F495604

General Info

Members Datasets Scaffolds Average Seq Length
1759 699 3518 400

Family's Representative Sequence

Representative Sequence 3300048915|Ga0496112_0044614|Ga0496112_0044614_1799_3163
Length 440
Sequence VSERVVLAYSGGLDTSVAIGWIAEETGAEVIAVAADVGQGGEDLDAIRERALACGAVESLVLDLKEEYAEEYCLPALKANALYLDRYPLVSALSRPVIVKHLVEAARYHGASTVAHGCTGKGNDQVRFEVGIGALAPDIRVLAPVRDSGMSRDKAIAFAEEKGLPIDVTKKSPYSIDQNLWGRAVETGFLEDIWNAPIEDVYDYTADPAVPRDADEVVITFDRGAPVAIDGRPVSVLQAVLELNKRAGAQGVGRLDLVEDRLVGIKSREVYEAPGAIALITAHQELENVTVERDLARFKRPVEQRWGELVYDGLWFSPLKRALDGFVEEANAHVSGDIRLTLHGGRAVVSGRRSQSALYEYEMATYDSGDAFDQSLAKGFVELWGLPSKMAARRDHRVATTQPRRPRMAGVWVLCEASVPGNVPTHLPYVVELNRRMIEA

Samples

Sample ID Description Type Environment
1 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
5 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
6 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
7 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
8 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
9 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
10 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
11 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
12 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
13 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
14 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
28 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
41 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
42 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
43 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
44 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
45 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
46 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
47 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
48 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
49 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
50 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
51 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
52 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
53 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
54 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
55 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
56 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
57 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
58 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
59 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
60 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
61 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
62 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
63 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
64 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
65 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
66 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
67 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
68 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
69 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
70 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
71 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
72 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
73 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
74 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
75 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
76 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
77 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
78 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
79 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
80 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
81 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
82 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
83 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
84 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
85 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
86 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
87 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
88 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
89 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
90 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
91 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
92 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
93 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
94 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
95 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
96 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
97 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
98 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
99 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
100 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
101 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
102 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
103 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
104 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
105 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
106 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
107 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
108 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
109 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
110 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
111 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
112 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
113 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
114 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
115 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
116 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
117 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
118 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
119 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
120 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
121 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
122 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
123 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
124 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
125 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
126 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
127 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
128 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
129 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
130 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
131 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
132 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
133 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
134 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
135 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
136 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
137 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
138 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
139 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
140 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
141 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
142 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
143 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
144 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
145 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
146 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
148 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
149 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
150 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
151 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
218 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
222 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
223 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
224 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
225 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
226 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
227 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
228 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
229 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
230 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
231 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
232 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
233 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
234 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
235 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
236 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
237 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
238 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
239 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
240 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
241 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
242 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
243 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
244 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
245 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
246 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
247 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
248 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
249 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
250 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
251 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
252 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
253 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
254 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
255 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
256 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
257 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
258 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
259 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
260 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
261 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
262 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
263 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
264 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
265 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
266 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
267 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
268 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
269 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
270 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
271 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
272 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
273 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
274 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
275 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
276 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
277 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
278 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
279 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
280 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
281 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
282 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
283 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
284 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
285 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
286 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
287 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
288 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
289 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
290 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
291 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
292 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
293 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
294 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
295 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
296 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
297 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
298 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
299 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
300 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
301 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
302 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
303 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
304 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
305 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
306 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
307 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
308 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
309 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
310 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
311 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
312 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
313 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
314 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
315 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
316 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
317 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
318 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
319 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
320 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
321 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
322 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
323 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
324 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
325 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
326 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
327 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
328 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
329 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
330 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
331 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
332 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
333 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
334 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
335 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
336 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
337 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
338 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
339 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
340 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
341 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
342 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
343 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
344 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
345 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
346 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
347 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
348 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
349 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
350 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
351 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
352 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
353 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
354 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
355 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
356 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
357 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
358 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
359 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
360 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
361 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
362 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
363 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
364 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
365 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
366 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
367 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
368 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
369 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
370 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
371 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
372 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
373 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
374 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
375 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
376 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
377 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
378 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
379 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
380 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
381 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
382 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
383 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
384 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
385 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
386 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
387 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
388 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
389 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
390 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
391 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
392 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
393 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
394 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
395 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
396 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
397 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
398 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
399 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
400 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
401 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
402 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
403 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
404 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
405 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
406 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
407 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
408 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
409 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
410 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
411 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
412 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
413 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
414 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
415 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
416 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
417 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
418 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
419 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
420 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
421 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
422 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
423 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
424 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
425 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
426 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
427 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
428 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
429 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
430 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
431 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
432 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
433 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
434 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
435 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
436 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
437 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
438 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
439 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
440 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
441 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
442 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
443 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
444 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
445 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
446 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
447 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
448 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
449 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
450 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
451 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
452 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
453 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
454 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
455 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
456 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
457 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
458 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
459 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
460 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
461 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
462 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
463 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
464 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
465 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
466 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
467 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
468 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
469 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
470 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
471 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
472 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
473 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
474 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
475 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
476 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
477 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
478 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
479 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
480 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
481 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
482 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
483 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
484 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
485 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
486 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
487 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
488 2501939600 Micromonospora sp. L5 Isolate Unclassified
489 2506783011 Frankia datiscae Dg1 Isolate Nodule
490 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
491 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
492 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
493 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
494 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
495 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
496 2523231044 Gordonia rhizosphera NBRC 16068 Isolate Rhizosphere
497 2527291627 Frankia casuarinae Thr Isolate Nodule
498 2527291629 Frankia sp. BMG5.23 Isolate Nodule
499 2546825537 Frankia sp. CcI6 Isolate Rhizoplane
500 2547132424 Nocardia nova SH22a Isolate Unclassified
501 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
502 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
503 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
504 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
505 2576861822 Frankia sp. CeD Isolate Nodule
506 2579778521 Frankia torreyi CpI1-S Isolate Unclassified
507 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
508 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
509 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
510 2619618881 Frankia sp. ACN1ag Isolate Unclassified
511 2619619003 Frankia sp. CpI1-P Isolate Nodule
512 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
513 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
514 2626541554 Frankia sp. AvcI.1 Isolate Nodule
515 2643221578 Streptomyces sp. Root63 Isolate Unclassified
516 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
517 2643221616 Leifsonia sp. Root227 Isolate Unclassified
518 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
519 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
520 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
521 2643221690 Cellulomonas sp. Root485 Isolate Unclassified
522 2643221692 Nocardia sp. Root136 Isolate Unclassified
523 2643221694 Cellulomonas sp. Root137 Isolate Unclassified
524 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
525 2643221722 Cellulomonas sp. Root930 Isolate Unclassified
526 2671180195 Frankia sp. CcI49 Isolate Nodule
527 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
528 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
529 2684623035 Frankia sp. NRRL B-16219 Isolate Rhizosphere
530 2684623036 Frankia sp. CgIM4 Isolate Nodule
531 2687453743 Frankia colletiae Cc1.17 Isolate Nodule
532 2710264753 Frankia sp. KB5 Isolate Nodule
533 2731639228 Motilibacter peucedani DSM 45328 Isolate Rhizosphere
534 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
535 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
536 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
537 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
538 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
539 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
540 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
541 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
542 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
543 2751185788 Curtobacterium pusillum AA3 Isolate Unclassified
544 2773857922 Frankia sp. CcI49 Isolate Nodule
545 2773857924 Frankia sp. CgIS1 Isolate Nodule
546 2773857933 Frankia sp. BMG5.30 Isolate Nodule
547 2775506925 Saccharopolyspora phatthalungensis NRRL B-24798 Isolate Rhizosphere
548 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
549 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
550 2808606700 Arthrobacter agilis UMCV2 Isolate Rhizosphere
551 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
552 2811994880 Cellulomonas sp. SLBN-39 Isolate Unclassified
553 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
554 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
555 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
556 2837183177 Egibacter rhizosphaerae EGI 80759 Isolate Unclassified
557 2839986021 Cellulosimicrobium cellulans JZ5 Isolate Unclassified
558 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
559 2844849076 Arthrobacter cupressi DSM 24664 Isolate Rhizosphere
560 2844852863 Herbiconiux flava DSM 26474 Isolate Rhizosphere
561 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
562 2855683550 Micromonospora sp. RP3T Isolate Unclassified
563 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
564 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
565 2857737099 Lysinimonas sp. R-73066 Isolate Unclassified
566 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
567 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
568 2858868258 Micromonospora sp. MH33 Isolate Unclassified
569 2858882152 Micromonospora noduli MED15 Isolate Nodule
570 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
571 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
572 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
573 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
574 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
575 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
576 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
577 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
578 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
579 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
580 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
581 2867369537 Streptomyces sp. Z26 Isolate Unclassified
582 2867475112 Streptomyces sp. TM32 Isolate Unclassified
583 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
584 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
585 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
586 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
587 2870622029 Conyzicola lurida DSM 105784 Isolate Unclassified
588 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
589 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
590 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
591 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
592 2884763398 Leifsonia sp. PS1209 Isolate Stem Tuber
593 2884994152 Cellulomonas sp. H30R-01 Isolate Rhizosphere
594 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
595 2891326441 Actinokineospora pegani TRM65233 Isolate Unclassified
596 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
597 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
598 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
599 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
600 2902582711 Micromonospora sp. AP08 Isolate Unclassified
601 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
602 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
603 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
604 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
605 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
606 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
607 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
608 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
609 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
610 2905926851 Arthrobacter sedimenti MIC A30 Isolate Rhizosphere
611 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
612 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
613 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
614 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
615 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
616 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
617 2919042368 Curtobacterium sp. 320 Isolate Rhizosphere
618 2919051321 Sinomonas atrocyanea 1003 Isolate Rhizosphere
619 2919059106 Arthrobacter sp. 1088 Isolate Rhizosphere
620 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
621 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
622 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
623 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
624 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
625 2922554459 Rhodococcus sp. 66b Isolate Unclassified
626 2928104781 Curtobacterium sp. 1544 Isolate Rhizosphere
627 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
628 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
629 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
630 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
631 2932398195 Dietzia sp. 2505 Isolate Rhizosphere
632 2932426870 Paenarthrobacter sp. 4246 Isolate Rhizosphere
633 2932431166 Cellulosimicrobium sp. 4261 Isolate Rhizosphere
634 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere
635 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
636 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
637 2939647034 Arthrobacter sp. 2762 Isolate Rhizosphere
638 2939660829 Mycetocola sp. 2940 Isolate Rhizosphere
639 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
640 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
641 2945920336 Pseudarthrobacter siccitolerans W1I3 Isolate Rhizosphere
642 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
643 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
644 2946003308 Arthrobacter agilis W3I6 Isolate Rhizosphere
645 2946037020 Arthrobacter sp. W4I7 Isolate Rhizosphere
646 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
647 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
648 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
649 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
650 2956939328 Lolliginicoccus suaedae LNNU 331112 Isolate Rhizosphere
651 2966924647 Frigoribacterium sp. 2355 Isolate Rhizosphere
652 2974302888 Pseudarthrobacter sp. SORGH_AS 212 Isolate Unclassified
653 2984523437 Rhodococcus sp. SORGH_AS303 Isolate Aerial Root
654 2984551494 Curtobacterium sp. SORGH_AS776 Isolate Aerial Root
655 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
656 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
657 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
658 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
659 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
660 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
661 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
662 3001119090 Lolliginicoccus lacisalsi G463 Isolate Rhizosphere
663 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
664 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
665 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
666 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
667 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
668 637000116 Frankia casuarinae CcI3 Isolate Nodule
669 649633069 Micromonospora sp. L5 Isolate Unclassified
670 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
671 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
672 8004025490 Arthrobacter wenxiniae AETb3-4 Isolate Rhizosphere
673 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
674 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
675 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
676 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
677 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
678 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
679 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
680 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
681 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
682 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
683 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
684 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere
685 8054107350 Arthrobacter rhizosphaerae CCNWLXL 1-35 Isolate Rhizosphere
686 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
687 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
688 8054734606 Micromonospora hortensis NIE111 Isolate Nodule
689 8054913762 Frankia gtarii Agncl-10 Isolate Nodule
690 8054920844 Frankia tisae Agncl-8 Isolate Nodule
691 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
692 8055157932 Frankia umida Ag45/Mut15 Isolate Nodule
693 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified
694 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule
695 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified
696 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
697 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
698 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere
699 8057568493 Actinorhabdospora filicis NBRC 111898 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.72
Metatranscriptomes 0.11
Isolates 12.17

Biome Distribution

Category Percentage (%)
Aerial Root 0.11
Bulb 0
Endosphere 5.69
Nodule 1.31
Rhizoplane 6.31
Rhizosphere 75.72
Stem 0
Stem Tuber 0.11
Unclassified 0.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496112_0044614 3300048915 Bacteria 4345
2 JGI24746J21847_1000536 3300001977 Bacteria 5692
3 JGI24737J22298_10021667 3300001990 Bacteria 2047
4 JGI24745J21846_1000370 3300002073 Bacteria 3926
5 JGI24749J21850_1007903 3300002076 Bacteria 1480
6 JGI24744J21845_10000965 3300002077 Bacteria 5488
7 JGI24034J26672_10008906 3300002239 Bacteria 1474
8 JGI24742J22300_10001394 3300002244 Bacteria 3810
9 JGI25164J39214_1000515 3300002772 Bacteria 18519
10 JGI25152J39213_1000980 3300002773 Bacteria 13874
11 JGI25151J46595_10031792 3300003187 Bacteria 2056
12 JGI25165J46597_1000044 3300003214 Bacteria 263289
13 Ga0055540_1000211 3300003792 Bacteria 55318
14 Ga0055540_1004259 3300003792 Bacteria 6554
15 Ga0055540_1006714 3300003792 Bacteria 4508
16 Ga0065714_10010605 3300005288 Bacteria 2082
17 Ga0065712_10022902 3300005290 Bacteria 1739
18 Ga0070658_10000155 3300005327 Bacteria 60553
19 Ga0070658_10002940 3300005327 Bacteria 14124
20 Ga0070658_10078060 3300005327 Bacteria 2717
21 Ga0070658_10112230 3300005327 Bacteria 2259
22 Ga0070658_10241926 3300005327 Bacteria 1530
23 Ga0070676_10113118 3300005328 Bacteria 1693
24 Ga0070683_100002759 3300005329 Bacteria 14036
25 Ga0070683_100008046 3300005329 Bacteria 8952
26 Ga0070683_100133817 3300005329 Bacteria 2347
27 Ga0070683_100140430 3300005329 Bacteria 2289
28 Ga0070690_100027643 3300005330 Bacteria 3507
29 Ga0070690_100074970 3300005330 Bacteria 2205
30 Ga0070670_100052841 3300005331 Bacteria 3489
31 Ga0068869_100011022 3300005334 Bacteria 5921
32 Ga0068869_100018593 3300005334 Bacteria 4732
33 Ga0068869_100030573 3300005334 Bacteria 3781
34 Ga0070666_10012208 3300005335 Bacteria 5413
35 Ga0070666_10073071 3300005335 Bacteria 2336
36 Ga0070680_100001962 3300005336 Bacteria 15137
37 Ga0070680_100021263 3300005336 Bacteria 5155
38 Ga0070680_100045036 3300005336 Bacteria 3586
39 Ga0070682_100003447 3300005337 Bacteria 8762
40 Ga0070682_100054024 3300005337 Bacteria 2519
41 Ga0070682_100165205 3300005337 Bacteria 1533
42 Ga0068868_100000794 3300005338 Bacteria 21371
43 Ga0068868_100013822 3300005338 Bacteria 5933
44 Ga0068868_100014864 3300005338 Bacteria 5745
45 Ga0068868_100178949 3300005338 Bacteria 1758
46 Ga0068868_100254829 3300005338 Bacteria 1478
47 Ga0070660_100011330 3300005339 Bacteria 6329
48 Ga0070660_100103520 3300005339 Bacteria 2258
49 Ga0070689_100053548 3300005340 Bacteria 3123
50 Ga0070691_10002291 3300005341 Bacteria 8472
51 Ga0070691_10006343 3300005341 Bacteria 5405
52 Ga0070661_100047797 3300005344 Bacteria 3131
53 Ga0070692_10003769 3300005345 Bacteria 6232
54 Ga0070692_10007565 3300005345 Bacteria 4791
55 Ga0070668_100000964 3300005347 Bacteria 20121
56 Ga0070668_100001978 3300005347 Bacteria 14972
57 Ga0070668_100014132 3300005347 Bacteria 5967
58 Ga0070668_100016742 3300005347 Bacteria 5481
59 Ga0070668_100017923 3300005347 Bacteria 5311
60 Ga0070668_100068032 3300005347 Bacteria 2768
61 Ga0070669_100027727 3300005353 Bacteria 4077
62 Ga0070669_100057955 3300005353 Bacteria 2843
63 Ga0070675_100000432 3300005354 Bacteria 28465
64 Ga0070675_100018048 3300005354 Bacteria 5616
65 Ga0070675_100024819 3300005354 Bacteria 4802
66 Ga0070675_100245660 3300005354 Bacteria 1565
67 Ga0070671_100000370 3300005355 Bacteria 31140
68 Ga0070671_100041360 3300005355 Bacteria 3831
69 Ga0070671_100087577 3300005355 Bacteria 2606
70 Ga0070674_100042205 3300005356 Bacteria 3097
71 Ga0070674_100090614 3300005356 Bacteria 2206
72 Ga0070674_100185527 3300005356 Bacteria 1596
73 Ga0070673_100031422 3300005364 Bacteria 3984
74 Ga0070688_100010888 3300005365 Bacteria 5034
75 Ga0070659_100006799 3300005366 Bacteria 8278
76 Ga0070659_100105731 3300005366 Bacteria 2268
77 Ga0070667_100000562 3300005367 Bacteria 36767
78 Ga0070667_100001312 3300005367 Bacteria 22360
79 Ga0070667_100006829 3300005367 Bacteria 9479
80 Ga0070667_100014813 3300005367 Bacteria 6442
81 Ga0070667_100092326 3300005367 Bacteria 2604
82 Ga0070709_10006919 3300005434 Bacteria 6192
83 Ga0070714_100000045 3300005435 Bacteria 113749
84 Ga0070714_100048774 3300005435 Bacteria 3602
85 Ga0070714_100064441 3300005435 Bacteria 3154
86 Ga0070714_100068199 3300005435 Bacteria 3068
87 Ga0070714_100120606 3300005435 Bacteria 2332
88 Ga0070714_100123813 3300005435 Bacteria 2302
89 Ga0070714_100289252 3300005435 Bacteria 1525
90 Ga0070713_100001944 3300005436 Bacteria 13338
91 Ga0070713_100007682 3300005436 Bacteria 7590
92 Ga0070713_100093894 3300005436 Bacteria 2585
93 Ga0070713_100105853 3300005436 Bacteria 2444
94 Ga0070713_100172511 3300005436 Bacteria 1938
95 Ga0070710_10001141 3300005437 Bacteria 12594
96 Ga0070710_10004138 3300005437 Bacteria 6884
97 Ga0070710_10010958 3300005437 Bacteria 4467
98 Ga0070710_10018959 3300005437 Bacteria 3548
99 Ga0070710_10115985 3300005437 Bacteria 1615
100 Ga0070701_10058009 3300005438 Bacteria 2031
101 Ga0070711_100001916 3300005439 Bacteria 11636
102 Ga0070711_100004625 3300005439 Bacteria 8147
103 Ga0070711_100081123 3300005439 Bacteria 2311
104 Ga0070705_100017002 3300005440 Bacteria 3790
105 Ga0070700_100000094 3300005441 Bacteria 60178
106 Ga0070700_100007945 3300005441 Bacteria 5757
107 Ga0070700_100008853 3300005441 Bacteria 5501
108 Ga0070700_100025985 3300005441 Bacteria 3453
109 Ga0070700_100035573 3300005441 Bacteria 3015
110 Ga0070708_100022408 3300005445 Bacteria 5358
111 Ga0070663_100009639 3300005455 Bacteria 5989
112 Ga0070663_100014886 3300005455 Bacteria 5002
113 Ga0070663_100035622 3300005455 Bacteria 3453
114 Ga0070663_100067628 3300005455 Bacteria 2592
115 Ga0070663_100201281 3300005455 Bacteria 1554
116 Ga0070678_100003103 3300005456 Bacteria 9209
117 Ga0070678_100011769 3300005456 Bacteria 5410
118 Ga0070678_100027420 3300005456 Bacteria 3867
119 Ga0070678_100050196 3300005456 Bacteria 3016
120 Ga0070678_100135038 3300005456 Bacteria 1966
121 Ga0070678_100144904 3300005456 Bacteria 1905
122 Ga0070678_100146363 3300005456 Bacteria 1897
123 Ga0070662_100002734 3300005457 Bacteria 10898
124 Ga0070662_100070790 3300005457 Bacteria 2570
125 Ga0070662_100092533 3300005457 Bacteria 2273
126 Ga0070681_10000504 3300005458 Bacteria 31959
127 Ga0070681_10009194 3300005458 Bacteria 9713
128 Ga0070681_10033991 3300005458 Bacteria 5120
129 Ga0070681_10100015 3300005458 Bacteria 2846
130 Ga0068867_100002956 3300005459 Bacteria 11971
131 Ga0070685_10006635 3300005466 Bacteria 5906
132 Ga0070685_10019605 3300005466 Bacteria 3652
133 Ga0070685_10022713 3300005466 Bacteria 3424
134 Ga0070706_100027267 3300005467 Bacteria 5256
135 Ga0070706_100032645 3300005467 Bacteria 4803
136 Ga0070707_100003790 3300005468 Bacteria 14265
137 Ga0070707_100039640 3300005468 Bacteria 4503
138 Ga0070707_100366908 3300005468 Bacteria 1399
139 Ga0070698_100006733 3300005471 Bacteria 12461
140 Ga0070698_100075451 3300005471 Bacteria 3376
141 Ga0070679_100000687 3300005530 Bacteria 29007
142 Ga0070679_100001838 3300005530 Bacteria 19103
143 Ga0070679_100005358 3300005530 Bacteria 11869
144 Ga0070679_100063294 3300005530 Bacteria 3687
145 Ga0070679_100088386 3300005530 Bacteria 3086
146 Ga0068853_100008631 3300005539 Bacteria 8194
147 Ga0068853_100026901 3300005539 Bacteria 4833
148 Ga0068853_100028554 3300005539 Bacteria 4693
149 Ga0068853_100047185 3300005539 Bacteria 3696
150 Ga0068853_100127831 3300005539 Bacteria 2272
151 Ga0068853_100233417 3300005539 Bacteria 1683
152 Ga0070672_100104720 3300005543 Bacteria 2299
153 Ga0070695_100023511 3300005545 Bacteria 3788
154 Ga0070696_100006572 3300005546 Bacteria 7761
155 Ga0070696_100088676 3300005546 Bacteria 2199
156 Ga0070693_100004975 3300005547 Bacteria 6346
157 Ga0070693_100005567 3300005547 Bacteria 6063
158 Ga0070693_100052400 3300005547 Bacteria 2339
159 Ga0070665_100001805 3300005548 Bacteria 24264
160 Ga0070665_100019654 3300005548 Bacteria 6780
161 Ga0070665_100054549 3300005548 Bacteria 4009
162 Ga0070665_100061354 3300005548 Bacteria 3769
163 Ga0070665_100063798 3300005548 Bacteria 3694
164 Ga0070665_100067128 3300005548 Bacteria 3597
165 Ga0070704_100005363 3300005549 Bacteria 7466
166 Ga0070704_100029852 3300005549 Bacteria 3645
167 Ga0070704_100076065 3300005549 Bacteria 2454
168 Ga0068855_100012387 3300005563 Bacteria 10301
169 Ga0068855_100027492 3300005563 Bacteria 6802
170 Ga0068855_100034580 3300005563 Bacteria 6024
171 Ga0068855_100039520 3300005563 Bacteria 5602
172 Ga0068855_100164286 3300005563 Bacteria 2518
173 Ga0070664_100001189 3300005564 Bacteria 20725
174 Ga0070664_100366178 3300005564 Bacteria 1313
175 Ga0068857_100012484 3300005577 Bacteria 7399
176 Ga0068857_100054554 3300005577 Bacteria 3547
177 Ga0068857_100186618 3300005577 Bacteria 1888
178 Ga0068854_100002196 3300005578 Bacteria 11999
179 Ga0068856_100031138 3300005614 Bacteria 5218
180 Ga0068856_100032411 3300005614 Bacteria 5115
181 Ga0068856_100050005 3300005614 Bacteria 4120
182 Ga0068856_100177027 3300005614 Bacteria 2146
183 Ga0068856_100188635 3300005614 Bacteria 2075
184 Ga0068856_100227229 3300005614 Bacteria 1882
185 Ga0070702_100000252 3300005615 Bacteria 18230
186 Ga0070702_100019881 3300005615 Bacteria 3510
187 Ga0070702_100038061 3300005615 Bacteria 2675
188 Ga0070702_100156110 3300005615 Bacteria 1470
189 Ga0068852_100018879 3300005616 Bacteria 5444
190 Ga0068852_100047617 3300005616 Bacteria 3658
191 Ga0068852_100191948 3300005616 Bacteria 1928
192 Ga0068859_100001857 3300005617 Bacteria 21468
193 Ga0068859_100019700 3300005617 Bacteria 6776
194 Ga0068859_100030262 3300005617 Bacteria 5432
195 Ga0068859_100038886 3300005617 Bacteria 4772
196 Ga0068859_100063907 3300005617 Bacteria 3712
197 Ga0068864_100055401 3300005618 Bacteria 3423
198 Ga0068864_100184358 3300005618 Bacteria 1910
199 Ga0068866_10002581 3300005718 Bacteria 7476
200 Ga0068866_10010288 3300005718 Bacteria 4005
201 Ga0068861_100009286 3300005719 Bacteria 6787
202 Ga0068861_100053137 3300005719 Bacteria 3081
203 Ga0068861_100082531 3300005719 Bacteria 2519
204 Ga0068861_100088673 3300005719 Bacteria 2436
205 Ga0068861_100106931 3300005719 Bacteria 2236
206 Ga0068851_10000124 3300005834 Bacteria 41585
207 Ga0068870_10001152 3300005840 Bacteria 10575
208 Ga0068863_100015607 3300005841 Bacteria 7297
209 Ga0068863_100034697 3300005841 Bacteria 4804
210 Ga0068863_100040994 3300005841 Bacteria 4402
211 Ga0068863_100048819 3300005841 Bacteria 4012
212 Ga0068863_100055479 3300005841 Bacteria 3752
213 Ga0068863_100077002 3300005841 Bacteria 3156
214 Ga0068863_100156177 3300005841 Bacteria 2184
215 Ga0068863_100390572 3300005841 Bacteria 1360
216 Ga0068858_100000032 3300005842 Bacteria 142794
217 Ga0068858_100000175 3300005842 Bacteria 68239
218 Ga0068858_100121712 3300005842 Bacteria 2441
219 Ga0068858_100121732 3300005842 Bacteria 2440
220 Ga0068860_100000085 3300005843 Bacteria 166269
221 Ga0068860_100000112 3300005843 Bacteria 130953
222 Ga0068860_100023080 3300005843 Bacteria 6017
223 Ga0068860_100056291 3300005843 Bacteria 3739
224 Ga0068862_100001577 3300005844 Bacteria 20769
225 Ga0068862_100102490 3300005844 Bacteria 2505
226 Ga0068862_100130004 3300005844 Bacteria 2226
227 Ga0068862_100283589 3300005844 Bacteria 1519
228 Ga0081455_10001891 3300005937 Bacteria 25187
229 Ga0081455_10005347 3300005937 Bacteria 14103
230 Ga0081455_10007359 3300005937 Bacteria 11605
231 Ga0081455_10090029 3300005937 Bacteria 2489
232 Ga0081455_10142666 3300005937 Bacteria 1858
233 Ga0081538_10001227 3300005981 Bacteria 26904
234 Ga0081538_10038909 3300005981 Bacteria 3058
235 Ga0081540_1003275 3300005983 Bacteria 12878
236 Ga0081540_1005254 3300005983 Bacteria 9691
237 Ga0081540_1010341 3300005983 Bacteria 6328
238 Ga0081539_10001305 3300005985 Bacteria 43590
239 Ga0081539_10001973 3300005985 Bacteria 31246
240 Ga0081539_10020787 3300005985 Bacteria 4416
241 Ga0070717_10055531 3300006028 Bacteria 3268
242 Ga0070717_10096763 3300006028 Bacteria 2500
243 Ga0070717_10274918 3300006028 Bacteria 1492
244 Ga0070717_10338763 3300006028 Bacteria 1343
245 Ga0075365_10002419 3300006038 Bacteria 9147
246 Ga0075365_10018831 3300006038 Bacteria 4252
247 Ga0075365_10035009 3300006038 Bacteria 3246
248 Ga0075365_10038497 3300006038 Bacteria 3109
249 Ga0075365_10043570 3300006038 Bacteria 2938
250 Ga0075365_10213262 3300006038 Bacteria 1354
251 Ga0075368_10054756 3300006042 Bacteria 1590
252 Ga0075363_100000882 3300006048 Bacteria 10552
253 Ga0075363_100002130 3300006048 Bacteria 7956
254 Ga0075363_100009173 3300006048 Bacteria 4645
255 Ga0075363_100014328 3300006048 Bacteria 3870
256 Ga0075363_100017745 3300006048 Bacteria 3534
257 Ga0075364_10003955 3300006051 Bacteria 8503
258 Ga0075364_10004377 3300006051 Bacteria 8113
259 Ga0075364_10007221 3300006051 Bacteria 6583
260 Ga0075364_10019257 3300006051 Bacteria 4282
261 Ga0075364_10020109 3300006051 Bacteria 4198
262 Ga0075364_10030027 3300006051 Bacteria 3487
263 Ga0075364_10091633 3300006051 Bacteria 2017
264 Ga0075432_10031113 3300006058 Bacteria 1847
265 Ga0070715_10001858 3300006163 Bacteria 6315
266 Ga0070715_10010123 3300006163 Bacteria 3350
267 Ga0070715_10037487 3300006163 Bacteria 2006
268 Ga0070716_100001032 3300006173 Bacteria 12191
269 Ga0070716_100007759 3300006173 Bacteria 5297
270 Ga0070716_100023759 3300006173 Bacteria 3255
271 Ga0070712_100021261 3300006175 Bacteria 4259
272 Ga0070712_100024582 3300006175 Bacteria 3994
273 Ga0070712_100132874 3300006175 Bacteria 1888
274 Ga0075367_10002786 3300006178 Bacteria 8101
275 Ga0075367_10040651 3300006178 Bacteria 2716
276 Ga0075367_10096811 3300006178 Bacteria 1800
277 Ga0075369_10001816 3300006186 Bacteria 7442
278 Ga0075369_10004962 3300006186 Bacteria 4953
279 Ga0075369_10032463 3300006186 Bacteria 2209
280 Ga0075369_10070535 3300006186 Bacteria 1537
281 Ga0075370_10018399 3300006353 Bacteria 3791
282 Ga0075370_10058776 3300006353 Bacteria 2187
283 Ga0068871_100292839 3300006358 Bacteria 1427
284 Ga0075428_100000416 3300006844 Bacteria 42412
285 Ga0075428_100000630 3300006844 Bacteria 36085
286 Ga0075428_100008931 3300006844 Bacteria 11121
287 Ga0075428_100016382 3300006844 Bacteria 8190
288 Ga0075428_100307936 3300006844 Bacteria 1703
289 Ga0075430_100000876 3300006846 Bacteria 23636
290 Ga0075430_100001812 3300006846 Bacteria 17488
291 Ga0075430_100004627 3300006846 Bacteria 11575
292 Ga0075430_100053863 3300006846 Bacteria 3387
293 Ga0075431_100001436 3300006847 Bacteria 21935
294 Ga0075431_100002862 3300006847 Bacteria 16694
295 Ga0075431_100143546 3300006847 Bacteria 2460
296 Ga0075433_10003068 3300006852 Bacteria 12833
297 Ga0075433_10046700 3300006852 Bacteria 3767
298 Ga0075433_10073782 3300006852 Bacteria 3002
299 Ga0075433_10189043 3300006852 Archaea 1832
300 Ga0075434_100003178 3300006871 Bacteria 14645
301 Ga0075434_100311857 3300006871 Bacteria 1593
302 Ga0075429_100000244 3300006880 Bacteria 37496
303 Ga0075429_100006508 3300006880 Bacteria 10119
304 Ga0075429_100020851 3300006880 Bacteria 5688
305 Ga0068865_100000680 3300006881 Bacteria 19178
306 Ga0068865_100019322 3300006881 Bacteria 4408
307 Ga0075436_100010015 3300006914 Bacteria 6484
308 Ga0075436_100085986 3300006914 Bacteria 2184
309 Ga0075436_100095390 3300006914 Bacteria 2069
310 Ga0097620_100001857 3300006931 Bacteria 21468
311 Ga0097620_100019700 3300006931 Bacteria 6776
312 Ga0097620_100030263 3300006931 Bacteria 5432
313 Ga0097620_100038886 3300006931 Bacteria 4772
314 Ga0097620_100063914 3300006931 Bacteria 3712
315 Ga0075435_100004538 3300007076 Bacteria 9545
316 Ga0075435_100189592 3300007076 Unclassified 1740
317 Ga0105251_10015488 3300009011 Bacteria 4165
318 Ga0105251_10057996 3300009011 Bacteria 1829
319 Ga0105244_10004000 3300009036 Bacteria 10314
320 Ga0105240_10023577 3300009093 Bacteria 8133
321 Ga0105240_10033631 3300009093 Bacteria 6620
322 Ga0111539_10053176 3300009094 Bacteria 4820
323 Ga0111539_10452066 3300009094 Bacteria 1496
324 Ga0105245_10001865 3300009098 Bacteria 19158
325 Ga0105245_10030109 3300009098 Bacteria 4799
326 Ga0105245_10040683 3300009098 Bacteria 4142
327 Ga0105245_10042678 3300009098 Bacteria 4046
328 Ga0105245_10083844 3300009098 Bacteria 2918
329 Ga0105245_10225790 3300009098 Bacteria 1809
330 Ga0105245_10296646 3300009098 Bacteria 1584
331 Ga0105247_10000007 3300009101 Bacteria 409490
332 Ga0105247_10000164 3300009101 Bacteria 64953
333 Ga0105247_10001456 3300009101 Bacteria 17102
334 Ga0105247_10004913 3300009101 Bacteria 8501
335 Ga0105247_10013514 3300009101 Bacteria 4896
336 Ga0105247_10038821 3300009101 Bacteria 2908
337 Ga0114129_10000723 3300009147 Bacteria 41902
338 Ga0114129_10006158 3300009147 Bacteria 17018
339 Ga0114129_10009646 3300009147 Bacteria 13775
340 Ga0114129_10012498 3300009147 Bacteria 12087
341 Ga0114129_10018283 3300009147 Bacteria 9983
342 Ga0114129_10032957 3300009147 Bacteria 7321
343 Ga0114129_10074178 3300009147 Bacteria 4739
344 Ga0114129_10178042 3300009147 Bacteria 2895
345 Ga0105243_10002145 3300009148 Bacteria 16675
346 Ga0105243_10003603 3300009148 Bacteria 12482
347 Ga0105243_10019596 3300009148 Bacteria 5128
348 Ga0105243_10053995 3300009148 Bacteria 3188
349 Ga0105243_10083040 3300009148 Bacteria 2620
350 Ga0105241_10000211 3300009174 Bacteria 43844
351 Ga0105241_10004546 3300009174 Bacteria 10265
352 Ga0105241_10107752 3300009174 Bacteria 2226
353 Ga0105241_10117969 3300009174 Bacteria 2133
354 Ga0105242_10013158 3300009176 Bacteria 6385
355 Ga0105242_10057362 3300009176 Bacteria 3189
356 Ga0105248_10002480 3300009177 Bacteria 20511
357 Ga0105248_10003147 3300009177 Bacteria 18262
358 Ga0105248_10007605 3300009177 Bacteria 11903
359 Ga0105248_10013762 3300009177 Bacteria 8906
360 Ga0105248_10018635 3300009177 Bacteria 7675
361 Ga0105248_10025426 3300009177 Bacteria 6583
362 Ga0105248_10059757 3300009177 Bacteria 4282
363 Ga0105248_10070636 3300009177 Bacteria 3921
364 Ga0105248_10092277 3300009177 Bacteria 3410
365 Ga0105237_10002337 3300009545 Bacteria 23560
366 Ga0105237_10048489 3300009545 Bacteria 4270
367 Ga0105237_10175054 3300009545 Bacteria 2146
368 Ga0105237_10247190 3300009545 Bacteria 1786
369 Ga0105238_10029500 3300009551 Bacteria 5588
370 Ga0105238_10199854 3300009551 Bacteria 1974
371 Ga0105238_10318583 3300009551 Bacteria 1541
372 Ga0105249_10000001 3300009553 Bacteria 504948
373 Ga0105249_10001870 3300009553 Bacteria 18265
374 Ga0105249_10016303 3300009553 Bacteria 6590
375 Ga0105249_10028646 3300009553 Bacteria 5027
376 Ga0105249_10122582 3300009553 Bacteria 2472
377 Ga0105239_10037404 3300010375 Bacteria 5321
378 Ga0105239_10037820 3300010375 Bacteria 5288
379 Ga0105239_10213248 3300010375 Bacteria 2165
380 Ga0105239_10221394 3300010375 Bacteria 2122
381 Ga0105246_10016299 3300011119 Bacteria 4704
382 Ga0105246_10020035 3300011119 Bacteria 4287
383 Ga0157371_10063256 3300013102 Bacteria 2623
384 Ga0157370_10010594 3300013104 Bacteria 9706
385 Ga0157370_10024520 3300013104 Bacteria 5973
386 Ga0157370_10069579 3300013104 Bacteria 3323
387 Ga0157370_10297806 3300013104 Bacteria 1489
388 Ga0157369_10003546 3300013105 Bacteria 18533
389 Ga0157369_10003610 3300013105 Bacteria 18383
390 Ga0157369_10013234 3300013105 Bacteria 9333
391 Ga0157369_10015580 3300013105 Bacteria 8566
392 Ga0157369_10095834 3300013105 Bacteria 3166
393 Ga0157369_10101407 3300013105 Bacteria 3067
394 Ga0157369_10156750 3300013105 Bacteria 2405
395 Ga0157369_10179918 3300013105 Bacteria 2225
396 Ga0157369_10228215 3300013105 Bacteria 1947
397 Ga0157374_10022265 3300013296 Bacteria 5651
398 Ga0157374_10105285 3300013296 Bacteria 2709
399 Ga0157374_10161367 3300013296 Bacteria 2183
400 Ga0157374_10186409 3300013296 Bacteria 2028
401 Ga0157374_10191161 3300013296 Bacteria 2002
402 Ga0157378_10009029 3300013297 Bacteria 8678
403 Ga0157378_10035250 3300013297 Bacteria 4425
404 Ga0163162_10016133 3300013306 Bacteria 7302
405 Ga0163162_10020493 3300013306 Bacteria 6498
406 Ga0163162_10145440 3300013306 Bacteria 2486
407 Ga0157372_10002203 3300013307 Bacteria 21158
408 Ga0157372_10003317 3300013307 Bacteria 17389
409 Ga0157372_10305276 3300013307 Bacteria 1852
410 Ga0157372_10465758 3300013307 Bacteria 1473
411 Ga0157375_10011217 3300013308 Bacteria 7907
412 Ga0157375_10049534 3300013308 Bacteria 4117
413 Ga0157375_10109831 3300013308 Bacteria 2854
414 Ga0157375_10153028 3300013308 Bacteria 2443
415 Ga0163163_10009670 3300014325 Bacteria 8626
416 Ga0163163_10016347 3300014325 Bacteria 6890
417 Ga0163163_10109690 3300014325 Bacteria 2787
418 Ga0163163_10126143 3300014325 Bacteria 2597
419 Ga0163163_10137611 3300014325 Bacteria 2483
420 Ga0163163_10366663 3300014325 Bacteria 1497
421 Ga0157380_10030521 3300014326 Bacteria 4129
422 Ga0157380_10049854 3300014326 Bacteria 3304
423 Ga0157377_10026431 3300014745 Bacteria 3106
424 Ga0157377_10031449 3300014745 Bacteria 2884
425 Ga0157379_10000802 3300014968 Bacteria 25461
426 Ga0157379_10012652 3300014968 Bacteria 7375
427 Ga0157379_10021056 3300014968 Bacteria 5771
428 Ga0157379_10075892 3300014968 Bacteria 3010
429 Ga0157379_10199641 3300014968 Bacteria 1809
430 Ga0157379_10202568 3300014968 Bacteria 1795
431 Ga0157376_10056950 3300014969 Bacteria 3268
432 Ga0157376_10101412 3300014969 Bacteria 2516
433 Ga0157376_10179127 3300014969 Bacteria 1936
434 Ga0163161_10007436 3300017792 Bacteria 7568
435 Ga0163161_10010399 3300017792 Bacteria 6443
436 Ga0163161_10038113 3300017792 Bacteria 3447
437 Ga0206353_11145561 3300020082 Bacteria 2999
438 Ga0213873_10000096 3300021358 Bacteria 17586
439 Ga0213876_10008265 3300021384 Bacteria 5631
440 Ga0213876_10020805 3300021384 Bacteria 3469
441 Ga0213875_10000455 3300021388 Bacteria 35424
442 Ga0213875_10011610 3300021388 Bacteria 4377
443 Ga0213875_10035249 3300021388 Bacteria 2361
444 Ga0207427_100126 3300025231 Bacteria 95170
445 Ga0209437_100585 3300025233 Bacteria 23238
446 Ga0209148_1004143 3300025254 Bacteria 3651
447 Ga0209129_1000079 3300025258 Bacteria 187308
448 Ga0209233_1000014 3300025261 Bacteria 996641
449 Ga0209673_1006798 3300025273 Bacteria 5432
450 Ga0209025_1001940 3300025294 Bacteria 23871
451 Ga0209051_1000011 3300025303 Bacteria 610828
452 Ga0209051_1000795 3300025303 Bacteria 33193
453 Ga0209051_1002312 3300025303 Bacteria 13876
454 Ga0209051_1017900 3300025303 Bacteria 3153
455 Ga0207656_10000001 3300025321 Bacteria 1323684
456 Ga0207656_10000003 3300025321 Bacteria 771644
457 Ga0207655_1005143 3300025728 Bacteria 9004
458 Ga0207655_1049401 3300025728 Bacteria 1718
459 Ga0207713_1012442 3300025735 Bacteria 4547
460 Ga0207682_10007444 3300025893 Bacteria 4364
461 Ga0207692_10001723 3300025898 Bacteria 8283
462 Ga0207692_10003209 3300025898 Bacteria 6361
463 Ga0207692_10007932 3300025898 Bacteria 4375
464 Ga0207642_10002272 3300025899 Bacteria 5982
465 Ga0207710_10000013 3300025900 Bacteria 409402
466 Ga0207710_10000082 3300025900 Bacteria 138091
467 Ga0207710_10000178 3300025900 Bacteria 64962
468 Ga0207710_10001332 3300025900 Bacteria 12412
469 Ga0207710_10018838 3300025900 Bacteria 2939
470 Ga0207710_10051974 3300025900 Bacteria 1842
471 Ga0207688_10001000 3300025901 Bacteria 14400
472 Ga0207688_10002930 3300025901 Bacteria 9278
473 Ga0207688_10003558 3300025901 Bacteria 8503
474 Ga0207680_10055045 3300025903 Bacteria 2396
475 Ga0207680_10065139 3300025903 Bacteria 2236
476 Ga0207647_10031084 3300025904 Bacteria 3439
477 Ga0207647_10067875 3300025904 Bacteria 2159
478 Ga0207685_10006158 3300025905 Bacteria 3241
479 Ga0207699_10003242 3300025906 Bacteria 7750
480 Ga0207699_10008552 3300025906 Bacteria 5059
481 Ga0207699_10044092 3300025906 Bacteria 2595
482 Ga0207645_10011165 3300025907 Bacteria 6144
483 Ga0207645_10067665 3300025907 Bacteria 2283
484 Ga0207643_10000642 3300025908 Bacteria 21849
485 Ga0207643_10053204 3300025908 Bacteria 2300
486 Ga0207705_10000595 3300025909 Bacteria 30272
487 Ga0207705_10015540 3300025909 Bacteria 5462
488 Ga0207705_10015936 3300025909 Bacteria 5396
489 Ga0207705_10036392 3300025909 Bacteria 3523
490 Ga0207705_10050987 3300025909 Bacteria 2979
491 Ga0207705_10242994 3300025909 Bacteria 1372
492 Ga0207684_10011027 3300025910 Bacteria 7921
493 Ga0207684_10085908 3300025910 Bacteria 2680
494 Ga0207684_10110326 3300025910 Bacteria 2355
495 Ga0207684_10299946 3300025910 Bacteria 1385
496 Ga0207654_10000003 3300025911 Bacteria 1030378
497 Ga0207654_10021949 3300025911 Bacteria 3400
498 Ga0207654_10081089 3300025911 Bacteria 1953
499 Ga0207654_10107808 3300025911 Bacteria 1727
500 Ga0207707_10016166 3300025912 Bacteria 6510
501 Ga0207707_10021899 3300025912 Bacteria 5586
502 Ga0207707_10022717 3300025912 Bacteria 5485
503 Ga0207707_10026215 3300025912 Bacteria 5095
504 Ga0207695_10005261 3300025913 Bacteria 17262
505 Ga0207695_10009600 3300025913 Bacteria 11949
506 Ga0207695_10035988 3300025913 Bacteria 5358
507 Ga0207695_10113003 3300025913 Bacteria 2693
508 Ga0207671_10000001 3300025914 Bacteria 1318881
509 Ga0207671_10047284 3300025914 Bacteria 3184
510 Ga0207693_10000420 3300025915 Bacteria 38541
511 Ga0207693_10002493 3300025915 Bacteria 16014
512 Ga0207693_10006587 3300025915 Bacteria 9613
513 Ga0207693_10011553 3300025915 Bacteria 7141
514 Ga0207693_10031552 3300025915 Bacteria 4187
515 Ga0207663_10005192 3300025916 Bacteria 6552
516 Ga0207663_10005313 3300025916 Bacteria 6484
517 Ga0207663_10013983 3300025916 Bacteria 4380
518 Ga0207663_10071693 3300025916 Bacteria 2236
519 Ga0207660_10009254 3300025917 Bacteria 6377
520 Ga0207660_10147980 3300025917 Bacteria 1802
521 Ga0207657_10018543 3300025919 Bacteria 6636
522 Ga0207657_10021331 3300025919 Bacteria 6100
523 Ga0207657_10038028 3300025919 Bacteria 4289
524 Ga0207649_10003700 3300025920 Bacteria 8343
525 Ga0207649_10030705 3300025920 Bacteria 3185
526 Ga0207649_10110283 3300025920 Bacteria 1837
527 Ga0207652_10001493 3300025921 Bacteria 20662
528 Ga0207652_10010256 3300025921 Bacteria 7540
529 Ga0207652_10011363 3300025921 Bacteria 7175
530 Ga0207652_10047865 3300025921 Bacteria 3653
531 Ga0207652_10126575 3300025921 Bacteria 2276
532 Ga0207652_10190258 3300025921 Bacteria 1846
533 Ga0207652_10203646 3300025921 Bacteria 1781
534 Ga0207646_10004909 3300025922 Bacteria 14315
535 Ga0207646_10224067 3300025922 Bacteria 1699
536 Ga0207681_10001110 3300025923 Bacteria 17448
537 Ga0207681_10032269 3300025923 Bacteria 3428
538 Ga0207694_10005422 3300025924 Bacteria 9817
539 Ga0207694_10055020 3300025924 Bacteria 3089
540 Ga0207694_10257031 3300025924 Bacteria 1430
541 Ga0207650_10032659 3300025925 Bacteria 3765
542 Ga0207659_10027257 3300025926 Bacteria 3866
543 Ga0207687_10001526 3300025927 Bacteria 15874
544 Ga0207687_10004349 3300025927 Bacteria 9453
545 Ga0207687_10011308 3300025927 Bacteria 5833
546 Ga0207687_10015347 3300025927 Bacteria 5021
547 Ga0207687_10024987 3300025927 Bacteria 3996
548 Ga0207687_10040902 3300025927 Bacteria 3180
549 Ga0207687_10070166 3300025927 Bacteria 2501
550 Ga0207687_10238274 3300025927 Bacteria 1440
551 Ga0207700_10004533 3300025928 Bacteria 8207
552 Ga0207700_10005586 3300025928 Bacteria 7547
553 Ga0207700_10056479 3300025928 Bacteria 2955
554 Ga0207700_10070499 3300025928 Bacteria 2687
555 Ga0207700_10209218 3300025928 Bacteria 1648
556 Ga0207700_10248327 3300025928 Bacteria 1519
557 Ga0207664_10000063 3300025929 Bacteria 113763
558 Ga0207664_10003992 3300025929 Bacteria 9941
559 Ga0207664_10006346 3300025929 Bacteria 8125
560 Ga0207664_10018596 3300025929 Bacteria 5119
561 Ga0207664_10054555 3300025929 Bacteria 3167
562 Ga0207644_10033273 3300025931 Bacteria 3601
563 Ga0207690_10018486 3300025932 Bacteria 4275
564 Ga0207690_10045554 3300025932 Bacteria 2898
565 Ga0207706_10002446 3300025933 Bacteria 18131
566 Ga0207706_10015108 3300025933 Bacteria 6988
567 Ga0207706_10051457 3300025933 Bacteria 3637
568 Ga0207706_10129662 3300025933 Bacteria 2218
569 Ga0207709_10010193 3300025935 Bacteria 5176
570 Ga0207709_10012673 3300025935 Bacteria 4648
571 Ga0207709_10032863 3300025935 Bacteria 3042
572 Ga0207709_10114899 3300025935 Bacteria 1807
573 Ga0207670_10034938 3300025936 Bacteria 3255
574 Ga0207670_10074152 3300025936 Bacteria 2361
575 Ga0207669_10000932 3300025937 Bacteria 12361
576 Ga0207669_10042240 3300025937 Bacteria 2660
577 Ga0207669_10242228 3300025937 Bacteria 1337
578 Ga0207704_10067588 3300025938 Bacteria 2249
579 Ga0207665_10001654 3300025939 Bacteria 14998
580 Ga0207665_10003273 3300025939 Bacteria 10848
581 Ga0207665_10004483 3300025939 Bacteria 9267
582 Ga0207665_10009362 3300025939 Bacteria 6430
583 Ga0207665_10013756 3300025939 Bacteria 5322
584 Ga0207691_10001332 3300025940 Bacteria 24657
585 Ga0207691_10227457 3300025940 Bacteria 1616
586 Ga0207711_10001465 3300025941 Bacteria 22000
587 Ga0207711_10001834 3300025941 Bacteria 19368
588 Ga0207711_10005962 3300025941 Bacteria 10300
589 Ga0207711_10129430 3300025941 Bacteria 2262
590 Ga0207711_10203309 3300025941 Bacteria 1808
591 Ga0207711_10253167 3300025941 Bacteria 1617
592 Ga0207689_10000187 3300025942 Bacteria 53919
593 Ga0207689_10002944 3300025942 Bacteria 15736
594 Ga0207689_10006655 3300025942 Bacteria 10192
595 Ga0207689_10015723 3300025942 Bacteria 6407
596 Ga0207689_10023181 3300025942 Bacteria 5211
597 Ga0207661_10001731 3300025944 Bacteria 14929
598 Ga0207661_10005113 3300025944 Bacteria 9208
599 Ga0207661_10056083 3300025944 Bacteria 3162
600 Ga0207661_10107587 3300025944 Bacteria 2353
601 Ga0207661_10123319 3300025944 Bacteria 2209
602 Ga0207679_10007877 3300025945 Bacteria 6767
603 Ga0207667_10005915 3300025949 Bacteria 14898
604 Ga0207667_10012713 3300025949 Bacteria 9671
605 Ga0207667_10027190 3300025949 Bacteria 6234
606 Ga0207667_10027909 3300025949 Bacteria 6136
607 Ga0207667_10038335 3300025949 Bacteria 5120
608 Ga0207667_10137161 3300025949 Bacteria 2519
609 Ga0207712_10000006 3300025961 Bacteria 573204
610 Ga0207712_10011671 3300025961 Bacteria 5600
611 Ga0207712_10233252 3300025961 Bacteria 1478
612 Ga0207668_10001742 3300025972 Bacteria 12748
613 Ga0207640_10004946 3300025981 Bacteria 7242
614 Ga0207640_10016616 3300025981 Bacteria 4286
615 Ga0207640_10042940 3300025981 Bacteria 2886
616 Ga0207658_10000970 3300025986 Bacteria 23684
617 Ga0207658_10009505 3300025986 Bacteria 6600
618 Ga0207658_10057863 3300025986 Bacteria 2882
619 Ga0207658_10176404 3300025986 Bacteria 1765
620 Ga0207677_10042913 3300026023 Bacteria 3003
621 Ga0207677_10048470 3300026023 Bacteria 2861
622 Ga0207677_10052078 3300026023 Bacteria 2779
623 Ga0207677_10067825 3300026023 Bacteria 2500
624 Ga0207677_10143290 3300026023 Bacteria 1833
625 Ga0207677_10225495 3300026023 Bacteria 1506
626 Ga0207703_10000015 3300026035 Bacteria 287079
627 Ga0207703_10000131 3300026035 Bacteria 90186
628 Ga0207703_10013056 3300026035 Bacteria 6473
629 Ga0207703_10021554 3300026035 Bacteria 5045
630 Ga0207703_10218624 3300026035 Bacteria 1702
631 Ga0207639_10005218 3300026041 Bacteria 8764
632 Ga0207639_10019729 3300026041 Bacteria 4813
633 Ga0207639_10130697 3300026041 Bacteria 2078
634 Ga0207678_10002354 3300026067 Bacteria 17155
635 Ga0207678_10011889 3300026067 Bacteria 7643
636 Ga0207678_10019054 3300026067 Bacteria 6027
637 Ga0207678_10032883 3300026067 Bacteria 4520
638 Ga0207678_10037802 3300026067 Bacteria 4198
639 Ga0207678_10075426 3300026067 Bacteria 2889
640 Ga0207708_10000123 3300026075 Bacteria 60071
641 Ga0207708_10008837 3300026075 Bacteria 7456
642 Ga0207708_10019476 3300026075 Bacteria 5116
643 Ga0207708_10084696 3300026075 Bacteria 2438
644 Ga0207702_10004958 3300026078 Bacteria 11692
645 Ga0207702_10019652 3300026078 Bacteria 5592
646 Ga0207702_10044872 3300026078 Bacteria 3716
647 Ga0207702_10118513 3300026078 Bacteria 2365
648 Ga0207702_10171037 3300026078 Bacteria 1992
649 Ga0207702_10174634 3300026078 Bacteria 1973
650 Ga0207641_10022729 3300026088 Bacteria 5163
651 Ga0207641_10031413 3300026088 Bacteria 4404
652 Ga0207641_10041605 3300026088 Bacteria 3851
653 Ga0207641_10126696 3300026088 Bacteria 2287
654 Ga0207648_10009571 3300026089 Bacteria 9270
655 Ga0207648_10023728 3300026089 Bacteria 5489
656 Ga0207648_10058974 3300026089 Bacteria 3347
657 Ga0207676_10001957 3300026095 Bacteria 15009
658 Ga0207674_10009940 3300026116 Bacteria 10823
659 Ga0207674_10020299 3300026116 Bacteria 7181
660 Ga0207674_10049467 3300026116 Bacteria 4299
661 Ga0207675_100004425 3300026118 Bacteria 13581
662 Ga0207675_100036517 3300026118 Bacteria 4583
663 Ga0207675_100086914 3300026118 Bacteria 2936
664 Ga0207675_100146475 3300026118 Bacteria 2245
665 Ga0207675_100192367 3300026118 Bacteria 1957
666 Ga0207675_100219272 3300026118 Bacteria 1832
667 Ga0207683_10003430 3300026121 Bacteria 13814
668 Ga0207683_10010756 3300026121 Bacteria 7801
669 Ga0207683_10024562 3300026121 Bacteria 5192
670 Ga0207683_10115208 3300026121 Bacteria 2409
671 Ga0207683_10125260 3300026121 Bacteria 2308
672 Ga0207683_10178115 3300026121 Bacteria 1927
673 Ga0207683_10305466 3300026121 Bacteria 1456
674 Ga0207698_10003180 3300026142 Bacteria 9852
675 Ga0207698_10023505 3300026142 Bacteria 4307
676 Ga0207698_10079070 3300026142 Bacteria 2644
677 Ga0207698_10080506 3300026142 Bacteria 2624
678 Ga0207698_10154594 3300026142 Bacteria 1996
679 Ga0207428_10068649 3300027907 Bacteria 2788
680 Ga0207428_10079774 3300027907 Bacteria 2558
681 Ga0207428_10099720 3300027907 Bacteria 2245
682 Ga0268266_10007851 3300028379 Bacteria 9561
683 Ga0268266_10024077 3300028379 Bacteria 5181
684 Ga0268266_10031295 3300028379 Bacteria 4518
685 Ga0268266_10064306 3300028379 Bacteria 3169
686 Ga0268266_10068211 3300028379 Bacteria 3079
687 Ga0268265_10000016 3300028380 Bacteria 299380
688 Ga0268265_10084439 3300028380 Bacteria 2517
689 Ga0268265_10273693 3300028380 Bacteria 1507
690 Ga0268264_10000026 3300028381 Bacteria 459088
691 Ga0268264_10000031 3300028381 Bacteria 409525
692 Ga0268264_10012141 3300028381 Bacteria 7092
693 Ga0268264_10052844 3300028381 Bacteria 3388
694 Ga0268264_10145580 3300028381 Bacteria 2118
695 Ga0265334_10000839 3300028573 Bacteria 15353
696 Ga0307515_10014277 3300028794 Bacteria 14747
697 Ga0307515_10021795 3300028794 Bacteria 11336
698 Ga0307515_10022335 3300028794 Bacteria 11156
699 Ga0307511_10106788 3300030521 Bacteria 1805
700 Ga0307512_10005170 3300030522 Bacteria 13762
701 Ga0307512_10009276 3300030522 Bacteria 9496
702 Ga0307512_10020281 3300030522 Bacteria 6024
703 Ga0307512_10047890 3300030522 Bacteria 3468
704 Ga0265340_10035175 3300031247 Bacteria 2488
705 Ga0265340_10040806 3300031247 Bacteria 2284
706 Ga0265327_10000041 3300031251 Bacteria 288506
707 Ga0265327_10001529 3300031251 Bacteria 28541
708 Ga0265327_10008570 3300031251 Bacteria 7589
709 Ga0265327_10029384 3300031251 Bacteria 3128
710 Ga0307513_10000001 3300031456 Bacteria 1660464
711 Ga0307513_10015478 3300031456 Bacteria 9246
712 Ga0307513_10022497 3300031456 Bacteria 7404
713 Ga0307408_100019307 3300031548 Bacteria 4588
714 Ga0307408_100022759 3300031548 Bacteria 4262
715 Ga0307408_100035646 3300031548 Bacteria 3492
716 Ga0307408_100064742 3300031548 Bacteria 2679
717 Ga0307408_100325912 3300031548 Bacteria 1295
718 Ga0265313_10035630 3300031595 Bacteria 2504
719 Ga0265313_10040218 3300031595 Bacteria 2313
720 Ga0307508_10001163 3300031616 Bacteria 30276
721 Ga0307508_10007864 3300031616 Bacteria 9897
722 Ga0307508_10024539 3300031616 Bacteria 5472
723 Ga0307508_10074409 3300031616 Bacteria 2972
724 Ga0307514_10040454 3300031649 Bacteria 3675
725 Ga0307514_10082332 3300031649 Bacteria 2375
726 Ga0316575_10063963 3300031665 Bacteria 1472
727 Ga0265314_10057721 3300031711 Bacteria 2663
728 Ga0265342_10041432 3300031712 Bacteria 2789
729 Ga0265342_10118549 3300031712 Bacteria 1492
730 Ga0316576_10000511 3300031727 Bacteria 18233
731 Ga0316576_10017182 3300031727 Bacteria 4908
732 Ga0316576_10017551 3300031727 Bacteria 4866
733 Ga0316576_10048395 3300031727 Bacteria 3084
734 Ga0316576_10140041 3300031727 Bacteria 1821
735 Ga0316578_10036615 3300031728 Bacteria 2824
736 Ga0316578_10081290 3300031728 Bacteria 1928
737 Ga0316578_10105522 3300031728 Bacteria 1690
738 Ga0307516_10003100 3300031730 Bacteria 21615
739 Ga0316577_10056287 3300031733 Bacteria 2194
740 Ga0307413_10042245 3300031824 Bacteria 2677
741 Ga0307518_10048571 3300031838 Bacteria 3085
742 Ga0307410_10024068 3300031852 Bacteria 3798
743 Ga0307410_10024166 3300031852 Bacteria 3792
744 Ga0307410_10057129 3300031852 Bacteria 2656
745 Ga0307410_10068104 3300031852 Bacteria 2457
746 Ga0307410_10109058 3300031852 Bacteria 2000
747 Ga0307410_10155605 3300031852 Bacteria 1707
748 Ga0307406_10068534 3300031901 Bacteria 2316
749 Ga0307406_10083514 3300031901 Bacteria 2130
750 Ga0307406_10093638 3300031901 Bacteria 2029
751 Ga0307406_10093771 3300031901 Bacteria 2028
752 Ga0307407_10080026 3300031903 Bacteria 1973
753 Ga0307407_10173283 3300031903 Bacteria 1423
754 Ga0307412_10029765 3300031911 Bacteria 3429
755 Ga0307409_100008616 3300031995 Bacteria 6202
756 Ga0307409_100021231 3300031995 Bacteria 4448
757 Ga0307409_100058000 3300031995 Bacteria 3004
758 Ga0307409_100107967 3300031995 Bacteria 2326
759 Ga0307409_100276950 3300031995 Bacteria 1548
760 Ga0307409_100385132 3300031995 Bacteria 1334
761 Ga0307416_100015187 3300032002 Bacteria 5307
762 Ga0307416_100039444 3300032002 Bacteria 3657
763 Ga0307416_100133681 3300032002 Bacteria 2239
764 Ga0307416_100232592 3300032002 Bacteria 1778
765 Ga0307416_100240066 3300032002 Bacteria 1755
766 Ga0307416_100270491 3300032002 Archaea 1668
767 Ga0307416_100424511 3300032002 Bacteria 1375
768 Ga0307414_10107423 3300032004 Bacteria 2115
769 Ga0307414_10268980 3300032004 Bacteria 1426
770 Ga0307411_10001113 3300032005 Bacteria 10472
771 Ga0307411_10248123 3300032005 Bacteria 1398
772 Ga0307415_100005815 3300032126 Bacteria 6592
773 Ga0307415_100023748 3300032126 Bacteria 3814
774 Ga0307415_100032681 3300032126 Bacteria 3368
775 Ga0307415_100037663 3300032126 Bacteria 3180
776 Ga0307415_100052500 3300032126 Bacteria 2773
777 Ga0307415_100114408 3300032126 Bacteria 2008
778 Ga0307415_100315876 3300032126 Bacteria 1300
779 Ga0316583_10010209 3300032133 Bacteria 3383
780 Ga0316580_10016328 3300032139 Bacteria 2278
781 Ga0307510_10008263 3300033180 Bacteria 12404
782 Ga0373930_0002591 3300034816 Bacteria 2807
783 Ga0373948_0001069 3300034817 Bacteria 3702
784 Ga0373934_0000014 3300035086 Bacteria 59312
785 Ga0373934_0019070 3300035086 Bacteria 2630
786 Ga0373949_0013828 3300035090 Bacteria 1793
787 Ga0373951_0000127 3300035091 Bacteria 28693
788 Ga0373951_0004369 3300035091 Bacteria 3362
789 Ga0373951_0019293 3300035091 Bacteria 1554
790 Ga0373932_0003524 3300035112 Bacteria 3752
791 Ga0373953_0001755 3300035117 Bacteria 6402
792 Ga0373953_0046502 3300035117 Bacteria 1742
793 Ga0373954_0001669 3300035118 Bacteria 9091
794 Ga0373954_0034701 3300035118 Bacteria 2337
795 Ga0373956_0001414 3300035119 Bacteria 9923
796 Ga0373956_0007651 3300035119 Bacteria 4354
797 Ga0373957_0000846 3300035120 Bacteria 8012
798 Ga0373957_0001048 3300035120 Bacteria 7302
799 Ga0373943_0015990 3300035170 Bacteria 3416
800 Ga0373946_0040136 3300035171 Bacteria 1913
801 Ga0373955_0000040 3300035172 Bacteria 51762
802 Ga0373955_0003554 3300035172 Bacteria 6861
803 Ga0373961_0019195 3300035241 Bacteria 1793
804 Ga0316574_0006815 3300035398 Bacteria 6208
805 Ga0316574_0031353 3300035398 Bacteria 3224
806 Ga0316574_0040647 3300035398 Bacteria 2864
807 Ga0316574_0140967 3300035398 Bacteria 1553
808 Ga0373924_0001593 3300035410 Bacteria 7428
809 Ga0373924_0038344 3300035410 Bacteria 1954
810 Ga0373931_0019275 3300035691 Bacteria 3404
811 Ga0373935_0013523 3300035692 Bacteria 4925
812 Ga0373933_0000085 3300035724 Bacteria 59115
813 Ga0373937_0000197 3300036401 Bacteria 59124
814 Ga0373937_0121631 3300036401 Bacteria 2432
815 Ga0373937_0123043 3300036401 Bacteria 2419
816 Ga0316584_0011739 3300036712 Bacteria 6165
817 Ga0316584_0033039 3300036712 Bacteria 3830
818 Ga0316584_0052838 3300036712 Bacteria 3039
819 Ga0316584_0075219 3300036712 Bacteria 2531
820 Ga0316584_0090142 3300036712 Bacteria 2295
821 Ga0395899_0002958 3300037312 Bacteria 13596
822 Ga0395899_0004671 3300037312 Bacteria 10692
823 Ga0395899_0035839 3300037312 Bacteria 3723
824 Ga0395899_0046758 3300037312 Bacteria 3223
825 Ga0395899_0049908 3300037312 Bacteria 3109
826 Ga0395899_0114071 3300037312 Bacteria 1940
827 Ga0395900_0005127 3300037418 Bacteria 13760
828 Ga0395900_0006397 3300037418 Bacteria 12279
829 Ga0395900_0010840 3300037418 Bacteria 9325
830 Ga0395900_0019678 3300037418 Bacteria 6882
831 Ga0395900_0025509 3300037418 Bacteria 6052
832 Ga0395900_0079080 3300037418 Bacteria 3379
833 Ga0395900_0102449 3300037418 Bacteria 2941
834 Ga0395900_0197109 3300037418 Bacteria 2039
835 Ga0395898_0006003 3300037466 Bacteria 13040
836 Ga0395898_0006892 3300037466 Bacteria 12089
837 Ga0395898_0013311 3300037466 Bacteria 8471
838 Ga0395898_0017536 3300037466 Bacteria 7309
839 Ga0395898_0029723 3300037466 Bacteria 5470
840 Ga0395898_0057223 3300037466 Bacteria 3800
841 Ga0395898_0077820 3300037466 Bacteria 3201
842 Ga0395898_0083918 3300037466 Bacteria 3070
843 Ga0395898_0112966 3300037466 Bacteria 2603
844 Ga0395898_0115035 3300037466 Bacteria 2577
845 Ga0395898_0324087 3300037466 Bacteria 1469
846 Ga0395898_0348124 3300037466 Bacteria 1413
847 Ga0395905_0001026 3300037471 Bacteria 35609
848 Ga0395905_0009643 3300037471 Bacteria 9423
849 Ga0395905_0303095 3300037471 Bacteria 1485
850 Ga0395905_0405009 3300037471 Bacteria 1259
851 Ga0436364_0113323 3300037853 Bacteria 5330
852 Ga0436364_0238472 3300037853 Bacteria 35445
853 Ga0436364_0418931 3300037853 Bacteria 2257
854 Ga0436364_0453470 3300037853 Bacteria 6660
855 Ga0436364_0647082 3300037853 Bacteria 2287
856 Ga0436364_1255815 3300037853 Bacteria 13267
857 Ga0436364_1390545 3300037853 Bacteria 3659
858 Ga0395901_0003412 3300038443 Bacteria 16006
859 Ga0395901_0021006 3300038443 Bacteria 6687
860 Ga0395901_0032994 3300038443 Bacteria 5342
861 Ga0395901_0054233 3300038443 Bacteria 4166
862 Ga0395901_0113011 3300038443 Bacteria 2852
863 Ga0395901_0161745 3300038443 Bacteria 2351
864 Ga0395901_0209072 3300038443 Bacteria 2043
865 Ga0436365_0613236 3300039437 Bacteria 5826
866 Ga0436365_0885952 3300039437 Bacteria 25510
867 Ga0436365_1214067 3300039437 Bacteria 31173
868 Ga0436363_0076260 3300039450 Bacteria 2214
869 Ga0436363_0265210 3300039450 Bacteria 3170
870 Ga0436363_0330623 3300039450 Bacteria 4938
871 Ga0436362_0604249 3300039453 Bacteria 12950
872 Ga0439439_0003804 3300041406 Bacteria 3352
873 Ga0439447_010755 3300041407 Bacteria 2702
874 Ga0439466_0020498 3300041411 Bacteria 2355
875 Ga0439466_0030633 3300041411 Bacteria 1843
876 Ga0439465_0008353 3300041413 Bacteria 3268
877 Ga0439465_0010651 3300041413 Bacteria 2885
878 Ga0439465_0011796 3300041413 Bacteria 2737
879 Ga0439465_0031545 3300041413 Bacteria 1688
880 Ga0451802_0335608 3300041460 Bacteria 1320
881 Ga0451802_1677789 3300041460 Bacteria 1996
882 Ga0451853_0988203 3300041512 Bacteria 1841
883 Ga0451853_2451760 3300041512 Bacteria 3750
884 Ga0439431_0000706 3300041997 Bacteria 7181
885 Ga0439433_0000016 3300041999 Bacteria 22353
886 Ga0439433_0005084 3300041999 Bacteria 2824
887 Ga0439442_000124 3300042002 Bacteria 19456
888 Ga0439442_000483 3300042002 Bacteria 9062
889 Ga0439442_006494 3300042002 Bacteria 2348
890 Ga0439442_007840 3300042002 Bacteria 2155
891 Ga0439442_012154 3300042002 Bacteria 1758
892 Ga0439432_027337 3300042006 Bacteria 1863
893 Ga0439449_0000123 3300042007 Bacteria 25838
894 Ga0439449_0044932 3300042007 Bacteria 1637
895 Ga0439452_008147 3300042010 Bacteria 3170
896 Ga0439452_027059 3300042010 Bacteria 1443
897 Ga0439463_026533 3300042016 Bacteria 1455
898 Ga0450920_001002 3300042122 Bacteria 4624
899 Ga0450920_008485 3300042122 Bacteria 1878
900 Ga0450907_000606 3300042146 Bacteria 9518
901 Ga0439434_0000220 3300042435 Bacteria 15927
902 Ga0439434_0018559 3300042435 Bacteria 2083
903 Ga0466969_0031467 3300044656 Bacteria 2701
904 Ga0466972_0017406 3300044658 Bacteria 3597
905 Ga0466972_0102840 3300044658 Bacteria 1351
906 Ga0466965_0008270 3300044683 Bacteria 4808
907 Ga0466965_0010455 3300044683 Bacteria 4329
908 Ga0466965_0014794 3300044683 Bacteria 3696
909 Ga0466965_0027934 3300044683 Bacteria 2739
910 Ga0466966_0003105 3300044684 Bacteria 10934
911 Ga0466966_0006470 3300044684 Bacteria 7752
912 Ga0466966_0012176 3300044684 Bacteria 5698
913 Ga0466966_0030188 3300044684 Bacteria 3521
914 Ga0466966_0074689 3300044684 Bacteria 2118
915 Ga0466966_0076601 3300044684 Bacteria 2088
916 Ga0466966_0078802 3300044684 Bacteria 2054
917 Ga0466966_0143115 3300044684 Bacteria 1460
918 Ga0466961_0000223 3300044693 Bacteria 38608
919 Ga0466961_0005237 3300044693 Bacteria 8166
920 Ga0466961_0014413 3300044693 Bacteria 5074
921 Ga0466961_0016492 3300044693 Bacteria 4746
922 Ga0466961_0019719 3300044693 Bacteria 4339
923 Ga0466961_0035925 3300044693 Bacteria 3181
924 Ga0466961_0049608 3300044693 Bacteria 2682
925 Ga0466961_0050180 3300044693 Bacteria 2665
926 Ga0466961_0052631 3300044693 Bacteria 2598
927 Ga0466961_0103753 3300044693 Bacteria 1790
928 Ga0466961_0107930 3300044693 Bacteria 1752
929 Ga0466961_0162785 3300044693 Bacteria 1390
930 Ga0466963_0000604 3300044694 Bacteria 17169
931 Ga0466963_0002782 3300044694 Bacteria 9861
932 Ga0466963_0104315 3300044694 Bacteria 1942
933 Ga0466964_0068658 3300044706 Bacteria 1493
934 Ga0466971_0000354 3300044719 Bacteria 17531
935 Ga0466971_0019022 3300044719 Bacteria 3048
936 Ga0466971_0023917 3300044719 Bacteria 2724
937 Ga0466971_0083518 3300044719 Bacteria 1458
938 Ga0466968_0001034 3300044735 Bacteria 9823
939 Ga0466968_0014236 3300044735 Bacteria 3141
940 Ga0466968_0046781 3300044735 Bacteria 1838
941 Ga0466970_0001205 3300044765 Bacteria 12557
942 Ga0466970_0007113 3300044765 Bacteria 5600
943 Ga0466970_0007660 3300044765 Bacteria 5414
944 Ga0466970_0026731 3300044765 Bacteria 3025
945 Ga0466970_0034538 3300044765 Bacteria 2677
946 Ga0466970_0050609 3300044765 Bacteria 2216
947 Ga0466957_0000283 3300044842 Bacteria 24756
948 Ga0466957_0004553 3300044842 Bacteria 7742
949 Ga0466957_0010194 3300044842 Bacteria 5382
950 Ga0466957_0012679 3300044842 Bacteria 4883
951 Ga0466957_0024790 3300044842 Bacteria 3552
952 Ga0466957_0043592 3300044842 Bacteria 2717
953 Ga0466957_0066258 3300044842 Bacteria 2226
954 Ga0466960_0002656 3300044901 Bacteria 6742
955 Ga0466960_0004820 3300044901 Bacteria 5301
956 Ga0466960_0005643 3300044901 Bacteria 4966
957 Ga0466960_0019496 3300044901 Bacteria 2991
958 Ga0466960_0025646 3300044901 Bacteria 2669
959 Ga0466960_0150487 3300044901 Bacteria 1243
960 Ga0466959_0009115 3300045049 Bacteria 7046
961 Ga0466959_0013261 3300045049 Bacteria 5969
962 Ga0466959_0014077 3300045049 Bacteria 5807
963 Ga0466959_0017810 3300045049 Bacteria 5210
964 Ga0466959_0022208 3300045049 Bacteria 4688
965 Ga0466959_0032930 3300045049 Bacteria 3836
966 Ga0466959_0040799 3300045049 Bacteria 3428
967 Ga0466959_0045121 3300045049 Bacteria 3246
968 Ga0466958_0000114 3300045836 Bacteria 25940
969 Ga0466958_0000748 3300045836 Bacteria 14254
970 Ga0466958_0005582 3300045836 Bacteria 6784
971 Ga0466958_0007421 3300045836 Bacteria 6031
972 Ga0466958_0020417 3300045836 Bacteria 3862
973 Ga0466958_0032227 3300045836 Bacteria 3117
974 Ga0466958_0035027 3300045836 Bacteria 2998
975 Ga0466958_0075985 3300045836 Bacteria 2061
976 Ga0466958_0098160 3300045836 Bacteria 1818
977 Ga0466967_0001120 3300045976 Bacteria 14881
978 Ga0466967_0006791 3300045976 Bacteria 8156
979 Ga0466967_0019688 3300045976 Bacteria 5434
980 Ga0466967_0024332 3300045976 Bacteria 4977
981 Ga0466967_0025471 3300045976 Bacteria 4879
982 Ga0466967_0027636 3300045976 Bacteria 4722
983 Ga0466967_0031995 3300045976 Bacteria 4437
984 Ga0466967_0075584 3300045976 Bacteria 3028
985 Ga0466967_0119314 3300045976 Bacteria 2434
986 Ga0466967_0364757 3300045976 Bacteria 1400
987 Ga0495627_039472 3300046453 Bacteria 1456
988 Ga0495627_046758 3300046453 Bacteria 1314
989 Ga0495592_0000157 3300046454 Bacteria 59697
990 Ga0495592_0064496 3300046454 Bacteria 2685
991 Ga0495603_0000552 3300046455 Bacteria 20921
992 Ga0495603_0013090 3300046455 Bacteria 5014
993 Ga0495603_0054857 3300046455 Bacteria 2361
994 Ga0495590_0000484 3300046457 Bacteria 19640
995 Ga0495629_0001111 3300046459 Bacteria 21303
996 Ga0495629_0001228 3300046459 Bacteria 20123
997 Ga0495629_0006771 3300046459 Bacteria 8470
998 Ga0495629_0014332 3300046459 Bacteria 5704
999 Ga0495638_0001596 3300046460 Bacteria 20236
1000 Ga0495638_0040952 3300046460 Bacteria 2933
1001 Ga0495638_0059658 3300046460 Bacteria 2362
1002 Ga0495641_0008500 3300046461 Bacteria 6245
1003 Ga0495641_0051617 3300046461 Bacteria 1876
1004 Ga0495651_0000115 3300046462 Bacteria 59129
1005 Ga0495651_0006516 3300046462 Bacteria 8919
1006 Ga0495651_0035816 3300046462 Bacteria 3863
1007 Ga0495653_0011549 3300046463 Bacteria 7210
1008 Ga0495653_0068042 3300046463 Bacteria 2672
1009 Ga0495580_0003950 3300046472 Bacteria 12508
1010 Ga0495582_0005171 3300046473 Bacteria 7297
1011 Ga0495605_0004092 3300046474 Bacteria 8603
1012 Ga0495639_0002427 3300046475 Bacteria 8141
1013 Ga0495639_0016313 3300046475 Bacteria 3224
1014 Ga0495639_0029477 3300046475 Bacteria 2436
1015 Ga0495664_0001861 3300046477 Bacteria 11208
1016 Ga0495664_0030935 3300046477 Bacteria 3136
1017 Ga0495585_0024459 3300046492 Bacteria 3463
1018 Ga0495594_0000581 3300046499 Bacteria 18807
1019 Ga0495607_0035772 3300046501 Bacteria 3000
1020 Ga0495583_0039585 3300046506 Bacteria 2219
1021 Ga0495608_0003716 3300046511 Bacteria 10963
1022 Ga0495616_0007512 3300046513 Bacteria 6525
1023 Ga0495618_0076007 3300046514 Bacteria 2139
1024 Ga0495628_0000492 3300046516 Bacteria 36145
1025 Ga0495628_0030926 3300046516 Bacteria 4331
1026 Ga0495630_0219288 3300046517 Bacteria 1452
1027 Ga0495631_0028018 3300046518 Bacteria 2572
1028 Ga0495632_0023354 3300046519 Bacteria 3303
1029 Ga0495632_0105050 3300046519 Bacteria 1329
1030 Ga0495637_0034811 3300046520 Bacteria 2203
1031 Ga0495643_0003144 3300046522 Bacteria 12292
1032 Ga0495643_0060299 3300046522 Bacteria 2014
1033 Ga0495648_0018440 3300046524 Bacteria 4939
1034 Ga0495648_0057527 3300046524 Bacteria 2331
1035 Ga0495666_0019999 3300046526 Bacteria 3320
1036 Ga0495666_0043441 3300046526 Bacteria 2171
1037 Ga0495652_0007274 3300046529 Bacteria 10216
1038 Ga0495652_0022385 3300046529 Bacteria 5606
1039 Ga0495652_0060817 3300046529 Bacteria 3190
1040 Ga0495652_0073275 3300046529 Bacteria 2852
1041 Ga0495665_0030387 3300046531 Bacteria 2890
1042 Ga0495640_0026843 3300046533 Bacteria 4156
1043 Ga0495586_0002370 3300046535 Bacteria 10227
1044 Ga0495586_0015897 3300046535 Bacteria 4003
1045 Ga0495586_0092857 3300046535 Bacteria 1668
1046 Ga0495587_0000123 3300046536 Bacteria 59101
1047 Ga0495587_0002547 3300046536 Bacteria 12188
1048 Ga0495609_0011345 3300046538 Bacteria 4245
1049 Ga0495645_0001555 3300046543 Bacteria 15530
1050 Ga0495645_0019225 3300046543 Bacteria 4918
1051 Ga0495645_0027772 3300046543 Bacteria 4112
1052 Ga0495645_0034357 3300046543 Bacteria 3699
1053 Ga0495645_0155719 3300046543 Bacteria 1583
1054 Ga0495622_0008572 3300046557 Bacteria 4739
1055 Ga0495622_0019863 3300046557 Bacteria 3127
1056 Ga0495622_0058800 3300046557 Bacteria 1780
1057 Ga0495633_0006910 3300046558 Bacteria 6641
1058 Ga0495667_0000107 3300046559 Bacteria 60366
1059 Ga0495667_0001041 3300046559 Bacteria 18008
1060 Ga0495667_0007253 3300046559 Bacteria 7522
1061 Ga0495668_0002662 3300046616 Bacteria 14339
1062 Ga0495634_0020569 3300046642 Bacteria 4678
1063 Ga0495611_0016203 3300046648 Bacteria 3186
1064 Ga0495635_0028622 3300046663 Bacteria 3872
1065 Ga0495588_0040447 3300046674 Bacteria 2378
1066 Ga0495657_0000169 3300046675 Bacteria 59112
1067 Ga0495657_0011577 3300046675 Bacteria 6591
1068 Ga0495657_0029164 3300046675 Bacteria 3872
1069 Ga0495657_0036625 3300046675 Bacteria 3389
1070 Ga0495599_0002521 3300046678 Bacteria 10653
1071 Ga0495599_0037427 3300046678 Bacteria 3048
1072 Ga0495599_0042368 3300046678 Bacteria 2856
1073 Ga0495623_0000166 3300046679 Bacteria 41152
1074 Ga0495623_0033496 3300046679 Bacteria 3296
1075 Ga0495623_0050024 3300046679 Bacteria 2648
1076 Ga0495646_0059942 3300046680 Bacteria 2271
1077 Ga0495646_0111000 3300046680 Bacteria 1561
1078 Ga0495658_0116082 3300046683 Bacteria 1614
1079 Ga0495658_0154287 3300046683 Bacteria 1412
1080 Ga0495613_0009856 3300046689 Bacteria 7106
1081 Ga0495613_0015671 3300046689 Bacteria 5641
1082 Ga0495613_0027353 3300046689 Bacteria 4244
1083 Ga0495613_0032534 3300046689 Bacteria 3874
1084 Ga0495624_0058068 3300046690 Bacteria 2431
1085 Ga0495624_0169833 3300046690 Bacteria 1330
1086 Ga0495589_0032868 3300046794 Bacteria 2607
1087 Ga0495600_0005572 3300046809 Bacteria 7601
1088 Ga0495600_0009464 3300046809 Bacteria 6020
1089 Ga0495600_0017124 3300046809 Bacteria 4607
1090 Ga0495581_0009107 3300047315 Bacteria 5742
1091 Ga0495581_0027592 3300047315 Bacteria 3292
1092 Ga0495581_0043604 3300047315 Bacteria 2594
1093 Ga0495604_0000161 3300047317 Bacteria 59093
1094 Ga0495604_0003057 3300047317 Bacteria 13372
1095 Ga0495604_0027138 3300047317 Bacteria 4556
1096 Ga0495604_0038371 3300047317 Bacteria 3768
1097 Ga0495604_0052981 3300047317 Bacteria 3139
1098 Ga0495636_0026434 3300047318 Bacteria 2361
1099 Ga0495674_0012623 3300047319 Bacteria 7960
1100 Ga0495674_0018404 3300047319 Bacteria 6504
1101 Ga0495674_0101431 3300047319 Bacteria 2448
1102 Ga0495672_0003416 3300047320 Bacteria 13614
1103 Ga0495672_0041435 3300047320 Bacteria 2785
1104 Ga0495672_0041850 3300047320 Bacteria 2767
1105 Ga0495676_0000233 3300047321 Bacteria 44485
1106 Ga0495676_0005210 3300047321 Bacteria 11893
1107 Ga0495676_0017972 3300047321 Bacteria 6239
1108 Ga0495676_0200323 3300047321 Bacteria 1387
1109 Ga0495680_0007013 3300047322 Bacteria 10389
1110 Ga0495680_0023511 3300047322 Bacteria 5122
1111 Ga0495680_0030600 3300047322 Bacteria 4394
1112 Ga0495683_0002632 3300047323 Bacteria 10723
1113 Ga0495683_0041213 3300047323 Bacteria 2330
1114 Ga0495687_000581 3300047443 Bacteria 42904
1115 Ga0495687_030957 3300047443 Bacteria 2460
1116 Ga0495675_0002978 3300047444 Bacteria 10167
1117 Ga0495675_0011761 3300047444 Bacteria 5499
1118 Ga0495675_0015106 3300047444 Bacteria 4882
1119 Ga0495675_0022673 3300047444 Bacteria 4003
1120 Ga0495677_0036674 3300047445 Bacteria 1791
1121 Ga0495685_012532 3300047447 Bacteria 2872
1122 Ga0495684_0050867 3300047471 Bacteria 3162
1123 Ga0495684_0122680 3300047471 Bacteria 1956
1124 Ga0495686_0092934 3300047472 Bacteria 1829
1125 Ga0495593_0017119 3300047673 Bacteria 4079
1126 Ga0495593_0047132 3300047673 Bacteria 2293
1127 Ga0495602_0000182 3300048088 Bacteria 59124
1128 Ga0495602_0075152 3300048088 Bacteria 2868
1129 Ga0495614_0006858 3300048089 Bacteria 5094
1130 Ga0496100_0000335 3300048903 Bacteria 22955
1131 Ga0496100_0003473 3300048903 Bacteria 8222
1132 Ga0496100_0018499 3300048903 Bacteria 4134
1133 Ga0496100_0067268 3300048903 Bacteria 2379
1134 Ga0496100_0125109 3300048903 Bacteria 1803
1135 Ga0496101_0000193 3300048904 Bacteria 47493
1136 Ga0496101_0001504 3300048904 Bacteria 13952
1137 Ga0496101_0001767 3300048904 Bacteria 12973
1138 Ga0496101_0015785 3300048904 Bacteria 5097
1139 Ga0496101_0031811 3300048904 Bacteria 3711
1140 Ga0496101_0038237 3300048904 Bacteria 3408
1141 Ga0496101_0056663 3300048904 Bacteria 2833
1142 Ga0496101_0215633 3300048904 Bacteria 1488
1143 Ga0496102_0000403 3300048905 Bacteria 50292
1144 Ga0496102_0000750 3300048905 Bacteria 31716
1145 Ga0496102_0021913 3300048905 Bacteria 5657
1146 Ga0496102_0031975 3300048905 Bacteria 4724
1147 Ga0496102_0032948 3300048905 Bacteria 4656
1148 Ga0496102_0139973 3300048905 Bacteria 2269
1149 Ga0496102_0147261 3300048905 Bacteria 2210
1150 Ga0496102_0198432 3300048905 Bacteria 1891
1151 Ga0496102_0202009 3300048905 Bacteria 1874
1152 Ga0496102_0284190 3300048905 Bacteria 1559
1153 Ga0496103_0000284 3300048906 Bacteria 47531
1154 Ga0496103_0001055 3300048906 Bacteria 19218
1155 Ga0496103_0002082 3300048906 Bacteria 12781
1156 Ga0496103_0042265 3300048906 Bacteria 2804
1157 Ga0496104_0012811 3300048907 Bacteria 7552
1158 Ga0496104_0025727 3300048907 Bacteria 5427
1159 Ga0496104_0039321 3300048907 Bacteria 4429
1160 Ga0496104_0059938 3300048907 Bacteria 3604
1161 Ga0496104_0093139 3300048907 Bacteria 2881
1162 Ga0496105_0002855 3300048908 Bacteria 12645
1163 Ga0496105_0021733 3300048908 Bacteria 5193
1164 Ga0496105_0036004 3300048908 Bacteria 4076
1165 Ga0496105_0050189 3300048908 Bacteria 3446
1166 Ga0496105_0062054 3300048908 Bacteria 3085
1167 Ga0496105_0069758 3300048908 Bacteria 2904
1168 Ga0496105_0187822 3300048908 Bacteria 1691
1169 Ga0496106_0000199 3300048909 Bacteria 42320
1170 Ga0496106_0005688 3300048909 Bacteria 9219
1171 Ga0496106_0008646 3300048909 Bacteria 7536
1172 Ga0496106_0014818 3300048909 Bacteria 5764
1173 Ga0496106_0017751 3300048909 Bacteria 5263
1174 Ga0496106_0058154 3300048909 Bacteria 2926
1175 Ga0496106_0163455 3300048909 Bacteria 1761
1176 Ga0496107_0001353 3300048910 Bacteria 15069
1177 Ga0496107_0003743 3300048910 Bacteria 10216
1178 Ga0496107_0013481 3300048910 Bacteria 5715
1179 Ga0496107_0014415 3300048910 Bacteria 5535
1180 Ga0496107_0067460 3300048910 Bacteria 2596
1181 Ga0496107_0202652 3300048910 Bacteria 1475
1182 Ga0496108_0000966 3300048911 Bacteria 22375
1183 Ga0496108_0006263 3300048911 Bacteria 9640
1184 Ga0496108_0012159 3300048911 Bacteria 6999
1185 Ga0496108_0022651 3300048911 Bacteria 5166
1186 Ga0496108_0045925 3300048911 Bacteria 3648
1187 Ga0496108_0051511 3300048911 Bacteria 3449
1188 Ga0496108_0060482 3300048911 Bacteria 3187
1189 Ga0496108_0125407 3300048911 Bacteria 2204
1190 Ga0496109_0001398 3300048912 Bacteria 19996
1191 Ga0496109_0008976 3300048912 Bacteria 8514
1192 Ga0496109_0013820 3300048912 Bacteria 7014
1193 Ga0496109_0038853 3300048912 Bacteria 4305
1194 Ga0496109_0053536 3300048912 Bacteria 3681
1195 Ga0496109_0066894 3300048912 Bacteria 3291
1196 Ga0496109_0078672 3300048912 Bacteria 3036
1197 Ga0496109_0114351 3300048912 Bacteria 2511
1198 Ga0496109_0171944 3300048912 Bacteria 2033
1199 Ga0496109_0257216 3300048912 Bacteria 1644
1200 Ga0496110_0003627 3300048913 Bacteria 11876
1201 Ga0496110_0010603 3300048913 Bacteria 7502
1202 Ga0496110_0020318 3300048913 Bacteria 5607
1203 Ga0496110_0028522 3300048913 Bacteria 4795
1204 Ga0496110_0032924 3300048913 Bacteria 4480
1205 Ga0496110_0056148 3300048913 Bacteria 3465
1206 Ga0496110_0071762 3300048913 Bacteria 3071
1207 Ga0496110_0080305 3300048913 Bacteria 2906
1208 Ga0496111_0045908 3300048914 Bacteria 3144
1209 Ga0496111_0057655 3300048914 Bacteria 2812
1210 Ga0496111_0095915 3300048914 Bacteria 2176
1211 Ga0496111_0218902 3300048914 Bacteria 1414
1212 Ga0496111_0256606 3300048914 Bacteria 1297
1213 Ga0496112_0002892 3300048915 Bacteria 13979
1214 Ga0496112_0017061 3300048915 Bacteria 6816
1215 Ga0496112_0018635 3300048915 Bacteria 6540
1216 Ga0496112_0066522 3300048915 Bacteria 3556
1217 Ga0496112_0181212 3300048915 Bacteria 2070
1218 Ga0496112_0197097 3300048915 Bacteria 1974
1219 Ga0496113_0006724 3300048916 Bacteria 7325
1220 Ga0496113_0007107 3300048916 Bacteria 7166
1221 Ga0496113_0122804 3300048916 Bacteria 2032
1222 Ga0496113_0297112 3300048916 Bacteria 1293
1223 Ga0496114_0000559 3300048917 Bacteria 27624
1224 Ga0496114_0001803 3300048917 Bacteria 16262
1225 Ga0496114_0008348 3300048917 Bacteria 8205
1226 Ga0496114_0015343 3300048917 Bacteria 6159
1227 Ga0496114_0017869 3300048917 Bacteria 5732
1228 Ga0496115_0003426 3300048918 Bacteria 11391
1229 Ga0496115_0010823 3300048918 Bacteria 6822
1230 Ga0496115_0019920 3300048918 Bacteria 5169
1231 Ga0496115_0020283 3300048918 Bacteria 5126
1232 Ga0496115_0059407 3300048918 Bacteria 3079
1233 Ga0496115_0101116 3300048918 Bacteria 2363
1234 Ga0496115_0124763 3300048918 Bacteria 2120
1235 Ga0496115_0151615 3300048918 Bacteria 1915
1236 Ga0496116_0000059 3300048919 Bacteria 274491
1237 Ga0496116_0031324 3300048919 Bacteria 3809
1238 Ga0496117_0000055 3300048920 Bacteria 274518
1239 Ga0496117_0002301 3300048920 Bacteria 24585
1240 Ga0496117_0003028 3300048920 Bacteria 20155
1241 Ga0496117_0029473 3300048920 Bacteria 4230
1242 Ga0496117_0034361 3300048920 Bacteria 3820
1243 Ga0496117_0057954 3300048920 Bacteria 2686
1244 Ga0496118_0000398 3300048921 Bacteria 73344
1245 Ga0496118_0000879 3300048921 Bacteria 47364
1246 Ga0496118_0002102 3300048921 Bacteria 27974
1247 Ga0496118_0009080 3300048921 Bacteria 10128
1248 Ga0496118_0045956 3300048921 Bacteria 3401
1249 Ga0496118_0072819 3300048921 Bacteria 2465
1250 Ga0496118_0099499 3300048921 Bacteria 1970
1251 Ga0496119_0000375 3300048922 Bacteria 61774
1252 Ga0496119_0010507 3300048922 Bacteria 7781
1253 Ga0496119_0016974 3300048922 Bacteria 5505
1254 Ga0496119_0018886 3300048922 Bacteria 5106
1255 Ga0496120_0000453 3300048923 Bacteria 64868
1256 Ga0496120_0004273 3300048923 Bacteria 12140
1257 Ga0496120_0011458 3300048923 Bacteria 6095
1258 Ga0496120_0016566 3300048923 Bacteria 4813
1259 Ga0496120_0016881 3300048923 Bacteria 4753
1260 Ga0496120_0089304 3300048923 Bacteria 1650
1261 Ga0496121_0000433 3300048924 Bacteria 82438
1262 Ga0496121_0001114 3300048924 Bacteria 47347
1263 Ga0496121_0011354 3300048924 Bacteria 9901
1264 Ga0496121_0043764 3300048924 Bacteria 3872
1265 Ga0496122_0001536 3300048925 Bacteria 36713
1266 Ga0496122_0008484 3300048925 Bacteria 11066
1267 Ga0496122_0009000 3300048925 Bacteria 10611
1268 Ga0496122_0099743 3300048925 Bacteria 1946
1269 Ga0496123_0001055 3300048926 Bacteria 41698
1270 Ga0496123_0054573 3300048926 Bacteria 2629
1271 Ga0496123_0088077 3300048926 Bacteria 1855
1272 Ga0496124_0000015 3300048927 Bacteria 460700
1273 Ga0496124_0000198 3300048927 Bacteria 119277
1274 Ga0496124_0007726 3300048927 Bacteria 11368
1275 Ga0496124_0007779 3300048927 Bacteria 11324
1276 Ga0496125_0000021 3300048928 Bacteria 460688
1277 Ga0496125_0000172 3300048928 Bacteria 144915
1278 Ga0496125_0003069 3300048928 Bacteria 20857
1279 Ga0496125_0020233 3300048928 Bacteria 6250
1280 Ga0496125_0051644 3300048928 Bacteria 3389
1281 Ga0496125_0210415 3300048928 Bacteria 1263
1282 Ga0496126_0000015 3300048929 Bacteria 663212
1283 Ga0496126_0000676 3300048929 Bacteria 62750
1284 Ga0496126_0005915 3300048929 Bacteria 13791
1285 Ga0496126_0008414 3300048929 Bacteria 11132
1286 Ga0496126_0009487 3300048929 Bacteria 10325
1287 Ga0496126_0064670 3300048929 Bacteria 3276
1288 Ga0496126_0084982 3300048929 Bacteria 2790
1289 Ga0496126_0217689 3300048929 Bacteria 1606
1290 Ga0501306_006485 3300049127 Bacteria 1374
1291 Ga0501031_0005824 3300049568 Bacteria 8029
1292 Ga0501031_0089703 3300049568 Bacteria 2005
1293 Ga0501032_0001836 3300049569 Bacteria 16790
1294 Ga0501032_0005443 3300049569 Bacteria 9450
1295 Ga0501032_0008992 3300049569 Bacteria 7264
1296 Ga0501032_0013197 3300049569 Bacteria 5879
1297 Ga0501033_0027710 3300049570 Bacteria 4259
1298 Ga0501033_0034053 3300049570 Bacteria 3822
1299 Ga0501033_0110295 3300049570 Bacteria 2003
1300 Ga0501033_0130203 3300049570 Bacteria 1823
1301 Ga0501034_0000015 3300049571 Bacteria 296163
1302 Ga0501034_0000543 3300049571 Bacteria 60025
1303 Ga0501034_0005064 3300049571 Bacteria 14478
1304 Ga0501034_0018586 3300049571 Bacteria 7125
1305 Ga0501034_0022037 3300049571 Bacteria 6490
1306 Ga0501034_0065426 3300049571 Bacteria 3648
1307 Ga0501034_0071162 3300049571 Bacteria 3488
1308 Ga0501034_0080618 3300049571 Bacteria 3258
1309 Ga0501034_0098570 3300049571 Bacteria 2918
1310 Ga0501034_0123536 3300049571 Bacteria 2574
1311 Ga0501034_0123811 3300049571 Bacteria 2571
1312 Ga0501034_0124822 3300049571 Bacteria 2559
1313 Ga0501034_0171816 3300049571 Bacteria 2134
1314 Ga0501034_0303310 3300049571 Bacteria 1533
1315 Ga0501034_0417429 3300049571 Bacteria 1263
1316 Ga0501036_0002530 3300049572 Bacteria 14358
1317 Ga0501036_0003852 3300049572 Bacteria 12037
1318 Ga0501036_0015135 3300049572 Bacteria 6442
1319 Ga0501036_0024970 3300049572 Bacteria 5040
1320 Ga0501036_0149485 3300049572 Bacteria 1970
1321 Ga0501036_0165471 3300049572 Bacteria 1864
1322 Ga0501037_0001123 3300049573 Bacteria 19813
1323 Ga0501037_0013330 3300049573 Bacteria 6058
1324 Ga0501037_0047486 3300049573 Bacteria 3146
1325 Ga0501037_0068478 3300049573 Bacteria 2584
1326 Ga0501037_0126288 3300049573 Bacteria 1836
1327 Ga0501038_0006115 3300049574 Bacteria 11140
1328 Ga0501038_0007725 3300049574 Bacteria 9916
1329 Ga0501038_0017810 3300049574 Bacteria 6418
1330 Ga0501038_0061692 3300049574 Bacteria 3205
1331 Ga0501038_0099827 3300049574 Bacteria 2419
1332 Ga0501038_0144817 3300049574 Bacteria 1941
1333 Ga0501038_0197175 3300049574 Bacteria 1618
1334 Ga0501039_0001048 3300049575 Bacteria 20241
1335 Ga0501039_0006498 3300049575 Bacteria 8890
1336 Ga0501039_0009678 3300049575 Bacteria 7346
1337 Ga0501040_0022837 3300049576 Bacteria 4191
1338 Ga0501040_0087038 3300049576 Bacteria 2169
1339 Ga0501041_0000703 3300049577 Bacteria 17796
1340 Ga0501041_0043969 3300049577 Bacteria 2715
1341 Ga0501041_0071309 3300049577 Bacteria 2133
1342 Ga0501042_0045990 3300049578 Bacteria 3111
1343 Ga0501042_0058123 3300049578 Bacteria 2760
1344 Ga0501042_0067621 3300049578 Bacteria 2554
1345 Ga0501042_0110801 3300049578 Bacteria 1976
1346 Ga0501043_0000606 3300049579 Bacteria 31710
1347 Ga0501043_0009509 3300049579 Bacteria 7621
1348 Ga0501043_0013569 3300049579 Bacteria 6374
1349 Ga0501043_0016803 3300049579 Bacteria 5735
1350 Ga0501043_0024460 3300049579 Bacteria 4740
1351 Ga0501043_0036812 3300049579 Bacteria 3850
1352 Ga0501043_0043569 3300049579 Bacteria 3527
1353 Ga0501043_0046336 3300049579 Bacteria 3419
1354 Ga0501043_0052392 3300049579 Bacteria 3205
1355 Ga0501043_0117528 3300049579 Bacteria 2086
1356 Ga0501043_0172766 3300049579 Bacteria 1686
1357 Ga0501046_0001735 3300049580 Bacteria 20794
1358 Ga0501046_0002135 3300049580 Bacteria 18685
1359 Ga0501046_0003857 3300049580 Bacteria 13713
1360 Ga0501046_0006220 3300049580 Bacteria 10599
1361 Ga0501047_0000107 3300049581 Bacteria 102041
1362 Ga0501047_0000268 3300049581 Bacteria 60315
1363 Ga0501047_0002183 3300049581 Bacteria 18725
1364 Ga0501047_0008765 3300049581 Bacteria 9545
1365 Ga0501047_0013070 3300049581 Bacteria 7863
1366 Ga0501047_0027020 3300049581 Bacteria 5528
1367 Ga0501047_0087040 3300049581 Bacteria 3002
1368 Ga0501048_0003331 3300049582 Bacteria 12228
1369 Ga0501048_0143518 3300049582 Bacteria 1688
1370 Ga0501048_0164294 3300049582 Bacteria 1572
1371 Ga0501048_0251248 3300049582 Bacteria 1255
1372 Ga0501067_0008668 3300049583 Bacteria 5637
1373 Ga0501067_0032390 3300049583 Bacteria 2901
1374 Ga0501068_0017903 3300049584 Bacteria 4102
1375 Ga0501068_0106361 3300049584 Bacteria 1742
1376 Ga0501069_0006022 3300049585 Bacteria 6328
1377 Ga0501069_0038097 3300049585 Bacteria 2654
1378 Ga0501069_0066513 3300049585 Bacteria 2015
1379 Ga0501070_0000925 3300049586 Bacteria 26486
1380 Ga0501070_0002491 3300049586 Bacteria 16128
1381 Ga0501070_0004541 3300049586 Bacteria 11911
1382 Ga0501070_0008759 3300049586 Bacteria 8555
1383 Ga0501070_0042137 3300049586 Bacteria 3802
1384 Ga0501070_0043498 3300049586 Bacteria 3737
1385 Ga0501070_0047700 3300049586 Bacteria 3559
1386 Ga0501070_0068120 3300049586 Bacteria 2946
1387 Ga0501070_0095453 3300049586 Bacteria 2460
1388 Ga0501071_0000938 3300049587 Bacteria 15841
1389 Ga0501071_0032295 3300049587 Bacteria 3717
1390 Ga0501072_0006940 3300049588 Bacteria 8598
1391 Ga0501072_0072579 3300049588 Bacteria 2720
1392 Ga0501072_0161295 3300049588 Bacteria 1789
1393 Ga0501072_0161952 3300049588 Bacteria 1785
1394 Ga0501072_0192834 3300049588 Bacteria 1625
1395 Ga0501073_0000024 3300049589 Bacteria 128851
1396 Ga0501073_0016913 3300049589 Bacteria 5282
1397 Ga0501073_0024223 3300049589 Bacteria 4358
1398 Ga0501073_0072087 3300049589 Bacteria 2406
1399 Ga0501073_0183129 3300049589 Bacteria 1450
1400 Ga0501074_0001157 3300049590 Bacteria 17270
1401 Ga0501074_0002652 3300049590 Bacteria 12537
1402 Ga0501074_0018015 3300049590 Bacteria 5130
1403 Ga0501074_0090092 3300049590 Bacteria 2197
1404 Ga0501076_0001496 3300049592 Bacteria 15672
1405 Ga0501076_0022476 3300049592 Bacteria 4846
1406 Ga0501076_0201480 3300049592 Bacteria 1625
1407 Ga0501077_0014871 3300049593 Bacteria 4891
1408 Ga0501079_0003055 3300049741 Bacteria 12245
1409 Ga0501079_0011446 3300049741 Bacteria 6772
1410 Ga0501080_0001035 3300049742 Bacteria 22914
1411 Ga0501080_0006153 3300049742 Bacteria 10769
1412 Ga0501080_0016596 3300049742 Bacteria 6802
1413 Ga0501080_0022823 3300049742 Bacteria 5799
1414 Ga0501080_0091423 3300049742 Bacteria 2827
1415 Ga0501080_0258973 3300049742 Bacteria 1585
1416 Ga0501081_0006271 3300049743 Bacteria 7710
1417 Ga0501081_0011062 3300049743 Bacteria 5901
1418 Ga0501083_0005406 3300049744 Bacteria 9042
1419 Ga0501083_0186096 3300049744 Bacteria 1356
1420 Ga0501035_0003186 3300049822 Bacteria 15726
1421 Ga0501035_0014479 3300049822 Bacteria 7279
1422 Ga0501035_0014942 3300049822 Bacteria 7164
1423 Ga0501035_0019336 3300049822 Bacteria 6266
1424 Ga0501035_0023019 3300049822 Bacteria 5718
1425 Ga0501035_0023206 3300049822 Bacteria 5691
1426 Ga0501044_0001612 3300049823 Bacteria 26422
1427 Ga0501044_0005882 3300049823 Bacteria 13589
1428 Ga0501044_0006459 3300049823 Bacteria 12950
1429 Ga0501044_0007748 3300049823 Bacteria 11806
1430 Ga0501044_0015647 3300049823 Bacteria 8170
1431 Ga0501044_0035143 3300049823 Bacteria 5250
1432 Ga0501044_0043045 3300049823 Bacteria 4692
1433 Ga0501044_0066591 3300049823 Bacteria 3672
1434 Ga0501044_0089672 3300049823 Bacteria 3103
1435 Ga0501045_0039028 3300049824 Bacteria 3455
1436 nmdc:mga03683_17583_c1 3300050489 Bacteria 2708
1437 nmdc:mga03n38_1081_c1 3300050490 Bacteria 7519
1438 nmdc:mga03n38_2844_c1 3300050490 Bacteria 5447
1439 nmdc:mga03n38_38141_c1 3300050490 Bacteria 2077
1440 nmdc:mga00v17_10006_c1 3300050491 Bacteria 5159
1441 nmdc:mga00v17_16972_c1 3300050491 Bacteria 4112
1442 nmdc:mga00v17_3299_c1 3300050491 Bacteria 8322
1443 nmdc:mga00v17_3766_c1 3300050491 Bacteria 7829
1444 nmdc:mga00v17_37721_c1 3300050491 Bacteria 2887
1445 nmdc:mga00v17_72057_c1 3300050491 Bacteria 2143
1446 nmdc:mga00v17_9193_c1 3300050491 Bacteria 5338
1447 nmdc:mga0yw44_2056_c1 3300050492 Bacteria 8398
1448 nmdc:mga0yw44_4555_c1 3300050492 Bacteria 6382
1449 nmdc:mga06z11_11779_c1 3300050494 Bacteria 3781
1450 nmdc:mga07m45_113737_c1 3300050496 Bacteria 1560
1451 nmdc:mga07m45_18278_c1 3300050496 Bacteria 3781
1452 nmdc:mga07m45_3115_c1 3300050496 Bacteria 7939
1453 nmdc:mga07m45_41926_c1 3300050496 Bacteria 2564
1454 nmdc:mga07m45_47346_c1 3300050496 Bacteria 2417
1455 nmdc:mga07m45_7793_c1 3300050496 Bacteria 5480
1456 nmdc:mga05p37_11899_c1 3300050507 Bacteria 10376
1457 nmdc:mga05p37_172547_c1 3300050507 Bacteria 2637
1458 nmdc:mga05p37_2128_c1 3300050507 Bacteria 23129
1459 nmdc:mga05p37_46755_c1 3300050507 Bacteria 5321
1460 nmdc:mga05p37_59920_c1 3300050507 Bacteria 4687
1461 nmdc:mga09592_1737_c1 3300050508 Bacteria 17543
1462 nmdc:mga09592_199312_c1 3300050508 Bacteria 1733
1463 nmdc:mga0qj67_193_c1 3300050509 Bacteria 41569
1464 nmdc:mga0qj67_3435_c1 3300050509 Bacteria 11415
1465 nmdc:mga0qj67_36297_c1 3300050509 Bacteria 3856
1466 nmdc:mga0qj67_695_c1 3300050509 Bacteria 22912
1467 nmdc:mga06r32_111190_c1 3300050510 Bacteria 2696
1468 nmdc:mga06r32_15489_c1 3300050510 Bacteria 6922
1469 nmdc:mga06r32_1594_c1 3300050510 Bacteria 20429
1470 nmdc:mga06r32_198_c1 3300050510 Bacteria 26154
1471 nmdc:mga06r32_261812_c1 3300050510 Bacteria 1717
1472 nmdc:mga06r32_275_c1 3300050510 Bacteria 42703
1473 nmdc:mga06r32_77316_c1 3300050510 Bacteria 3233
1474 nmdc:mga08y16_5920_c1 3300050511 Bacteria 12821
1475 nmdc:mga08y16_85139_c1 3300050511 Bacteria 3294
1476 nmdc:mga08y16_92314_c1 3300050511 Bacteria 3155
1477 nmdc:mga0n895_41320_c1 3300050512 Bacteria 4482
1478 nmdc:mga0n895_7027_c1 3300050512 Bacteria 9616
1479 nmdc:mga0n895_93647_c1 3300050512 Bacteria 3008
1480 nmdc:mga0n895_99740_c1 3300050512 Bacteria 2913
1481 nmdc:mga0rr50_41993_c1 3300050513 Bacteria 3337
1482 nmdc:mga0rr50_64626_c1 3300050513 Bacteria 2769
1483 nmdc:mga08x19_6450_c1 3300050514 Bacteria 6947
1484 nmdc:mga0a205_109248_c1 3300050515 Bacteria 2664
1485 nmdc:mga0a205_38254_c1 3300050515 Bacteria 4615
1486 nmdc:mga0a205_56142_c1 3300050515 Bacteria 3803
1487 nmdc:mga0a205_8625_c2 3300050515 Bacteria 7926
1488 nmdc:mga0sz30_4791_c1 3300050516 Bacteria 4922
1489 nmdc:mga0sz30_65576_c1 3300050516 Bacteria 1557
1490 nmdc:mga0sz30_656_c1 3300050516 Bacteria 12820
1491 nmdc:mga0sz30_8114_c1 3300050516 Bacteria 3956
1492 Ga0495601_0125810 3300053077 Bacteria 1667
1493 Ga0495612_0000472 3300053078 Bacteria 16204
1494 Ga0495612_0029687 3300053078 Bacteria 2203
1495 Ga0495612_0043180 3300053078 Bacteria 1841
1496 Ga0495595_0006267 3300053084 Bacteria 4845
1497 Ga0495595_0017594 3300053084 Bacteria 3077
1498 Ga0495619_0061541 3300053085 Bacteria 2498
1499 Ga0495619_0077770 3300053085 Bacteria 2229
1500 Ga0495619_0103658 3300053085 Bacteria 1938
1501 Ga0500643_000189 3300053087 Bacteria 58813
1502 Ga0500643_000352 3300053087 Bacteria 36502
1503 Ga0500646_0000612 3300053090 Bacteria 10209
1504 Ga0500651_0001689 3300053093 Bacteria 11274
1505 Ga0500651_0131400 3300053093 Bacteria 1514
1506 Ga0500641_0035450 3300053096 Bacteria 1991
1507 Ga0500554_006511 3300053102 Bacteria 2624
1508 Ga0500556_0000062 3300053104 Bacteria 110818
1509 Ga0500593_035358 3300053117 Bacteria 2236
1510 Ga0500594_0004228 3300053118 Bacteria 3167
1511 Ga0500652_058759 3300053131 Bacteria 1580
1512 Ga0500658_0039444 3300053134 Bacteria 1888
1513 Ga0500559_0000868 3300053136 Bacteria 19392
1514 Ga0500559_0002901 3300053136 Bacteria 8631
1515 Ga0500559_0020640 3300053136 Bacteria 2786
1516 Ga0500568_0000060 3300053139 Bacteria 107901
1517 Ga0500568_0000124 3300053139 Bacteria 68924
1518 Ga0500568_0002651 3300053139 Bacteria 10388
1519 Ga0500568_0019851 3300053139 Bacteria 2914
1520 Ga0500568_0033263 3300053139 Bacteria 2117
1521 Ga0500573_0000007 3300053140 Bacteria 272970
1522 Ga0500588_0003567 3300053146 Bacteria 3297
1523 Ga0500589_052185 3300053147 Bacteria 1895
1524 Ga0500590_001918 3300053148 Bacteria 8895
1525 Ga0500600_0068994 3300053149 Bacteria 1944
1526 Ga0500604_0013291 3300053151 Bacteria 2229
1527 Ga0500616_0002004 3300053153 Bacteria 18042
1528 Ga0500616_0064516 3300053153 Bacteria 1886
1529 Ga0500620_000387 3300053155 Bacteria 8152
1530 Ga0500645_000128 3300053730 Bacteria 59444
1531 Ga0501084_0002094 3300054114 Bacteria 15945
1532 Ga0501084_0028238 3300054114 Bacteria 4689
1533 Ga0501084_0052351 3300054114 Bacteria 3416
1534 Ga0501084_0053198 3300054114 Bacteria 3387
1535 Ga0501084_0063808 3300054114 Bacteria 3084
1536 Ga0501084_0126504 3300054114 Bacteria 2150
1537 Ga0501084_0237061 3300054114 Bacteria 1540
1538 Ga0590075_004557 3300059424 Bacteria 3284
1539 Ga0501082_0013306 3300060353 Bacteria 7074
1540 Ga0501082_0064397 3300060353 Bacteria 3157
1541 Ga0466962_0000302 3300061719 Bacteria 21145
1542 Ga0466962_0003093 3300061719 Bacteria 7915
1543 Ga0466962_0004408 3300061719 Bacteria 6749
1544 Ga0466962_0006025 3300061719 Bacteria 5830
1545 Ga0466962_0028426 3300061719 Bacteria 2679
1546 2501942824 2501939600 Bacteria 6907073
1547 2506867832 2506783011 Bacteria 5323186
1548 2515494912 2515154088 Bacteria 5526283
1549 2515718916 2515154129 Bacteria 5584369
1550 2515755575 2515154137 Bacteria 5711575
1551 2515851904 2515154155 Bacteria 7985436
1552 2516083128 2515154202 Bacteria 5471270
1553 2516090214 2515154203 Bacteria 5458536
1554 2523383290 2523231044 Bacteria 6434991
1555 2528205551 2527291627 Bacteria 5309833
1556 2528214972 2527291629 Bacteria 5267418
1557 2546950328 2546825537 Bacteria 5389291
1558 2548694814 2547132424 Bacteria 8348532
1559 2552107491 2551306166 Bacteria 9731570
1560 2554259472 2554235005 Bacteria 6457341
1561 2558914157 2558860112 Bacteria 9931328
1562 2566997442 2565956761 Bacteria 6601618
1563 2579750244 2576861822 Bacteria 5004595
1564 2579856475 2579778521 Bacteria 7624758
1565 2585302008 2582581312 Bacteria 7308206
1566 2585321075 2582581314 Bacteria 11452267
1567 2616695704 2616644814 Bacteria 11555299
1568 2619858079 2619618881 Bacteria 7521104
1569 2620352616 2619619003 Bacteria 7619552
1570 2623501119 2622736605 Bacteria 4992138
1571 2623588025 2622736626 Bacteria 7181580
1572 2626639665 2626541554 Bacteria 7741902
1573 2643904555 2643221578 Bacteria 9213798
1574 2644019206 2643221601 Bacteria 7493239
1575 2644095148 2643221616 Bacteria 4066575
1576 2644174112 2643221631 Bacteria 8168043
1577 2644406179 2643221673 Bacteria 9196637
1578 2644488693 2643221687 Bacteria 6500351
1579 2644506432 2643221690 Bacteria 4654705
1580 2644518138 2643221692 Bacteria 7282860
1581 2644526650 2643221694 Bacteria 4392972
1582 2644636685 2643221715 Bacteria 6671032
1583 2644671316 2643221722 Bacteria 4247614
1584 2671839072 2671180195 Bacteria 9757215
1585 2676476047 2675903058 Bacteria 6822861
1586 2676487337 2675903059 Bacteria 8644972
1587 2686537797 2684623035 Bacteria 8032739
1588 2686543134 2684623036 Bacteria 5199090
1589 2689991648 2687453743 Bacteria 8361025
1590 2710603810 2710264753 Bacteria 5455564
1591 2731907033 2731639228 Bacteria 4187555
1592 2738664986 2738541264 Bacteria 5935393
1593 2738708135 2738541274 Bacteria 6909446
1594 2738886690 2738541308 Bacteria 7020677
1595 2739144120 2738541356 Bacteria 5935017
1596 2739203829 2738543005 Bacteria 5278128
1597 2739239384 2738543011 Bacteria 5731169
1598 2739334712 2738543028 Bacteria 6917070
1599 2744954612 2744054611 Bacteria 5611514
1600 2753076170 2751185734 Bacteria 8863695
1601 2753303407 2751185788 Bacteria 4541048
1602 2774857228 2773857922 Bacteria 9757215
1603 2774866103 2773857924 Bacteria 5256821
1604 2774904260 2773857933 Bacteria 5818019
1605 2776370698 2775506925 Bacteria 7237746
1606 2793983469 2791355406 Bacteria 11364898
1607 2808890684 2808606370 Bacteria 4942454
1608 2810363513 2808606700 Bacteria 3482157
1609 2811847040 2808606982 Bacteria 7791042
1610 2812365412 2811994880 Bacteria 4147780
1611 2812482300 2811994917 Bacteria 7761064
1612 2819739146 2818991472 Bacteria 10089953
1613 2827630609 2827628540 Bacteria 6858585
1614 2837187228 2837183177 Bacteria 4637169
1615 2839989531 2839986021 Bacteria 3685650
1616 2842137806 2842134933 Bacteria 5847019
1617 2844852307 2844849076 Bacteria 4091819
1618 2844856559 2844852863 Bacteria 3849151
1619 2855681951 2855676851 Bacteria 7063653
1620 2855686874 2855683550 Bacteria 7134265
1621 2856862049 2856858025 Bacteria 7255264
1622 2857289182 2857288857 Bacteria 7189066
1623 2857740182 2857737099 Bacteria 3104305
1624 2857743804 2857740372 Bacteria 4782044
1625 2858850004 2858848962 Bacteria 6963058
1626 2858874904 2858868258 Bacteria 7683772
1627 2858883484 2858882152 Bacteria 7230291
1628 2858891979 2858888857 Bacteria 7060307
1629 2858899339 2858895516 Bacteria 7378898
1630 2858907845 2858902515 Bacteria 7086037
1631 2861527631 2861520306 Bacteria 8348283
1632 2862510485 2862507626 Bacteria 9425308
1633 2862706808 2862705112 Bacteria 6563286
1634 2863072248 2863067949 Bacteria 8541735
1635 2867307773 2867302475 Bacteria 7087181
1636 2867319094 2867312974 Bacteria 7058875
1637 2867320099 2867319477 Bacteria 7069771
1638 2867346895 2867346516 Bacteria 7608576
1639 2867369926 2867369537 Bacteria 6501581
1640 2867480854 2867475112 Bacteria 6909112
1641 2868094364 2868088558 Bacteria 7609351
1642 2869051888 2869048445 Bacteria 6875584
1643 2869067946 2869061728 Bacteria 7112407
1644 2869073443 2869068681 Bacteria 7205615
1645 2870622737 2870622029 Bacteria 3643329
1646 2870726152 2870721527 Bacteria 9689237
1647 2875392761 2875391855 Bacteria 7600475
1648 2880492030 2880489317 Bacteria 7096270
1649 2880500262 2880495981 Bacteria 7340502
1650 2884764545 2884763398 Bacteria 4091164
1651 2884995185 2884994152 Bacteria 4492978
1652 2889301981 2889300758 Bacteria 5690814
1653 2891327154 2891326441 Bacteria 6439512
1654 2895429234 2895427314 Bacteria 13147766
1655 2895888739 2895880812 Bacteria 11255272
1656 2899368037 2899359706 Bacteria 10940472
1657 2899375434 2899370129 Bacteria 6781179
1658 2902586652 2902582711 Bacteria 6187705
1659 2902795775 2902792274 Bacteria 7270173
1660 2902803821 2902799365 Bacteria 5419524
1661 2902811851 2902810491 Bacteria 6794147
1662 2902838577 2902837492 Bacteria 6697721
1663 2904499703 2904497146 Bacteria 4731781
1664 2904540346 2904535858 Bacteria 6308016
1665 2904769221 2904765812 Bacteria 5369154
1666 2904776331 2904770941 Bacteria 5580202
1667 2904780360 2904776348 Bacteria 4658726
1668 2905927707 2905926851 Bacteria 4423176
1669 2905929264 2905926851 Bacteria 4423176
1670 2905930281 2905926851 Bacteria 4423176
1671 2908814417 2908811453 Bacteria 5478616
1672 2910814860 2910809715 Bacteria 4982797
1673 2912722325 2912715099 Bacteria 9460473
1674 2912726037 2912723979 Bacteria 8557534
1675 2912758959 2912757875 Bacteria 7940295
1676 2919036156 2919034639 Bacteria 4763403
1677 2919046180 2919042368 Bacteria 3905917
1678 2919053168 2919051321 Bacteria 4210889
1679 2919060871 2919059106 Bacteria 4991624
1680 2919392436 2919391150 Bacteria 4884741
1681 2919422858 2919420072 Bacteria 5390363
1682 2919434889 2919432681 Bacteria 5390474
1683 2919538626 2919538618 Bacteria 4677069
1684 2919718922 2919713450 Bacteria 7431245
1685 2922556375 2922554459 Bacteria 6683962
1686 2928106968 2928104781 Bacteria 3877447
1687 2928147267 2928142448 Bacteria 5288925
1688 2929215655 2929212328 Bacteria 7708288
1689 2929222155 2929219909 Bacteria 6984360
1690 2929228820 2929226422 Bacteria 7248583
1691 2932398928 2932398195 Bacteria 3847976
1692 2932431103 2932426870 Bacteria 4547726
1693 2932433655 2932431166 Bacteria 4215299
1694 2933419213 2933418574 Bacteria 4476724
1695 2935394777 2935390628 Bacteria 7043367
1696 2939589358 2939582691 Bacteria 7088898
1697 2939647868 2939647034 Bacteria 4681660
1698 2939663719 2939660829 Bacteria 3784848
1699 2939679070 2939674588 Bacteria 4844420
1700 2939748198 2939743619 Bacteria 5762299
1701 2945924525 2945920336 Bacteria 4501603
1702 2945943739 2945941187 Bacteria 4682474
1703 2945958072 2945956166 Bacteria 5110334
1704 2946004070 2946003308 Bacteria 3857229
1705 2946039708 2946037020 Bacteria 4900426
1706 2946051954 2946045630 Bacteria 8527308
1707 2947231749 2947224130 Bacteria 9938529
1708 2954000932 2953998280 Bacteria 4812144
1709 2954011001 2954002825 Bacteria 9173742
1710 2956941213 2956939328 Bacteria 3474458
1711 2966927682 2966924647 Bacteria 3268643
1712 2974303208 2974302888 Bacteria 4369871
1713 2984526003 2984523437 Bacteria 4508481
1714 2984551711 2984551494 Bacteria 3877562
1715 2990050098 2990044586 Bacteria 6603797
1716 2990061429 2990059506 Bacteria 9321252
1717 2990092041 2990088156 Bacteria 6657676
1718 2995469292 2995463766 Bacteria 8577691
1719 2996227977 2996221748 Bacteria 6799777
1720 2997454832 2997451912 Bacteria 8492419
1721 2997605605 2997600082 Bacteria 9896405
1722 3001120351 3001119090 Bacteria 3449530
1723 3003002251 3002998708 Bacteria 11715108
1724 3006327930 3006321560 Bacteria 8247479
1725 3006399468 3006393351 Bacteria 6615579
1726 3006430613 3006425503 Bacteria 6491253
1727 3006491715 3006486233 Bacteria 8157040
1728 637880493 637000116 Bacteria 5433628
1729 649812648 649633069 Bacteria 6962533
1730 8003835703 8003830390 Bacteria 6541657
1731 8003858503 8003856774 Bacteria 7675274
1732 8004026160 8004025490 Bacteria 4327753
1733 8008486503 8008485437 Bacteria 7198341
1734 8008580681 8008574985 Bacteria 7815457
1735 8025481225 8025478263 Bacteria 8209203
1736 8025525572 8025524527 Bacteria 7197316
1737 8025531020 8025530807 Bacteria 8495698
1738 8033688272 8033684223 Bacteria 6906479
1739 8047894932 8047893842 Bacteria 11723082
1740 8048130482 8048127548 Bacteria 11053136
1741 8048364118 8048356638 Bacteria 11044339
1742 8048371950 8048369669 Bacteria 11666822
1743 8048380884 8048379754 Bacteria 11877923
1744 8053947878 8053945823 Bacteria 8962862
1745 8054110003 8054107350 Bacteria 5022511
1746 8054706813 8054704163 Bacteria 7247792
1747 8054730850 8054727385 Bacteria 7558670
1748 8054738895 8054734606 Bacteria 6947278
1749 8054914099 8054913762 Bacteria 7713009
1750 8054922895 8054920844 Bacteria 7068637
1751 8055068480 8055066027 Bacteria 9479577
1752 8055162372 8055157932 Bacteria 6429399
1753 8055181034 8055172936 Bacteria 9305943
1754 8055412800 8055412473 Bacteria 6257500
1755 8056066074 8056060235 Bacteria 7259403
1756 8056449305 8056447290 Bacteria 7680491
1757 8056670177 8056667051 Bacteria 6953971
1758 8056835631 8056829672 Bacteria 9045328
1759 8057568517 8057568493 Bacteria 7221719
1760 Ga0496112_0044614
1761 JGI24746J21847_1000536
1762 JGI24737J22298_10021667
1763 JGI24745J21846_1000370
1764 JGI24749J21850_1007903
1765 JGI24744J21845_10000965
1766 JGI24034J26672_10008906
1767 JGI24742J22300_10001394
1768 JGI25164J39214_1000515
1769 JGI25152J39213_1000980
1770 JGI25151J46595_10031792
1771 JGI25165J46597_1000044
1772 Ga0055540_1000211
1773 Ga0055540_1004259
1774 Ga0055540_1006714
1775 Ga0065714_10010605
1776 Ga0065712_10022902
1777 Ga0070658_10000155
1778 Ga0070658_10002940
1779 Ga0070658_10078060
1780 Ga0070658_10112230
1781 Ga0070658_10241926
1782 Ga0070676_10113118
1783 Ga0070683_100002759
1784 Ga0070683_100008046
1785 Ga0070683_100133817
1786 Ga0070683_100140430
1787 Ga0070690_100027643
1788 Ga0070690_100074970
1789 Ga0070670_100052841
1790 Ga0068869_100011022
1791 Ga0068869_100018593
1792 Ga0068869_100030573
1793 Ga0070666_10012208
1794 Ga0070666_10073071
1795 Ga0070680_100001962
1796 Ga0070680_100021263
1797 Ga0070680_100045036
1798 Ga0070682_100003447
1799 Ga0070682_100054024
1800 Ga0070682_100165205
1801 Ga0068868_100000794
1802 Ga0068868_100013822
1803 Ga0068868_100014864
1804 Ga0068868_100178949
1805 Ga0068868_100254829
1806 Ga0070660_100011330
1807 Ga0070660_100103520
1808 Ga0070689_100053548
1809 Ga0070691_10002291
1810 Ga0070691_10006343
1811 Ga0070661_100047797
1812 Ga0070692_10003769
1813 Ga0070692_10007565
1814 Ga0070668_100000964
1815 Ga0070668_100001978
1816 Ga0070668_100014132
1817 Ga0070668_100016742
1818 Ga0070668_100017923
1819 Ga0070668_100068032
1820 Ga0070669_100027727
1821 Ga0070669_100057955
1822 Ga0070675_100000432
1823 Ga0070675_100018048
1824 Ga0070675_100024819
1825 Ga0070675_100245660
1826 Ga0070671_100000370
1827 Ga0070671_100041360
1828 Ga0070671_100087577
1829 Ga0070674_100042205
1830 Ga0070674_100090614
1831 Ga0070674_100185527
1832 Ga0070673_100031422
1833 Ga0070688_100010888
1834 Ga0070659_100006799
1835 Ga0070659_100105731
1836 Ga0070667_100000562
1837 Ga0070667_100001312
1838 Ga0070667_100006829
1839 Ga0070667_100014813
1840 Ga0070667_100092326
1841 Ga0070709_10006919
1842 Ga0070714_100000045
1843 Ga0070714_100048774
1844 Ga0070714_100064441
1845 Ga0070714_100068199
1846 Ga0070714_100120606
1847 Ga0070714_100123813
1848 Ga0070714_100289252
1849 Ga0070713_100001944
1850 Ga0070713_100007682
1851 Ga0070713_100093894
1852 Ga0070713_100105853
1853 Ga0070713_100172511
1854 Ga0070710_10001141
1855 Ga0070710_10004138
1856 Ga0070710_10010958
1857 Ga0070710_10018959
1858 Ga0070710_10115985
1859 Ga0070701_10058009
1860 Ga0070711_100001916
1861 Ga0070711_100004625
1862 Ga0070711_100081123
1863 Ga0070705_100017002
1864 Ga0070700_100000094
1865 Ga0070700_100007945
1866 Ga0070700_100008853
1867 Ga0070700_100025985
1868 Ga0070700_100035573
1869 Ga0070708_100022408
1870 Ga0070663_100009639
1871 Ga0070663_100014886
1872 Ga0070663_100035622
1873 Ga0070663_100067628
1874 Ga0070663_100201281
1875 Ga0070678_100003103
1876 Ga0070678_100011769
1877 Ga0070678_100027420
1878 Ga0070678_100050196
1879 Ga0070678_100135038
1880 Ga0070678_100144904
1881 Ga0070678_100146363
1882 Ga0070662_100002734
1883 Ga0070662_100070790
1884 Ga0070662_100092533
1885 Ga0070681_10000504
1886 Ga0070681_10009194
1887 Ga0070681_10033991
1888 Ga0070681_10100015
1889 Ga0068867_100002956
1890 Ga0070685_10006635
1891 Ga0070685_10019605
1892 Ga0070685_10022713
1893 Ga0070706_100027267
1894 Ga0070706_100032645
1895 Ga0070707_100003790
1896 Ga0070707_100039640
1897 Ga0070707_100366908
1898 Ga0070698_100006733
1899 Ga0070698_100075451
1900 Ga0070679_100000687
1901 Ga0070679_100001838
1902 Ga0070679_100005358
1903 Ga0070679_100063294
1904 Ga0070679_100088386
1905 Ga0068853_100008631
1906 Ga0068853_100026901
1907 Ga0068853_100028554
1908 Ga0068853_100047185
1909 Ga0068853_100127831
1910 Ga0068853_100233417
1911 Ga0070672_100104720
1912 Ga0070695_100023511
1913 Ga0070696_100006572
1914 Ga0070696_100088676
1915 Ga0070693_100004975
1916 Ga0070693_100005567
1917 Ga0070693_100052400
1918 Ga0070665_100001805
1919 Ga0070665_100019654
1920 Ga0070665_100054549
1921 Ga0070665_100061354
1922 Ga0070665_100063798
1923 Ga0070665_100067128
1924 Ga0070704_100005363
1925 Ga0070704_100029852
1926 Ga0070704_100076065
1927 Ga0068855_100012387
1928 Ga0068855_100027492
1929 Ga0068855_100034580
1930 Ga0068855_100039520
1931 Ga0068855_100164286
1932 Ga0070664_100001189
1933 Ga0070664_100366178
1934 Ga0068857_100012484
1935 Ga0068857_100054554
1936 Ga0068857_100186618
1937 Ga0068854_100002196
1938 Ga0068856_100031138
1939 Ga0068856_100032411
1940 Ga0068856_100050005
1941 Ga0068856_100177027
1942 Ga0068856_100188635
1943 Ga0068856_100227229
1944 Ga0070702_100000252
1945 Ga0070702_100019881
1946 Ga0070702_100038061
1947 Ga0070702_100156110
1948 Ga0068852_100018879
1949 Ga0068852_100047617
1950 Ga0068852_100191948
1951 Ga0068859_100001857
1952 Ga0068859_100019700
1953 Ga0068859_100030262
1954 Ga0068859_100038886
1955 Ga0068859_100063907
1956 Ga0068864_100055401
1957 Ga0068864_100184358
1958 Ga0068866_10002581
1959 Ga0068866_10010288
1960 Ga0068861_100009286
1961 Ga0068861_100053137
1962 Ga0068861_100082531
1963 Ga0068861_100088673
1964 Ga0068861_100106931
1965 Ga0068851_10000124
1966 Ga0068870_10001152
1967 Ga0068863_100015607
1968 Ga0068863_100034697
1969 Ga0068863_100040994
1970 Ga0068863_100048819
1971 Ga0068863_100055479
1972 Ga0068863_100077002
1973 Ga0068863_100156177
1974 Ga0068863_100390572
1975 Ga0068858_100000032
1976 Ga0068858_100000175
1977 Ga0068858_100121712
1978 Ga0068858_100121732
1979 Ga0068860_100000085
1980 Ga0068860_100000112
1981 Ga0068860_100023080
1982 Ga0068860_100056291
1983 Ga0068862_100001577
1984 Ga0068862_100102490
1985 Ga0068862_100130004
1986 Ga0068862_100283589
1987 Ga0081455_10001891
1988 Ga0081455_10005347
1989 Ga0081455_10007359
1990 Ga0081455_10090029
1991 Ga0081455_10142666
1992 Ga0081538_10001227
1993 Ga0081538_10038909
1994 Ga0081540_1003275
1995 Ga0081540_1005254
1996 Ga0081540_1010341
1997 Ga0081539_10001305
1998 Ga0081539_10001973
1999 Ga0081539_10020787
2000 Ga0070717_10055531
2001 Ga0070717_10096763
2002 Ga0070717_10274918
2003 Ga0070717_10338763
2004 Ga0075365_10002419
2005 Ga0075365_10018831
2006 Ga0075365_10035009
2007 Ga0075365_10038497
2008 Ga0075365_10043570
2009 Ga0075365_10213262
2010 Ga0075368_10054756
2011 Ga0075363_100000882
2012 Ga0075363_100002130
2013 Ga0075363_100009173
2014 Ga0075363_100014328
2015 Ga0075363_100017745
2016 Ga0075364_10003955
2017 Ga0075364_10004377
2018 Ga0075364_10007221
2019 Ga0075364_10019257
2020 Ga0075364_10020109
2021 Ga0075364_10030027
2022 Ga0075364_10091633
2023 Ga0075432_10031113
2024 Ga0070715_10001858
2025 Ga0070715_10010123
2026 Ga0070715_10037487
2027 Ga0070716_100001032
2028 Ga0070716_100007759
2029 Ga0070716_100023759
2030 Ga0070712_100021261
2031 Ga0070712_100024582
2032 Ga0070712_100132874
2033 Ga0075367_10002786
2034 Ga0075367_10040651
2035 Ga0075367_10096811
2036 Ga0075369_10001816
2037 Ga0075369_10004962
2038 Ga0075369_10032463
2039 Ga0075369_10070535
2040 Ga0075370_10018399
2041 Ga0075370_10058776
2042 Ga0068871_100292839
2043 Ga0075428_100000416
2044 Ga0075428_100000630
2045 Ga0075428_100008931
2046 Ga0075428_100016382
2047 Ga0075428_100307936
2048 Ga0075430_100000876
2049 Ga0075430_100001812
2050 Ga0075430_100004627
2051 Ga0075430_100053863
2052 Ga0075431_100001436
2053 Ga0075431_100002862
2054 Ga0075431_100143546
2055 Ga0075433_10003068
2056 Ga0075433_10046700
2057 Ga0075433_10073782
2058 Ga0075433_10189043
2059 Ga0075434_100003178
2060 Ga0075434_100311857
2061 Ga0075429_100000244
2062 Ga0075429_100006508
2063 Ga0075429_100020851
2064 Ga0068865_100000680
2065 Ga0068865_100019322
2066 Ga0075436_100010015
2067 Ga0075436_100085986
2068 Ga0075436_100095390
2069 Ga0097620_100001857
2070 Ga0097620_100019700
2071 Ga0097620_100030263
2072 Ga0097620_100038886
2073 Ga0097620_100063914
2074 Ga0075435_100004538
2075 Ga0075435_100189592
2076 Ga0105251_10015488
2077 Ga0105251_10057996
2078 Ga0105244_10004000
2079 Ga0105240_10023577
2080 Ga0105240_10033631
2081 Ga0111539_10053176
2082 Ga0111539_10452066
2083 Ga0105245_10001865
2084 Ga0105245_10030109
2085 Ga0105245_10040683
2086 Ga0105245_10042678
2087 Ga0105245_10083844
2088 Ga0105245_10225790
2089 Ga0105245_10296646
2090 Ga0105247_10000007
2091 Ga0105247_10000164
2092 Ga0105247_10001456
2093 Ga0105247_10004913
2094 Ga0105247_10013514
2095 Ga0105247_10038821
2096 Ga0114129_10000723
2097 Ga0114129_10006158
2098 Ga0114129_10009646
2099 Ga0114129_10012498
2100 Ga0114129_10018283
2101 Ga0114129_10032957
2102 Ga0114129_10074178
2103 Ga0114129_10178042
2104 Ga0105243_10002145
2105 Ga0105243_10003603
2106 Ga0105243_10019596
2107 Ga0105243_10053995
2108 Ga0105243_10083040
2109 Ga0105241_10000211
2110 Ga0105241_10004546
2111 Ga0105241_10107752
2112 Ga0105241_10117969
2113 Ga0105242_10013158
2114 Ga0105242_10057362
2115 Ga0105248_10002480
2116 Ga0105248_10003147
2117 Ga0105248_10007605
2118 Ga0105248_10013762
2119 Ga0105248_10018635
2120 Ga0105248_10025426
2121 Ga0105248_10059757
2122 Ga0105248_10070636
2123 Ga0105248_10092277
2124 Ga0105237_10002337
2125 Ga0105237_10048489
2126 Ga0105237_10175054
2127 Ga0105237_10247190
2128 Ga0105238_10029500
2129 Ga0105238_10199854
2130 Ga0105238_10318583
2131 Ga0105249_10000001
2132 Ga0105249_10001870
2133 Ga0105249_10016303
2134 Ga0105249_10028646
2135 Ga0105249_10122582
2136 Ga0105239_10037404
2137 Ga0105239_10037820
2138 Ga0105239_10213248
2139 Ga0105239_10221394
2140 Ga0105246_10016299
2141 Ga0105246_10020035
2142 Ga0157371_10063256
2143 Ga0157370_10010594
2144 Ga0157370_10024520
2145 Ga0157370_10069579
2146 Ga0157370_10297806
2147 Ga0157369_10003546
2148 Ga0157369_10003610
2149 Ga0157369_10013234
2150 Ga0157369_10015580
2151 Ga0157369_10095834
2152 Ga0157369_10101407
2153 Ga0157369_10156750
2154 Ga0157369_10179918
2155 Ga0157369_10228215
2156 Ga0157374_10022265
2157 Ga0157374_10105285
2158 Ga0157374_10161367
2159 Ga0157374_10186409
2160 Ga0157374_10191161
2161 Ga0157378_10009029
2162 Ga0157378_10035250
2163 Ga0163162_10016133
2164 Ga0163162_10020493
2165 Ga0163162_10145440
2166 Ga0157372_10002203
2167 Ga0157372_10003317
2168 Ga0157372_10305276
2169 Ga0157372_10465758
2170 Ga0157375_10011217
2171 Ga0157375_10049534
2172 Ga0157375_10109831
2173 Ga0157375_10153028
2174 Ga0163163_10009670
2175 Ga0163163_10016347
2176 Ga0163163_10109690
2177 Ga0163163_10126143
2178 Ga0163163_10137611
2179 Ga0163163_10366663
2180 Ga0157380_10030521
2181 Ga0157380_10049854
2182 Ga0157377_10026431
2183 Ga0157377_10031449
2184 Ga0157379_10000802
2185 Ga0157379_10012652
2186 Ga0157379_10021056
2187 Ga0157379_10075892
2188 Ga0157379_10199641
2189 Ga0157379_10202568
2190 Ga0157376_10056950
2191 Ga0157376_10101412
2192 Ga0157376_10179127
2193 Ga0163161_10007436
2194 Ga0163161_10010399
2195 Ga0163161_10038113
2196 Ga0206353_11145561
2197 Ga0213873_10000096
2198 Ga0213876_10008265
2199 Ga0213876_10020805
2200 Ga0213875_10000455
2201 Ga0213875_10011610
2202 Ga0213875_10035249
2203 Ga0207427_100126
2204 Ga0209437_100585
2205 Ga0209148_1004143
2206 Ga0209129_1000079
2207 Ga0209233_1000014
2208 Ga0209673_1006798
2209 Ga0209025_1001940
2210 Ga0209051_1000011
2211 Ga0209051_1000795
2212 Ga0209051_1002312
2213 Ga0209051_1017900
2214 Ga0207656_10000001
2215 Ga0207656_10000003
2216 Ga0207655_1005143
2217 Ga0207655_1049401
2218 Ga0207713_1012442
2219 Ga0207682_10007444
2220 Ga0207692_10001723
2221 Ga0207692_10003209
2222 Ga0207692_10007932
2223 Ga0207642_10002272
2224 Ga0207710_10000013
2225 Ga0207710_10000082
2226 Ga0207710_10000178
2227 Ga0207710_10001332
2228 Ga0207710_10018838
2229 Ga0207710_10051974
2230 Ga0207688_10001000
2231 Ga0207688_10002930
2232 Ga0207688_10003558
2233 Ga0207680_10055045
2234 Ga0207680_10065139
2235 Ga0207647_10031084
2236 Ga0207647_10067875
2237 Ga0207685_10006158
2238 Ga0207699_10003242
2239 Ga0207699_10008552
2240 Ga0207699_10044092
2241 Ga0207645_10011165
2242 Ga0207645_10067665
2243 Ga0207643_10000642
2244 Ga0207643_10053204
2245 Ga0207705_10000595
2246 Ga0207705_10015540
2247 Ga0207705_10015936
2248 Ga0207705_10036392
2249 Ga0207705_10050987
2250 Ga0207705_10242994
2251 Ga0207684_10011027
2252 Ga0207684_10085908
2253 Ga0207684_10110326
2254 Ga0207684_10299946
2255 Ga0207654_10000003
2256 Ga0207654_10021949
2257 Ga0207654_10081089
2258 Ga0207654_10107808
2259 Ga0207707_10016166
2260 Ga0207707_10021899
2261 Ga0207707_10022717
2262 Ga0207707_10026215
2263 Ga0207695_10005261
2264 Ga0207695_10009600
2265 Ga0207695_10035988
2266 Ga0207695_10113003
2267 Ga0207671_10000001
2268 Ga0207671_10047284
2269 Ga0207693_10000420
2270 Ga0207693_10002493
2271 Ga0207693_10006587
2272 Ga0207693_10011553
2273 Ga0207693_10031552
2274 Ga0207663_10005192
2275 Ga0207663_10005313
2276 Ga0207663_10013983
2277 Ga0207663_10071693
2278 Ga0207660_10009254
2279 Ga0207660_10147980
2280 Ga0207657_10018543
2281 Ga0207657_10021331
2282 Ga0207657_10038028
2283 Ga0207649_10003700
2284 Ga0207649_10030705
2285 Ga0207649_10110283
2286 Ga0207652_10001493
2287 Ga0207652_10010256
2288 Ga0207652_10011363
2289 Ga0207652_10047865
2290 Ga0207652_10126575
2291 Ga0207652_10190258
2292 Ga0207652_10203646
2293 Ga0207646_10004909
2294 Ga0207646_10224067
2295 Ga0207681_10001110
2296 Ga0207681_10032269
2297 Ga0207694_10005422
2298 Ga0207694_10055020
2299 Ga0207694_10257031
2300 Ga0207650_10032659
2301 Ga0207659_10027257
2302 Ga0207687_10001526
2303 Ga0207687_10004349
2304 Ga0207687_10011308
2305 Ga0207687_10015347
2306 Ga0207687_10024987
2307 Ga0207687_10040902
2308 Ga0207687_10070166
2309 Ga0207687_10238274
2310 Ga0207700_10004533
2311 Ga0207700_10005586
2312 Ga0207700_10056479
2313 Ga0207700_10070499
2314 Ga0207700_10209218
2315 Ga0207700_10248327
2316 Ga0207664_10000063
2317 Ga0207664_10003992
2318 Ga0207664_10006346
2319 Ga0207664_10018596
2320 Ga0207664_10054555
2321 Ga0207644_10033273
2322 Ga0207690_10018486
2323 Ga0207690_10045554
2324 Ga0207706_10002446
2325 Ga0207706_10015108
2326 Ga0207706_10051457
2327 Ga0207706_10129662
2328 Ga0207709_10010193
2329 Ga0207709_10012673
2330 Ga0207709_10032863
2331 Ga0207709_10114899
2332 Ga0207670_10034938
2333 Ga0207670_10074152
2334 Ga0207669_10000932
2335 Ga0207669_10042240
2336 Ga0207669_10242228
2337 Ga0207704_10067588
2338 Ga0207665_10001654
2339 Ga0207665_10003273
2340 Ga0207665_10004483
2341 Ga0207665_10009362
2342 Ga0207665_10013756
2343 Ga0207691_10001332
2344 Ga0207691_10227457
2345 Ga0207711_10001465
2346 Ga0207711_10001834
2347 Ga0207711_10005962
2348 Ga0207711_10129430
2349 Ga0207711_10203309
2350 Ga0207711_10253167
2351 Ga0207689_10000187
2352 Ga0207689_10002944
2353 Ga0207689_10006655
2354 Ga0207689_10015723
2355 Ga0207689_10023181
2356 Ga0207661_10001731
2357 Ga0207661_10005113
2358 Ga0207661_10056083
2359 Ga0207661_10107587
2360 Ga0207661_10123319
2361 Ga0207679_10007877
2362 Ga0207667_10005915
2363 Ga0207667_10012713
2364 Ga0207667_10027190
2365 Ga0207667_10027909
2366 Ga0207667_10038335
2367 Ga0207667_10137161
2368 Ga0207712_10000006
2369 Ga0207712_10011671
2370 Ga0207712_10233252
2371 Ga0207668_10001742
2372 Ga0207640_10004946
2373 Ga0207640_10016616
2374 Ga0207640_10042940
2375 Ga0207658_10000970
2376 Ga0207658_10009505
2377 Ga0207658_10057863
2378 Ga0207658_10176404
2379 Ga0207677_10042913
2380 Ga0207677_10048470
2381 Ga0207677_10052078
2382 Ga0207677_10067825
2383 Ga0207677_10143290
2384 Ga0207677_10225495
2385 Ga0207703_10000015
2386 Ga0207703_10000131
2387 Ga0207703_10013056
2388 Ga0207703_10021554
2389 Ga0207703_10218624
2390 Ga0207639_10005218
2391 Ga0207639_10019729
2392 Ga0207639_10130697
2393 Ga0207678_10002354
2394 Ga0207678_10011889
2395 Ga0207678_10019054
2396 Ga0207678_10032883
2397 Ga0207678_10037802
2398 Ga0207678_10075426
2399 Ga0207708_10000123
2400 Ga0207708_10008837
2401 Ga0207708_10019476
2402 Ga0207708_10084696
2403 Ga0207702_10004958
2404 Ga0207702_10019652
2405 Ga0207702_10044872
2406 Ga0207702_10118513
2407 Ga0207702_10171037
2408 Ga0207702_10174634
2409 Ga0207641_10022729
2410 Ga0207641_10031413
2411 Ga0207641_10041605
2412 Ga0207641_10126696
2413 Ga0207648_10009571
2414 Ga0207648_10023728
2415 Ga0207648_10058974
2416 Ga0207676_10001957
2417 Ga0207674_10009940
2418 Ga0207674_10020299
2419 Ga0207674_10049467
2420 Ga0207675_100004425
2421 Ga0207675_100036517
2422 Ga0207675_100086914
2423 Ga0207675_100146475
2424 Ga0207675_100192367
2425 Ga0207675_100219272
2426 Ga0207683_10003430
2427 Ga0207683_10010756
2428 Ga0207683_10024562
2429 Ga0207683_10115208
2430 Ga0207683_10125260
2431 Ga0207683_10178115
2432 Ga0207683_10305466
2433 Ga0207698_10003180
2434 Ga0207698_10023505
2435 Ga0207698_10079070
2436 Ga0207698_10080506
2437 Ga0207698_10154594
2438 Ga0207428_10068649
2439 Ga0207428_10079774
2440 Ga0207428_10099720
2441 Ga0268266_10007851
2442 Ga0268266_10024077
2443 Ga0268266_10031295
2444 Ga0268266_10064306
2445 Ga0268266_10068211
2446 Ga0268265_10000016
2447 Ga0268265_10084439
2448 Ga0268265_10273693
2449 Ga0268264_10000026
2450 Ga0268264_10000031
2451 Ga0268264_10012141
2452 Ga0268264_10052844
2453 Ga0268264_10145580
2454 Ga0265334_10000839
2455 Ga0307515_10014277
2456 Ga0307515_10021795
2457 Ga0307515_10022335
2458 Ga0307511_10106788
2459 Ga0307512_10005170
2460 Ga0307512_10009276
2461 Ga0307512_10020281
2462 Ga0307512_10047890
2463 Ga0265340_10035175
2464 Ga0265340_10040806
2465 Ga0265327_10000041
2466 Ga0265327_10001529
2467 Ga0265327_10008570
2468 Ga0265327_10029384
2469 Ga0307513_10000001
2470 Ga0307513_10015478
2471 Ga0307513_10022497
2472 Ga0307408_100019307
2473 Ga0307408_100022759
2474 Ga0307408_100035646
2475 Ga0307408_100064742
2476 Ga0307408_100325912
2477 Ga0265313_10035630
2478 Ga0265313_10040218
2479 Ga0307508_10001163
2480 Ga0307508_10007864
2481 Ga0307508_10024539
2482 Ga0307508_10074409
2483 Ga0307514_10040454
2484 Ga0307514_10082332
2485 Ga0316575_10063963
2486 Ga0265314_10057721
2487 Ga0265342_10041432
2488 Ga0265342_10118549
2489 Ga0316576_10000511
2490 Ga0316576_10017182
2491 Ga0316576_10017551
2492 Ga0316576_10048395
2493 Ga0316576_10140041
2494 Ga0316578_10036615
2495 Ga0316578_10081290
2496 Ga0316578_10105522
2497 Ga0307516_10003100
2498 Ga0316577_10056287
2499 Ga0307413_10042245
2500 Ga0307518_10048571
2501 Ga0307410_10024068
2502 Ga0307410_10024166
2503 Ga0307410_10057129
2504 Ga0307410_10068104
2505 Ga0307410_10109058
2506 Ga0307410_10155605
2507 Ga0307406_10068534
2508 Ga0307406_10083514
2509 Ga0307406_10093638
2510 Ga0307406_10093771
2511 Ga0307407_10080026
2512 Ga0307407_10173283
2513 Ga0307412_10029765
2514 Ga0307409_100008616
2515 Ga0307409_100021231
2516 Ga0307409_100058000
2517 Ga0307409_100107967
2518 Ga0307409_100276950
2519 Ga0307409_100385132
2520 Ga0307416_100015187
2521 Ga0307416_100039444
2522 Ga0307416_100133681
2523 Ga0307416_100232592
2524 Ga0307416_100240066
2525 Ga0307416_100270491
2526 Ga0307416_100424511
2527 Ga0307414_10107423
2528 Ga0307414_10268980
2529 Ga0307411_10001113
2530 Ga0307411_10248123
2531 Ga0307415_100005815
2532 Ga0307415_100023748
2533 Ga0307415_100032681
2534 Ga0307415_100037663
2535 Ga0307415_100052500
2536 Ga0307415_100114408
2537 Ga0307415_100315876
2538 Ga0316583_10010209
2539 Ga0316580_10016328
2540 Ga0307510_10008263
2541 Ga0373930_0002591
2542 Ga0373948_0001069
2543 Ga0373934_0000014
2544 Ga0373934_0019070
2545 Ga0373949_0013828
2546 Ga0373951_0000127
2547 Ga0373951_0004369
2548 Ga0373951_0019293
2549 Ga0373932_0003524
2550 Ga0373953_0001755
2551 Ga0373953_0046502
2552 Ga0373954_0001669
2553 Ga0373954_0034701
2554 Ga0373956_0001414
2555 Ga0373956_0007651
2556 Ga0373957_0000846
2557 Ga0373957_0001048
2558 Ga0373943_0015990
2559 Ga0373946_0040136
2560 Ga0373955_0000040
2561 Ga0373955_0003554
2562 Ga0373961_0019195
2563 Ga0316574_0006815
2564 Ga0316574_0031353
2565 Ga0316574_0040647
2566 Ga0316574_0140967
2567 Ga0373924_0001593
2568 Ga0373924_0038344
2569 Ga0373931_0019275
2570 Ga0373935_0013523
2571 Ga0373933_0000085
2572 Ga0373937_0000197
2573 Ga0373937_0121631
2574 Ga0373937_0123043
2575 Ga0316584_0011739
2576 Ga0316584_0033039
2577 Ga0316584_0052838
2578 Ga0316584_0075219
2579 Ga0316584_0090142
2580 Ga0395899_0002958
2581 Ga0395899_0004671
2582 Ga0395899_0035839
2583 Ga0395899_0046758
2584 Ga0395899_0049908
2585 Ga0395899_0114071
2586 Ga0395900_0005127
2587 Ga0395900_0006397
2588 Ga0395900_0010840
2589 Ga0395900_0019678
2590 Ga0395900_0025509
2591 Ga0395900_0079080
2592 Ga0395900_0102449
2593 Ga0395900_0197109
2594 Ga0395898_0006003
2595 Ga0395898_0006892
2596 Ga0395898_0013311
2597 Ga0395898_0017536
2598 Ga0395898_0029723
2599 Ga0395898_0057223
2600 Ga0395898_0077820
2601 Ga0395898_0083918
2602 Ga0395898_0112966
2603 Ga0395898_0115035
2604 Ga0395898_0324087
2605 Ga0395898_0348124
2606 Ga0395905_0001026
2607 Ga0395905_0009643
2608 Ga0395905_0303095
2609 Ga0395905_0405009
2610 Ga0436364_0113323
2611 Ga0436364_0238472
2612 Ga0436364_0418931
2613 Ga0436364_0453470
2614 Ga0436364_0647082
2615 Ga0436364_1255815
2616 Ga0436364_1390545
2617 Ga0395901_0003412
2618 Ga0395901_0021006
2619 Ga0395901_0032994
2620 Ga0395901_0054233
2621 Ga0395901_0113011
2622 Ga0395901_0161745
2623 Ga0395901_0209072
2624 Ga0436365_0613236
2625 Ga0436365_0885952
2626 Ga0436365_1214067
2627 Ga0436363_0076260
2628 Ga0436363_0265210
2629 Ga0436363_0330623
2630 Ga0436362_0604249
2631 Ga0439439_0003804
2632 Ga0439447_010755
2633 Ga0439466_0020498
2634 Ga0439466_0030633
2635 Ga0439465_0008353
2636 Ga0439465_0010651
2637 Ga0439465_0011796
2638 Ga0439465_0031545
2639 Ga0451802_0335608
2640 Ga0451802_1677789
2641 Ga0451853_0988203
2642 Ga0451853_2451760
2643 Ga0439431_0000706
2644 Ga0439433_0000016
2645 Ga0439433_0005084
2646 Ga0439442_000124
2647 Ga0439442_000483
2648 Ga0439442_006494
2649 Ga0439442_007840
2650 Ga0439442_012154
2651 Ga0439432_027337
2652 Ga0439449_0000123
2653 Ga0439449_0044932
2654 Ga0439452_008147
2655 Ga0439452_027059
2656 Ga0439463_026533
2657 Ga0450920_001002
2658 Ga0450920_008485
2659 Ga0450907_000606
2660 Ga0439434_0000220
2661 Ga0439434_0018559
2662 Ga0466969_0031467
2663 Ga0466972_0017406
2664 Ga0466972_0102840
2665 Ga0466965_0008270
2666 Ga0466965_0010455
2667 Ga0466965_0014794
2668 Ga0466965_0027934
2669 Ga0466966_0003105
2670 Ga0466966_0006470
2671 Ga0466966_0012176
2672 Ga0466966_0030188
2673 Ga0466966_0074689
2674 Ga0466966_0076601
2675 Ga0466966_0078802
2676 Ga0466966_0143115
2677 Ga0466961_0000223
2678 Ga0466961_0005237
2679 Ga0466961_0014413
2680 Ga0466961_0016492
2681 Ga0466961_0019719
2682 Ga0466961_0035925
2683 Ga0466961_0049608
2684 Ga0466961_0050180
2685 Ga0466961_0052631
2686 Ga0466961_0103753
2687 Ga0466961_0107930
2688 Ga0466961_0162785
2689 Ga0466963_0000604
2690 Ga0466963_0002782
2691 Ga0466963_0104315
2692 Ga0466964_0068658
2693 Ga0466971_0000354
2694 Ga0466971_0019022
2695 Ga0466971_0023917
2696 Ga0466971_0083518
2697 Ga0466968_0001034
2698 Ga0466968_0014236
2699 Ga0466968_0046781
2700 Ga0466970_0001205
2701 Ga0466970_0007113
2702 Ga0466970_0007660
2703 Ga0466970_0026731
2704 Ga0466970_0034538
2705 Ga0466970_0050609
2706 Ga0466957_0000283
2707 Ga0466957_0004553
2708 Ga0466957_0010194
2709 Ga0466957_0012679
2710 Ga0466957_0024790
2711 Ga0466957_0043592
2712 Ga0466957_0066258
2713 Ga0466960_0002656
2714 Ga0466960_0004820
2715 Ga0466960_0005643
2716 Ga0466960_0019496
2717 Ga0466960_0025646
2718 Ga0466960_0150487
2719 Ga0466959_0009115
2720 Ga0466959_0013261
2721 Ga0466959_0014077
2722 Ga0466959_0017810
2723 Ga0466959_0022208
2724 Ga0466959_0032930
2725 Ga0466959_0040799
2726 Ga0466959_0045121
2727 Ga0466958_0000114
2728 Ga0466958_0000748
2729 Ga0466958_0005582
2730 Ga0466958_0007421
2731 Ga0466958_0020417
2732 Ga0466958_0032227
2733 Ga0466958_0035027
2734 Ga0466958_0075985
2735 Ga0466958_0098160
2736 Ga0466967_0001120
2737 Ga0466967_0006791
2738 Ga0466967_0019688
2739 Ga0466967_0024332
2740 Ga0466967_0025471
2741 Ga0466967_0027636
2742 Ga0466967_0031995
2743 Ga0466967_0075584
2744 Ga0466967_0119314
2745 Ga0466967_0364757
2746 Ga0495627_039472
2747 Ga0495627_046758
2748 Ga0495592_0000157
2749 Ga0495592_0064496
2750 Ga0495603_0000552
2751 Ga0495603_0013090
2752 Ga0495603_0054857
2753 Ga0495590_0000484
2754 Ga0495629_0001111
2755 Ga0495629_0001228
2756 Ga0495629_0006771
2757 Ga0495629_0014332
2758 Ga0495638_0001596
2759 Ga0495638_0040952
2760 Ga0495638_0059658
2761 Ga0495641_0008500
2762 Ga0495641_0051617
2763 Ga0495651_0000115
2764 Ga0495651_0006516
2765 Ga0495651_0035816
2766 Ga0495653_0011549
2767 Ga0495653_0068042
2768 Ga0495580_0003950
2769 Ga0495582_0005171
2770 Ga0495605_0004092
2771 Ga0495639_0002427
2772 Ga0495639_0016313
2773 Ga0495639_0029477
2774 Ga0495664_0001861
2775 Ga0495664_0030935
2776 Ga0495585_0024459
2777 Ga0495594_0000581
2778 Ga0495607_0035772
2779 Ga0495583_0039585
2780 Ga0495608_0003716
2781 Ga0495616_0007512
2782 Ga0495618_0076007
2783 Ga0495628_0000492
2784 Ga0495628_0030926
2785 Ga0495630_0219288
2786 Ga0495631_0028018
2787 Ga0495632_0023354
2788 Ga0495632_0105050
2789 Ga0495637_0034811
2790 Ga0495643_0003144
2791 Ga0495643_0060299
2792 Ga0495648_0018440
2793 Ga0495648_0057527
2794 Ga0495666_0019999
2795 Ga0495666_0043441
2796 Ga0495652_0007274
2797 Ga0495652_0022385
2798 Ga0495652_0060817
2799 Ga0495652_0073275
2800 Ga0495665_0030387
2801 Ga0495640_0026843
2802 Ga0495586_0002370
2803 Ga0495586_0015897
2804 Ga0495586_0092857
2805 Ga0495587_0000123
2806 Ga0495587_0002547
2807 Ga0495609_0011345
2808 Ga0495645_0001555
2809 Ga0495645_0019225
2810 Ga0495645_0027772
2811 Ga0495645_0034357
2812 Ga0495645_0155719
2813 Ga0495622_0008572
2814 Ga0495622_0019863
2815 Ga0495622_0058800
2816 Ga0495633_0006910
2817 Ga0495667_0000107
2818 Ga0495667_0001041
2819 Ga0495667_0007253
2820 Ga0495668_0002662
2821 Ga0495634_0020569
2822 Ga0495611_0016203
2823 Ga0495635_0028622
2824 Ga0495588_0040447
2825 Ga0495657_0000169
2826 Ga0495657_0011577
2827 Ga0495657_0029164
2828 Ga0495657_0036625
2829 Ga0495599_0002521
2830 Ga0495599_0037427
2831 Ga0495599_0042368
2832 Ga0495623_0000166
2833 Ga0495623_0033496
2834 Ga0495623_0050024
2835 Ga0495646_0059942
2836 Ga0495646_0111000
2837 Ga0495658_0116082
2838 Ga0495658_0154287
2839 Ga0495613_0009856
2840 Ga0495613_0015671
2841 Ga0495613_0027353
2842 Ga0495613_0032534
2843 Ga0495624_0058068
2844 Ga0495624_0169833
2845 Ga0495589_0032868
2846 Ga0495600_0005572
2847 Ga0495600_0009464
2848 Ga0495600_0017124
2849 Ga0495581_0009107
2850 Ga0495581_0027592
2851 Ga0495581_0043604
2852 Ga0495604_0000161
2853 Ga0495604_0003057
2854 Ga0495604_0027138
2855 Ga0495604_0038371
2856 Ga0495604_0052981
2857 Ga0495636_0026434
2858 Ga0495674_0012623
2859 Ga0495674_0018404
2860 Ga0495674_0101431
2861 Ga0495672_0003416
2862 Ga0495672_0041435
2863 Ga0495672_0041850
2864 Ga0495676_0000233
2865 Ga0495676_0005210
2866 Ga0495676_0017972
2867 Ga0495676_0200323
2868 Ga0495680_0007013
2869 Ga0495680_0023511
2870 Ga0495680_0030600
2871 Ga0495683_0002632
2872 Ga0495683_0041213
2873 Ga0495687_000581
2874 Ga0495687_030957
2875 Ga0495675_0002978
2876 Ga0495675_0011761
2877 Ga0495675_0015106
2878 Ga0495675_0022673
2879 Ga0495677_0036674
2880 Ga0495685_012532
2881 Ga0495684_0050867
2882 Ga0495684_0122680
2883 Ga0495686_0092934
2884 Ga0495593_0017119
2885 Ga0495593_0047132
2886 Ga0495602_0000182
2887 Ga0495602_0075152
2888 Ga0495614_0006858
2889 Ga0496100_0000335
2890 Ga0496100_0003473
2891 Ga0496100_0018499
2892 Ga0496100_0067268
2893 Ga0496100_0125109
2894 Ga0496101_0000193
2895 Ga0496101_0001504
2896 Ga0496101_0001767
2897 Ga0496101_0015785
2898 Ga0496101_0031811
2899 Ga0496101_0038237
2900 Ga0496101_0056663
2901 Ga0496101_0215633
2902 Ga0496102_0000403
2903 Ga0496102_0000750
2904 Ga0496102_0021913
2905 Ga0496102_0031975
2906 Ga0496102_0032948
2907 Ga0496102_0139973
2908 Ga0496102_0147261
2909 Ga0496102_0198432
2910 Ga0496102_0202009
2911 Ga0496102_0284190
2912 Ga0496103_0000284
2913 Ga0496103_0001055
2914 Ga0496103_0002082
2915 Ga0496103_0042265
2916 Ga0496104_0012811
2917 Ga0496104_0025727
2918 Ga0496104_0039321
2919 Ga0496104_0059938
2920 Ga0496104_0093139
2921 Ga0496105_0002855
2922 Ga0496105_0021733
2923 Ga0496105_0036004
2924 Ga0496105_0050189
2925 Ga0496105_0062054
2926 Ga0496105_0069758
2927 Ga0496105_0187822
2928 Ga0496106_0000199
2929 Ga0496106_0005688
2930 Ga0496106_0008646
2931 Ga0496106_0014818
2932 Ga0496106_0017751
2933 Ga0496106_0058154
2934 Ga0496106_0163455
2935 Ga0496107_0001353
2936 Ga0496107_0003743
2937 Ga0496107_0013481
2938 Ga0496107_0014415
2939 Ga0496107_0067460
2940 Ga0496107_0202652
2941 Ga0496108_0000966
2942 Ga0496108_0006263
2943 Ga0496108_0012159
2944 Ga0496108_0022651
2945 Ga0496108_0045925
2946 Ga0496108_0051511
2947 Ga0496108_0060482
2948 Ga0496108_0125407
2949 Ga0496109_0001398
2950 Ga0496109_0008976
2951 Ga0496109_0013820
2952 Ga0496109_0038853
2953 Ga0496109_0053536
2954 Ga0496109_0066894
2955 Ga0496109_0078672
2956 Ga0496109_0114351
2957 Ga0496109_0171944
2958 Ga0496109_0257216
2959 Ga0496110_0003627
2960 Ga0496110_0010603
2961 Ga0496110_0020318
2962 Ga0496110_0028522
2963 Ga0496110_0032924
2964 Ga0496110_0056148
2965 Ga0496110_0071762
2966 Ga0496110_0080305
2967 Ga0496111_0045908
2968 Ga0496111_0057655
2969 Ga0496111_0095915
2970 Ga0496111_0218902
2971 Ga0496111_0256606
2972 Ga0496112_0002892
2973 Ga0496112_0017061
2974 Ga0496112_0018635
2975 Ga0496112_0066522
2976 Ga0496112_0181212
2977 Ga0496112_0197097
2978 Ga0496113_0006724
2979 Ga0496113_0007107
2980 Ga0496113_0122804
2981 Ga0496113_0297112
2982 Ga0496114_0000559
2983 Ga0496114_0001803
2984 Ga0496114_0008348
2985 Ga0496114_0015343
2986 Ga0496114_0017869
2987 Ga0496115_0003426
2988 Ga0496115_0010823
2989 Ga0496115_0019920
2990 Ga0496115_0020283
2991 Ga0496115_0059407
2992 Ga0496115_0101116
2993 Ga0496115_0124763
2994 Ga0496115_0151615
2995 Ga0496116_0000059
2996 Ga0496116_0031324
2997 Ga0496117_0000055
2998 Ga0496117_0002301
2999 Ga0496117_0003028
3000 Ga0496117_0029473
3001 Ga0496117_0034361
3002 Ga0496117_0057954
3003 Ga0496118_0000398
3004 Ga0496118_0000879
3005 Ga0496118_0002102
3006 Ga0496118_0009080
3007 Ga0496118_0045956
3008 Ga0496118_0072819
3009 Ga0496118_0099499
3010 Ga0496119_0000375
3011 Ga0496119_0010507
3012 Ga0496119_0016974
3013 Ga0496119_0018886
3014 Ga0496120_0000453
3015 Ga0496120_0004273
3016 Ga0496120_0011458
3017 Ga0496120_0016566
3018 Ga0496120_0016881
3019 Ga0496120_0089304
3020 Ga0496121_0000433
3021 Ga0496121_0001114
3022 Ga0496121_0011354
3023 Ga0496121_0043764
3024 Ga0496122_0001536
3025 Ga0496122_0008484
3026 Ga0496122_0009000
3027 Ga0496122_0099743
3028 Ga0496123_0001055
3029 Ga0496123_0054573
3030 Ga0496123_0088077
3031 Ga0496124_0000015
3032 Ga0496124_0000198
3033 Ga0496124_0007726
3034 Ga0496124_0007779
3035 Ga0496125_0000021
3036 Ga0496125_0000172
3037 Ga0496125_0003069
3038 Ga0496125_0020233
3039 Ga0496125_0051644
3040 Ga0496125_0210415
3041 Ga0496126_0000015
3042 Ga0496126_0000676
3043 Ga0496126_0005915
3044 Ga0496126_0008414
3045 Ga0496126_0009487
3046 Ga0496126_0064670
3047 Ga0496126_0084982
3048 Ga0496126_0217689
3049 Ga0501306_006485
3050 Ga0501031_0005824
3051 Ga0501031_0089703
3052 Ga0501032_0001836
3053 Ga0501032_0005443
3054 Ga0501032_0008992
3055 Ga0501032_0013197
3056 Ga0501033_0027710
3057 Ga0501033_0034053
3058 Ga0501033_0110295
3059 Ga0501033_0130203
3060 Ga0501034_0000015
3061 Ga0501034_0000543
3062 Ga0501034_0005064
3063 Ga0501034_0018586
3064 Ga0501034_0022037
3065 Ga0501034_0065426
3066 Ga0501034_0071162
3067 Ga0501034_0080618
3068 Ga0501034_0098570
3069 Ga0501034_0123536
3070 Ga0501034_0123811
3071 Ga0501034_0124822
3072 Ga0501034_0171816
3073 Ga0501034_0303310
3074 Ga0501034_0417429
3075 Ga0501036_0002530
3076 Ga0501036_0003852
3077 Ga0501036_0015135
3078 Ga0501036_0024970
3079 Ga0501036_0149485
3080 Ga0501036_0165471
3081 Ga0501037_0001123
3082 Ga0501037_0013330
3083 Ga0501037_0047486
3084 Ga0501037_0068478
3085 Ga0501037_0126288
3086 Ga0501038_0006115
3087 Ga0501038_0007725
3088 Ga0501038_0017810
3089 Ga0501038_0061692
3090 Ga0501038_0099827
3091 Ga0501038_0144817
3092 Ga0501038_0197175
3093 Ga0501039_0001048
3094 Ga0501039_0006498
3095 Ga0501039_0009678
3096 Ga0501040_0022837
3097 Ga0501040_0087038
3098 Ga0501041_0000703
3099 Ga0501041_0043969
3100 Ga0501041_0071309
3101 Ga0501042_0045990
3102 Ga0501042_0058123
3103 Ga0501042_0067621
3104 Ga0501042_0110801
3105 Ga0501043_0000606
3106 Ga0501043_0009509
3107 Ga0501043_0013569
3108 Ga0501043_0016803
3109 Ga0501043_0024460
3110 Ga0501043_0036812
3111 Ga0501043_0043569
3112 Ga0501043_0046336
3113 Ga0501043_0052392
3114 Ga0501043_0117528
3115 Ga0501043_0172766
3116 Ga0501046_0001735
3117 Ga0501046_0002135
3118 Ga0501046_0003857
3119 Ga0501046_0006220
3120 Ga0501047_0000107
3121 Ga0501047_0000268
3122 Ga0501047_0002183
3123 Ga0501047_0008765
3124 Ga0501047_0013070
3125 Ga0501047_0027020
3126 Ga0501047_0087040
3127 Ga0501048_0003331
3128 Ga0501048_0143518
3129 Ga0501048_0164294
3130 Ga0501048_0251248
3131 Ga0501067_0008668
3132 Ga0501067_0032390
3133 Ga0501068_0017903
3134 Ga0501068_0106361
3135 Ga0501069_0006022
3136 Ga0501069_0038097
3137 Ga0501069_0066513
3138 Ga0501070_0000925
3139 Ga0501070_0002491
3140 Ga0501070_0004541
3141 Ga0501070_0008759
3142 Ga0501070_0042137
3143 Ga0501070_0043498
3144 Ga0501070_0047700
3145 Ga0501070_0068120
3146 Ga0501070_0095453
3147 Ga0501071_0000938
3148 Ga0501071_0032295
3149 Ga0501072_0006940
3150 Ga0501072_0072579
3151 Ga0501072_0161295
3152 Ga0501072_0161952
3153 Ga0501072_0192834
3154 Ga0501073_0000024
3155 Ga0501073_0016913
3156 Ga0501073_0024223
3157 Ga0501073_0072087
3158 Ga0501073_0183129
3159 Ga0501074_0001157
3160 Ga0501074_0002652
3161 Ga0501074_0018015
3162 Ga0501074_0090092
3163 Ga0501076_0001496
3164 Ga0501076_0022476
3165 Ga0501076_0201480
3166 Ga0501077_0014871
3167 Ga0501079_0003055
3168 Ga0501079_0011446
3169 Ga0501080_0001035
3170 Ga0501080_0006153
3171 Ga0501080_0016596
3172 Ga0501080_0022823
3173 Ga0501080_0091423
3174 Ga0501080_0258973
3175 Ga0501081_0006271
3176 Ga0501081_0011062
3177 Ga0501083_0005406
3178 Ga0501083_0186096
3179 Ga0501035_0003186
3180 Ga0501035_0014479
3181 Ga0501035_0014942
3182 Ga0501035_0019336
3183 Ga0501035_0023019
3184 Ga0501035_0023206
3185 Ga0501044_0001612
3186 Ga0501044_0005882
3187 Ga0501044_0006459
3188 Ga0501044_0007748
3189 Ga0501044_0015647
3190 Ga0501044_0035143
3191 Ga0501044_0043045
3192 Ga0501044_0066591
3193 Ga0501044_0089672
3194 Ga0501045_0039028
3195 nmdc:mga03683_17583_c1
3196 nmdc:mga03n38_1081_c1
3197 nmdc:mga03n38_2844_c1
3198 nmdc:mga03n38_38141_c1
3199 nmdc:mga00v17_10006_c1
3200 nmdc:mga00v17_16972_c1
3201 nmdc:mga00v17_3299_c1
3202 nmdc:mga00v17_3766_c1
3203 nmdc:mga00v17_37721_c1
3204 nmdc:mga00v17_72057_c1
3205 nmdc:mga00v17_9193_c1
3206 nmdc:mga0yw44_2056_c1
3207 nmdc:mga0yw44_4555_c1
3208 nmdc:mga06z11_11779_c1
3209 nmdc:mga07m45_113737_c1
3210 nmdc:mga07m45_18278_c1
3211 nmdc:mga07m45_3115_c1
3212 nmdc:mga07m45_41926_c1
3213 nmdc:mga07m45_47346_c1
3214 nmdc:mga07m45_7793_c1
3215 nmdc:mga05p37_11899_c1
3216 nmdc:mga05p37_172547_c1
3217 nmdc:mga05p37_2128_c1
3218 nmdc:mga05p37_46755_c1
3219 nmdc:mga05p37_59920_c1
3220 nmdc:mga09592_1737_c1
3221 nmdc:mga09592_199312_c1
3222 nmdc:mga0qj67_193_c1
3223 nmdc:mga0qj67_3435_c1
3224 nmdc:mga0qj67_36297_c1
3225 nmdc:mga0qj67_695_c1
3226 nmdc:mga06r32_111190_c1
3227 nmdc:mga06r32_15489_c1
3228 nmdc:mga06r32_1594_c1
3229 nmdc:mga06r32_198_c1
3230 nmdc:mga06r32_261812_c1
3231 nmdc:mga06r32_275_c1
3232 nmdc:mga06r32_77316_c1
3233 nmdc:mga08y16_5920_c1
3234 nmdc:mga08y16_85139_c1
3235 nmdc:mga08y16_92314_c1
3236 nmdc:mga0n895_41320_c1
3237 nmdc:mga0n895_7027_c1
3238 nmdc:mga0n895_93647_c1
3239 nmdc:mga0n895_99740_c1
3240 nmdc:mga0rr50_41993_c1
3241 nmdc:mga0rr50_64626_c1
3242 nmdc:mga08x19_6450_c1
3243 nmdc:mga0a205_109248_c1
3244 nmdc:mga0a205_38254_c1
3245 nmdc:mga0a205_56142_c1
3246 nmdc:mga0a205_8625_c2
3247 nmdc:mga0sz30_4791_c1
3248 nmdc:mga0sz30_65576_c1
3249 nmdc:mga0sz30_656_c1
3250 nmdc:mga0sz30_8114_c1
3251 Ga0495601_0125810
3252 Ga0495612_0000472
3253 Ga0495612_0029687
3254 Ga0495612_0043180
3255 Ga0495595_0006267
3256 Ga0495595_0017594
3257 Ga0495619_0061541
3258 Ga0495619_0077770
3259 Ga0495619_0103658
3260 Ga0500643_000189
3261 Ga0500643_000352
3262 Ga0500646_0000612
3263 Ga0500651_0001689
3264 Ga0500651_0131400
3265 Ga0500641_0035450
3266 Ga0500554_006511
3267 Ga0500556_0000062
3268 Ga0500593_035358
3269 Ga0500594_0004228
3270 Ga0500652_058759
3271 Ga0500658_0039444
3272 Ga0500559_0000868
3273 Ga0500559_0002901
3274 Ga0500559_0020640
3275 Ga0500568_0000060
3276 Ga0500568_0000124
3277 Ga0500568_0002651
3278 Ga0500568_0019851
3279 Ga0500568_0033263
3280 Ga0500573_0000007
3281 Ga0500588_0003567
3282 Ga0500589_052185
3283 Ga0500590_001918
3284 Ga0500600_0068994
3285 Ga0500604_0013291
3286 Ga0500616_0002004
3287 Ga0500616_0064516
3288 Ga0500620_000387
3289 Ga0500645_000128
3290 Ga0501084_0002094
3291 Ga0501084_0028238
3292 Ga0501084_0052351
3293 Ga0501084_0053198
3294 Ga0501084_0063808
3295 Ga0501084_0126504
3296 Ga0501084_0237061
3297 Ga0590075_004557
3298 Ga0501082_0013306
3299 Ga0501082_0064397
3300 Ga0466962_0000302
3301 Ga0466962_0003093
3302 Ga0466962_0004408
3303 Ga0466962_0006025
3304 Ga0466962_0028426
3305 2501942824
3306 2506867832
3307 2515494912
3308 2515718916
3309 2515755575
3310 2515851904
3311 2516083128
3312 2516090214
3313 2523383290
3314 2528205551
3315 2528214972
3316 2546950328
3317 2548694814
3318 2552107491
3319 2554259472
3320 2558914157
3321 2566997442
3322 2579750244
3323 2579856475
3324 2585302008
3325 2585321075
3326 2616695704
3327 2619858079
3328 2620352616
3329 2623501119
3330 2623588025
3331 2626639665
3332 2643904555
3333 2644019206
3334 2644095148
3335 2644174112
3336 2644406179
3337 2644488693
3338 2644506432
3339 2644518138
3340 2644526650
3341 2644636685
3342 2644671316
3343 2671839072
3344 2676476047
3345 2676487337
3346 2686537797
3347 2686543134
3348 2689991648
3349 2710603810
3350 2731907033
3351 2738664986
3352 2738708135
3353 2738886690
3354 2739144120
3355 2739203829
3356 2739239384
3357 2739334712
3358 2744954612
3359 2753076170
3360 2753303407
3361 2774857228
3362 2774866103
3363 2774904260
3364 2776370698
3365 2793983469
3366 2808890684
3367 2810363513
3368 2811847040
3369 2812365412
3370 2812482300
3371 2819739146
3372 2827630609
3373 2837187228
3374 2839989531
3375 2842137806
3376 2844852307
3377 2844856559
3378 2855681951
3379 2855686874
3380 2856862049
3381 2857289182
3382 2857740182
3383 2857743804
3384 2858850004
3385 2858874904
3386 2858883484
3387 2858891979
3388 2858899339
3389 2858907845
3390 2861527631
3391 2862510485
3392 2862706808
3393 2863072248
3394 2867307773
3395 2867319094
3396 2867320099
3397 2867346895
3398 2867369926
3399 2867480854
3400 2868094364
3401 2869051888
3402 2869067946
3403 2869073443
3404 2870622737
3405 2870726152
3406 2875392761
3407 2880492030
3408 2880500262
3409 2884764545
3410 2884995185
3411 2889301981
3412 2891327154
3413 2895429234
3414 2895888739
3415 2899368037
3416 2899375434
3417 2902586652
3418 2902795775
3419 2902803821
3420 2902811851
3421 2902838577
3422 2904499703
3423 2904540346
3424 2904769221
3425 2904776331
3426 2904780360
3427 2905927707
3428 2905929264
3429 2905930281
3430 2908814417
3431 2910814860
3432 2912722325
3433 2912726037
3434 2912758959
3435 2919036156
3436 2919046180
3437 2919053168
3438 2919060871
3439 2919392436
3440 2919422858
3441 2919434889
3442 2919538626
3443 2919718922
3444 2922556375
3445 2928106968
3446 2928147267
3447 2929215655
3448 2929222155
3449 2929228820
3450 2932398928
3451 2932431103
3452 2932433655
3453 2933419213
3454 2935394777
3455 2939589358
3456 2939647868
3457 2939663719
3458 2939679070
3459 2939748198
3460 2945924525
3461 2945943739
3462 2945958072
3463 2946004070
3464 2946039708
3465 2946051954
3466 2947231749
3467 2954000932
3468 2954011001
3469 2956941213
3470 2966927682
3471 2974303208
3472 2984526003
3473 2984551711
3474 2990050098
3475 2990061429
3476 2990092041
3477 2995469292
3478 2996227977
3479 2997454832
3480 2997605605
3481 3001120351
3482 3003002251
3483 3006327930
3484 3006399468
3485 3006430613
3486 3006491715
3487 637880493
3488 649812648
3489 8003835703
3490 8003858503
3491 8004026160
3492 8008486503
3493 8008580681
3494 8025481225
3495 8025525572
3496 8025531020
3497 8033688272
3498 8047894932
3499 8048130482
3500 8048364118
3501 8048371950
3502 8048380884
3503 8053947878
3504 8054110003
3505 8054706813
3506 8054730850
3507 8054738895
3508 8054914099
3509 8054922895
3510 8055068480
3511 8055162372
3512 8055181034
3513 8055412800
3514 8056066074
3515 8056449305
3516 8056670177
3517 8056835631
3518 8057568517

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00764

Arginosuc_synth

Arginosuccinate synthase N-terminal HUP domain

4

165

0.99

PF20979

Arginosuc_syn_C

Arginosuccinate synthase C-terminal domain

174

391

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
4xfj-assembly1.cif.gz_A-2 crystal structure of argininosuccinate synthase from mycobacterium thermoresistibile in complex with amppnp and arginine 0.9851 2 397
4xfj-assembly1.cif.gz_B crystal structure of argininosuccinate synthase from mycobacterium thermoresistibile in complex with amppnp and arginine 0.984 2 397
4u7j-assembly1.cif.gz_B-2 crystal structure of argininosuccinate synthase from mycobacterium thermoresistibile 0.9821 3 397
4xfj-assembly1.cif.gz_A-2 crystal structure of argininosuccinate synthase from mycobacterium thermoresistibile in complex with amppnp and arginine 0.9802 2 397
4xfj-assembly1.cif.gz_B crystal structure of argininosuccinate synthase from mycobacterium thermoresistibile in complex with amppnp and arginine 0.9791 2 397
ID Description Score Start End Superfamily
4xfjA02 Alpha Beta;Alpha-Beta Complex;Argininosuccinate synthetase, chain A, domain 2;Argininosuccinate synthetase, chain A, domain 2 0.9983 175 361 3.90.1260.10
4xfjA02 Alpha Beta;Alpha-Beta Complex;Argininosuccinate synthetase, chain A, domain 2;Argininosuccinate synthetase, chain A, domain 2 0.9929 175 361 3.90.1260.10
af_A0A0R0IGZ2_74_244_3.90.1260.10 Alpha Beta;Alpha-Beta Complex;Argininosuccinate synthetase, chain A, domain 2;Argininosuccinate synthetase, chain A, domain 2 0.9816 175 344 3.90.1260.10
1kh1C02 Alpha Beta;Alpha-Beta Complex;Argininosuccinate synthetase, chain A, domain 2;Argininosuccinate synthetase, chain A, domain 2 0.9778 66 355 3.90.1260.10
af_A0A0P0Y1E8_15_149_3.90.1260.10 Alpha Beta;Alpha-Beta Complex;Argininosuccinate synthetase, chain A, domain 2;Argininosuccinate synthetase, chain A, domain 2 0.9736 252 378 3.90.1260.10
ID Description Score Start End GO Terms
AF-A0A3D1ZR42-F1-model_v4 Argininosuccinate synthase (EC 6.3.4.5) 0.9997 3 73 GO:0000050
GO:0000053
GO:0004055
GO:0005524
GO:0005737
GO:0006526
AF-A0A0E3N9I3-F1-model_v4 argininosuccinate synthase (EC 6.3.4.5) 0.9991 183 352 GO:0000050
GO:0000053
GO:0004055
GO:0005524
GO:0005737
GO:0006526
AF-A0A7G1ICP1-F1-model_v4 argininosuccinate synthase (EC 6.3.4.5) 0.9973 235 397 GO:0000050
GO:0000053
GO:0004055
GO:0005524
GO:0005737
GO:0006526
AF-A0A3E2CCP6-F1-model_v4 Argininosuccinate synthase (EC 6.3.4.5) 0.9969 3 147 GO:0000050
GO:0000053
GO:0004055
GO:0005524
GO:0005737
GO:0006526
AF-A0A365UVF0-F1-model_v4 deleted 0.995 1 398

Map