2665 | Ga0466965_0008270 | |||
| 2666 | Ga0466965_0010455 | |||
| 2667 | Ga0466965_0014794 | |||
| 2668 | Ga0466965_0027934 | |||
| 2669 | Ga0466966_0003105 | |||
| 2670 | Ga0466966_0006470 | |||
| 2671 | Ga0466966_0012176 | |||
| 2672 | Ga0466966_0030188 | |||
| 2673 | Ga0466966_0074689 | |||
| 2674 | Ga0466966_0076601 | |||
| 2675 | Ga0466966_0078802 | |||
| 2676 | Ga0466966_0143115 | |||
| 2677 | Ga0466961_0000223 | |||
| 2678 | Ga0466961_0005237 | |||
| 2679 | Ga0466961_0014413 | |||
| 2680 | Ga0466961_0016492 | |||
| 2681 | Ga0466961_0019719 | |||
| 2682 | Ga0466961_0035925 | |||
| 2683 | Ga0466961_0049608 | |||
| 2684 | Ga0466961_0050180 | |||
| 2685 | Ga0466961_0052631 | |||
| 2686 | Ga0466961_0103753 | |||
| 2687 | Ga0466961_0107930 | |||
| 2688 | Ga0466961_0162785 | |||
| 2689 | Ga0466963_0000604 | |||
| 2690 | Ga0466963_0002782 | |||
| 2691 | Ga0466963_0104315 | |||
| 2692 | Ga0466964_0068658 | |||
| 2693 | Ga0466971_0000354 | |||
| 2694 | Ga0466971_0019022 | |||
| 2695 | Ga0466971_0023917 | |||
| 2696 | Ga0466971_0083518 | |||
| 2697 | Ga0466968_0001034 | |||
| 2698 | Ga0466968_0014236 | |||
| 2699 | Ga0466968_0046781 | |||
| 2700 | Ga0466970_0001205 | |||
| 2701 | Ga0466970_0007113 | |||
| 2702 | Ga0466970_0007660 | |||
| 2703 | Ga0466970_0026731 | |||
| 2704 | Ga0466970_0034538 | |||
| 2705 | Ga0466970_0050609 | |||
| 2706 | Ga0466957_0000283 | |||
| 2707 | Ga0466957_0004553 | |||
| 2708 | Ga0466957_0010194 | |||
| 2709 | Ga0466957_0012679 | |||
| 2710 | Ga0466957_0024790 | |||
| 2711 | Ga0466957_0043592 | |||
| 2712 | Ga0466957_0066258 | |||
| 2713 | Ga0466960_0002656 | |||
| 2714 | Ga0466960_0004820 | |||
| 2715 | Ga0466960_0005643 | |||
| 2716 | Ga0466960_0019496 | |||
| 2717 | Ga0466960_0025646 | |||
| 2718 | Ga0466960_0150487 | |||
| 2719 | Ga0466959_0009115 | |||
| 2720 | Ga0466959_0013261 | |||
| 2721 | Ga0466959_0014077 | |||
| 2722 | Ga0466959_0017810 | |||
| 2723 | Ga0466959_0022208 | |||
| 2724 | Ga0466959_0032930 | |||
| 2725 | Ga0466959_0040799 | |||
| 2726 | Ga0466959_0045121 | |||
| 2727 | Ga0466958_0000114 | |||
| 2728 | Ga0466958_0000748 | |||
| 2729 | Ga0466958_0005582 | |||
| 2730 | Ga0466958_0007421 | |||
| 2731 | Ga0466958_0020417 | |||
| 2732 | Ga0466958_0032227 | |||
| 2733 | Ga0466958_0035027 | |||
| 2734 | Ga0466958_0075985 | |||
| 2735 | Ga0466958_0098160 | |||
| 2736 | Ga0466967_0001120 | |||
| 2737 | Ga0466967_0006791 | |||
| 2738 | Ga0466967_0019688 | |||
| 2739 | Ga0466967_0024332 | |||
| 2740 | Ga0466967_0025471 | |||
| 2741 | Ga0466967_0027636 | |||
| 2742 | Ga0466967_0031995 | |||
| 2743 | Ga0466967_0075584 | |||
| 2744 | Ga0466967_0119314 | |||
| 2745 | Ga0466967_0364757 | |||
| 2746 | Ga0495627_039472 | |||
| 2747 | Ga0495627_046758 | |||
| 2748 | Ga0495592_0000157 | |||
| 2749 | Ga0495592_0064496 | |||
| 2750 | Ga0495603_0000552 | |||
| 2751 | Ga0495603_0013090 | |||
| 2752 | Ga0495603_0054857 | |||
| 2753 | Ga0495590_0000484 | |||
| 2754 | Ga0495629_0001111 | |||
| 2755 | Ga0495629_0001228 | |||
| 2756 | Ga0495629_0006771 | |||
| 2757 | Ga0495629_0014332 | |||
| 2758 | Ga0495638_0001596 | |||
| 2759 | Ga0495638_0040952 | |||
| 2760 | Ga0495638_0059658 | |||
| 2761 | Ga0495641_0008500 | |||
| 2762 | Ga0495641_0051617 | |||
| 2763 | Ga0495651_0000115 | |||
| 2764 | Ga0495651_0006516 | |||
| 2765 | Ga0495651_0035816 | |||
| 2766 | Ga0495653_0011549 | |||
| 2767 | Ga0495653_0068042 | |||
| 2768 | Ga0495580_0003950 | |||
| 2769 | Ga0495582_0005171 | |||
| 2770 | Ga0495605_0004092 | |||
| 2771 | Ga0495639_0002427 | |||
| 2772 | Ga0495639_0016313 | |||
| 2773 | Ga0495639_0029477 | |||
| 2774 | Ga0495664_0001861 | |||
| 2775 | Ga0495664_0030935 | |||
| 2776 | Ga0495585_0024459 | |||
| 2777 | Ga0495594_0000581 | |||
| 2778 | Ga0495607_0035772 | |||
| 2779 | Ga0495583_0039585 | |||
| 2780 | Ga0495608_0003716 | |||
| 2781 | Ga0495616_0007512 | |||
| 2782 | Ga0495618_0076007 | |||
| 2783 | Ga0495628_0000492 | |||
| 2784 | Ga0495628_0030926 | |||
| 2785 | Ga0495630_0219288 | |||
| 2786 | Ga0495631_0028018 | |||
| 2787 | Ga0495632_0023354 | |||
| 2788 | Ga0495632_0105050 | |||
| 2789 | Ga0495637_0034811 | |||
| 2790 | Ga0495643_0003144 | |||
| 2791 | Ga0495643_0060299 | |||
| 2792 | Ga0495648_0018440 | |||
| 2793 | Ga0495648_0057527 | |||
| 2794 | Ga0495666_0019999 | |||
| 2795 | Ga0495666_0043441 | |||
| 2796 | Ga0495652_0007274 | |||
| 2797 | Ga0495652_0022385 | |||
| 2798 | Ga0495652_0060817 | |||
| 2799 | Ga0495652_0073275 | |||
| 2800 | Ga0495665_0030387 | |||
| 2801 | Ga0495640_0026843 | |||
| 2802 | Ga0495586_0002370 | |||
| 2803 | Ga0495586_0015897 | |||
| 2804 | Ga0495586_0092857 | |||
| 2805 | Ga0495587_0000123 | |||
| 2806 | Ga0495587_0002547 | |||
| 2807 | Ga0495609_0011345 | |||
| 2808 | Ga0495645_0001555 | |||
| 2809 | Ga0495645_0019225 | |||
| 2810 | Ga0495645_0027772 | |||
| 2811 | Ga0495645_0034357 | |||
| 2812 | Ga0495645_0155719 | |||
| 2813 | Ga0495622_0008572 | |||
| 2814 | Ga0495622_0019863 | |||
| 2815 | Ga0495622_0058800 | |||
| 2816 | Ga0495633_0006910 | |||
| 2817 | Ga0495667_0000107 | |||
| 2818 | Ga0495667_0001041 | |||
| 2819 | Ga0495667_0007253 | |||
| 2820 | Ga0495668_0002662 | |||
| 2821 | Ga0495634_0020569 | |||
| 2822 | Ga0495611_0016203 | |||
| 2823 | Ga0495635_0028622 | |||
| 2824 | Ga0495588_0040447 | |||
| 2825 | Ga0495657_0000169 | |||
| 2826 | Ga0495657_0011577 | |||
| 2827 | Ga0495657_0029164 | |||
| 2828 | Ga0495657_0036625 | |||
| 2829 | Ga0495599_0002521 | |||
| 2830 | Ga0495599_0037427 | |||
| 2831 | Ga0495599_0042368 | |||
| 2832 | Ga0495623_0000166 | |||
| 2833 | Ga0495623_0033496 | |||
| 2834 | Ga0495623_0050024 | |||
| 2835 | Ga0495646_0059942 | |||
| 2836 | Ga0495646_0111000 | |||
| 2837 | Ga0495658_0116082 | |||
| 2838 | Ga0495658_0154287 | |||
| 2839 | Ga0495613_0009856 | |||
| 2840 | Ga0495613_0015671 | |||
| 2841 | Ga0495613_0027353 | |||
| 2842 | Ga0495613_0032534 | |||
| 2843 | Ga0495624_0058068 | |||
| 2844 | Ga0495624_0169833 | |||
| 2845 | Ga0495589_0032868 | |||
| 2846 | Ga0495600_0005572 | |||
| 2847 | Ga0495600_0009464 | |||
| 2848 | Ga0495600_0017124 | |||
| 2849 | Ga0495581_0009107 | |||
| 2850 | Ga0495581_0027592 | |||
| 2851 | Ga0495581_0043604 | |||
| 2852 | Ga0495604_0000161 | |||
| 2853 | Ga0495604_0003057 | |||
| 2854 | Ga0495604_0027138 | |||
| 2855 | Ga0495604_0038371 | |||
| 2856 | Ga0495604_0052981 | |||
| 2857 | Ga0495636_0026434 | |||
| 2858 | Ga0495674_0012623 | |||
| 2859 | Ga0495674_0018404 | |||
| 2860 | Ga0495674_0101431 | |||
| 2861 | Ga0495672_0003416 | |||
| 2862 | Ga0495672_0041435 | |||
| 2863 | Ga0495672_0041850 | |||
| 2864 | Ga0495676_0000233 | |||
| 2865 | Ga0495676_0005210 | |||
| 2866 | Ga0495676_0017972 | |||
| 2867 | Ga0495676_0200323 | |||
| 2868 | Ga0495680_0007013 | |||
| 2869 | Ga0495680_0023511 | |||
| 2870 | Ga0495680_0030600 | |||
| 2871 | Ga0495683_0002632 | |||
| 2872 | Ga0495683_0041213 | |||
| 2873 | Ga0495687_000581 | |||
| 2874 | Ga0495687_030957 | |||
| 2875 | Ga0495675_0002978 | |||
| 2876 | Ga0495675_0011761 | |||
| 2877 | Ga0495675_0015106 | |||
| 2878 | Ga0495675_0022673 | |||
| 2879 | Ga0495677_0036674 | |||
| 2880 | Ga0495685_012532 | |||
| 2881 | Ga0495684_0050867 | |||
| 2882 | Ga0495684_0122680 | |||
| 2883 | Ga0495686_0092934 | |||
| 2884 | Ga0495593_0017119 | |||
| 2885 | Ga0495593_0047132 | |||
| 2886 | Ga0495602_0000182 | |||
| 2887 | Ga0495602_0075152 | |||
| 2888 | Ga0495614_0006858 | |||
| 2889 | Ga0496100_0000335 | |||
| 2890 | Ga0496100_0003473 | |||
| 2891 | Ga0496100_0018499 | |||
| 2892 | Ga0496100_0067268 | |||
| 2893 | Ga0496100_0125109 | |||
| 2894 | Ga0496101_0000193 | |||
| 2895 | Ga0496101_0001504 | |||
| 2896 | Ga0496101_0001767 | |||
| 2897 | Ga0496101_0015785 | |||
| 2898 | Ga0496101_0031811 | |||
| 2899 | Ga0496101_0038237 | |||
| 2900 | Ga0496101_0056663 | |||
| 2901 | Ga0496101_0215633 | |||
| 2902 | Ga0496102_0000403 | |||
| 2903 | Ga0496102_0000750 | |||
| 2904 | Ga0496102_0021913 | |||
| 2905 | Ga0496102_0031975 | |||
| 2906 | Ga0496102_0032948 | |||
| 2907 | Ga0496102_0139973 | |||
| 2908 | Ga0496102_0147261 | |||
| 2909 | Ga0496102_0198432 | |||
| 2910 | Ga0496102_0202009 | |||
| 2911 | Ga0496102_0284190 | |||
| 2912 | Ga0496103_0000284 | |||
| 2913 | Ga0496103_0001055 | |||
| 2914 | Ga0496103_0002082 | |||
| 2915 | Ga0496103_0042265 | |||
| 2916 | Ga0496104_0012811 | |||
| 2917 | Ga0496104_0025727 | |||
| 2918 | Ga0496104_0039321 | |||
| 2919 | Ga0496104_0059938 | |||
| 2920 | Ga0496104_0093139 | |||
| 2921 | Ga0496105_0002855 | |||
| 2922 | Ga0496105_0021733 | |||
| 2923 | Ga0496105_0036004 | |||
| 2924 | Ga0496105_0050189 | |||
| 2925 | Ga0496105_0062054 | |||
| 2926 | Ga0496105_0069758 | |||
| 2927 | Ga0496105_0187822 | |||
| 2928 | Ga0496106_0000199 | |||
| 2929 | Ga0496106_0005688 | |||
| 2930 | Ga0496106_0008646 | |||
| 2931 | Ga0496106_0014818 | |||
| 2932 | Ga0496106_0017751 | |||
| 2933 | Ga0496106_0058154 | |||
| 2934 | Ga0496106_0163455 | |||
| 2935 | Ga0496107_0001353 | |||
| 2936 | Ga0496107_0003743 | |||
| 2937 | Ga0496107_0013481 | |||
| 2938 | Ga0496107_0014415 | |||
| 2939 | Ga0496107_0067460 | |||
| 2940 | Ga0496107_0202652 | |||
| 2941 | Ga0496108_0000966 | |||
| 2942 | Ga0496108_0006263 | |||
| 2943 | Ga0496108_0012159 | |||
| 2944 | Ga0496108_0022651 | |||
| 2945 | Ga0496108_0045925 | |||
| 2946 | Ga0496108_0051511 | |||
| 2947 | Ga0496108_0060482 | |||
| 2948 | Ga0496108_0125407 | |||
| 2949 | Ga0496109_0001398 | |||
| 2950 | Ga0496109_0008976 | |||
| 2951 | Ga0496109_0013820 | |||
| 2952 | Ga0496109_0038853 | |||
| 2953 | Ga0496109_0053536 | |||
| 2954 | Ga0496109_0066894 | |||
| 2955 | Ga0496109_0078672 | |||
| 2956 | Ga0496109_0114351 | |||
| 2957 | Ga0496109_0171944 | |||
| 2958 | Ga0496109_0257216 | |||
| 2959 | Ga0496110_0003627 | |||
| 2960 | Ga0496110_0010603 | |||
| 2961 | Ga0496110_0020318 | |||
| 2962 | Ga0496110_0028522 | |||
| 2963 | Ga0496110_0032924 | |||
| 2964 | Ga0496110_0056148 | |||
| 2965 | Ga0496110_0071762 | |||
| 2966 | Ga0496110_0080305 | |||
| 2967 | Ga0496111_0045908 | |||
| 2968 | Ga0496111_0057655 | |||
| 2969 | Ga0496111_0095915 | |||
| 2970 | Ga0496111_0218902 | |||
| 2971 | Ga0496111_0256606 | |||
| 2972 | Ga0496112_0002892 | |||
| 2973 | Ga0496112_0017061 | |||
| 2974 | Ga0496112_0018635 | |||
| 2975 | Ga0496112_0066522 | |||
| 2976 | Ga0496112_0181212 | |||
| 2977 | Ga0496112_0197097 | |||
| 2978 | Ga0496113_0006724 | |||
| 2979 | Ga0496113_0007107 | |||
| 2980 | Ga0496113_0122804 | |||
| 2981 | Ga0496113_0297112 | |||
| 2982 | Ga0496114_0000559 | |||
| 2983 | Ga0496114_0001803 | |||
| 2984 | Ga0496114_0008348 | |||
| 2985 | Ga0496114_0015343 | |||
| 2986 | Ga0496114_0017869 | |||
| 2987 | Ga0496115_0003426 | |||
| 2988 | Ga0496115_0010823 | |||
| 2989 | Ga0496115_0019920 | |||
| 2990 | Ga0496115_0020283 | |||
| 2991 | Ga0496115_0059407 | |||
| 2992 | Ga0496115_0101116 | |||
| 2993 | Ga0496115_0124763 | |||
| 2994 | Ga0496115_0151615 | |||
| 2995 | Ga0496116_0000059 | |||
| 2996 | Ga0496116_0031324 | |||
| 2997 | Ga0496117_0000055 | |||
| 2998 | Ga0496117_0002301 | |||
| 2999 | Ga0496117_0003028 | |||
| 3000 | Ga0496117_0029473 | |||
| 3001 | Ga0496117_0034361 | |||
| 3002 | Ga0496117_0057954 | |||
| 3003 | Ga0496118_0000398 | |||
| 3004 | Ga0496118_0000879 | |||
| 3005 | Ga0496118_0002102 | |||
| 3006 | Ga0496118_0009080 | |||
| 3007 | Ga0496118_0045956 | |||
| 3008 | Ga0496118_0072819 | |||
| 3009 | Ga0496118_0099499 | |||
| 3010 | Ga0496119_0000375 | |||
| 3011 | Ga0496119_0010507 | |||
| 3012 | Ga0496119_0016974 | |||
| 3013 | Ga0496119_0018886 | |||
| 3014 | Ga0496120_0000453 | |||
| 3015 | Ga0496120_0004273 | |||
| 3016 | Ga0496120_0011458 | |||
| 3017 | Ga0496120_0016566 | |||
| 3018 | Ga0496120_0016881 | |||
| 3019 | Ga0496120_0089304 | |||
| 3020 | Ga0496121_0000433 | |||
| 3021 | Ga0496121_0001114 | |||
| 3022 | Ga0496121_0011354 | |||
| 3023 | Ga0496121_0043764 | |||
| 3024 | Ga0496122_0001536 | |||
| 3025 | Ga0496122_0008484 | |||
| 3026 | Ga0496122_0009000 | |||
| 3027 | Ga0496122_0099743 | |||
| 3028 | Ga0496123_0001055 | |||
| 3029 | Ga0496123_0054573 | |||
| 3030 | Ga0496123_0088077 | |||
| 3031 | Ga0496124_0000015 | |||
| 3032 | Ga0496124_0000198 | |||
| 3033 | Ga0496124_0007726 | |||
| 3034 | Ga0496124_0007779 | |||
| 3035 | Ga0496125_0000021 | |||
| 3036 | Ga0496125_0000172 | |||
| 3037 | Ga0496125_0003069 | |||
| 3038 | Ga0496125_0020233 | |||
| 3039 | Ga0496125_0051644 | |||
| 3040 | Ga0496125_0210415 | |||
| 3041 | Ga0496126_0000015 | |||
| 3042 | Ga0496126_0000676 | |||
| 3043 | Ga0496126_0005915 | |||
| 3044 | Ga0496126_0008414 | |||
| 3045 | Ga0496126_0009487 | |||
| 3046 | Ga0496126_0064670 | |||
| 3047 | Ga0496126_0084982 | |||
| 3048 | Ga0496126_0217689 | |||
| 3049 | Ga0501306_006485 | |||
| 3050 | Ga0501031_0005824 | |||
| 3051 | Ga0501031_0089703 | |||
| 3052 | Ga0501032_0001836 | |||
| 3053 | Ga0501032_0005443 | |||
| 3054 | Ga0501032_0008992 | |||
| 3055 | Ga0501032_0013197 | |||
| 3056 | Ga0501033_0027710 | |||
| 3057 | Ga0501033_0034053 | |||
| 3058 | Ga0501033_0110295 | |||
| 3059 | Ga0501033_0130203 | |||
| 3060 | Ga0501034_0000015 | |||
| 3061 | Ga0501034_0000543 | |||
| 3062 | Ga0501034_0005064 | |||
| 3063 | Ga0501034_0018586 | |||
| 3064 | Ga0501034_0022037 | |||
| 3065 | Ga0501034_0065426 | |||
| 3066 | Ga0501034_0071162 | |||
| 3067 | Ga0501034_0080618 | |||
| 3068 | Ga0501034_0098570 | |||
| 3069 | Ga0501034_0123536 | |||
| 3070 | Ga0501034_0123811 | |||
| 3071 | Ga0501034_0124822 | |||
| 3072 | Ga0501034_0171816 | |||
| 3073 | Ga0501034_0303310 | |||
| 3074 | Ga0501034_0417429 | |||
| 3075 | Ga0501036_0002530 | |||
| 3076 | Ga0501036_0003852 | |||
| 3077 | Ga0501036_0015135 | |||
| 3078 | Ga0501036_0024970 | |||
| 3079 | Ga0501036_0149485 | |||
| 3080 | Ga0501036_0165471 | |||
| 3081 | Ga0501037_0001123 | |||
| 3082 | Ga0501037_0013330 | |||
| 3083 | Ga0501037_0047486 | |||
| 3084 | Ga0501037_0068478 | |||
| 3085 | Ga0501037_0126288 | |||
| 3086 | Ga0501038_0006115 | |||
| 3087 | Ga0501038_0007725 | |||
| 3088 | Ga0501038_0017810 | |||
| 3089 | Ga0501038_0061692 | |||
| 3090 | Ga0501038_0099827 | |||
| 3091 | Ga0501038_0144817 | |||
| 3092 | Ga0501038_0197175 | |||
| 3093 | Ga0501039_0001048 | |||
| 3094 | Ga0501039_0006498 | |||
| 3095 | Ga0501039_0009678 | |||
| 3096 | Ga0501040_0022837 | |||
| 3097 | Ga0501040_0087038 | |||
| 3098 | Ga0501041_0000703 | |||
| 3099 | Ga0501041_0043969 | |||
| 3100 | Ga0501041_0071309 | |||
| 3101 | Ga0501042_0045990 | |||
| 3102 | Ga0501042_0058123 | |||
| 3103 | Ga0501042_0067621 | |||
| 3104 | Ga0501042_0110801 | |||
| 3105 | Ga0501043_0000606 | |||
| 3106 | Ga0501043_0009509 | |||
| 3107 | Ga0501043_0013569 | |||
| 3108 | Ga0501043_0016803 | |||
| 3109 | Ga0501043_0024460 | |||
| 3110 | Ga0501043_0036812 | |||
| 3111 | Ga0501043_0043569 | |||
| 3112 | Ga0501043_0046336 | |||
| 3113 | Ga0501043_0052392 | |||
| 3114 | Ga0501043_0117528 | |||
| 3115 | Ga0501043_0172766 | |||
| 3116 | Ga0501046_0001735 | |||
| 3117 | Ga0501046_0002135 | |||
| 3118 | Ga0501046_0003857 | |||
| 3119 | Ga0501046_0006220 | |||
| 3120 | Ga0501047_0000107 | |||
| 3121 | Ga0501047_0000268 | |||
| 3122 | Ga0501047_0002183 | |||
| 3123 | Ga0501047_0008765 | |||
| 3124 | Ga0501047_0013070 | |||
| 3125 | Ga0501047_0027020 | |||
| 3126 | Ga0501047_0087040 | |||
| 3127 | Ga0501048_0003331 | |||
| 3128 | Ga0501048_0143518 | |||
| 3129 | Ga0501048_0164294 | |||
| 3130 | Ga0501048_0251248 | |||
| 3131 | Ga0501067_0008668 | |||
| 3132 | Ga0501067_0032390 | |||
| 3133 | Ga0501068_0017903 | |||
| 3134 | Ga0501068_0106361 | |||
| 3135 | Ga0501069_0006022 | |||
| 3136 | Ga0501069_0038097 | |||
| 3137 | Ga0501069_0066513 | |||
| 3138 | Ga0501070_0000925 | |||
| 3139 | Ga0501070_0002491 | |||
| 3140 | Ga0501070_0004541 | |||
| 3141 | Ga0501070_0008759 | |||
| 3142 | Ga0501070_0042137 | |||
| 3143 | Ga0501070_0043498 | |||
| 3144 | Ga0501070_0047700 | |||
| 3145 | Ga0501070_0068120 | |||
| 3146 | Ga0501070_0095453 | |||
| 3147 | Ga0501071_0000938 | |||
| 3148 | Ga0501071_0032295 | |||
| 3149 | Ga0501072_0006940 | |||
| 3150 | Ga0501072_0072579 | |||
| 3151 | Ga0501072_0161295 | |||
| 3152 | Ga0501072_0161952 | |||
| 3153 | Ga0501072_0192834 | |||
| 3154 | Ga0501073_0000024 | |||
| 3155 | Ga0501073_0016913 | |||
| 3156 | Ga0501073_0024223 | |||
| 3157 | Ga0501073_0072087 | |||
| 3158 | Ga0501073_0183129 | |||
| 3159 | Ga0501074_0001157 | |||
| 3160 | Ga0501074_0002652 | |||
| 3161 | Ga0501074_0018015 | |||
| 3162 | Ga0501074_0090092 | |||
| 3163 | Ga0501076_0001496 | |||
| 3164 | Ga0501076_0022476 | |||
| 3165 | Ga0501076_0201480 | |||
| 3166 | Ga0501077_0014871 | |||
| 3167 | Ga0501079_0003055 | |||
| 3168 | Ga0501079_0011446 | |||
| 3169 | Ga0501080_0001035 | |||
| 3170 | Ga0501080_0006153 | |||
| 3171 | Ga0501080_0016596 | |||
| 3172 | Ga0501080_0022823 | |||
| 3173 | Ga0501080_0091423 | |||
| 3174 | Ga0501080_0258973 | |||
| 3175 | Ga0501081_0006271 | |||
| 3176 | Ga0501081_0011062 | |||
| 3177 | Ga0501083_0005406 | |||
| 3178 | Ga0501083_0186096 | |||
| 3179 | Ga0501035_0003186 | |||
| 3180 | Ga0501035_0014479 | |||
| 3181 | Ga0501035_0014942 | |||
| 3182 | Ga0501035_0019336 | |||
| 3183 | Ga0501035_0023019 | |||
| 3184 | Ga0501035_0023206 | |||
| 3185 | Ga0501044_0001612 | |||
| 3186 | Ga0501044_0005882 | |||
| 3187 | Ga0501044_0006459 | |||
| 3188 | Ga0501044_0007748 | |||
| 3189 | Ga0501044_0015647 | |||
| 3190 | Ga0501044_0035143 | |||
| 3191 | Ga0501044_0043045 | |||
| 3192 | Ga0501044_0066591 | |||
| 3193 | Ga0501044_0089672 | |||
| 3194 | Ga0501045_0039028 | |||
| 3195 | nmdc:mga03683_17583_c1 | |||
| 3196 | nmdc:mga03n38_1081_c1 | |||
| 3197 | nmdc:mga03n38_2844_c1 | |||
| 3198 | nmdc:mga03n38_38141_c1 | |||
| 3199 | nmdc:mga00v17_10006_c1 | |||
| 3200 | nmdc:mga00v17_16972_c1 | |||
| 3201 | nmdc:mga00v17_3299_c1 | |||
| 3202 | nmdc:mga00v17_3766_c1 | |||
| 3203 | nmdc:mga00v17_37721_c1 | |||
| 3204 | nmdc:mga00v17_72057_c1 | |||
| 3205 | nmdc:mga00v17_9193_c1 | |||
| 3206 | nmdc:mga0yw44_2056_c1 | |||
| 3207 | nmdc:mga0yw44_4555_c1 | |||
| 3208 | nmdc:mga06z11_11779_c1 | |||
| 3209 | nmdc:mga07m45_113737_c1 | |||
| 3210 | nmdc:mga07m45_18278_c1 | |||
| 3211 | nmdc:mga07m45_3115_c1 | |||
| 3212 | nmdc:mga07m45_41926_c1 | |||
| 3213 | nmdc:mga07m45_47346_c1 | |||
| 3214 | nmdc:mga07m45_7793_c1 | |||
| 3215 | nmdc:mga05p37_11899_c1 | |||
| 3216 | nmdc:mga05p37_172547_c1 | |||
| 3217 | nmdc:mga05p37_2128_c1 | |||
| 3218 | nmdc:mga05p37_46755_c1 | |||
| 3219 | nmdc:mga05p37_59920_c1 | |||
| 3220 | nmdc:mga09592_1737_c1 | |||
| 3221 | nmdc:mga09592_199312_c1 | |||
| 3222 | nmdc:mga0qj67_193_c1 | |||
| 3223 | nmdc:mga0qj67_3435_c1 | |||
| 3224 | nmdc:mga0qj67_36297_c1 | |||
| 3225 | nmdc:mga0qj67_695_c1 | |||
| 3226 | nmdc:mga06r32_111190_c1 | |||
| 3227 | nmdc:mga06r32_15489_c1 | |||
| 3228 | nmdc:mga06r32_1594_c1 | |||
| 3229 | nmdc:mga06r32_198_c1 | |||
| 3230 | nmdc:mga06r32_261812_c1 | |||
| 3231 | nmdc:mga06r32_275_c1 | |||
| 3232 | nmdc:mga06r32_77316_c1 | |||
| 3233 | nmdc:mga08y16_5920_c1 | |||
| 3234 | nmdc:mga08y16_85139_c1 | |||
| 3235 | nmdc:mga08y16_92314_c1 | |||
| 3236 | nmdc:mga0n895_41320_c1 | |||
| 3237 | nmdc:mga0n895_7027_c1 | |||
| 3238 | nmdc:mga0n895_93647_c1 | |||
| 3239 | nmdc:mga0n895_99740_c1 | |||
| 3240 | nmdc:mga0rr50_41993_c1 | |||
| 3241 | nmdc:mga0rr50_64626_c1 | |||
| 3242 | nmdc:mga08x19_6450_c1 | |||
| 3243 | nmdc:mga0a205_109248_c1 | |||
| 3244 | nmdc:mga0a205_38254_c1 | |||
| 3245 | nmdc:mga0a205_56142_c1 | |||
| 3246 | nmdc:mga0a205_8625_c2 | |||
| 3247 | nmdc:mga0sz30_4791_c1 | |||
| 3248 | nmdc:mga0sz30_65576_c1 | |||
| 3249 | nmdc:mga0sz30_656_c1 | |||
| 3250 | nmdc:mga0sz30_8114_c1 | |||
| 3251 | Ga0495601_0125810 | |||
| 3252 | Ga0495612_0000472 | |||
| 3253 | Ga0495612_0029687 | |||
| 3254 | Ga0495612_0043180 | |||
| 3255 | Ga0495595_0006267 | |||
| 3256 | Ga0495595_0017594 | |||
| 3257 | Ga0495619_0061541 | |||
| 3258 | Ga0495619_0077770 | |||
| 3259 | Ga0495619_0103658 | |||
| 3260 | Ga0500643_000189 | |||
| 3261 | Ga0500643_000352 | |||
| 3262 | Ga0500646_0000612 | |||
| 3263 | Ga0500651_0001689 | |||
| 3264 | Ga0500651_0131400 | |||
| 3265 | Ga0500641_0035450 | |||
| 3266 | Ga0500554_006511 | |||
| 3267 | Ga0500556_0000062 | |||
| 3268 | Ga0500593_035358 | |||
| 3269 | Ga0500594_0004228 | |||
| 3270 | Ga0500652_058759 | |||
| 3271 | Ga0500658_0039444 | |||
| 3272 | Ga0500559_0000868 | |||
| 3273 | Ga0500559_0002901 | |||
| 3274 | Ga0500559_0020640 | |||
| 3275 | Ga0500568_0000060 | |||
| 3276 | Ga0500568_0000124 | |||
| 3277 | Ga0500568_0002651 | |||
| 3278 | Ga0500568_0019851 | |||
| 3279 | Ga0500568_0033263 | |||
| 3280 | Ga0500573_0000007 | |||
| 3281 | Ga0500588_0003567 | |||
| 3282 | Ga0500589_052185 | |||
| 3283 | Ga0500590_001918 | |||
| 3284 | Ga0500600_0068994 | |||
| 3285 | Ga0500604_0013291 | |||
| 3286 | Ga0500616_0002004 | |||
| 3287 | Ga0500616_0064516 | |||
| 3288 | Ga0500620_000387 | |||
| 3289 | Ga0500645_000128 | |||
| 3290 | Ga0501084_0002094 | |||
| 3291 | Ga0501084_0028238 | |||
| 3292 | Ga0501084_0052351 | |||
| 3293 | Ga0501084_0053198 | |||
| 3294 | Ga0501084_0063808 | |||
| 3295 | Ga0501084_0126504 | |||
| 3296 | Ga0501084_0237061 | |||
| 3297 | Ga0590075_004557 | |||
| 3298 | Ga0501082_0013306 | |||
| 3299 | Ga0501082_0064397 | |||
| 3300 | Ga0466962_0000302 | |||
| 3301 | Ga0466962_0003093 | |||
| 3302 | Ga0466962_0004408 | |||
| 3303 | Ga0466962_0006025 | |||
| 3304 | Ga0466962_0028426 | |||
| 3305 | 2501942824 | |||
| 3306 | 2506867832 | |||
| 3307 | 2515494912 | |||
| 3308 | 2515718916 | |||
| 3309 | 2515755575 | |||
| 3310 | 2515851904 | |||
| 3311 | 2516083128 | |||
| 3312 | 2516090214 | |||
| 3313 | 2523383290 | |||
| 3314 | 2528205551 | |||
| 3315 | 2528214972 | |||
| 3316 | 2546950328 | |||
| 3317 | 2548694814 | |||
| 3318 | 2552107491 | |||
| 3319 | 2554259472 | |||
| 3320 | 2558914157 | |||
| 3321 | 2566997442 | |||
| 3322 | 2579750244 | |||
| 3323 | 2579856475 | |||
| 3324 | 2585302008 | |||
| 3325 | 2585321075 | |||
| 3326 | 2616695704 | |||
| 3327 | 2619858079 | |||
| 3328 | 2620352616 | |||
| 3329 | 2623501119 | |||
| 3330 | 2623588025 | |||
| 3331 | 2626639665 | |||
| 3332 | 2643904555 | |||
| 3333 | 2644019206 | |||
| 3334 | 2644095148 | |||
| 3335 | 2644174112 | |||
| 3336 | 2644406179 | |||
| 3337 | 2644488693 | |||
| 3338 | 2644506432 | |||
| 3339 | 2644518138 | |||
| 3340 | 2644526650 | |||
| 3341 | 2644636685 | |||
| 3342 | 2644671316 | |||
| 3343 | 2671839072 | |||
| 3344 | 2676476047 | |||
| 3345 | 2676487337 | |||
| 3346 | 2686537797 | |||
| 3347 | 2686543134 | |||
| 3348 | 2689991648 | |||
| 3349 | 2710603810 | |||
| 3350 | 2731907033 | |||
| 3351 | 2738664986 | |||
| 3352 | 2738708135 | |||
| 3353 | 2738886690 | |||
| 3354 | 2739144120 | |||
| 3355 | 2739203829 | |||
| 3356 | 2739239384 | |||
| 3357 | 2739334712 | |||
| 3358 | 2744954612 | |||
| 3359 | 2753076170 | |||
| 3360 | 2753303407 | |||
| 3361 | 2774857228 | |||
| 3362 | 2774866103 | |||
| 3363 | 2774904260 | |||
| 3364 | 2776370698 | |||
| 3365 | 2793983469 | |||
| 3366 | 2808890684 | |||
| 3367 | 2810363513 | |||
| 3368 | 2811847040 | |||
| 3369 | 2812365412 | |||
| 3370 | 2812482300 | |||
| 3371 | 2819739146 | |||
| 3372 | 2827630609 | |||
| 3373 | 2837187228 | |||
| 3374 | 2839989531 | |||
| 3375 | 2842137806 | |||
| 3376 | 2844852307 | |||
| 3377 | 2844856559 | |||
| 3378 | 2855681951 | |||
| 3379 | 2855686874 | |||
| 3380 | 2856862049 | |||
| 3381 | 2857289182 | |||
| 3382 | 2857740182 | |||
| 3383 | 2857743804 | |||
| 3384 | 2858850004 | |||
| 3385 | 2858874904 | |||
| 3386 | 2858883484 | |||
| 3387 | 2858891979 | |||
| 3388 | 2858899339 | |||
| 3389 | 2858907845 | |||
| 3390 | 2861527631 | |||
| 3391 | 2862510485 | |||
| 3392 | 2862706808 | |||
| 3393 | 2863072248 | |||
| 3394 | 2867307773 | |||
| 3395 | 2867319094 | |||
| 3396 | 2867320099 | |||
| 3397 | 2867346895 | |||
| 3398 | 2867369926 | |||
| 3399 | 2867480854 | |||
| 3400 | 2868094364 | |||
| 3401 | 2869051888 | |||
| 3402 | 2869067946 | |||
| 3403 | 2869073443 | |||
| 3404 | 2870622737 | |||
| 3405 | 2870726152 | |||
| 3406 | 2875392761 | |||
| 3407 | 2880492030 | |||
| 3408 | 2880500262 | |||
| 3409 | 2884764545 | |||
| 3410 | 2884995185 | |||
| 3411 | 2889301981 | |||
| 3412 | 2891327154 | |||
| 3413 | 2895429234 | |||
| 3414 | 2895888739 | |||
| 3415 | 2899368037 | |||
| 3416 | 2899375434 | |||
| 3417 | 2902586652 | |||
| 3418 | 2902795775 | |||
| 3419 | 2902803821 | |||
| 3420 | 2902811851 | |||
| 3421 | 2902838577 | |||
| 3422 | 2904499703 | |||
| 3423 | 2904540346 | |||
| 3424 | 2904769221 | |||
| 3425 | 2904776331 | |||
| 3426 | 2904780360 | |||
| 3427 | 2905927707 | |||
| 3428 | 2905929264 | |||
| 3429 | 2905930281 | |||
| 3430 | 2908814417 | |||
| 3431 | 2910814860 | |||
| 3432 | 2912722325 | |||
| 3433 | 2912726037 | |||
| 3434 | 2912758959 | |||
| 3435 | 2919036156 | |||
| 3436 | 2919046180 | |||
| 3437 | 2919053168 | |||
| 3438 | 2919060871 | |||
| 3439 | 2919392436 | |||
| 3440 | 2919422858 | |||
| 3441 | 2919434889 | |||
| 3442 | 2919538626 | |||
| 3443 | 2919718922 | |||
| 3444 | 2922556375 | |||
| 3445 | 2928106968 | |||
| 3446 | 2928147267 | |||
| 3447 | 2929215655 | |||
| 3448 | 2929222155 | |||
| 3449 | 2929228820 | |||
| 3450 | 2932398928 | |||
| 3451 | 2932431103 | |||
| 3452 | 2932433655 | |||
| 3453 | 2933419213 | |||
| 3454 | 2935394777 | |||
| 3455 | 2939589358 | |||
| 3456 | 2939647868 | |||
| 3457 | 2939663719 | |||
| 3458 | 2939679070 | |||
| 3459 | 2939748198 | |||
| 3460 | 2945924525 | |||
| 3461 | 2945943739 | |||
| 3462 | 2945958072 | |||
| 3463 | 2946004070 | |||
| 3464 | 2946039708 | |||
| 3465 | 2946051954 | |||
| 3466 | 2947231749 | |||
| 3467 | 2954000932 | |||
| 3468 | 2954011001 | |||
| 3469 | 2956941213 | |||
| 3470 | 2966927682 | |||
| 3471 | 2974303208 | |||
| 3472 | 2984526003 | |||
| 3473 | 2984551711 | |||
| 3474 | 2990050098 | |||
| 3475 | 2990061429 | |||
| 3476 | 2990092041 | |||
| 3477 | 2995469292 | |||
| 3478 | 2996227977 | |||
| 3479 | 2997454832 | |||
| 3480 | 2997605605 | |||
| 3481 | 3001120351 | |||
| 3482 | 3003002251 | |||
| 3483 | 3006327930 | |||
| 3484 | 3006399468 | |||
| 3485 | 3006430613 | |||
| 3486 | 3006491715 | |||
| 3487 | 637880493 | |||
| 3488 | 649812648 | |||
| 3489 | 8003835703 | |||
| 3490 | 8003858503 | |||
| 3491 | 8004026160 | |||
| 3492 | 8008486503 | |||
| 3493 | 8008580681 | |||
| 3494 | 8025481225 | |||
| 3495 | 8025525572 | |||
| 3496 | 8025531020 | |||
| 3497 | 8033688272 | |||
| 3498 | 8047894932 | |||
| 3499 | 8048130482 | |||
| 3500 | 8048364118 | |||
| 3501 | 8048371950 | |||
| 3502 | 8048380884 | |||
| 3503 | 8053947878 | |||
| 3504 | 8054110003 | |||
| 3505 | 8054706813 | |||
| 3506 | 8054730850 | |||
| 3507 | 8054738895 | |||
| 3508 | 8054914099 | |||
| 3509 | 8054922895 | |||
| 3510 | 8055068480 | |||
| 3511 | 8055162372 | |||
| 3512 | 8055181034 | |||
| 3513 | 8055412800 | |||
| 3514 | 8056066074 | |||
| 3515 | 8056449305 | |||
| 3516 | 8056670177 | |||
| 3517 | 8056835631 | |||
| 3518 | 8057568517 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4xfj-assembly1.cif.gz_A-2 | crystal structure of argininosuccinate synthase from mycobacterium thermoresistibile in complex with amppnp and arginine | 0.9851 | 2 | 397 |
| 4xfj-assembly1.cif.gz_B | crystal structure of argininosuccinate synthase from mycobacterium thermoresistibile in complex with amppnp and arginine | 0.984 | 2 | 397 |
| 4u7j-assembly1.cif.gz_B-2 | crystal structure of argininosuccinate synthase from mycobacterium thermoresistibile | 0.9821 | 3 | 397 |
| 4xfj-assembly1.cif.gz_A-2 | crystal structure of argininosuccinate synthase from mycobacterium thermoresistibile in complex with amppnp and arginine | 0.9802 | 2 | 397 |
| 4xfj-assembly1.cif.gz_B | crystal structure of argininosuccinate synthase from mycobacterium thermoresistibile in complex with amppnp and arginine | 0.9791 | 2 | 397 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4xfjA02 | Alpha Beta;Alpha-Beta Complex;Argininosuccinate synthetase, chain A, domain 2;Argininosuccinate synthetase, chain A, domain 2 | 0.9983 | 175 | 361 | 3.90.1260.10 |
| 4xfjA02 | Alpha Beta;Alpha-Beta Complex;Argininosuccinate synthetase, chain A, domain 2;Argininosuccinate synthetase, chain A, domain 2 | 0.9929 | 175 | 361 | 3.90.1260.10 |
| af_A0A0R0IGZ2_74_244_3.90.1260.10 | Alpha Beta;Alpha-Beta Complex;Argininosuccinate synthetase, chain A, domain 2;Argininosuccinate synthetase, chain A, domain 2 | 0.9816 | 175 | 344 | 3.90.1260.10 |
| 1kh1C02 | Alpha Beta;Alpha-Beta Complex;Argininosuccinate synthetase, chain A, domain 2;Argininosuccinate synthetase, chain A, domain 2 | 0.9778 | 66 | 355 | 3.90.1260.10 |
| af_A0A0P0Y1E8_15_149_3.90.1260.10 | Alpha Beta;Alpha-Beta Complex;Argininosuccinate synthetase, chain A, domain 2;Argininosuccinate synthetase, chain A, domain 2 | 0.9736 | 252 | 378 | 3.90.1260.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3D1ZR42-F1-model_v4 | Argininosuccinate synthase (EC 6.3.4.5) | 0.9997 | 3 | 73 |
GO:0000050
GO:0000053 GO:0004055 GO:0005524 GO:0005737 GO:0006526 |
| AF-A0A0E3N9I3-F1-model_v4 | argininosuccinate synthase (EC 6.3.4.5) | 0.9991 | 183 | 352 |
GO:0000050
GO:0000053 GO:0004055 GO:0005524 GO:0005737 GO:0006526 |
| AF-A0A7G1ICP1-F1-model_v4 | argininosuccinate synthase (EC 6.3.4.5) | 0.9973 | 235 | 397 |
GO:0000050
GO:0000053 GO:0004055 GO:0005524 GO:0005737 GO:0006526 |
| AF-A0A3E2CCP6-F1-model_v4 | Argininosuccinate synthase (EC 6.3.4.5) | 0.9969 | 3 | 147 |
GO:0000050
GO:0000053 GO:0004055 GO:0005524 GO:0005737 GO:0006526 |
| AF-A0A365UVF0-F1-model_v4 | deleted | 0.995 | 1 | 398 |
|