F495644

General Info

Members Datasets Scaffolds Average Seq Length
1769 620 3532 371

Family's Representative Sequence

Representative Sequence 3300028786|Ga0307517_10000447|Ga0307517_1000044736
Length 448
Sequence MNRHIQIYGLVFNKVVTVYSALVKFQMADNQRFMTVHRCSCCVNVNTGKSIMPTFTIKLDNIVRYSLPEQMKTALITGITGQDGAYLAEFLLKKGYTVHGVKRRSSLFNTDRIDHLYHDPHEPNVKFKLHFGDLTDSTNLIRLVQEVQPDEIYNLAAQSHVKVSFDTPEYTANADGVGTLRILEAVRLLGMTQKTRIYQASTSELYGLVQAVPQSETTPFYPRSPYAVAKLYGYWIIVNYREAYNMYACNGILFNHESPIRGETFVTRKITRAASKIVLGLQNCLYVGNLSAKRDWGHAKDYIEAMWLMLQQDKAEDFVIATGVTTTVRDFIRMAFAELGVEIEFSGKDEHEKGVIIDIDEQRAEELGLNMDALKFGQTVVKVDPKYFRPTEVDLLIGDATKAREKLGWIPKYDLQALVQDMVQSDLHLVKKDDYLKKGGFKTLNYFE

Samples

Sample ID Description Type Environment
1 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
2 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
3 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
4 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
7 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
8 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
9 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
10 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
11 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
12 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
13 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
14 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
15 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
16 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
17 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
18 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
19 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
20 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
21 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
22 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
23 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
24 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
25 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
26 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
27 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
28 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
29 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
30 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
31 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
32 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
33 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
34 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
35 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
36 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
37 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
38 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
39 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
40 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
41 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
42 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
43 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
44 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
45 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
46 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
47 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
48 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
49 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
50 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
51 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
52 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
53 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
54 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
55 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
56 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
57 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
58 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
59 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
60 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
61 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
62 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
63 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
64 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
65 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
66 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
67 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
68 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
69 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
70 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
71 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
72 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
73 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
74 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
75 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
76 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
77 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
78 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
79 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
80 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
81 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
82 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
83 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
84 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
85 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
86 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
87 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
88 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
89 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
90 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
91 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
92 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
93 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
94 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
95 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
96 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
97 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
98 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
99 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
100 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
101 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
102 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
103 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
104 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
105 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
106 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
107 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
108 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
109 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
110 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
111 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
112 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
113 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
114 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
115 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
116 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
117 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
118 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
119 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
120 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
121 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
122 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
123 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
124 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
125 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
126 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
127 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
128 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
129 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
130 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
131 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
132 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
133 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
134 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
135 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
136 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
137 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
138 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
139 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
140 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
141 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
142 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
143 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
144 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
145 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
146 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
147 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
148 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
149 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
150 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
151 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
152 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
153 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
154 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
155 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
156 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
157 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
158 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
159 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
160 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
161 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
162 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
163 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
164 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
165 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
166 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
167 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
168 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
169 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
170 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
171 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
172 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
173 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
174 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
175 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
176 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
177 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
178 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
179 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
180 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
181 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
182 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
183 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
184 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
185 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
186 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
187 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
188 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
189 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
190 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
191 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
192 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
193 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
194 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
195 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
196 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
197 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
198 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
249 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
250 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
251 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
252 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
253 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
255 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
257 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
258 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
259 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
260 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
261 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
262 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
263 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
264 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
265 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
266 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
267 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
268 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
269 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
270 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
271 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
272 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
273 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
274 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
275 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
276 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
277 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
278 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
279 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
280 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
281 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
282 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
283 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
284 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
285 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
286 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
287 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
288 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
289 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
290 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
291 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
292 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
293 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
294 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
295 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
296 3300036535 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU6 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
297 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
298 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
299 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
300 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
301 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
302 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
303 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
304 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
305 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
306 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
307 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
308 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
309 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
310 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
311 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
312 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
313 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
314 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
315 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
316 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
317 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
318 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
319 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
320 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
321 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
322 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
323 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
324 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
325 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
326 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
327 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
328 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
329 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
330 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
331 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
332 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
333 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
334 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
335 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
336 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
337 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
338 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
339 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
340 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
341 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
342 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
343 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
344 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
345 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
346 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
347 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
348 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
349 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
350 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
351 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
352 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
353 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
354 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
355 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
356 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
357 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
358 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
359 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
360 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
361 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
362 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
363 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
364 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
365 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
366 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
367 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
368 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
369 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
370 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
371 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
372 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
373 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
374 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
375 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
376 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
377 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
378 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
379 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
380 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
381 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
382 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
383 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
384 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
385 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
386 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
387 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
388 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
389 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
390 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
391 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
392 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
393 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
394 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
395 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
396 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
397 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
398 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
399 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
400 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
401 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
402 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
403 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
404 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
405 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
406 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
407 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
408 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
409 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
410 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
411 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
412 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
413 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
414 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
415 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
416 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
417 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
418 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
419 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
420 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
421 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
422 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
423 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
424 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
425 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
426 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
427 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
428 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
429 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
430 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
431 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
432 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
433 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
434 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
435 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
436 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
437 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
438 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
439 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
440 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
441 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
442 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
443 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
444 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
445 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
446 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
447 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
448 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
449 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
450 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
451 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
452 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
453 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
454 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
455 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
456 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
457 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
458 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
459 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
460 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
461 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
462 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
463 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
464 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
465 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
466 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
467 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
468 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
469 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
470 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
471 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
472 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
473 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
474 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
475 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
476 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
477 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
478 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
479 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
480 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
481 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
482 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
483 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
484 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
485 2512875024
486 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
487 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
488 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
489 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
490 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
491 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
492 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
493 2547132103 Chromobacterium sp. C-61 Isolate Rhizosphere
494 2547132181 Kosakonia sacchari SP1 Isolate Stem
495 2561511199 Enterobacter sp. R4-368 Isolate Nodule
496 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
497 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
498 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
499 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
500 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
501 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
502 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
503 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
504 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
505 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
506 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
507 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
508 2600255256 Enterobacter sp. NFIX08 Isolate Rhizoplane
509 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
510 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
511 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
512 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
513 2602042046 Enterobacter sp. NFIX09 Isolate Rhizoplane
514 2609459761 Enterobacter sp. NFR05 Isolate Rhizoplane
515 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
516 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
517 2643221725 Flavobacterium sp. Root935 Isolate Unclassified
518 2711768156 Atlantibacter hermannii DDE1 Isolate Unclassified
519 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
520 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
521 2738541278 Niastella sp. CF465 Isolate Unclassified
522 2738541283 Pedobacter sp. OK701 Isolate Unclassified
523 2738541284 Pedobacter sp. YR016 Isolate Unclassified
524 2738541302 Pedobacter sp. CF074 Isolate Unclassified
525 2738543023 Pedobacter sp. OK628 Isolate Unclassified
526 2739367651 Pedobacter sp. OK291 Isolate Unclassified
527 2739367656 Pedobacter sp. CF523 Isolate Unclassified
528 2739367663 Pedobacter sp. YR510 Isolate Unclassified
529 2739367866 Hymenobacter sp. YR204 Isolate Unclassified
530 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
531 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
532 2791355010 Kosakonia pseudosacchari NN143 Isolate Unclassified
533 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
534 2791355275 Enterobacter sp. Sa187 Isolate Unclassified
535 2802428842 Flavobacterium sp. S87F.05.LMB.W.Kidney.N Isolate Unclassified
536 2811995292 Kosakonia oryzae Ola 51 Isolate Unclassified
537 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
538 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
539 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
540 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
541 2818991437 Pedobacter terrae 518 Isolate Unclassified
542 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
543 2818991444 Filimonas endophytica 3197 Isolate Unclassified
544 2818991450 Burkholderia sp. 604 Isolate Unclassified
545 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
546 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
547 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
548 2839989709 Pontibacter arcticus 2b14 Isolate Unclassified
549 2840677318 Chitinophaga alhagiae T22 Isolate Unclassified
550 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
551 2846037992 Chromobacterium alticapitis MWU14-2602 Isolate Rhizosphere
552 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
553 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
554 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
555 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
556 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
557 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
558 2858688981 Cupriavidus sp. UYMMa02A Isolate Unclassified
559 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
560 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
561 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
562 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
563 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
564 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
565 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
566 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
567 2890737413 Parapedobacter sp. SGR-10 Isolate Rhizosphere
568 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
569 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
570 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
571 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
572 2898795034 Rhodobacter sp. SGA-6-6 Isolate Rhizosphere
573 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
574 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
575 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
576 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
577 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
578 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
579 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
580 2911138879 Spirosoma sp. KUDC1026 Isolate Rhizosphere
581 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
582 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
583 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
584 2919688452 Pararheinheimera soli 4138 Isolate Unclassified
585 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
586 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
587 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
588 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
589 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
590 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
591 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
592 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
593 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
594 2935625433 Kosakonia sp. 1610 Isolate Rhizosphere
595 2939573065 Citrobacter sp. 506 Isolate Rhizosphere
596 2939617950 Kosakonia cowanii 2056 Isolate Rhizosphere
597 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
598 2945874760 Phytobacter diazotrophicus UAEU22 Isolate Rhizosphere
599 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
600 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
601 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
602 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
603 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
604 2974435778 Kosakonia cowanii SORGH_AS 304 Isolate Unclassified
605 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
606 2977268062 Flavobacterium sp. SORGH_AS 622 Isolate Unclassified
607 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
608 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
609 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
610 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified
611 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
612 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
613 8001522603 Methylomicrobium sp. RS1 Isolate Unclassified
614 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
615 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified
616 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
617 8019504834 Atlantibacter hermannii 1903 Isolate Rhizosphere
618 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
619 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
620 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.22
Metatranscriptomes 1.02
Isolates 8.76

Biome Distribution

Category Percentage (%)
Aerial Root 0.11
Bulb 0
Endosphere 11.87
Nodule 1.36
Rhizoplane 1.87
Rhizosphere 73.88
Stem 0.06
Stem Tuber 0
Unclassified 0.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307517_10000447 3300028786 Bacteria 70799
2 RicEn_C1960 2010549000 Bacteria 6509
3 SwRhRL2b_contig_1771167 2162886007 Bacteria 4418
4 SwRhRL2b_contig_3310149 2162886007 Bacteria 3373
5 SwRhRL2b_contig_385312 2162886007 Bacteria 3294
6 SwRhRL2b_contig_830811 2162886007 Bacteria 3158
7 JGI24736J21556_1000689 3300001904 Bacteria 6174
8 JGI24736J21556_1002055 3300001904 Bacteria 3577
9 JGI24740J21852_10000688 3300001979 Bacteria 14666
10 JGI24740J21852_10002889 3300001979 Bacteria 7682
11 JGI24740J21852_10014200 3300001979 Bacteria 2947
12 JGI24739J22299_10000054 3300001989 Bacteria 31944
13 JGI24739J22299_10001392 3300001989 Bacteria 9093
14 JGI24739J22299_10001561 3300001989 Bacteria 8665
15 JGI24739J22299_10029986 3300001989 Bacteria 1887
16 JGI24737J22298_10000351 3300001990 Bacteria 15507
17 JGI24737J22298_10000774 3300001990 Bacteria 11313
18 JGI24737J22298_10011000 3300001990 Bacteria 2971
19 JGI24737J22298_10014675 3300001990 Bacteria 2541
20 JGI24735J21928_10000009 3300002067 Bacteria 247425
21 JGI24735J21928_10000015 3300002067 Bacteria 167231
22 JGI24735J21928_10001420 3300002067 Bacteria 8463
23 JGI24744J21845_10005103 3300002077 Bacteria 2717
24 JGI24744J21845_10010143 3300002077 Bacteria 1931
25 JGI25162J39368_1000016 3300002737 Bacteria 288734
26 JGI25162J39368_1000120 3300002737 Bacteria 86031
27 JGI25162J39368_1001488 3300002737 Bacteria 12229
28 JGI25154J39366_1000003 3300002738 Bacteria 397627
29 JGI25154J39366_1000014 3300002738 Bacteria 265287
30 JGI25157J39369_1002726 3300002741 Bacteria 4074
31 JGI25157J39369_1003748 3300002741 Bacteria 2989
32 JGI25152J39213_1000253 3300002773 Bacteria 35641
33 JGI25152J39213_1000916 3300002773 Bacteria 14450
34 JGI25150J39212_1000186 3300002774 Bacteria 35005
35 JGI25159J45721_1004095 3300002987 Bacteria 4945
36 JGI25151J46595_10000543 3300003187 Bacteria 34834
37 JGI25151J46595_10000614 3300003187 Bacteria 31207
38 JGI25151J46595_10001047 3300003187 Bacteria 20648
39 JGI25165J46597_1000989 3300003214 Bacteria 18960
40 JGI25153J46596_10000323 3300003215 Bacteria 34832
41 JGI25153J46596_10000539 3300003215 Bacteria 23685
42 JGI25153J46596_10002851 3300003215 Bacteria 9818
43 rootH1_10032125 3300003316 Bacteria 16380
44 rootH2_10007289 3300003320 Bacteria 23271
45 rootH2_10008034 3300003320 Bacteria 73088
46 rootH2_10012859 3300003320 Bacteria 7490
47 rootH2_10017110 3300003320 Bacteria 22949
48 rootH2_10021200 3300003320 Bacteria 27262
49 rootH2_10036622 3300003320 Bacteria 17189
50 rootH2_10135448 3300003320 Bacteria 4017
51 rootL2_10000040 3300003322 Bacteria 12566
52 rootL2_10005069 3300003322 Bacteria 20828
53 rootL2_10005267 3300003322 Bacteria 13006
54 rootL2_10059365 3300003322 Bacteria 5292
55 rootL2_10099365 3300003322 Bacteria 5797
56 rootH1_10000940 3300003323 Bacteria 88997
57 rootH1_10004759 3300003323 Bacteria 40082
58 rootH1_10008851 3300003323 Bacteria 21396
59 rootH1_10010201 3300003323 Bacteria 42291
60 rootH1_10012646 3300003323 Bacteria 62371
61 rootH1_10013602 3300003323 Bacteria 7757
62 rootH1_10026775 3300003323 Bacteria 37408
63 rootH1_10042727 3300003323 Bacteria 5775
64 rootH1_10075611 3300003323 Bacteria 2537
65 rootH1_10131898 3300003323 Bacteria 4675
66 rootH1_10278347 3300003323 Bacteria 2235
67 JGI25160J50197_1000130 3300003354 Bacteria 67851
68 JGI25160J50197_1000175 3300003354 Bacteria 54393
69 JGI25160J50197_1000320 3300003354 Bacteria 33351
70 JGI25160J50197_1004550 3300003354 Bacteria 5976
71 JGI25160J50197_1006527 3300003354 Bacteria 4707
72 JGI25160J50197_1016140 3300003354 Bacteria 2418
73 Ga0007417J51691_1008595 3300003544 Bacteria 6828
74 Ga0007409J51694_1008960 3300003575 Bacteria 6458
75 Ga0007416J51690_1007087 3300003577 Bacteria 11747
76 Ga0032354_1016447 3300003693 Bacteria 6265
77 Ga0055532_1000181 3300003758 Bacteria 53448
78 Ga0055525_1000004 3300003759 Bacteria 888039
79 Ga0055527_1000141 3300003760 Bacteria 50795
80 Ga0055535_1000285 3300003761 Bacteria 53448
81 Ga0055535_1010640 3300003761 Bacteria 1499
82 Ga0055542_1002369 3300003762 Bacteria 6386
83 Ga0055529_1001935 3300003763 Bacteria 4703
84 Ga0055526_1000270 3300003771 Bacteria 43854
85 Ga0055526_1001579 3300003771 Bacteria 16023
86 Ga0055526_1002277 3300003771 Bacteria 13115
87 Ga0055526_1002922 3300003771 Bacteria 11218
88 Ga0055526_1003259 3300003771 Bacteria 10429
89 Ga0055537_1002383 3300003773 Bacteria 6355
90 Ga0055524_1000196 3300003775 Bacteria 66415
91 Ga0055536_1000002 3300003781 Bacteria 605605
92 Ga0055536_1000163 3300003781 Bacteria 56770
93 Ga0055536_1012977 3300003781 Bacteria 3043
94 Ga0055534_1000270 3300003784 Bacteria 35440
95 Ga0055534_1000368 3300003784 Bacteria 28258
96 Ga0055534_1000395 3300003784 Bacteria 27036
97 Ga0055528_1000108 3300003790 Bacteria 66828
98 Ga0055528_1001425 3300003790 Bacteria 14634
99 Ga0055530_10000183 3300003791 Bacteria 56206
100 Ga0055530_10000279 3300003791 Bacteria 46371
101 Ga0055530_10001816 3300003791 Bacteria 14771
102 Ga0055531_10000091 3300003794 Bacteria 99363
103 Ga0055531_10000093 3300003794 Bacteria 97901
104 Ga0058692_1002767 3300003856 Bacteria 5769
105 Ga0055543_1003562 3300004625 Bacteria 4518
106 Ga0055543_1012700 3300004625 Bacteria 1683
107 Ga0058862_10125298 3300004803 Bacteria 1190
108 Ga0065165_1000019 3300005262 Bacteria 271815
109 Ga0065165_1000036 3300005262 Bacteria 212900
110 Ga0065165_1000104 3300005262 Bacteria 140410
111 Ga0065165_1000424 3300005262 Bacteria 66582
112 Ga0065165_1000572 3300005262 Bacteria 54513
113 Ga0065165_1012476 3300005262 Bacteria 3458
114 Ga0065165_1013267 3300005262 Bacteria 3289
115 Ga0065165_1031014 3300005262 Bacteria 1695
116 Ga0065714_10003570 3300005288 Bacteria 7000
117 Ga0065714_10064439 3300005288 Bacteria 112310
118 Ga0065714_10065908 3300005288 Bacteria 8125
119 Ga0065714_10073910 3300005288 Bacteria 3114
120 Ga0065714_10076440 3300005288 Bacteria 2791
121 Ga0065714_10081275 3300005288 Bacteria 2387
122 Ga0065714_10085472 3300005288 Bacteria 2146
123 Ga0065714_10086930 3300005288 Bacteria 2081
124 Ga0065714_10108618 3300005288 Bacteria 1512
125 Ga0065704_10000226 3300005289 Bacteria 67111
126 Ga0065704_10000526 3300005289 Bacteria 21219
127 Ga0065704_10001507 3300005289 Bacteria 12195
128 Ga0065704_10007283 3300005289 Bacteria 4206
129 Ga0065704_10071143 3300005289 Bacteria 12868
130 Ga0065704_10081932 3300005289 Bacteria 3681
131 Ga0065704_10085422 3300005289 Bacteria 3224
132 Ga0065712_10176322 3300005290 Bacteria 1216
133 Ga0070658_10000008 3300005327 Bacteria 319912
134 Ga0070658_10000011 3300005327 Bacteria 294396
135 Ga0070658_10008754 3300005327 Bacteria 8130
136 Ga0070658_10011667 3300005327 Bacteria 7047
137 Ga0070658_10101967 3300005327 Bacteria 2373
138 Ga0070676_10000571 3300005328 Bacteria 17879
139 Ga0070676_10001016 3300005328 Bacteria 13922
140 Ga0070676_10043231 3300005328 Bacteria 2618
141 Ga0070683_100000971 3300005329 Bacteria 21358
142 Ga0070683_100106205 3300005329 Bacteria 2647
143 Ga0070683_100276353 3300005329 Bacteria 1598
144 Ga0070670_100072469 3300005331 Bacteria 2958
145 Ga0068869_100010053 3300005334 Bacteria 6154
146 Ga0068869_100017619 3300005334 Bacteria 4846
147 Ga0068869_100135191 3300005334 Bacteria 1899
148 Ga0070666_10000197 3300005335 Bacteria 41178
149 Ga0070666_10002958 3300005335 Bacteria 10296
150 Ga0070680_100013718 3300005336 Bacteria 6320
151 Ga0070680_100035380 3300005336 Bacteria 4031
152 Ga0070682_100053013 3300005337 Bacteria 2540
153 Ga0068868_100000524 3300005338 Bacteria 25677
154 Ga0068868_100005736 3300005338 Bacteria 8738
155 Ga0068868_100018853 3300005338 Bacteria 5163
156 Ga0068868_100037934 3300005338 Bacteria 3738
157 Ga0068868_100054044 3300005338 Bacteria 3164
158 Ga0068868_100081438 3300005338 Bacteria 2595
159 Ga0068868_100195140 3300005338 Bacteria 1685
160 Ga0070660_100029313 3300005339 Bacteria 4124
161 Ga0070689_100004044 3300005340 Bacteria 9868
162 Ga0070691_10004047 3300005341 Bacteria 6642
163 Ga0070691_10006306 3300005341 Bacteria 5420
164 Ga0070691_10041547 3300005341 Bacteria 2174
165 Ga0070661_100014545 3300005344 Bacteria 5545
166 Ga0070668_100005980 3300005347 Bacteria 9029
167 Ga0070669_100022298 3300005353 Bacteria 4529
168 Ga0070671_100009462 3300005355 Bacteria 7823
169 Ga0070671_100018462 3300005355 Bacteria 5666
170 Ga0070671_100042635 3300005355 Bacteria 3772
171 Ga0070671_100049295 3300005355 Bacteria 3504
172 Ga0070671_100069251 3300005355 Bacteria 2943
173 Ga0070674_100260931 3300005356 Bacteria 1365
174 Ga0070673_100005895 3300005364 Bacteria 7908
175 Ga0070673_100011099 3300005364 Bacteria 6140
176 Ga0070673_100016838 3300005364 Bacteria 5182
177 Ga0070688_100033676 3300005365 Bacteria 3098
178 Ga0070688_100069521 3300005365 Bacteria 2248
179 Ga0070659_100002370 3300005366 Bacteria 13388
180 Ga0070659_100002879 3300005366 Bacteria 12252
181 Ga0070659_100034879 3300005366 Bacteria 3915
182 Ga0070659_100056904 3300005366 Bacteria 3083
183 Ga0070667_100000240 3300005367 Bacteria 62100
184 Ga0070667_100022276 3300005367 Bacteria 5256
185 Ga0070667_100039396 3300005367 Bacteria 3961
186 Ga0070667_100084008 3300005367 Bacteria 2728
187 Ga0070667_100169440 3300005367 Bacteria 1927
188 Ga0070667_100188948 3300005367 Bacteria 1824
189 Ga0070714_100024740 3300005435 Bacteria 4948
190 Ga0070713_100129949 3300005436 Bacteria 2220
191 Ga0070694_100026790 3300005444 Bacteria 3739
192 Ga0070663_100010774 3300005455 Bacteria 5709
193 Ga0070663_100039901 3300005455 Bacteria 3284
194 Ga0070663_100047975 3300005455 Bacteria 3027
195 Ga0070678_100003871 3300005456 Bacteria 8409
196 Ga0070678_100053372 3300005456 Bacteria 2939
197 Ga0070678_100090896 3300005456 Bacteria 2341
198 Ga0070678_100110301 3300005456 Bacteria 2152
199 Ga0070662_100000863 3300005457 Bacteria 18571
200 Ga0070662_100002459 3300005457 Bacteria 11410
201 Ga0070662_100003891 3300005457 Bacteria 9359
202 Ga0070662_100004308 3300005457 Bacteria 8989
203 Ga0070662_100006048 3300005457 Bacteria 7770
204 Ga0070662_100026442 3300005457 Bacteria 4020
205 Ga0070662_100088759 3300005457 Bacteria 2318
206 Ga0070681_10000494 3300005458 Bacteria 32160
207 Ga0070681_10023463 3300005458 Bacteria 6204
208 Ga0068867_100000252 3300005459 Bacteria 35429
209 Ga0068867_100009548 3300005459 Bacteria 6839
210 Ga0068867_100080400 3300005459 Bacteria 2454
211 Ga0070685_10018108 3300005466 Bacteria 3784
212 Ga0070707_100051113 3300005468 Bacteria 3962
213 Ga0070699_100015745 3300005518 Bacteria 6492
214 Ga0070679_100033325 3300005530 Bacteria 5100
215 Ga0070679_100034856 3300005530 Bacteria 4991
216 Ga0070679_100099526 3300005530 Bacteria 2894
217 Ga0070679_100158664 3300005530 Bacteria 2236
218 Ga0070684_100000433 3300005535 Bacteria 28743
219 Ga0070684_100020672 3300005535 Bacteria 5460
220 Ga0070684_100049610 3300005535 Bacteria 3643
221 Ga0070684_100068460 3300005535 Bacteria 3120
222 Ga0070684_100200126 3300005535 Bacteria 1819
223 Ga0070684_100227562 3300005535 Bacteria 1702
224 Ga0068853_100001703 3300005539 Bacteria 16107
225 Ga0068853_100009975 3300005539 Bacteria 7670
226 Ga0068853_100010094 3300005539 Bacteria 7630
227 Ga0068853_100015336 3300005539 Bacteria 6297
228 Ga0068853_100043110 3300005539 Bacteria 3861
229 Ga0068853_100094463 3300005539 Bacteria 2635
230 Ga0068853_100127500 3300005539 Bacteria 2275
231 Ga0068853_100128557 3300005539 Bacteria 2266
232 Ga0068853_100207544 3300005539 Bacteria 1785
233 Ga0070672_100038128 3300005543 Bacteria 3670
234 Ga0070672_100234348 3300005543 Bacteria 1543
235 Ga0070686_100018814 3300005544 Bacteria 4061
236 Ga0070696_100001233 3300005546 Bacteria 16612
237 Ga0070696_100095662 3300005546 Bacteria 2121
238 Ga0070693_100013488 3300005547 Bacteria 4162
239 Ga0070665_100000003 3300005548 Bacteria 811857
240 Ga0070665_100000014 3300005548 Bacteria 484881
241 Ga0070665_100000061 3300005548 Bacteria 222138
242 Ga0070665_100008147 3300005548 Bacteria 10608
243 Ga0070665_100010319 3300005548 Bacteria 9448
244 Ga0070665_100038251 3300005548 Bacteria 4823
245 Ga0070665_100157143 3300005548 Bacteria 2276
246 Ga0070665_100177025 3300005548 Bacteria 2134
247 Ga0070665_100328831 3300005548 Bacteria 1533
248 Ga0068855_100000019 3300005563 Bacteria 205963
249 Ga0068855_100000041 3300005563 Bacteria 151653
250 Ga0068855_100000108 3300005563 Bacteria 103059
251 Ga0068855_100000130 3300005563 Bacteria 95659
252 Ga0068855_100000299 3300005563 Bacteria 61738
253 Ga0068855_100000916 3300005563 Bacteria 36640
254 Ga0068855_100001186 3300005563 Bacteria 32411
255 Ga0068855_100002648 3300005563 Bacteria 22068
256 Ga0068855_100003330 3300005563 Bacteria 19652
257 Ga0068855_100004660 3300005563 Bacteria 16743
258 Ga0068855_100006690 3300005563 Bacteria 13992
259 Ga0068855_100009523 3300005563 Bacteria 11729
260 Ga0068855_100030687 3300005563 Bacteria 6426
261 Ga0068855_100041488 3300005563 Bacteria 5454
262 Ga0068855_100044948 3300005563 Bacteria 5225
263 Ga0068855_100068313 3300005563 Bacteria 4137
264 Ga0068855_100070732 3300005563 Bacteria 4059
265 Ga0068855_100118288 3300005563 Bacteria 3035
266 Ga0068855_100122693 3300005563 Bacteria 2973
267 Ga0068855_100189645 3300005563 Bacteria 2320
268 Ga0068855_100215430 3300005563 Bacteria 2156
269 Ga0068855_100385174 3300005563 Bacteria 1539
270 Ga0070664_100006889 3300005564 Bacteria 9161
271 Ga0068857_100011323 3300005577 Bacteria 7760
272 Ga0068857_100043217 3300005577 Bacteria 3997
273 Ga0068857_100061223 3300005577 Bacteria 3344
274 Ga0068857_100313493 3300005577 Bacteria 1448
275 Ga0068857_100363916 3300005577 Bacteria 1341
276 Ga0068854_100060109 3300005578 Bacteria 2748
277 Ga0068856_100000112 3300005614 Bacteria 80466
278 Ga0068856_100011222 3300005614 Bacteria 8696
279 Ga0068856_100018206 3300005614 Bacteria 6809
280 Ga0068856_100034242 3300005614 Bacteria 4975
281 Ga0068856_100036531 3300005614 Bacteria 4817
282 Ga0068856_100036715 3300005614 Bacteria 4805
283 Ga0068856_100056668 3300005614 Bacteria 3867
284 Ga0068856_100057187 3300005614 Bacteria 3850
285 Ga0068856_100153146 3300005614 Bacteria 2315
286 Ga0068856_100202555 3300005614 Bacteria 1999
287 Ga0068856_100228394 3300005614 Bacteria 1877
288 Ga0068856_100283235 3300005614 Bacteria 1674
289 Ga0070702_100041211 3300005615 Bacteria 2588
290 Ga0068852_100000226 3300005616 Bacteria 38233
291 Ga0068852_100003319 3300005616 Bacteria 11236
292 Ga0068852_100003809 3300005616 Bacteria 10584
293 Ga0068852_100012764 3300005616 Bacteria 6397
294 Ga0068852_100033957 3300005616 Bacteria 4242
295 Ga0068852_100066244 3300005616 Bacteria 3154
296 Ga0068852_100089443 3300005616 Bacteria 2752
297 Ga0068852_100215661 3300005616 Bacteria 1823
298 Ga0068852_100320170 3300005616 Bacteria 1506
299 Ga0068859_100000007 3300005617 Bacteria 390070
300 Ga0068859_100115887 3300005617 Bacteria 2744
301 Ga0068864_100027557 3300005618 Bacteria 4799
302 Ga0068866_10006035 3300005718 Bacteria 5041
303 Ga0068866_10148594 3300005718 Bacteria 1354
304 Ga0068861_100080306 3300005719 Bacteria 2551
305 Ga0068851_10069582 3300005834 Bacteria 1818
306 Ga0068863_100000444 3300005841 Bacteria 41977
307 Ga0068863_100087667 3300005841 Bacteria 2949
308 Ga0068863_100407023 3300005841 Viruses 1331
309 Ga0068858_100002218 3300005842 Bacteria 19660
310 Ga0068858_100048943 3300005842 Bacteria 3915
311 Ga0068858_100132461 3300005842 Bacteria 2338
312 Ga0068858_100329084 3300005842 Bacteria 1461
313 Ga0068860_100000061 3300005843 Bacteria 192548
314 Ga0068860_100000494 3300005843 Bacteria 48832
315 Ga0068860_100000661 3300005843 Bacteria 40073
316 Ga0068860_100006071 3300005843 Bacteria 12160
317 Ga0068860_100032987 3300005843 Bacteria 4972
318 Ga0068862_100406403 3300005844 Bacteria 1275
319 Ga0081455_10004385 3300005937 Bacteria 15894
320 Ga0081540_1043235 3300005983 Bacteria 2314
321 Ga0075365_10145160 3300006038 Bacteria 1649
322 Ga0075364_10000388 3300006051 Bacteria 21839
323 Ga0075432_10000392 3300006058 Bacteria 12706
324 Ga0075366_10000031 3300006195 Bacteria 49332
325 Ga0075366_10000170 3300006195 Bacteria 27881
326 Ga0075366_10000799 3300006195 Bacteria 15070
327 Ga0075366_10003200 3300006195 Bacteria 8591
328 Ga0075366_10009736 3300006195 Bacteria 5373
329 Ga0075366_10103513 3300006195 Bacteria 1710
330 Ga0075366_10110043 3300006195 Bacteria 1657
331 Ga0075366_10131069 3300006195 Bacteria 1513
332 Ga0097621_100000016 3300006237 Bacteria 91785
333 Ga0097621_100000033 3300006237 Bacteria 69289
334 Ga0097621_100000465 3300006237 Bacteria 28387
335 Ga0097621_100007122 3300006237 Bacteria 7973
336 Ga0097621_100007495 3300006237 Bacteria 7812
337 Ga0097621_100048113 3300006237 Bacteria 3458
338 Ga0097621_100099323 3300006237 Bacteria 2446
339 Ga0075370_10004929 3300006353 Bacteria 6558
340 Ga0075370_10011195 3300006353 Bacteria 4708
341 Ga0075370_10054237 3300006353 Bacteria 2276
342 Ga0075370_10079363 3300006353 Bacteria 1885
343 Ga0075370_10115074 3300006353 Bacteria 1563
344 Ga0068871_100000020 3300006358 Bacteria 84930
345 Ga0068871_100000504 3300006358 Bacteria 26679
346 Ga0068871_100001644 3300006358 Bacteria 15052
347 Ga0068871_100045957 3300006358 Bacteria 3516
348 Ga0068871_100051456 3300006358 Bacteria 3335
349 Ga0068871_100122108 3300006358 Bacteria 2201
350 Ga0068871_100163692 3300006358 Bacteria 1903
351 Ga0068871_100240982 3300006358 Bacteria 1572
352 Ga0068871_100291083 3300006358 Bacteria 1431
353 Ga0075428_100037054 3300006844 Bacteria 5371
354 Ga0075430_100013674 3300006846 Bacteria 6918
355 Ga0075430_100016236 3300006846 Bacteria 6341
356 Ga0075431_100021229 3300006847 Bacteria 6637
357 Ga0075431_100034030 3300006847 Bacteria 5251
358 Ga0075429_100005261 3300006880 Bacteria 11132
359 Ga0075429_100019573 3300006880 Bacteria 5866
360 Ga0068865_100000048 3300006881 Bacteria 67416
361 Ga0068865_100000214 3300006881 Bacteria 32364
362 Ga0068865_100004575 3300006881 Bacteria 8348
363 Ga0068865_100233495 3300006881 Bacteria 1444
364 Ga0097620_100000007 3300006931 Bacteria 390070
365 Ga0097620_100115887 3300006931 Bacteria 2744
366 Ga0079104_1000018 3300006946 Bacteria 271088
367 Ga0079104_1000282 3300006946 Bacteria 65218
368 Ga0099794_10103848 3300007265 Bacteria 1420
369 Ga0105251_10000591 3300009011 Bacteria 33251
370 Ga0105251_10060439 3300009011 Bacteria 1784
371 Ga0105244_10006930 3300009036 Bacteria 7265
372 Ga0105250_10002931 3300009092 Bacteria 8327
373 Ga0105240_10000082 3300009093 Bacteria 195184
374 Ga0105240_10000173 3300009093 Bacteria 131281
375 Ga0105240_10000198 3300009093 Bacteria 122388
376 Ga0105240_10001981 3300009093 Bacteria 33825
377 Ga0105240_10004434 3300009093 Bacteria 21402
378 Ga0105240_10008014 3300009093 Bacteria 15215
379 Ga0105240_10013347 3300009093 Bacteria 11289
380 Ga0105240_10013834 3300009093 Bacteria 11052
381 Ga0105240_10017264 3300009093 Bacteria 9735
382 Ga0105240_10022637 3300009093 Bacteria 8325
383 Ga0105240_10026991 3300009093 Bacteria 7527
384 Ga0105240_10032466 3300009093 Bacteria 6759
385 Ga0105240_10034852 3300009093 Bacteria 6489
386 Ga0105240_10049536 3300009093 Bacteria 5301
387 Ga0105240_10055196 3300009093 Bacteria 4974
388 Ga0105240_10065857 3300009093 Bacteria 4497
389 Ga0105240_10070449 3300009093 Bacteria 4326
390 Ga0105240_10074083 3300009093 Bacteria 4203
391 Ga0105240_10076056 3300009093 Bacteria 4140
392 Ga0105240_10091437 3300009093 Bacteria 3718
393 Ga0105240_10099167 3300009093 Bacteria 3546
394 Ga0105240_10118557 3300009093 Bacteria 3189
395 Ga0105240_10119814 3300009093 Bacteria 3170
396 Ga0105240_10155021 3300009093 Bacteria 2725
397 Ga0105240_10156874 3300009093 Bacteria 2706
398 Ga0105240_10174228 3300009093 Bacteria 2545
399 Ga0105240_10255333 3300009093 Bacteria 2025
400 Ga0111539_10016524 3300009094 Bacteria 9149
401 Ga0111539_10053178 3300009094 Bacteria 4820
402 Ga0111539_10101972 3300009094 Bacteria 3369
403 Ga0111539_10167990 3300009094 Bacteria 2564
404 Ga0105245_10210122 3300009098 Bacteria 1873
405 Ga0114129_10000629 3300009147 Bacteria 43924
406 Ga0114129_10015902 3300009147 Bacteria 10703
407 Ga0114129_10091477 3300009147 Bacteria 4215
408 Ga0105243_10000009 3300009148 Bacteria 354419
409 Ga0105241_10000116 3300009174 Bacteria 57591
410 Ga0105241_10000137 3300009174 Bacteria 52153
411 Ga0105241_10000424 3300009174 Bacteria 31880
412 Ga0105241_10001206 3300009174 Bacteria 19744
413 Ga0105241_10002469 3300009174 Bacteria 13900
414 Ga0105241_10006651 3300009174 Bacteria 8516
415 Ga0105241_10006947 3300009174 Bacteria 8332
416 Ga0105241_10010211 3300009174 Bacteria 6897
417 Ga0105241_10010456 3300009174 Bacteria 6809
418 Ga0105241_10010715 3300009174 Bacteria 6728
419 Ga0105241_10013333 3300009174 Bacteria 6024
420 Ga0105241_10027864 3300009174 Bacteria 4207
421 Ga0105241_10038039 3300009174 Bacteria 3628
422 Ga0105241_10155470 3300009174 Bacteria 1875
423 Ga0105242_10005456 3300009176 Bacteria 9825
424 Ga0105242_10016702 3300009176 Bacteria 5709
425 Ga0105242_10094916 3300009176 Bacteria 2517
426 Ga0105242_10130963 3300009176 Bacteria 2165
427 Ga0105248_10005045 3300009177 Bacteria 14576
428 Ga0105248_10014314 3300009177 Bacteria 8730
429 Ga0105248_10046051 3300009177 Bacteria 4889
430 Ga0105248_10093590 3300009177 Bacteria 3385
431 Ga0105237_10000179 3300009545 Bacteria 89808
432 Ga0105237_10000310 3300009545 Bacteria 67887
433 Ga0105237_10000409 3300009545 Bacteria 61096
434 Ga0105237_10000577 3300009545 Bacteria 51264
435 Ga0105237_10001131 3300009545 Bacteria 35787
436 Ga0105237_10001142 3300009545 Bacteria 35679
437 Ga0105237_10001258 3300009545 Bacteria 33852
438 Ga0105237_10001360 3300009545 Bacteria 32389
439 Ga0105237_10001901 3300009545 Bacteria 26640
440 Ga0105237_10002517 3300009545 Bacteria 22696
441 Ga0105237_10005617 3300009545 Bacteria 14137
442 Ga0105237_10010415 3300009545 Bacteria 9893
443 Ga0105237_10013208 3300009545 Bacteria 8663
444 Ga0105237_10014892 3300009545 Bacteria 8111
445 Ga0105237_10018071 3300009545 Bacteria 7303
446 Ga0105237_10033601 3300009545 Bacteria 5197
447 Ga0105237_10035348 3300009545 Bacteria 5056
448 Ga0105237_10035767 3300009545 Bacteria 5024
449 Ga0105237_10064828 3300009545 Bacteria 3649
450 Ga0105237_10071114 3300009545 Bacteria 3475
451 Ga0105237_10071256 3300009545 Bacteria 3470
452 Ga0105237_10099233 3300009545 Bacteria 2904
453 Ga0105237_10196939 3300009545 Bacteria 2014
454 Ga0105237_10228781 3300009545 Bacteria 1860
455 Ga0105237_10314973 3300009545 Bacteria 1568
456 Ga0105238_10007301 3300009551 Bacteria 11064
457 Ga0105238_10029586 3300009551 Bacteria 5579
458 Ga0105238_10031475 3300009551 Bacteria 5401
459 Ga0105238_10034403 3300009551 Bacteria 5156
460 Ga0105238_10385003 3300009551 Bacteria 1394
461 Ga0105249_10007158 3300009553 Bacteria 9740
462 Ga0105239_10000019 3300010375 Bacteria 273836
463 Ga0105239_10000049 3300010375 Bacteria 177578
464 Ga0105239_10000166 3300010375 Bacteria 94743
465 Ga0105239_10000343 3300010375 Bacteria 67956
466 Ga0105239_10000659 3300010375 Bacteria 49123
467 Ga0105239_10000740 3300010375 Bacteria 46443
468 Ga0105239_10000775 3300010375 Bacteria 45289
469 Ga0105239_10001138 3300010375 Bacteria 36690
470 Ga0105239_10001606 3300010375 Bacteria 29871
471 Ga0105239_10003303 3300010375 Bacteria 19863
472 Ga0105239_10012560 3300010375 Bacteria 9428
473 Ga0105239_10014720 3300010375 Bacteria 8674
474 Ga0105239_10014750 3300010375 Bacteria 8665
475 Ga0105239_10018759 3300010375 Bacteria 7642
476 Ga0105239_10026647 3300010375 Bacteria 6362
477 Ga0105239_10041485 3300010375 Bacteria 5043
478 Ga0105239_10042514 3300010375 Bacteria 4980
479 Ga0105239_10042888 3300010375 Bacteria 4957
480 Ga0105239_10070201 3300010375 Bacteria 3848
481 Ga0105239_10084016 3300010375 Bacteria 3506
482 Ga0105239_10193270 3300010375 Bacteria 2278
483 Ga0105239_10207040 3300010375 Bacteria 2198
484 Ga0105239_10210210 3300010375 Bacteria 2181
485 Ga0105239_10221669 3300010375 Bacteria 2121
486 Ga0105239_10309453 3300010375 Bacteria 1780
487 Ga0105239_10468959 3300010375 Bacteria 1430
488 Ga0105239_10507178 3300010375 Bacteria 1372
489 Ga0105246_10013710 3300011119 Bacteria 5085
490 Ga0105246_10027150 3300011119 Bacteria 3748
491 Ga0105246_10067458 3300011119 Bacteria 2507
492 Ga0157373_10000161 3300013100 Bacteria 54194
493 Ga0157373_10000387 3300013100 Bacteria 35264
494 Ga0157373_10000448 3300013100 Bacteria 32580
495 Ga0157373_10004564 3300013100 Bacteria 10416
496 Ga0157373_10006319 3300013100 Bacteria 8850
497 Ga0157373_10032170 3300013100 Bacteria 3776
498 Ga0157373_10041191 3300013100 Bacteria 3304
499 Ga0157373_10052973 3300013100 Bacteria 2886
500 Ga0157373_10068421 3300013100 Bacteria 2510
501 Ga0157373_10102025 3300013100 Bacteria 2019
502 Ga0157373_10121421 3300013100 Bacteria 1836
503 Ga0157371_10000137 3300013102 Bacteria 107248
504 Ga0157371_10000511 3300013102 Bacteria 46681
505 Ga0157371_10000970 3300013102 Bacteria 31856
506 Ga0157371_10001238 3300013102 Bacteria 27095
507 Ga0157371_10002079 3300013102 Bacteria 19608
508 Ga0157371_10004326 3300013102 Bacteria 12452
509 Ga0157371_10068028 3300013102 Bacteria 2521
510 Ga0157371_10071936 3300013102 Bacteria 2448
511 Ga0157371_10072875 3300013102 Bacteria 2432
512 Ga0157371_10090083 3300013102 Bacteria 2173
513 Ga0157371_10153455 3300013102 Bacteria 1643
514 Ga0157370_10000552 3300013104 Bacteria 46652
515 Ga0157370_10000637 3300013104 Bacteria 43772
516 Ga0157370_10001009 3300013104 Bacteria 35544
517 Ga0157370_10001243 3300013104 Bacteria 31845
518 Ga0157370_10001385 3300013104 Bacteria 30010
519 Ga0157370_10002121 3300013104 Bacteria 24226
520 Ga0157370_10004343 3300013104 Bacteria 16282
521 Ga0157370_10010926 3300013104 Bacteria 9533
522 Ga0157370_10015818 3300013104 Bacteria 7656
523 Ga0157370_10019842 3300013104 Bacteria 6727
524 Ga0157370_10021999 3300013104 Bacteria 6349
525 Ga0157370_10025587 3300013104 Bacteria 5842
526 Ga0157370_10026367 3300013104 Bacteria 5739
527 Ga0157370_10029536 3300013104 Bacteria 5376
528 Ga0157370_10032396 3300013104 Bacteria 5105
529 Ga0157370_10035465 3300013104 Bacteria 4847
530 Ga0157370_10042833 3300013104 Bacteria 4360
531 Ga0157370_10420524 3300013104 Bacteria 1229
532 Ga0157369_10000594 3300013105 Bacteria 47098
533 Ga0157369_10003620 3300013105 Bacteria 18346
534 Ga0157369_10022085 3300013105 Bacteria 7109
535 Ga0157369_10027638 3300013105 Bacteria 6286
536 Ga0157369_10039027 3300013105 Bacteria 5191
537 Ga0157369_10039512 3300013105 Bacteria 5156
538 Ga0157369_10078743 3300013105 Bacteria 3530
539 Ga0157369_10118483 3300013105 Bacteria 2810
540 Ga0157369_10239218 3300013105 Bacteria 1897
541 Ga0157369_10326797 3300013105 Bacteria 1594
542 Ga0157374_10000011 3300013296 Bacteria 466749
543 Ga0157374_10000034 3300013296 Bacteria 180660
544 Ga0157374_10000427 3300013296 Bacteria 38121
545 Ga0157374_10000642 3300013296 Bacteria 30802
546 Ga0157374_10000918 3300013296 Bacteria 25617
547 Ga0157374_10004749 3300013296 Bacteria 11393
548 Ga0157374_10005742 3300013296 Bacteria 10471
549 Ga0157374_10008935 3300013296 Bacteria 8585
550 Ga0157374_10016485 3300013296 Bacteria 6497
551 Ga0157378_10015365 3300013297 Bacteria 6704
552 Ga0157378_10016768 3300013297 Bacteria 6419
553 Ga0157378_10019641 3300013297 Bacteria 5940
554 Ga0157378_10064382 3300013297 Bacteria 3280
555 Ga0157378_10070763 3300013297 Bacteria 3132
556 Ga0163162_10000012 3300013306 Bacteria 292674
557 Ga0163162_10000058 3300013306 Bacteria 108298
558 Ga0163162_10000151 3300013306 Bacteria 64454
559 Ga0163162_10000406 3300013306 Bacteria 39456
560 Ga0163162_10000763 3300013306 Bacteria 29930
561 Ga0163162_10000782 3300013306 Bacteria 29601
562 Ga0163162_10000827 3300013306 Bacteria 28791
563 Ga0163162_10001117 3300013306 Bacteria 24935
564 Ga0163162_10001444 3300013306 Bacteria 22104
565 Ga0163162_10009940 3300013306 Bacteria 9255
566 Ga0163162_10010911 3300013306 Bacteria 8846
567 Ga0163162_10014906 3300013306 Bacteria 7590
568 Ga0163162_10015925 3300013306 Bacteria 7349
569 Ga0163162_10016270 3300013306 Bacteria 7272
570 Ga0163162_10024996 3300013306 Bacteria 5900
571 Ga0163162_10034656 3300013306 Bacteria 5024
572 Ga0163162_10037543 3300013306 Bacteria 4834
573 Ga0163162_10333232 3300013306 Bacteria 1650
574 Ga0163162_10355565 3300013306 Bacteria 1597
575 Ga0157372_10000039 3300013307 Bacteria 165839
576 Ga0157372_10000241 3300013307 Bacteria 60488
577 Ga0157372_10000298 3300013307 Bacteria 55298
578 Ga0157372_10000439 3300013307 Bacteria 45857
579 Ga0157372_10000691 3300013307 Bacteria 37017
580 Ga0157372_10001390 3300013307 Bacteria 26087
581 Ga0157372_10002911 3300013307 Bacteria 18522
582 Ga0157372_10003323 3300013307 Bacteria 17379
583 Ga0157372_10003342 3300013307 Bacteria 17320
584 Ga0157372_10005914 3300013307 Bacteria 13028
585 Ga0157372_10007944 3300013307 Bacteria 11276
586 Ga0157372_10012766 3300013307 Bacteria 8950
587 Ga0157372_10020545 3300013307 Bacteria 7125
588 Ga0157372_10040394 3300013307 Bacteria 5152
589 Ga0157372_10047807 3300013307 Bacteria 4755
590 Ga0157372_10269330 3300013307 Bacteria 1979
591 Ga0157372_10310923 3300013307 Bacteria 1834
592 Ga0157372_10507766 3300013307 Bacteria 1406
593 Ga0157375_10000911 3300013308 Bacteria 25700
594 Ga0157375_10008429 3300013308 Bacteria 9029
595 Ga0157375_10012275 3300013308 Bacteria 7597
596 Ga0157375_10016156 3300013308 Bacteria 6696
597 Ga0157375_10044269 3300013308 Bacteria 4323
598 Ga0157375_10079382 3300013308 Bacteria 3317
599 Ga0157375_10108117 3300013308 Bacteria 2875
600 Ga0157375_10129740 3300013308 Bacteria 2639
601 Ga0157375_10140014 3300013308 Bacteria 2546
602 Ga0157375_10183352 3300013308 Bacteria 2246
603 Ga0157375_10262083 3300013308 Bacteria 1890
604 Ga0157375_10287131 3300013308 Bacteria 1808
605 Ga0163163_10000215 3300014325 Bacteria 60028
606 Ga0163163_10007541 3300014325 Bacteria 9606
607 Ga0163163_10091197 3300014325 Bacteria 3061
608 Ga0163163_10147104 3300014325 Bacteria 2400
609 Ga0163163_10258598 3300014325 Bacteria 1792
610 Ga0163163_10488291 3300014325 Bacteria 1293
611 Ga0157380_10000019 3300014326 Bacteria 116129
612 Ga0157380_10004165 3300014326 Bacteria 9990
613 Ga0182008_10000022 3300014497 Bacteria 207052
614 Ga0182008_10000369 3300014497 Bacteria 35027
615 Ga0182008_10000531 3300014497 Bacteria 28430
616 Ga0182008_10008958 3300014497 Bacteria 5424
617 Ga0182008_10009453 3300014497 Bacteria 5259
618 Ga0157377_10002912 3300014745 Bacteria 7652
619 Ga0157379_10002102 3300014968 Bacteria 16509
620 Ga0157379_10003291 3300014968 Bacteria 13674
621 Ga0157379_10004097 3300014968 Bacteria 12436
622 Ga0157379_10031917 3300014968 Bacteria 4693
623 Ga0157379_10346239 3300014968 Bacteria 1360
624 Ga0157376_10000216 3300014969 Bacteria 39942
625 Ga0157376_10005885 3300014969 Bacteria 8605
626 Ga0157376_10015107 3300014969 Bacteria 5820
627 Ga0157376_10031544 3300014969 Bacteria 4246
628 Ga0157376_10043996 3300014969 Bacteria 3668
629 Ga0157376_10107882 3300014969 Bacteria 2445
630 Ga0157376_10121935 3300014969 Bacteria 2312
631 Ga0157376_10219781 3300014969 Bacteria 1759
632 Ga0182006_1000018 3300015261 Bacteria 299376
633 Ga0182006_1000108 3300015261 Bacteria 89633
634 Ga0182006_1000360 3300015261 Bacteria 38015
635 Ga0182006_1001134 3300015261 Bacteria 16955
636 Ga0182006_1006041 3300015261 Bacteria 5670
637 Ga0182007_10000024 3300015262 Bacteria 181761
638 Ga0182007_10001080 3300015262 Bacteria 14848
639 Ga0182007_10013772 3300015262 Bacteria 3072
640 Ga0182005_1000039 3300015265 Bacteria 155210
641 Ga0182005_1000159 3300015265 Bacteria 47132
642 Ga0183373_1002 3300015682 Bacteria 990153
643 Ga0183361_10026 3300016635 Bacteria 62773
644 Ga0163161_10000094 3300017792 Bacteria 90423
645 Ga0163161_10000151 3300017792 Bacteria 63663
646 Ga0163161_10000337 3300017792 Bacteria 39961
647 Ga0163161_10001005 3300017792 Bacteria 21489
648 Ga0163161_10007027 3300017792 Bacteria 7789
649 Ga0163161_10012307 3300017792 Bacteria 5939
650 Ga0163161_10013189 3300017792 Bacteria 5744
651 Ga0163161_10013362 3300017792 Bacteria 5712
652 Ga0163161_10026859 3300017792 Bacteria 4081
653 Ga0163161_10052860 3300017792 Bacteria 2945
654 Ga0197907_10239113 3300020069 Bacteria 5021
655 Ga0206356_10813215 3300020070 Bacteria 4124
656 Ga0206356_11215947 3300020070 Bacteria 2012
657 Ga0206349_1290235 3300020075 Bacteria 1447
658 Ga0206349_1400312 3300020075 Bacteria 7777
659 Ga0206351_10526408 3300020077 Bacteria 4297
660 Ga0206352_10200773 3300020078 Bacteria 7779
661 Ga0206352_10597293 3300020078 Bacteria 2384
662 Ga0206350_11468347 3300020080 Bacteria 4390
663 Ga0154015_1171474 3300020610 Bacteria 2873
664 Ga0213872_10004354 3300021361 Bacteria 7541
665 Ga0213872_10008741 3300021361 Bacteria 4889
666 Ga0213876_10000034 3300021384 Bacteria 202967
667 Ga0213871_10032870 3300021441 Bacteria 1361
668 Ga0224712_10009051 3300022467 Bacteria 2981
669 Ga0209436_100146 3300025208 Bacteria 34185
670 Ga0209436_100384 3300025208 Bacteria 19938
671 Ga0209672_100135 3300025228 Bacteria 73078
672 Ga0209672_100205 3300025228 Bacteria 46968
673 Ga0209147_100187 3300025229 Bacteria 73078
674 Ga0209563_107204 3300025230 Bacteria 1845
675 Ga0207427_100309 3300025231 Bacteria 33924
676 Ga0209437_100048 3300025233 Bacteria 405107
677 Ga0209437_100119 3300025233 Bacteria 206549
678 Ga0209437_100143 3300025233 Bacteria 164970
679 Ga0209258_100129 3300025242 Bacteria 176515
680 Ga0209258_100145 3300025242 Bacteria 163672
681 Ga0209258_100320 3300025242 Bacteria 73078
682 Ga0207425_1000051 3300025245 Bacteria 166795
683 Ga0209646_1000002 3300025246 Bacteria 1425781
684 Ga0209646_1000004 3300025246 Bacteria 786587
685 Ga0209646_1001703 3300025246 Bacteria 5576
686 Ga0209026_1000132 3300025250 Bacteria 119048
687 Ga0209026_1000178 3300025250 Bacteria 96368
688 Ga0209026_1000463 3300025250 Bacteria 31275
689 Ga0209026_1000753 3300025250 Bacteria 18346
690 Ga0209026_1001439 3300025250 Bacteria 10527
691 Ga0209026_1001474 3300025250 Bacteria 10370
692 Ga0209026_1002731 3300025250 Bacteria 6332
693 Ga0209148_1000177 3300025254 Bacteria 127365
694 Ga0209148_1000477 3300025254 Bacteria 42265
695 Ga0209759_1019981 3300025256 Bacteria 1571
696 Ga0209129_1000077 3300025258 Bacteria 193474
697 Ga0209129_1000395 3300025258 Bacteria 34881
698 Ga0209129_1005440 3300025258 Bacteria 4503
699 Ga0209129_1008773 3300025258 Bacteria 2761
700 Ga0209233_1000029 3300025261 Bacteria 641642
701 Ga0209233_1001087 3300025261 Bacteria 11202
702 Ga0209565_1000368 3300025263 Bacteria 38635
703 Ga0209455_1000291 3300025272 Bacteria 53500
704 Ga0209455_1001556 3300025272 Bacteria 10165
705 Ga0209455_1003124 3300025272 Bacteria 6032
706 Ga0209673_1000183 3300025273 Bacteria 126175
707 Ga0209673_1000483 3300025273 Bacteria 66457
708 Ga0209673_1014060 3300025273 Bacteria 3121
709 Ga0209130_1003186 3300025284 Bacteria 7247
710 Ga0209130_1004353 3300025284 Bacteria 5425
711 Ga0209675_1000070 3300025291 Bacteria 169161
712 Ga0209675_1000092 3300025291 Bacteria 144839
713 Ga0209675_1000383 3300025291 Bacteria 36811
714 Ga0209676_1000022 3300025292 Bacteria 605659
715 Ga0209676_1000480 3300025292 Bacteria 65842
716 Ga0209676_1000587 3300025292 Bacteria 54532
717 Ga0209676_1001144 3300025292 Bacteria 28983
718 Ga0209025_1000160 3300025294 Bacteria 166795
719 Ga0209025_1000628 3300025294 Bacteria 62542
720 Ga0209025_1001088 3300025294 Bacteria 39306
721 Ga0209564_1000380 3300025295 Bacteria 81287
722 Ga0209564_1000497 3300025295 Bacteria 64942
723 Ga0209564_1000561 3300025295 Bacteria 59357
724 Ga0209564_1000848 3300025295 Bacteria 40926
725 Ga0209564_1000882 3300025295 Bacteria 39680
726 Ga0209564_1006913 3300025295 Bacteria 5969
727 Ga0209564_1017925 3300025295 Bacteria 2728
728 Ga0209564_1019370 3300025295 Bacteria 2546
729 Ga0209758_1000147 3300025297 Bacteria 166795
730 Ga0209758_1000912 3300025297 Bacteria 40017
731 Ga0209758_1001298 3300025297 Bacteria 30631
732 Ga0209758_1006687 3300025297 Bacteria 8139
733 Ga0209758_1023027 3300025297 Bacteria 2832
734 Ga0209050_1000020 3300025298 Bacteria 605671
735 Ga0209050_1000160 3300025298 Bacteria 157000
736 Ga0209050_1000879 3300025298 Bacteria 40293
737 Ga0209256_1000059 3300025299 Bacteria 272170
738 Ga0207426_1000033 3300025302 Bacteria 455976
739 Ga0207426_1000037 3300025302 Bacteria 442735
740 Ga0207426_1000051 3300025302 Bacteria 391700
741 Ga0207426_1000104 3300025302 Bacteria 249464
742 Ga0207426_1000360 3300025302 Bacteria 82007
743 Ga0207426_1000681 3300025302 Bacteria 41125
744 Ga0207426_1000904 3300025302 Bacteria 29822
745 Ga0207426_1001364 3300025302 Bacteria 20704
746 Ga0207426_1001887 3300025302 Bacteria 15299
747 Ga0207426_1005820 3300025302 Bacteria 5515
748 Ga0209051_1005127 3300025303 Bacteria 7776
749 Ga0209257_1000001 3300025304 Bacteria 2274655
750 Ga0209257_1000006 3300025304 Bacteria 1570111
751 Ga0209257_1001540 3300025304 Bacteria 26823
752 Ga0209257_1013542 3300025304 Bacteria 3612
753 Ga0207656_10018488 3300025321 Bacteria 2746
754 Ga0207696_1000053 3300025711 Bacteria 268590
755 Ga0207713_1000124 3300025735 Bacteria 122014
756 Ga0207680_10000177 3300025903 Bacteria 30942
757 Ga0207680_10001858 3300025903 Bacteria 9924
758 Ga0207680_10066260 3300025903 Bacteria 2220
759 Ga0207647_10000018 3300025904 Bacteria 124816
760 Ga0207647_10000256 3300025904 Bacteria 43702
761 Ga0207647_10000761 3300025904 Bacteria 25222
762 Ga0207647_10008403 3300025904 Bacteria 7405
763 Ga0207647_10021677 3300025904 Bacteria 4284
764 Ga0207647_10061409 3300025904 Bacteria 2294
765 Ga0207647_10064599 3300025904 Bacteria 2224
766 Ga0207647_10170934 3300025904 Bacteria 1265
767 Ga0207645_10000172 3300025907 Bacteria 51794
768 Ga0207645_10001507 3300025907 Bacteria 19057
769 Ga0207645_10015742 3300025907 Bacteria 5015
770 Ga0207645_10043803 3300025907 Bacteria 2864
771 Ga0207645_10082486 3300025907 Bacteria 2061
772 Ga0207645_10143044 3300025907 Bacteria 1559
773 Ga0207705_10000015 3300025909 Bacteria 382901
774 Ga0207705_10000035 3300025909 Bacteria 201649
775 Ga0207705_10014374 3300025909 Bacteria 5696
776 Ga0207705_10019160 3300025909 Bacteria 4895
777 Ga0207705_10069946 3300025909 Bacteria 2543
778 Ga0207654_10002002 3300025911 Bacteria 10474
779 Ga0207654_10005471 3300025911 Bacteria 6422
780 Ga0207654_10007056 3300025911 Bacteria 5659
781 Ga0207654_10007062 3300025911 Bacteria 5657
782 Ga0207654_10009147 3300025911 Bacteria 5024
783 Ga0207654_10048805 3300025911 Bacteria 2424
784 Ga0207654_10113827 3300025911 Bacteria 1687
785 Ga0207654_10126344 3300025911 Bacteria 1613
786 Ga0207654_10131425 3300025911 Bacteria 1585
787 Ga0207707_10014259 3300025912 Bacteria 6924
788 Ga0207707_10106546 3300025912 Bacteria 2450
789 Ga0207695_10000053 3300025913 Bacteria 396740
790 Ga0207695_10000060 3300025913 Bacteria 360217
791 Ga0207695_10000212 3300025913 Bacteria 156450
792 Ga0207695_10000276 3300025913 Bacteria 128924
793 Ga0207695_10000313 3300025913 Bacteria 117072
794 Ga0207695_10000346 3300025913 Bacteria 107028
795 Ga0207695_10000797 3300025913 Bacteria 59086
796 Ga0207695_10002702 3300025913 Bacteria 25862
797 Ga0207695_10003291 3300025913 Bacteria 22952
798 Ga0207695_10009664 3300025913 Bacteria 11884
799 Ga0207695_10011959 3300025913 Bacteria 10447
800 Ga0207695_10013946 3300025913 Bacteria 9553
801 Ga0207695_10016403 3300025913 Bacteria 8667
802 Ga0207695_10019413 3300025913 Bacteria 7830
803 Ga0207695_10031895 3300025913 Bacteria 5771
804 Ga0207695_10036487 3300025913 Bacteria 5314
805 Ga0207695_10036596 3300025913 Bacteria 5305
806 Ga0207695_10043620 3300025913 Bacteria 4780
807 Ga0207695_10050530 3300025913 Bacteria 4373
808 Ga0207695_10057323 3300025913 Bacteria 4047
809 Ga0207695_10084279 3300025913 Bacteria 3209
810 Ga0207695_10145181 3300025913 Bacteria 2318
811 Ga0207695_10253318 3300025913 Bacteria 1659
812 Ga0207695_10263354 3300025913 Bacteria 1621
813 Ga0207671_10000366 3300025914 Bacteria 64454
814 Ga0207671_10000402 3300025914 Bacteria 60371
815 Ga0207671_10000987 3300025914 Bacteria 35078
816 Ga0207671_10001317 3300025914 Bacteria 29052
817 Ga0207671_10001776 3300025914 Bacteria 24234
818 Ga0207671_10002743 3300025914 Bacteria 18404
819 Ga0207671_10002977 3300025914 Bacteria 17383
820 Ga0207671_10003165 3300025914 Bacteria 16628
821 Ga0207671_10003926 3300025914 Bacteria 14493
822 Ga0207671_10004651 3300025914 Bacteria 12997
823 Ga0207671_10006511 3300025914 Bacteria 10383
824 Ga0207671_10007415 3300025914 Bacteria 9517
825 Ga0207671_10008823 3300025914 Bacteria 8492
826 Ga0207671_10011907 3300025914 Bacteria 7033
827 Ga0207671_10012752 3300025914 Bacteria 6741
828 Ga0207671_10013351 3300025914 Bacteria 6545
829 Ga0207671_10014991 3300025914 Bacteria 6092
830 Ga0207671_10016271 3300025914 Bacteria 5786
831 Ga0207671_10030252 3300025914 Bacteria 4039
832 Ga0207671_10060246 3300025914 Bacteria 2816
833 Ga0207671_10078303 3300025914 Bacteria 2475
834 Ga0207671_10079920 3300025914 Bacteria 2450
835 Ga0207660_10007400 3300025917 Bacteria 7103
836 Ga0207657_10030704 3300025919 Bacteria 4874
837 Ga0207657_10087727 3300025919 Bacteria 2602
838 Ga0207657_10132526 3300025919 Bacteria 2042
839 Ga0207649_10002116 3300025920 Bacteria 11250
840 Ga0207649_10158694 3300025920 Bacteria 1565
841 Ga0207652_10032151 3300025921 Bacteria 4408
842 Ga0207652_10090893 3300025921 Bacteria 2683
843 Ga0207652_10122743 3300025921 Bacteria 2312
844 Ga0207652_10124777 3300025921 Bacteria 2293
845 Ga0207652_10446331 3300025921 Bacteria 1166
846 Ga0207646_10275168 3300025922 Bacteria 1522
847 Ga0207694_10006626 3300025924 Bacteria 8801
848 Ga0207694_10020764 3300025924 Bacteria 4972
849 Ga0207694_10037765 3300025924 Bacteria 3711
850 Ga0207694_10057179 3300025924 Bacteria 3032
851 Ga0207694_10085662 3300025924 Bacteria 2481
852 Ga0207650_10043496 3300025925 Bacteria 3297
853 Ga0207659_10037293 3300025926 Bacteria 3374
854 Ga0207687_10132380 3300025927 Bacteria 1881
855 Ga0207700_10115822 3300025928 Bacteria 2165
856 Ga0207644_10004990 3300025931 Bacteria 8662
857 Ga0207644_10031025 3300025931 Bacteria 3721
858 Ga0207644_10078531 3300025931 Bacteria 2433
859 Ga0207644_10130032 3300025931 Bacteria 1926
860 Ga0207690_10000253 3300025932 Bacteria 38909
861 Ga0207690_10022000 3300025932 Bacteria 3961
862 Ga0207690_10113539 3300025932 Bacteria 1955
863 Ga0207706_10000013 3300025933 Bacteria 188236
864 Ga0207706_10000646 3300025933 Bacteria 36855
865 Ga0207706_10002185 3300025933 Bacteria 19069
866 Ga0207706_10002489 3300025933 Bacteria 17951
867 Ga0207706_10007739 3300025933 Bacteria 9918
868 Ga0207706_10044505 3300025933 Bacteria 3934
869 Ga0207686_10056620 3300025934 Bacteria 2465
870 Ga0207686_10097721 3300025934 Bacteria 1953
871 Ga0207709_10000026 3300025935 Bacteria 354467
872 Ga0207670_10003877 3300025936 Bacteria 7974
873 Ga0207704_10000094 3300025938 Bacteria 52198
874 Ga0207704_10000354 3300025938 Bacteria 21443
875 Ga0207704_10020620 3300025938 Bacteria 3492
876 Ga0207691_10007032 3300025940 Bacteria 10855
877 Ga0207691_10065691 3300025940 Bacteria 3283
878 Ga0207711_10003663 3300025941 Bacteria 13284
879 Ga0207689_10003255 3300025942 Bacteria 14889
880 Ga0207689_10034678 3300025942 Bacteria 4191
881 Ga0207661_10005203 3300025944 Bacteria 9149
882 Ga0207661_10010722 3300025944 Bacteria 6605
883 Ga0207679_10000915 3300025945 Bacteria 18846
884 Ga0207667_10000020 3300025949 Bacteria 374770
885 Ga0207667_10000274 3300025949 Bacteria 71328
886 Ga0207667_10000394 3300025949 Bacteria 58926
887 Ga0207667_10000414 3300025949 Bacteria 57815
888 Ga0207667_10000597 3300025949 Bacteria 46839
889 Ga0207667_10001034 3300025949 Bacteria 35423
890 Ga0207667_10003766 3300025949 Bacteria 18678
891 Ga0207667_10005885 3300025949 Bacteria 14935
892 Ga0207667_10006159 3300025949 Bacteria 14576
893 Ga0207667_10011198 3300025949 Bacteria 10438
894 Ga0207667_10011442 3300025949 Bacteria 10312
895 Ga0207667_10012737 3300025949 Bacteria 9660
896 Ga0207667_10019599 3300025949 Bacteria 7545
897 Ga0207667_10030965 3300025949 Bacteria 5781
898 Ga0207667_10036938 3300025949 Bacteria 5229
899 Ga0207667_10038904 3300025949 Bacteria 5073
900 Ga0207667_10040451 3300025949 Bacteria 4964
901 Ga0207667_10048241 3300025949 Bacteria 4504
902 Ga0207667_10069970 3300025949 Bacteria 3653
903 Ga0207667_10091554 3300025949 Bacteria 3141
904 Ga0207667_10116630 3300025949 Bacteria 2751
905 Ga0207667_10135296 3300025949 Bacteria 2538
906 Ga0207667_10198302 3300025949 Bacteria 2059
907 Ga0207667_10246734 3300025949 Bacteria 1827
908 Ga0207667_10277004 3300025949 Bacteria 1715
909 Ga0207651_10003979 3300025960 Bacteria 7344
910 Ga0207651_10022953 3300025960 Bacteria 3828
911 Ga0207712_10003067 3300025961 Bacteria 10662
912 Ga0207640_10051724 3300025981 Bacteria 2672
913 Ga0207640_10079304 3300025981 Bacteria 2238
914 Ga0207640_10118303 3300025981 Bacteria 1893
915 Ga0207658_10028460 3300025986 Bacteria 3935
916 Ga0207658_10041566 3300025986 Bacteria 3330
917 Ga0207658_10042617 3300025986 Bacteria 3294
918 Ga0207658_10126200 3300025986 Unclassified 2048
919 Ga0207677_10058309 3300026023 Bacteria 2657
920 Ga0207703_10009385 3300026035 Bacteria 7690
921 Ga0207703_10031728 3300026035 Bacteria 4179
922 Ga0207639_10008408 3300026041 Bacteria 7071
923 Ga0207639_10015099 3300026041 Bacteria 5441
924 Ga0207639_10015873 3300026041 Bacteria 5318
925 Ga0207639_10021989 3300026041 Bacteria 4588
926 Ga0207639_10066764 3300026041 Bacteria 2797
927 Ga0207639_10132897 3300026041 Bacteria 2062
928 Ga0207639_10346100 3300026041 Bacteria 1326
929 Ga0207678_10000115 3300026067 Bacteria 66130
930 Ga0207678_10033705 3300026067 Bacteria 4461
931 Ga0207678_10065348 3300026067 Bacteria 3124
932 Ga0207678_10098019 3300026067 Bacteria 2505
933 Ga0207678_10115568 3300026067 Bacteria 2289
934 Ga0207702_10000223 3300026078 Bacteria 66194
935 Ga0207702_10000278 3300026078 Bacteria 58953
936 Ga0207702_10010340 3300026078 Bacteria 7816
937 Ga0207702_10026381 3300026078 Bacteria 4823
938 Ga0207702_10044099 3300026078 Bacteria 3747
939 Ga0207702_10055284 3300026078 Bacteria 3366
940 Ga0207702_10073026 3300026078 Bacteria 2957
941 Ga0207702_10106833 3300026078 Bacteria 2481
942 Ga0207702_10120895 3300026078 Bacteria 2344
943 Ga0207702_10122639 3300026078 Bacteria 2328
944 Ga0207702_10147581 3300026078 Bacteria 2136
945 Ga0207702_10255378 3300026078 Bacteria 1648
946 Ga0207702_10286576 3300026078 Bacteria 1559
947 Ga0207641_10000090 3300026088 Bacteria 127735
948 Ga0207641_10224369 3300026088 Bacteria 1744
949 Ga0207641_10314318 3300026088 Bacteria 1483
950 Ga0207641_10378529 3300026088 Viruses 1355
951 Ga0207641_10424194 3300026088 Bacteria 1281
952 Ga0207648_10000081 3300026089 Bacteria 90676
953 Ga0207648_10000307 3300026089 Bacteria 53572
954 Ga0207648_10014112 3300026089 Bacteria 7390
955 Ga0207648_10065581 3300026089 Bacteria 3165
956 Ga0207648_10089865 3300026089 Bacteria 2683
957 Ga0207676_10007606 3300026095 Bacteria 7693
958 Ga0207676_10008833 3300026095 Bacteria 7171
959 Ga0207676_10060106 3300026095 Bacteria 3004
960 Ga0207674_10003090 3300026116 Bacteria 20578
961 Ga0207674_10007260 3300026116 Bacteria 12917
962 Ga0207674_10014469 3300026116 Bacteria 8713
963 Ga0207674_10119057 3300026116 Bacteria 2610
964 Ga0207674_10365954 3300026116 Bacteria 1394
965 Ga0207675_100009737 3300026118 Bacteria 8998
966 Ga0207683_10009701 3300026121 Bacteria 8209
967 Ga0207683_10023168 3300026121 Bacteria 5336
968 Ga0207683_10027808 3300026121 Bacteria 4887
969 Ga0207683_10077563 3300026121 Bacteria 2943
970 Ga0207683_10089229 3300026121 Bacteria 2744
971 Ga0207698_10001331 3300026142 Bacteria 14433
972 Ga0207698_10002895 3300026142 Bacteria 10270
973 Ga0207698_10007919 3300026142 Bacteria 6692
974 Ga0207698_10032367 3300026142 Bacteria 3788
975 Ga0207698_10058884 3300026142 Bacteria 2980
976 Ga0207698_10075410 3300026142 Bacteria 2695
977 Ga0207698_10164250 3300026142 Bacteria 1946
978 Ga0207698_10205885 3300026142 Bacteria 1766
979 Ga0207698_10320444 3300026142 Bacteria 1451
980 Ga0209281_1000014 3300027111 Bacteria 643021
981 Ga0209281_1000257 3300027111 Bacteria 103090
982 Ga0209371_1000002 3300027312 Bacteria 1551985
983 Ga0209371_1000015 3300027312 Bacteria 659640
984 Ga0209970_1002110 3300027614 Bacteria 3410
985 Ga0207428_10094128 3300027907 Bacteria 2323
986 Ga0265354_1003144 3300028016 Bacteria 1891
987 Ga0268266_10000052 3300028379 Bacteria 296230
988 Ga0268266_10000053 3300028379 Bacteria 295181
989 Ga0268266_10000068 3300028379 Bacteria 241100
990 Ga0268266_10006444 3300028379 Bacteria 10748
991 Ga0268266_10054246 3300028379 Bacteria 3444
992 Ga0268266_10084381 3300028379 Bacteria 2774
993 Ga0268266_10131819 3300028379 Bacteria 2236
994 Ga0268266_10136815 3300028379 Bacteria 2195
995 Ga0268266_10244818 3300028379 Bacteria 1656
996 Ga0268265_10029603 3300028380 Bacteria 3933
997 Ga0268264_10000079 3300028381 Bacteria 249516
998 Ga0268264_10000517 3300028381 Bacteria 48865
999 Ga0268264_10004288 3300028381 Bacteria 12173
1000 Ga0268264_10023200 3300028381 Bacteria 5063
1001 Ga0268264_10047692 3300028381 Bacteria 3561
1002 Ga0265334_10000965 3300028573 Bacteria 14325
1003 Ga0265318_10015182 3300028577 Bacteria 3210
1004 Ga0307517_10002947 3300028786 Bacteria 26911
1005 Ga0307515_10000078 3300028794 Bacteria 227988
1006 Ga0307515_10000290 3300028794 Bacteria 123604
1007 Ga0307515_10000316 3300028794 Bacteria 119243
1008 Ga0307515_10001308 3300028794 Bacteria 56577
1009 Ga0307515_10002255 3300028794 Bacteria 42214
1010 Ga0307515_10003180 3300028794 Bacteria 34757
1011 Ga0307515_10005687 3300028794 Bacteria 25166
1012 Ga0307515_10006021 3300028794 Bacteria 24408
1013 Ga0307515_10011199 3300028794 Bacteria 17050
1014 Ga0307515_10041765 3300028794 Bacteria 7198
1015 Ga0307515_10293472 3300028794 Bacteria 1319
1016 Ga0265338_10009682 3300028800 Bacteria 11433
1017 Ga0265338_10026234 3300028800 Bacteria 5884
1018 Ga0265338_10120944 3300028800 Bacteria 2087
1019 Ga0265338_10248223 3300028800 Bacteria 1314
1020 Ga0265324_10018052 3300029957 Bacteria 2559
1021 Ga0268256_1000002 3300030500 Bacteria 1535763
1022 Ga0268256_1000018 3300030500 Bacteria 594572
1023 Ga0307511_10002426 3300030521 Bacteria 19480
1024 Ga0316177_1092983 3300030731 Bacteria 4059
1025 Ga0316176_1008738 3300030732 Bacteria 8053
1026 Ga0316183_1033300 3300030742 Bacteria 31987
1027 Ga0316181_1035519 3300030744 Bacteria 5006
1028 Ga0316182_1061293 3300030745 Bacteria 3268
1029 Ga0265325_10056010 3300031241 Bacteria 2014
1030 Ga0265331_10010586 3300031250 Bacteria 5094
1031 Ga0265331_10012971 3300031250 Bacteria 4493
1032 Ga0265327_10000283 3300031251 Bacteria 100296
1033 Ga0265327_10010964 3300031251 Bacteria 6305
1034 Ga0265327_10107237 3300031251 Bacteria 1340
1035 Ga0265316_10124755 3300031344 Bacteria 1942
1036 Ga0265316_10251951 3300031344 Bacteria 1296
1037 Ga0307513_10092041 3300031456 Bacteria 3088
1038 Ga0307509_10014794 3300031507 Bacteria 9148
1039 Ga0307509_10019232 3300031507 Bacteria 7798
1040 Ga0307509_10025814 3300031507 Bacteria 6561
1041 Ga0307509_10221424 3300031507 Bacteria 1705
1042 Ga0307408_100000035 3300031548 Bacteria 205352
1043 Ga0307408_100000468 3300031548 Bacteria 35371
1044 Ga0307408_100004638 3300031548 Bacteria 9288
1045 Ga0307408_100004866 3300031548 Bacteria 9046
1046 Ga0307408_100006865 3300031548 Bacteria 7546
1047 Ga0265313_10029396 3300031595 Bacteria 2843
1048 Ga0307508_10000123 3300031616 Bacteria 92439
1049 Ga0265342_10024105 3300031712 Bacteria 3844
1050 Ga0307516_10022679 3300031730 Bacteria 6444
1051 Ga0307516_10111009 3300031730 Bacteria 2544
1052 Ga0307405_10003512 3300031731 Bacteria 7220
1053 Ga0307413_10008054 3300031824 Bacteria 4945
1054 Ga0307413_10030828 3300031824 Bacteria 3017
1055 Ga0307410_10005100 3300031852 Bacteria 6904
1056 Ga0307406_10000127 3300031901 Bacteria 44877
1057 Ga0307406_10000193 3300031901 Bacteria 36307
1058 Ga0307406_10003065 3300031901 Bacteria 9091
1059 Ga0307406_10008797 3300031901 Bacteria 5643
1060 Ga0307407_10000163 3300031903 Bacteria 20529
1061 Ga0307407_10010668 3300031903 Bacteria 4343
1062 Ga0307412_10000001 3300031911 Bacteria 822691
1063 Ga0307412_10041210 3300031911 Bacteria 2991
1064 Ga0307412_10190096 3300031911 Bacteria 1551
1065 Ga0307409_100000039 3300031995 Bacteria 45539
1066 Ga0307409_100008002 3300031995 Bacteria 6372
1067 Ga0307409_100009599 3300031995 Bacteria 5957
1068 Ga0307409_100015145 3300031995 Bacteria 5047
1069 Ga0307409_100025308 3300031995 Bacteria 4159
1070 Ga0307416_100000050 3300032002 Bacteria 116313
1071 Ga0307416_100000054 3300032002 Bacteria 107633
1072 Ga0307416_100033586 3300032002 Bacteria 3891
1073 Ga0307416_100061955 3300032002 Bacteria 3056
1074 Ga0307414_10000074 3300032004 Bacteria 94049
1075 Ga0307414_10001174 3300032004 Bacteria 13449
1076 Ga0307414_10002273 3300032004 Bacteria 10029
1077 Ga0307414_10006497 3300032004 Bacteria 6521
1078 Ga0307414_10009537 3300032004 Bacteria 5583
1079 Ga0307414_10014424 3300032004 Bacteria 4737
1080 Ga0307414_10019606 3300032004 Bacteria 4195
1081 Ga0307414_10029263 3300032004 Bacteria 3583
1082 Ga0307414_10039907 3300032004 Bacteria 3167
1083 Ga0307414_10072171 3300032004 Bacteria 2493
1084 Ga0307414_10075590 3300032004 Bacteria 2445
1085 Ga0307414_10166772 3300032004 Bacteria 1756
1086 Ga0307414_10221589 3300032004 Bacteria 1553
1087 Ga0307414_10264903 3300032004 Bacteria 1436
1088 Ga0307414_10282629 3300032004 Bacteria 1395
1089 Ga0307411_10001193 3300032005 Bacteria 10272
1090 Ga0307411_10004116 3300032005 Bacteria 6900
1091 Ga0307411_10014649 3300032005 Bacteria 4372
1092 Ga0307415_100000659 3300032126 Bacteria 15221
1093 Ga0307415_100016006 3300032126 Bacteria 4456
1094 Ga0307507_10000032 3300033179 Bacteria 194155
1095 Ga0307507_10000337 3300033179 Bacteria 95356
1096 Ga0307510_10000774 3300033180 Bacteria 33030
1097 Ga0373953_0016898 3300035117 Bacteria 2673
1098 Ga0373927_0024612 3300035695 Bacteria 3936
1099 Ga0373933_0032011 3300035724 Bacteria 3055
1100 Ga0373937_0005416 3300036401 Bacteria 10921
1101 Ga0373937_0176034 3300036401 Bacteria 2008
1102 Ga0310110_011986 3300036535 Eukaryota 1258
1103 Ga0395899_0000002 3300037312 Bacteria 1324310
1104 Ga0395899_0000008 3300037312 Bacteria 567572
1105 Ga0395899_0000027 3300037312 Bacteria 337387
1106 Ga0395899_0000282 3300037312 Bacteria 66053
1107 Ga0395899_0000986 3300037312 Bacteria 26237
1108 Ga0395899_0001553 3300037312 Bacteria 19381
1109 Ga0395899_0002581 3300037312 Bacteria 14610
1110 Ga0395899_0007660 3300037312 Bacteria 8324
1111 Ga0395899_0023629 3300037312 Bacteria 4653
1112 Ga0395899_0049096 3300037312 Bacteria 3138
1113 Ga0395900_0000195 3300037418 Bacteria 97204
1114 Ga0395900_0000632 3300037418 Bacteria 47357
1115 Ga0395900_0001022 3300037418 Bacteria 35888
1116 Ga0395900_0001145 3300037418 Bacteria 33427
1117 Ga0395900_0002406 3300037418 Bacteria 20644
1118 Ga0395900_0002423 3300037418 Bacteria 20558
1119 Ga0395900_0089547 3300037418 Bacteria 3163
1120 Ga0395900_0264214 3300037418 Bacteria 1717
1121 Ga0395898_0000072 3300037466 Bacteria 249505
1122 Ga0395898_0007940 3300037466 Bacteria 11258
1123 Ga0395898_0009115 3300037466 Bacteria 10451
1124 Ga0395898_0013540 3300037466 Bacteria 8398
1125 Ga0395898_0030717 3300037466 Bacteria 5374
1126 Ga0395905_0000115 3300037471 Bacteria 133996
1127 Ga0395905_0000667 3300037471 Bacteria 45573
1128 Ga0395905_0001183 3300037471 Bacteria 32616
1129 Ga0395905_0001272 3300037471 Bacteria 31128
1130 Ga0395905_0002266 3300037471 Bacteria 21602
1131 Ga0395905_0002992 3300037471 Bacteria 18338
1132 Ga0395905_0003489 3300037471 Bacteria 16794
1133 Ga0395905_0016857 3300037471 Bacteria 6941
1134 Ga0395905_0017953 3300037471 Bacteria 6718
1135 Ga0395905_0023672 3300037471 Bacteria 5799
1136 Ga0395905_0174899 3300037471 Bacteria 2016
1137 Ga0395901_0000003 3300038443 Bacteria 701538
1138 Ga0395901_0000600 3300038443 Bacteria 41936
1139 Ga0395901_0000644 3300038443 Bacteria 40364
1140 Ga0395901_0002952 3300038443 Bacteria 17163
1141 Ga0395901_0154911 3300038443 Bacteria 2407
1142 Ga0395901_0180425 3300038443 Bacteria 2214
1143 Ga0400484_10965 3300038725 Bacteria 4431
1144 Ga0400490_19815 3300038726 Bacteria 12936
1145 Ga0400485_04164 3300038735 Bacteria 1864
1146 Ga0400486_17818 3300038742 Bacteria 2184
1147 Ga0400486_23005 3300038742 Bacteria 13731
1148 Ga0400483_181305 3300039062 Bacteria 1480
1149 Ga0400483_226464 3300039062 Bacteria 2836
1150 Ga0400489_17023 3300039093 Bacteria 3201
1151 Ga0400487_08555 3300039110 Bacteria 1570
1152 Ga0400487_33670 3300039110 Bacteria 6334
1153 Ga0436365_0965775 3300039437 Bacteria 470291
1154 Ga0436365_1777577 3300039437 Bacteria 5242
1155 Ga0436360_0204520 3300039438 Bacteria 8806
1156 Ga0436361_0246539 3300039447 Bacteria 3635
1157 Ga0436361_0324465 3300039447 Bacteria 7177
1158 Ga0436361_0434733 3300039447 Bacteria 12240
1159 Ga0436361_0468389 3300039447 Bacteria 14150
1160 Ga0436361_1126675 3300039447 Bacteria 11002
1161 Ga0436361_1202653 3300039447 Bacteria 36636
1162 Ga0439436_0012191 3300041404 Bacteria 2608
1163 Ga0439439_0037657 3300041406 Bacteria 1247
1164 Ga0451839_0925907 3300041496 Bacteria 1501
1165 Ga0451851_1126820 3300041507 Bacteria 1287
1166 Ga0439448_0002717 3300042005 Bacteria 4838
1167 Ga0439452_000002 3300042010 Bacteria 1377577
1168 Ga0439452_000020 3300042010 Bacteria 309345
1169 Ga0439455_0000005 3300042012 Bacteria 41504
1170 Ga0439457_002931 3300042014 Bacteria 4745
1171 Ga0439462_0001872 3300042015 Bacteria 4781
1172 Ga0451577_0001858 3300042876 Bacteria 26914
1173 Ga0451577_0021656 3300042876 Bacteria 5879
1174 Ga0451577_0056657 3300042876 Bacteria 3496
1175 Ga0451577_0093008 3300042876 Bacteria 2693
1176 Ga0466969_0000072 3300044656 Bacteria 53055
1177 Ga0466969_0000836 3300044656 Bacteria 16716
1178 Ga0466969_0013340 3300044656 Bacteria 4325
1179 Ga0466969_0095624 3300044656 Bacteria 1403
1180 Ga0466972_0000166 3300044658 Bacteria 52364
1181 Ga0466972_0000433 3300044658 Bacteria 21713
1182 Ga0466972_0002124 3300044658 Bacteria 9732
1183 Ga0466972_0005460 3300044658 Bacteria 6369
1184 Ga0466972_0009300 3300044658 Bacteria 4939
1185 Ga0466972_0038480 3300044658 Bacteria 2336
1186 Ga0453683_0000054 3300044673 Bacteria 194357
1187 Ga0453683_0000112 3300044673 Bacteria 121330
1188 Ga0453683_0009980 3300044673 Bacteria 6316
1189 Ga0453683_0010198 3300044673 Bacteria 6235
1190 Ga0453683_0183508 3300044673 Bacteria 1327
1191 Ga0466965_0001104 3300044683 Bacteria 10526
1192 Ga0466965_0029997 3300044683 Bacteria 2648
1193 Ga0466965_0081925 3300044683 Bacteria 1632
1194 Ga0466965_0151229 3300044683 Bacteria 1213
1195 Ga0466966_0000047 3300044684 Bacteria 91962
1196 Ga0466966_0000055 3300044684 Bacteria 82126
1197 Ga0466966_0000323 3300044684 Bacteria 30921
1198 Ga0466966_0055559 3300044684 Bacteria 2505
1199 Ga0466961_0000288 3300044693 Bacteria 33438
1200 Ga0466961_0068518 3300044693 Bacteria 2253
1201 Ga0466964_0037363 3300044706 Bacteria 1950
1202 Ga0466964_0103879 3300044706 Bacteria 1257
1203 Ga0453684_0000206 3300044712 Bacteria 257650
1204 Ga0453684_0000273 3300044712 Bacteria 222658
1205 Ga0453684_0004800 3300044712 Bacteria 27826
1206 Ga0453684_0006454 3300044712 Bacteria 22264
1207 Ga0453684_0008233 3300044712 Bacteria 18795
1208 Ga0453684_0018008 3300044712 Bacteria 10878
1209 Ga0453684_0021215 3300044712 Bacteria 9722
1210 Ga0453684_0099837 3300044712 Bacteria 3554
1211 Ga0453684_0112056 3300044712 Bacteria 3312
1212 Ga0453684_0202073 3300044712 Bacteria 2316
1213 Ga0453684_0203651 3300044712 Bacteria 2305
1214 Ga0453684_0206744 3300044712 Bacteria 2284
1215 Ga0453684_0227808 3300044712 Bacteria 2154
1216 Ga0453684_0258840 3300044712 Bacteria 1994
1217 Ga0453684_0374860 3300044712 Bacteria 1599
1218 Ga0453684_0556903 3300044712 Bacteria 1262
1219 Ga0466971_0071275 3300044719 Bacteria 1578
1220 Ga0466968_0003012 3300044735 Bacteria 6222
1221 Ga0466968_0008819 3300044735 Bacteria 3870
1222 Ga0466968_0010641 3300044735 Bacteria 3572
1223 Ga0466968_0019578 3300044735 Bacteria 2725
1224 Ga0466968_0044812 3300044735 Bacteria 1875
1225 Ga0466957_0000096 3300044842 Bacteria 35179
1226 Ga0466957_0000937 3300044842 Bacteria 14932
1227 Ga0466957_0001190 3300044842 Bacteria 13530
1228 Ga0466957_0004449 3300044842 Bacteria 7809
1229 Ga0466957_0113876 3300044842 Bacteria 1718
1230 Ga0466959_0000065 3300045049 Bacteria 73931
1231 Ga0466959_0005837 3300045049 Bacteria 8477
1232 Ga0466959_0006101 3300045049 Bacteria 8321
1233 Ga0466959_0014230 3300045049 Bacteria 5773
1234 Ga0466959_0034646 3300045049 Bacteria 3735
1235 Ga0466959_0039845 3300045049 Bacteria 3473
1236 Ga0466959_0106962 3300045049 Bacteria 2000
1237 Ga0466959_0116585 3300045049 Bacteria 1901
1238 Ga0466959_0117112 3300045049 Bacteria 1897
1239 Ga0451576_0000072 3300045051 Bacteria 257650
1240 Ga0451576_0000687 3300045051 Bacteria 68943
1241 Ga0451576_0001003 3300045051 Bacteria 52190
1242 Ga0451576_0001140 3300045051 Bacteria 48038
1243 Ga0451576_0002396 3300045051 Bacteria 28162
1244 Ga0495627_000792 3300046453 Bacteria 23123
1245 Ga0495603_0019726 3300046455 Bacteria 4082
1246 Ga0495591_015588 3300046458 Bacteria 2678
1247 Ga0495629_0001523 3300046459 Bacteria 18223
1248 Ga0495629_0024999 3300046459 Bacteria 4249
1249 Ga0495638_0013150 3300046460 Bacteria 5648
1250 Ga0495638_0020710 3300046460 Bacteria 4342
1251 Ga0495638_0078026 3300046460 Bacteria 2015
1252 Ga0495638_0115978 3300046460 Bacteria 1587
1253 Ga0495653_0145108 3300046463 Bacteria 1664
1254 Ga0495650_0000003 3300046471 Bacteria 900730
1255 Ga0495650_0000144 3300046471 Bacteria 165957
1256 Ga0495650_0000162 3300046471 Bacteria 148927
1257 Ga0495650_0001307 3300046471 Bacteria 25272
1258 Ga0495650_0024473 3300046471 Bacteria 2850
1259 Ga0495580_0002422 3300046472 Bacteria 16303
1260 Ga0495580_0003588 3300046472 Bacteria 13165
1261 Ga0495580_0024285 3300046472 Bacteria 4441
1262 Ga0495605_0001846 3300046474 Bacteria 13548
1263 Ga0495585_0000091 3300046492 Bacteria 95620
1264 Ga0495585_0000426 3300046492 Bacteria 40518
1265 Ga0495585_0000470 3300046492 Bacteria 38600
1266 Ga0495585_0000596 3300046492 Bacteria 33838
1267 Ga0495585_0002119 3300046492 Bacteria 14495
1268 Ga0495585_0051427 3300046492 Bacteria 2283
1269 Ga0495585_0062395 3300046492 Bacteria 2047
1270 Ga0495596_0027536 3300046500 Bacteria 2285
1271 Ga0495607_0005412 3300046501 Bacteria 9143
1272 Ga0495607_0020750 3300046501 Bacteria 4146
1273 Ga0495583_0008946 3300046506 Bacteria 6045
1274 Ga0495583_0014992 3300046506 Bacteria 4241
1275 Ga0495583_0057341 3300046506 Bacteria 1752
1276 Ga0495583_0078397 3300046506 Bacteria 1439
1277 Ga0495606_0000553 3300046507 Bacteria 59889
1278 Ga0495606_0000919 3300046507 Bacteria 43453
1279 Ga0495606_0001495 3300046507 Bacteria 31082
1280 Ga0495606_0003323 3300046507 Bacteria 17173
1281 Ga0495606_0005759 3300046507 Bacteria 11714
1282 Ga0495606_0014783 3300046507 Bacteria 6064
1283 Ga0495606_0024974 3300046507 Bacteria 4291
1284 Ga0495606_0030291 3300046507 Bacteria 3783
1285 Ga0495606_0054968 3300046507 Bacteria 2576
1286 Ga0495606_0087866 3300046507 Bacteria 1918
1287 Ga0495606_0121284 3300046507 Bacteria 1565
1288 Ga0495608_0099447 3300046511 Bacteria 1876
1289 Ga0495610_0000815 3300046512 Bacteria 29262
1290 Ga0495610_0006223 3300046512 Bacteria 8278
1291 Ga0495610_0006790 3300046512 Bacteria 7764
1292 Ga0495610_0007529 3300046512 Bacteria 7215
1293 Ga0495610_0013940 3300046512 Bacteria 4750
1294 Ga0495616_0001963 3300046513 Bacteria 13847
1295 Ga0495616_0002520 3300046513 Bacteria 12110
1296 Ga0495616_0002531 3300046513 Bacteria 12080
1297 Ga0495616_0035438 3300046513 Bacteria 2582
1298 Ga0495616_0046738 3300046513 Bacteria 2183
1299 Ga0495628_0007406 3300046516 Bacteria 9501
1300 Ga0495628_0080442 3300046516 Bacteria 2533
1301 Ga0495630_0055754 3300046517 Bacteria 2961
1302 Ga0495630_0152144 3300046517 Bacteria 1760
1303 Ga0495631_0044829 3300046518 Bacteria 1948
1304 Ga0495632_0057823 3300046519 Bacteria 1892
1305 Ga0495632_0060773 3300046519 Bacteria 1835
1306 Ga0495643_0000051 3300046522 Bacteria 207804
1307 Ga0495643_0025899 3300046522 Bacteria 3315
1308 Ga0495644_0007728 3300046523 Bacteria 4145
1309 Ga0495648_0000851 3300046524 Bacteria 32195
1310 Ga0495648_0003925 3300046524 Bacteria 12873
1311 Ga0495648_0010599 3300046524 Bacteria 7007
1312 Ga0495648_0024944 3300046524 Bacteria 4058
1313 Ga0495648_0035510 3300046524 Bacteria 3231
1314 Ga0495648_0068329 3300046524 Bacteria 2074
1315 Ga0495648_0078321 3300046524 Bacteria 1891
1316 Ga0495663_0000093 3300046525 Bacteria 39511
1317 Ga0495652_0055952 3300046529 Bacteria 3353
1318 Ga0495654_0010683 3300046530 Bacteria 4988
1319 Ga0495665_0029537 3300046531 Bacteria 2937
1320 Ga0495640_0104526 3300046533 Bacteria 1856
1321 Ga0495586_0036116 3300046535 Bacteria 2652
1322 Ga0495586_0050248 3300046535 Bacteria 2256
1323 Ga0495587_0022367 3300046536 Bacteria 3893
1324 Ga0495587_0084533 3300046536 Bacteria 1838
1325 Ga0495609_0000003 3300046538 Bacteria 711547
1326 Ga0495609_0004681 3300046538 Bacteria 7413
1327 Ga0495609_0049094 3300046538 Bacteria 1884
1328 Ga0495597_0000308 3300046542 Bacteria 43955
1329 Ga0495597_0001174 3300046542 Bacteria 19643
1330 Ga0495645_0001552 3300046543 Bacteria 15534
1331 Ga0495645_0020210 3300046543 Bacteria 4802
1332 Ga0495645_0024578 3300046543 Bacteria 4372
1333 Ga0495622_0000579 3300046557 Bacteria 21900
1334 Ga0495622_0040619 3300046557 Bacteria 2165
1335 Ga0495633_0000005 3300046558 Bacteria 357644
1336 Ga0495633_0000021 3300046558 Bacteria 227171
1337 Ga0495633_0000026 3300046558 Bacteria 204722
1338 Ga0495633_0032843 3300046558 Bacteria 2505
1339 Ga0495633_0055893 3300046558 Bacteria 1855
1340 Ga0495667_0040877 3300046559 Bacteria 3077
1341 Ga0495667_0130820 3300046559 Bacteria 1619
1342 Ga0495667_0137930 3300046559 Bacteria 1572
1343 Ga0495668_0000009 3300046616 Bacteria 492623
1344 Ga0495668_0000012 3300046616 Bacteria 458817
1345 Ga0495668_0000054 3300046616 Bacteria 203960
1346 Ga0495634_0038993 3300046642 Bacteria 3237
1347 Ga0495611_0000435 3300046648 Bacteria 25748
1348 Ga0495625_0000059 3300046660 Bacteria 180330
1349 Ga0495625_0000175 3300046660 Bacteria 99386
1350 Ga0495625_0000515 3300046660 Bacteria 56971
1351 Ga0495625_0000534 3300046660 Bacteria 55918
1352 Ga0495625_0000719 3300046660 Bacteria 46578
1353 Ga0495625_0000907 3300046660 Bacteria 39912
1354 Ga0495625_0001227 3300046660 Bacteria 32490
1355 Ga0495625_0001942 3300046660 Bacteria 23400
1356 Ga0495625_0010378 3300046660 Bacteria 7713
1357 Ga0495625_0014323 3300046660 Bacteria 6335
1358 Ga0495625_0017125 3300046660 Bacteria 5680
1359 Ga0495625_0047988 3300046660 Bacteria 3077
1360 Ga0495625_0080640 3300046660 Bacteria 2266
1361 Ga0495625_0089737 3300046660 Bacteria 2127
1362 Ga0495625_0114513 3300046660 Bacteria 1841
1363 Ga0495661_0001605 3300046665 Bacteria 18539
1364 Ga0495661_0024433 3300046665 Bacteria 3912
1365 Ga0495623_0017966 3300046679 Bacteria 4568
1366 Ga0495658_0006565 3300046683 Bacteria 5714
1367 Ga0495658_0022658 3300046683 Bacteria 3324
1368 Ga0495669_0012930 3300046684 Bacteria 3554
1369 Ga0495671_0051763 3300046692 Bacteria 2042
1370 Ga0495649_0000009 3300046694 Bacteria 451725
1371 Ga0495649_0000031 3300046694 Bacteria 151547
1372 Ga0495649_0000037 3300046694 Bacteria 133848
1373 Ga0495649_0000926 3300046694 Bacteria 23257
1374 Ga0495649_0004071 3300046694 Bacteria 9620
1375 Ga0495649_0005835 3300046694 Bacteria 7745
1376 Ga0495649_0037571 3300046694 Bacteria 2658
1377 Ga0495589_0027271 3300046794 Bacteria 2888
1378 Ga0495660_0013025 3300046810 Bacteria 4821
1379 Ga0495660_0058093 3300046810 Bacteria 2085
1380 Ga0495581_0003610 3300047315 Bacteria 8906
1381 Ga0495672_0000030 3300047320 Bacteria 305021
1382 Ga0495672_0000093 3300047320 Bacteria 145111
1383 Ga0495672_0004809 3300047320 Bacteria 10891
1384 Ga0495676_0235223 3300047321 Bacteria 1257
1385 Ga0495683_0022308 3300047323 Bacteria 3256
1386 Ga0495683_0022362 3300047323 Bacteria 3251
1387 Ga0495683_0116666 3300047323 Bacteria 1270
1388 Ga0495687_000104 3300047443 Bacteria 128704
1389 Ga0495687_000741 3300047443 Bacteria 35578
1390 Ga0495687_000889 3300047443 Bacteria 31475
1391 Ga0495687_001385 3300047443 Bacteria 22382
1392 Ga0495687_004762 3300047443 Bacteria 8965
1393 Ga0495687_078170 3300047443 Bacteria 1304
1394 Ga0495681_0039289 3300047470 Bacteria 2313
1395 Ga0495686_0000005 3300047472 Bacteria 827143
1396 Ga0495686_0000210 3300047472 Bacteria 107859
1397 Ga0495686_0000247 3300047472 Bacteria 97327
1398 Ga0495686_0000468 3300047472 Bacteria 60235
1399 Ga0495686_0000621 3300047472 Bacteria 48956
1400 Ga0495686_0000821 3300047472 Bacteria 40069
1401 Ga0495686_0001919 3300047472 Bacteria 20750
1402 Ga0495686_0003426 3300047472 Bacteria 13762
1403 Ga0495686_0014895 3300047472 Bacteria 5335
1404 Ga0495686_0022680 3300047472 Bacteria 4151
1405 Ga0495686_0050721 3300047472 Bacteria 2607
1406 Ga0495614_0021813 3300048089 Bacteria 2765
1407 Ga0495626_0039077 3300048091 Bacteria 2247
1408 Ga0496102_0009318 3300048905 Bacteria 8431
1409 Ga0496102_0013721 3300048905 Bacteria 7026
1410 Ga0496102_0114340 3300048905 Bacteria 2518
1411 Ga0496102_0145241 3300048905 Bacteria 2226
1412 Ga0496103_0013479 3300048906 Bacteria 4849
1413 Ga0496104_0032067 3300048907 Bacteria 4890
1414 Ga0496104_0398025 3300048907 Bacteria 1289
1415 Ga0496106_0056702 3300048909 Bacteria 2962
1416 Ga0496107_0047859 3300048910 Bacteria 3079
1417 Ga0496107_0071737 3300048910 Bacteria 2517
1418 Ga0496108_0006039 3300048911 Bacteria 9802
1419 Ga0496108_0090271 3300048911 Bacteria 2605
1420 Ga0496111_0046852 3300048914 Bacteria 3114
1421 Ga0496113_0223788 3300048916 Bacteria 1500
1422 Ga0496114_0001462 3300048917 Bacteria 17955
1423 Ga0496114_0076633 3300048917 Bacteria 2818
1424 Ga0496115_0072774 3300048918 Bacteria 2789
1425 Ga0496116_0002509 3300048919 Bacteria 19214
1426 Ga0496116_0005392 3300048919 Bacteria 11897
1427 Ga0496116_0007473 3300048919 Bacteria 9681
1428 Ga0496117_0000209 3300048920 Bacteria 113908
1429 Ga0496117_0000850 3300048920 Bacteria 47287
1430 Ga0496117_0012827 3300048920 Bacteria 7349
1431 Ga0496117_0015973 3300048920 Bacteria 6360
1432 Ga0496118_0000019 3300048921 Bacteria 489649
1433 Ga0496118_0000895 3300048921 Bacteria 46802
1434 Ga0496118_0014190 3300048921 Bacteria 7471
1435 Ga0496118_0016166 3300048921 Bacteria 6860
1436 Ga0496119_0000049 3300048922 Bacteria 185482
1437 Ga0496119_0007161 3300048922 Bacteria 10115
1438 Ga0496119_0011523 3300048922 Bacteria 7306
1439 Ga0496119_0025414 3300048922 Bacteria 4137
1440 Ga0496120_0000649 3300048923 Bacteria 51212
1441 Ga0496120_0012032 3300048923 Bacteria 5912
1442 Ga0496121_0000024 3300048924 Bacteria 462959
1443 Ga0496121_0000669 3300048924 Bacteria 64027
1444 Ga0496121_0038803 3300048924 Bacteria 4209
1445 Ga0496121_0055043 3300048924 Bacteria 3318
1446 Ga0496122_0000088 3300048925 Bacteria 207600
1447 Ga0496122_0002429 3300048925 Bacteria 26491
1448 Ga0496122_0066390 3300048925 Bacteria 2607
1449 Ga0496123_0000139 3300048926 Bacteria 151469
1450 Ga0496123_0000945 3300048926 Bacteria 45308
1451 Ga0496123_0001057 3300048926 Bacteria 41648
1452 Ga0496124_0000045 3300048927 Bacteria 287396
1453 Ga0496124_0005207 3300048927 Bacteria 14767
1454 Ga0496124_0023711 3300048927 Bacteria 5595
1455 Ga0496124_0098633 3300048927 Bacteria 2370
1456 Ga0496125_0000065 3300048928 Bacteria 249830
1457 Ga0496125_0008498 3300048928 Bacteria 10740
1458 Ga0496125_0047533 3300048928 Bacteria 3587
1459 Ga0496125_0111143 3300048928 Bacteria 1984
1460 Ga0496126_0000739 3300048929 Bacteria 59186
1461 Ga0496126_0008429 3300048929 Bacteria 11116
1462 Ga0496126_0009193 3300048929 Bacteria 10540
1463 Ga0496126_0011254 3300048929 Bacteria 9281
1464 Ga0496126_0014302 3300048929 Bacteria 8029
1465 Ga0496126_0015139 3300048929 Bacteria 7768
1466 Ga0496126_0019853 3300048929 Bacteria 6608
1467 Ga0496126_0056394 3300048929 Bacteria 3552
1468 Ga0495678_000040 3300049459 Bacteria 190664
1469 Ga0495678_009963 3300049459 Bacteria 4653
1470 Ga0495678_010791 3300049459 Bacteria 4411
1471 Ga0495682_0004988 3300049460 Bacteria 5580
1472 Ga0495682_0011166 3300049460 Bacteria 3461
1473 Ga0501298_005586 3300049521 Bacteria 2024
1474 Ga0501031_0004060 3300049568 Bacteria 9448
1475 Ga0501032_0000170 3300049569 Bacteria 53079
1476 Ga0501032_0005161 3300049569 Bacteria 9739
1477 Ga0501032_0094739 3300049569 Unclassified 1979
1478 Ga0501033_0000004 3300049570 Bacteria 441310
1479 Ga0501034_0000007 3300049571 Bacteria 357805
1480 Ga0501034_0001804 3300049571 Bacteria 27281
1481 Ga0501034_0016304 3300049571 Bacteria 7628
1482 Ga0501034_0022036 3300049571 Bacteria 6490
1483 Ga0501034_0047251 3300049571 Bacteria 4348
1484 Ga0501034_0056617 3300049571 Bacteria 3944
1485 Ga0501034_0308818 3300049571 Bacteria 1517
1486 Ga0501034_0434964 3300049571 Bacteria 1231
1487 Ga0501036_0002845 3300049572 Bacteria 13717
1488 Ga0501036_0005475 3300049572 Bacteria 10290
1489 Ga0501036_0217031 3300049572 Unclassified 1606
1490 Ga0501037_0001925 3300049573 Bacteria 15050
1491 Ga0501037_0008556 3300049573 Bacteria 7505
1492 Ga0501038_0001517 3300049574 Bacteria 21376
1493 Ga0501038_0001903 3300049574 Bacteria 19296
1494 Ga0501038_0007369 3300049574 Bacteria 10149
1495 Ga0501039_0015765 3300049575 Bacteria 5784
1496 Ga0501039_0018601 3300049575 Bacteria 5332
1497 Ga0501040_0002525 3300049576 Bacteria 11800
1498 Ga0501042_0008404 3300049578 Bacteria 6811
1499 Ga0501043_0002109 3300049579 Bacteria 16977
1500 Ga0501043_0003067 3300049579 Bacteria 13880
1501 Ga0501043_0015026 3300049579 Bacteria 6062
1502 Ga0501043_0062787 3300049579 Bacteria 2917
1503 Ga0501043_0168338 3300049579 Bacteria 1710
1504 Ga0501046_0005766 3300049580 Bacteria 11055
1505 Ga0501046_0008014 3300049580 Bacteria 9233
1506 Ga0501047_0004779 3300049581 Bacteria 12743
1507 Ga0501047_0007622 3300049581 Bacteria 10190
1508 Ga0501047_0015554 3300049581 Bacteria 7250
1509 Ga0501047_0216101 3300049581 Bacteria 1774
1510 Ga0501069_0105134 3300049585 Bacteria 1604
1511 Ga0501202_016323 3300049652 Bacteria 1439
1512 Ga0501206_001534 3300049653 Bacteria 2879
1513 Ga0501223_000995 3300049663 Bacteria 6703
1514 Ga0501240_002278 3300049673 Bacteria 2013
1515 Ga0501257_001356 3300049686 Bacteria 5048
1516 Ga0501257_019450 3300049686 Bacteria 1589
1517 Ga0501225_0000330 3300049705 Bacteria 14824
1518 Ga0501080_0034125 3300049742 Bacteria 4749
1519 Ga0501083_0000212 3300049744 Bacteria 37667
1520 Ga0501241_000156 3300049758 Bacteria 15206
1521 Ga0501265_001916 3300049762 Bacteria 2371
1522 Ga0501280_000145 3300049776 Bacteria 18218
1523 Ga0501282_001182 3300049778 Bacteria 2925
1524 Ga0501035_0001627 3300049822 Bacteria 22735
1525 Ga0501035_0037561 3300049822 Bacteria 4385
1526 Ga0501035_0200260 3300049822 Bacteria 1713
1527 Ga0501044_0008288 3300049823 Bacteria 11394
1528 Ga0501044_0008832 3300049823 Bacteria 11022
1529 Ga0501044_0010895 3300049823 Bacteria 9868
1530 Ga0501044_0012157 3300049823 Bacteria 9321
1531 Ga0501044_0098841 3300049823 Bacteria 2938
1532 Ga0501045_0000002 3300049824 Bacteria 94022
1533 nmdc:mga03683_4691_c1 3300050489 Bacteria 4560
1534 nmdc:mga00v17_367_c1 3300050491 Bacteria 25605
1535 nmdc:mga0k408_162445_c1 3300050493 Bacteria 1331
1536 nmdc:mga0k408_30302_c1 3300050493 Bacteria 3084
1537 nmdc:mga0k408_44723_c1 3300050493 Bacteria 2553
1538 nmdc:mga0k408_78_c1 3300050493 Bacteria 45819
1539 nmdc:mga0k408_82_c1 3300050493 Bacteria 45008
1540 nmdc:mga0k408_85_c1 3300050493 Bacteria 43890
1541 nmdc:mga0k408_9453_c1 3300050493 Bacteria 5254
1542 nmdc:mga07m45_10615_c1 3300050496 Bacteria 4818
1543 nmdc:mga07m45_5753_c1 3300050496 Bacteria 6204
1544 nmdc:mga07m45_81812_c1 3300050496 Bacteria 1844
1545 nmdc:mga05p37_160869_c1 3300050507 Bacteria 2742
1546 nmdc:mga05p37_9734_c1 3300050507 Bacteria 11396
1547 nmdc:mga05p37_990_c2 3300050507 Bacteria 10473
1548 nmdc:mga09592_138309_c1 3300050508 Bacteria 2099
1549 nmdc:mga09592_48509_c1 3300050508 Bacteria 3580
1550 nmdc:mga0qj67_162693_c1 3300050509 Bacteria 1812
1551 nmdc:mga06r32_134893_c1 3300050510 Bacteria 2443
1552 nmdc:mga06r32_63551_c1 3300050510 Bacteria 3559
1553 nmdc:mga08y16_232600_c1 3300050511 Bacteria 1906
1554 nmdc:mga08y16_32146_c1 3300050511 Bacteria 5518
1555 nmdc:mga08y16_6512_c1 3300050511 Bacteria 12247
1556 Ga0500635_0000900 3300053080 Bacteria 7201
1557 Ga0500635_0002059 3300053080 Bacteria 4919
1558 Ga0500578_0000541 3300053086 Bacteria 45881
1559 Ga0500644_0000042 3300053088 Bacteria 76909
1560 Ga0500644_0000111 3300053088 Bacteria 51484
1561 Ga0500644_0032679 3300053088 Bacteria 1665
1562 Ga0500646_0000393 3300053090 Bacteria 13091
1563 Ga0500646_0001536 3300053090 Bacteria 6092
1564 Ga0500583_0000010 3300053092 Bacteria 160546
1565 Ga0500583_0000884 3300053092 Bacteria 8634
1566 Ga0500583_0001631 3300053092 Bacteria 6529
1567 Ga0500583_0010133 3300053092 Bacteria 3482
1568 Ga0500651_0000142 3300053093 Bacteria 44963
1569 Ga0500651_0001832 3300053093 Bacteria 10908
1570 Ga0500556_0015782 3300053104 Bacteria 2338
1571 Ga0500562_000098 3300053108 Bacteria 33851
1572 Ga0500562_000829 3300053108 Bacteria 7528
1573 Ga0500569_011508 3300053109 Bacteria 2115
1574 Ga0500607_084621 3300053121 Bacteria 1610
1575 Ga0500608_000428 3300053122 Bacteria 15994
1576 Ga0500614_017015 3300053123 Bacteria 1638
1577 Ga0500618_000009 3300053125 Bacteria 209970
1578 Ga0500618_000018 3300053125 Bacteria 163272
1579 Ga0500618_000080 3300053125 Bacteria 78455
1580 Ga0500618_026589 3300053125 Bacteria 1381
1581 Ga0500642_0026337 3300053130 Bacteria 2373
1582 Ga0500652_000050 3300053131 Bacteria 55884
1583 Ga0500652_025159 3300053131 Bacteria 2278
1584 Ga0500658_0001969 3300053134 Bacteria 8031
1585 Ga0500658_0004946 3300053134 Bacteria 4968
1586 Ga0500561_0032228 3300053137 Bacteria 1331
1587 Ga0500577_0000669 3300053142 Bacteria 8765
1588 Ga0500577_0005231 3300053142 Bacteria 3483
1589 Ga0500588_0048748 3300053146 Bacteria 1311
1590 Ga0500600_0006391 3300053149 Bacteria 7023
1591 Ga0500616_0000007 3300053153 Bacteria 836875
1592 Ga0500616_0001241 3300053153 Bacteria 25574
1593 Ga0500622_0000053 3300053156 Bacteria 145070
1594 Ga0500622_0000292 3300053156 Bacteria 51243
1595 Ga0500622_0000371 3300053156 Bacteria 43288
1596 Ga0500622_0000809 3300053156 Bacteria 26806
1597 Ga0500622_0001408 3300053156 Bacteria 19385
1598 Ga0500622_0002797 3300053156 Bacteria 12259
1599 Ga0500622_0003008 3300053156 Bacteria 11653
1600 Ga0500622_0005861 3300053156 Bacteria 7266
1601 Ga0500622_0022320 3300053156 Bacteria 3356
1602 Ga0500624_001241 3300053157 Bacteria 4521
1603 Ga0500627_0049882 3300053158 Bacteria 1822
1604 Ga0500634_0007544 3300053161 Bacteria 5379
1605 Ga0500634_0106142 3300053161 Bacteria 1396
1606 Ga0500645_000552 3300053730 Bacteria 24729
1607 Ga0500587_001403 3300053739 Bacteria 3404
1608 Ga0587083_0003735 3300059505 Bacteria 2055
1609 Ga0466962_0001301 3300061719 Bacteria 11528
1610 Ga0466962_0015777 3300061719 Bacteria 3644
1611 Ga0466962_0018366 3300061719 Bacteria 3364
1612 2512934704 2512875016 Bacteria 6529530
1613 2512963059 2512875024 Bacteria 7195110
1614 2513704636 2513237102 Bacteria 7703324
1615 2514037797 2513237164 Bacteria 7563725
1616 2514046315 2513237166 Bacteria 10373764
1617 2515688612 2515154123 Bacteria 6387382
1618 2516016973 2515154189 Bacteria 9629850
1619 2522553591 2522125168 Bacteria 7376607
1620 2535517772 2534681796 Bacteria 7146037
1621 2547373875 2547132103 Bacteria 5115736
1622 2547697200 2547132181 Bacteria 4945084
1623 2562463356 2561511199 Bacteria 5155034
1624 2563061934 2562617112 Bacteria 10918404
1625 2585295464 2582581311 Bacteria 6763856
1626 2585405341 2582581867 Bacteria 7184437
1627 2586209654 2585427687 Bacteria 5544917
1628 2599358158 2599185160 Bacteria 6844013
1629 2599383323 2599185164 Bacteria 6841688
1630 2599389770 2599185165 Bacteria 6843250
1631 2599464973 2599185181 Bacteria 6844519
1632 2599479134 2599185184 Bacteria 6430550
1633 2599482006 2599185184 Bacteria 6430550
1634 2599494112 2599185186 Bacteria 6831633
1635 2599723275 2599185236 Bacteria 6875203
1636 2600217705 2599185356 Bacteria 6843884
1637 2601534840 2600255256 Bacteria 5597742
1638 2601539531 2600255257 Bacteria 5597196
1639 2601757881 2600255310 Bacteria 5600903
1640 2601764239 2600255311 Bacteria 5598766
1641 2601777872 2600255313 Bacteria 6842543
1642 2603637049 2602042046 Bacteria 5483348
1643 2609909831 2609459761 Bacteria 5513740
1644 2644038817 2643221605 Bacteria 4772303
1645 2644302900 2643221654 Bacteria 5273570
1646 2644683424 2643221725 Bacteria 5087956
1647 2712469400 2711768156 Bacteria 4471618
1648 2713478230 2711768613 Bacteria 11048459
1649 2722726212 2721755487 Bacteria 6357185
1650 2738728971 2738541278 Bacteria 9755573
1651 2738731588 2738541278 Bacteria 9755573
1652 2738756143 2738541283 Bacteria 7222293
1653 2738761306 2738541284 Bacteria 5199923
1654 2738763253 2738541284 Bacteria 5199923
1655 2738852403 2738541302 Bacteria 5944758
1656 2739304225 2738543023 Bacteria 6767879
1657 2739591474 2739367651 Bacteria 6359826
1658 2739615281 2739367656 Bacteria 5152243
1659 2739645512 2739367663 Bacteria 5040914
1660 2739645590 2739367663 Bacteria 5040914
1661 2740033392 2739367866 Bacteria 4215900
1662 2756677029 2756170246 Bacteria 7451806
1663 2776616182 2775506987 Bacteria 5373360
1664 2792310330 2791355010 Bacteria 4864581
1665 2792833043 2791355137 Bacteria 9654227
1666 2793404909 2791355275 Bacteria 4429597
1667 2802652694 2802428842 Bacteria 4926114
1668 2813728059 2811995292 Bacteria 5303342
1669 2814695614 2814123068 Bacteria 5687681
1670 2817263401 2816332253 Bacteria 6764532
1671 2817276779 2816332256 Bacteria 6891714
1672 2817452852 2816332286 Bacteria 6853759
1673 2819549520 2818991437 Bacteria 5805520
1674 2819574077 2818991442 Bacteria 8318214
1675 2819586371 2818991444 Bacteria 6968812
1676 2819619657 2818991450 Bacteria 6962147
1677 2819681555 2818991460 Bacteria 7595395
1678 2821137396 2821136567 Bacteria 8080116
1679 2821140729 2821136567 Bacteria 8080116
1680 2835320254 2835312727 Bacteria 7413381
1681 2839991510 2839989709 Bacteria 3773432
1682 2840678446 2840677318 Bacteria 2664183
1683 2842908268 2842903701 Bacteria 6986368
1684 2842908667 2842903701 Bacteria 6986368
1685 2846038048 2846037992 Bacteria 4526407
1686 2849286615 2849281842 Bacteria 6065644
1687 2852625536 2852623160 Bacteria 4376875
1688 2852630623 2852627209 Bacteria 5896285
1689 2856289163 2856287931 Bacteria 7223934
1690 2857363466 2857357740 Bacteria 9937880
1691 2857631587 2857627736 Bacteria 5625397
1692 2857632424 2857627736 Bacteria 5625397
1693 2858690602 2858688981 Bacteria 8184122
1694 2869166330 2869162929 Bacteria 6399702
1695 2876365311 2876363079 Bacteria 6544991
1696 2881101154 2881101125 Bacteria 4590519
1697 2883071363 2883068021 Bacteria 6192739
1698 2884792474 2884791551 Bacteria 8511252
1699 2884796383 2884791551 Bacteria 8511252
1700 2884934540 2884933994 Bacteria 4535041
1701 2885277216 2885270888 Bacteria 9831543
1702 2888349984 2888343758 Bacteria 6611049
1703 2890740545 2890737413 Bacteria 4269751
1704 2891637063 2891633521 Bacteria 4602265
1705 2895523354 2895522137 Bacteria 3284416
1706 2896086263 2896085136 Bacteria 6129793
1707 2896089148 2896085136 Bacteria 6129793
1708 2896110263 2896109856 Bacteria 7140722
1709 2896113478 2896109856 Bacteria 7140722
1710 2898796440 2898795034 Bacteria 4294459
1711 2903523663 2903521522 Bacteria 6525694
1712 2903529962 2903528002 Bacteria 6586099
1713 2904445304 2904445276 Bacteria 5310396
1714 2904467863 2904467357 Bacteria 8057758
1715 2904471231 2904467357 Bacteria 8057758
1716 2904618851 2904615490 Bacteria 10047340
1717 2904782822 2904780799 Bacteria 5840761
1718 2910246547 2910245624 Bacteria 6935613
1719 2911139402 2911138879 Bacteria 5811561
1720 2919180433 2919177583 Bacteria 5641607
1721 2919190583 2919186247 Bacteria 6244071
1722 2919438235 2919437846 Bacteria 6199444
1723 2919440547 2919437846 Bacteria 6199444
1724 2919688631 2919688452 Bacteria 4595932
1725 2921643673 2921643360 Bacteria 11448031
1726 2928082115 2928078545 Bacteria 6534839
1727 2928082551 2928078545 Bacteria 6534839
1728 2928104519 2928100450 Bacteria 4837635
1729 2928148861 2928147474 Bacteria 6512076
1730 2928149307 2928147474 Bacteria 6512076
1731 2929155156 2929154850 Bacteria 6753285
1732 2929159936 2929154850 Bacteria 6753285
1733 2929179121 2929177148 Bacteria 7883697
1734 2929241723 2929239360 Bacteria 7745570
1735 2929243993 2929239360 Bacteria 7745570
1736 2929923662 2929921140 Bacteria 8649150
1737 2932086347 2932082852 Bacteria 6563563
1738 2932087957 2932082852 Bacteria 6563563
1739 2935625940 2935625433 Bacteria 5042964
1740 2939575129 2939573065 Bacteria 4926053
1741 2939577838 2939573065 Bacteria 4926053
1742 2939618310 2939617950 Bacteria 4820956
1743 2939669207 2939664404 Bacteria 6364494
1744 2945877036 2945874760 Bacteria 5527237
1745 2945981521 2945977869 Bacteria 7777518
1746 2946019073 2946013367 Bacteria 7766675
1747 2954020846 2954016120 Bacteria 6446024
1748 2958119968 2958115193 Bacteria 6923548
1749 2963650913 2963644680 Bacteria 6530403
1750 2974439101 2974435778 Bacteria 4876478
1751 2977233768 2977232053 Bacteria 5485925
1752 2977271209 2977268062 Bacteria 5243061
1753 2977990060 2977986579 Bacteria 6581278
1754 2984559212 2984555340 Bacteria 4247089
1755 2993359865 2993356040 Bacteria 4247105
1756 3003235921 3003233435 Bacteria 4458031
1757 637077912 637000159 Bacteria 7596297
1758 642594261 642555112 Bacteria 8676562
1759 8001524284 8001522603 Bacteria 4726425
1760 8002291396 8002285264 Bacteria 6717907
1761 8003155203 8003151029 Bacteria 8187759
1762 8004705220 8004703790 Bacteria 8006957
1763 8019505353 8019504834 Bacteria 4819156
1764 8020810562 8020807995 Bacteria 6801506
1765 8040176311 8040173305 Bacteria 6827067
1766 8055819702 8055817908 Bacteria 6609162
1767 Ga0307517_10000447
1768 RicEn_C1960
1769 SwRhRL2b_contig_1771167
1770 SwRhRL2b_contig_3310149
1771 SwRhRL2b_contig_385312
1772 SwRhRL2b_contig_830811
1773 JGI24736J21556_1000689
1774 JGI24736J21556_1002055
1775 JGI24740J21852_10000688
1776 JGI24740J21852_10002889
1777 JGI24740J21852_10014200
1778 JGI24739J22299_10000054
1779 JGI24739J22299_10001392
1780 JGI24739J22299_10001561
1781 JGI24739J22299_10029986
1782 JGI24737J22298_10000351
1783 JGI24737J22298_10000774
1784 JGI24737J22298_10011000
1785 JGI24737J22298_10014675
1786 JGI24735J21928_10000009
1787 JGI24735J21928_10000015
1788 JGI24735J21928_10001420
1789 JGI24744J21845_10005103
1790 JGI24744J21845_10010143
1791 JGI25162J39368_1000016
1792 JGI25162J39368_1000120
1793 JGI25162J39368_1001488
1794 JGI25154J39366_1000003
1795 JGI25154J39366_1000014
1796 JGI25157J39369_1002726
1797 JGI25157J39369_1003748
1798 JGI25152J39213_1000253
1799 JGI25152J39213_1000916
1800 JGI25150J39212_1000186
1801 JGI25159J45721_1004095
1802 JGI25151J46595_10000543
1803 JGI25151J46595_10000614
1804 JGI25151J46595_10001047
1805 JGI25165J46597_1000989
1806 JGI25153J46596_10000323
1807 JGI25153J46596_10000539
1808 JGI25153J46596_10002851
1809 rootH1_10032125
1810 rootH2_10007289
1811 rootH2_10008034
1812 rootH2_10012859
1813 rootH2_10017110
1814 rootH2_10021200
1815 rootH2_10036622
1816 rootH2_10135448
1817 rootL2_10000040
1818 rootL2_10005069
1819 rootL2_10005267
1820 rootL2_10059365
1821 rootL2_10099365
1822 rootH1_10000940
1823 rootH1_10004759
1824 rootH1_10008851
1825 rootH1_10010201
1826 rootH1_10012646
1827 rootH1_10013602
1828 rootH1_10026775
1829 rootH1_10042727
1830 rootH1_10075611
1831 rootH1_10131898
1832 rootH1_10278347
1833 JGI25160J50197_1000130
1834 JGI25160J50197_1000175
1835 JGI25160J50197_1000320
1836 JGI25160J50197_1004550
1837 JGI25160J50197_1006527
1838 JGI25160J50197_1016140
1839 Ga0007417J51691_1008595
1840 Ga0007409J51694_1008960
1841 Ga0007416J51690_1007087
1842 Ga0032354_1016447
1843 Ga0055532_1000181
1844 Ga0055525_1000004
1845 Ga0055527_1000141
1846 Ga0055535_1000285
1847 Ga0055535_1010640
1848 Ga0055542_1002369
1849 Ga0055529_1001935
1850 Ga0055526_1000270
1851 Ga0055526_1001579
1852 Ga0055526_1002277
1853 Ga0055526_1002922
1854 Ga0055526_1003259
1855 Ga0055537_1002383
1856 Ga0055524_1000196
1857 Ga0055536_1000002
1858 Ga0055536_1000163
1859 Ga0055536_1012977
1860 Ga0055534_1000270
1861 Ga0055534_1000368
1862 Ga0055534_1000395
1863 Ga0055528_1000108
1864 Ga0055528_1001425
1865 Ga0055530_10000183
1866 Ga0055530_10000279
1867 Ga0055530_10001816
1868 Ga0055531_10000091
1869 Ga0055531_10000093
1870 Ga0058692_1002767
1871 Ga0055543_1003562
1872 Ga0055543_1012700
1873 Ga0058862_10125298
1874 Ga0065165_1000019
1875 Ga0065165_1000036
1876 Ga0065165_1000104
1877 Ga0065165_1000424
1878 Ga0065165_1000572
1879 Ga0065165_1012476
1880 Ga0065165_1013267
1881 Ga0065165_1031014
1882 Ga0065714_10003570
1883 Ga0065714_10064439
1884 Ga0065714_10065908
1885 Ga0065714_10073910
1886 Ga0065714_10076440
1887 Ga0065714_10081275
1888 Ga0065714_10085472
1889 Ga0065714_10086930
1890 Ga0065714_10108618
1891 Ga0065704_10000226
1892 Ga0065704_10000526
1893 Ga0065704_10001507
1894 Ga0065704_10007283
1895 Ga0065704_10071143
1896 Ga0065704_10081932
1897 Ga0065704_10085422
1898 Ga0065712_10176322
1899 Ga0070658_10000008
1900 Ga0070658_10000011
1901 Ga0070658_10008754
1902 Ga0070658_10011667
1903 Ga0070658_10101967
1904 Ga0070676_10000571
1905 Ga0070676_10001016
1906 Ga0070676_10043231
1907 Ga0070683_100000971
1908 Ga0070683_100106205
1909 Ga0070683_100276353
1910 Ga0070670_100072469
1911 Ga0068869_100010053
1912 Ga0068869_100017619
1913 Ga0068869_100135191
1914 Ga0070666_10000197
1915 Ga0070666_10002958
1916 Ga0070680_100013718
1917 Ga0070680_100035380
1918 Ga0070682_100053013
1919 Ga0068868_100000524
1920 Ga0068868_100005736
1921 Ga0068868_100018853
1922 Ga0068868_100037934
1923 Ga0068868_100054044
1924 Ga0068868_100081438
1925 Ga0068868_100195140
1926 Ga0070660_100029313
1927 Ga0070689_100004044
1928 Ga0070691_10004047
1929 Ga0070691_10006306
1930 Ga0070691_10041547
1931 Ga0070661_100014545
1932 Ga0070668_100005980
1933 Ga0070669_100022298
1934 Ga0070671_100009462
1935 Ga0070671_100018462
1936 Ga0070671_100042635
1937 Ga0070671_100049295
1938 Ga0070671_100069251
1939 Ga0070674_100260931
1940 Ga0070673_100005895
1941 Ga0070673_100011099
1942 Ga0070673_100016838
1943 Ga0070688_100033676
1944 Ga0070688_100069521
1945 Ga0070659_100002370
1946 Ga0070659_100002879
1947 Ga0070659_100034879
1948 Ga0070659_100056904
1949 Ga0070667_100000240
1950 Ga0070667_100022276
1951 Ga0070667_100039396
1952 Ga0070667_100084008
1953 Ga0070667_100169440
1954 Ga0070667_100188948
1955 Ga0070714_100024740
1956 Ga0070713_100129949
1957 Ga0070694_100026790
1958 Ga0070663_100010774
1959 Ga0070663_100039901
1960 Ga0070663_100047975
1961 Ga0070678_100003871
1962 Ga0070678_100053372
1963 Ga0070678_100090896
1964 Ga0070678_100110301
1965 Ga0070662_100000863
1966 Ga0070662_100002459
1967 Ga0070662_100003891
1968 Ga0070662_100004308
1969 Ga0070662_100006048
1970 Ga0070662_100026442
1971 Ga0070662_100088759
1972 Ga0070681_10000494
1973 Ga0070681_10023463
1974 Ga0068867_100000252
1975 Ga0068867_100009548
1976 Ga0068867_100080400
1977 Ga0070685_10018108
1978 Ga0070707_100051113
1979 Ga0070699_100015745
1980 Ga0070679_100033325
1981 Ga0070679_100034856
1982 Ga0070679_100099526
1983 Ga0070679_100158664
1984 Ga0070684_100000433
1985 Ga0070684_100020672
1986 Ga0070684_100049610
1987 Ga0070684_100068460
1988 Ga0070684_100200126
1989 Ga0070684_100227562
1990 Ga0068853_100001703
1991 Ga0068853_100009975
1992 Ga0068853_100010094
1993 Ga0068853_100015336
1994 Ga0068853_100043110
1995 Ga0068853_100094463
1996 Ga0068853_100127500
1997 Ga0068853_100128557
1998 Ga0068853_100207544
1999 Ga0070672_100038128
2000 Ga0070672_100234348
2001 Ga0070686_100018814
2002 Ga0070696_100001233
2003 Ga0070696_100095662
2004 Ga0070693_100013488
2005 Ga0070665_100000003
2006 Ga0070665_100000014
2007 Ga0070665_100000061
2008 Ga0070665_100008147
2009 Ga0070665_100010319
2010 Ga0070665_100038251
2011 Ga0070665_100157143
2012 Ga0070665_100177025
2013 Ga0070665_100328831
2014 Ga0068855_100000019
2015 Ga0068855_100000041
2016 Ga0068855_100000108
2017 Ga0068855_100000130
2018 Ga0068855_100000299
2019 Ga0068855_100000916
2020 Ga0068855_100001186
2021 Ga0068855_100002648
2022 Ga0068855_100003330
2023 Ga0068855_100004660
2024 Ga0068855_100006690
2025 Ga0068855_100009523
2026 Ga0068855_100030687
2027 Ga0068855_100041488
2028 Ga0068855_100044948
2029 Ga0068855_100068313
2030 Ga0068855_100070732
2031 Ga0068855_100118288
2032 Ga0068855_100122693
2033 Ga0068855_100189645
2034 Ga0068855_100215430
2035 Ga0068855_100385174
2036 Ga0070664_100006889
2037 Ga0068857_100011323
2038 Ga0068857_100043217
2039 Ga0068857_100061223
2040 Ga0068857_100313493
2041 Ga0068857_100363916
2042 Ga0068854_100060109
2043 Ga0068856_100000112
2044 Ga0068856_100011222
2045 Ga0068856_100018206
2046 Ga0068856_100034242
2047 Ga0068856_100036531
2048 Ga0068856_100036715
2049 Ga0068856_100056668
2050 Ga0068856_100057187
2051 Ga0068856_100153146
2052 Ga0068856_100202555
2053 Ga0068856_100228394
2054 Ga0068856_100283235
2055 Ga0070702_100041211
2056 Ga0068852_100000226
2057 Ga0068852_100003319
2058 Ga0068852_100003809
2059 Ga0068852_100012764
2060 Ga0068852_100033957
2061 Ga0068852_100066244
2062 Ga0068852_100089443
2063 Ga0068852_100215661
2064 Ga0068852_100320170
2065 Ga0068859_100000007
2066 Ga0068859_100115887
2067 Ga0068864_100027557
2068 Ga0068866_10006035
2069 Ga0068866_10148594
2070 Ga0068861_100080306
2071 Ga0068851_10069582
2072 Ga0068863_100000444
2073 Ga0068863_100087667
2074 Ga0068863_100407023
2075 Ga0068858_100002218
2076 Ga0068858_100048943
2077 Ga0068858_100132461
2078 Ga0068858_100329084
2079 Ga0068860_100000061
2080 Ga0068860_100000494
2081 Ga0068860_100000661
2082 Ga0068860_100006071
2083 Ga0068860_100032987
2084 Ga0068862_100406403
2085 Ga0081455_10004385
2086 Ga0081540_1043235
2087 Ga0075365_10145160
2088 Ga0075364_10000388
2089 Ga0075432_10000392
2090 Ga0075366_10000031
2091 Ga0075366_10000170
2092 Ga0075366_10000799
2093 Ga0075366_10003200
2094 Ga0075366_10009736
2095 Ga0075366_10103513
2096 Ga0075366_10110043
2097 Ga0075366_10131069
2098 Ga0097621_100000016
2099 Ga0097621_100000033
2100 Ga0097621_100000465
2101 Ga0097621_100007122
2102 Ga0097621_100007495
2103 Ga0097621_100048113
2104 Ga0097621_100099323
2105 Ga0075370_10004929
2106 Ga0075370_10011195
2107 Ga0075370_10054237
2108 Ga0075370_10079363
2109 Ga0075370_10115074
2110 Ga0068871_100000020
2111 Ga0068871_100000504
2112 Ga0068871_100001644
2113 Ga0068871_100045957
2114 Ga0068871_100051456
2115 Ga0068871_100122108
2116 Ga0068871_100163692
2117 Ga0068871_100240982
2118 Ga0068871_100291083
2119 Ga0075428_100037054
2120 Ga0075430_100013674
2121 Ga0075430_100016236
2122 Ga0075431_100021229
2123 Ga0075431_100034030
2124 Ga0075429_100005261
2125 Ga0075429_100019573
2126 Ga0068865_100000048
2127 Ga0068865_100000214
2128 Ga0068865_100004575
2129 Ga0068865_100233495
2130 Ga0097620_100000007
2131 Ga0097620_100115887
2132 Ga0079104_1000018
2133 Ga0079104_1000282
2134 Ga0099794_10103848
2135 Ga0105251_10000591
2136 Ga0105251_10060439
2137 Ga0105244_10006930
2138 Ga0105250_10002931
2139 Ga0105240_10000082
2140 Ga0105240_10000173
2141 Ga0105240_10000198
2142 Ga0105240_10001981
2143 Ga0105240_10004434
2144 Ga0105240_10008014
2145 Ga0105240_10013347
2146 Ga0105240_10013834
2147 Ga0105240_10017264
2148 Ga0105240_10022637
2149 Ga0105240_10026991
2150 Ga0105240_10032466
2151 Ga0105240_10034852
2152 Ga0105240_10049536
2153 Ga0105240_10055196
2154 Ga0105240_10065857
2155 Ga0105240_10070449
2156 Ga0105240_10074083
2157 Ga0105240_10076056
2158 Ga0105240_10091437
2159 Ga0105240_10099167
2160 Ga0105240_10118557
2161 Ga0105240_10119814
2162 Ga0105240_10155021
2163 Ga0105240_10156874
2164 Ga0105240_10174228
2165 Ga0105240_10255333
2166 Ga0111539_10016524
2167 Ga0111539_10053178
2168 Ga0111539_10101972
2169 Ga0111539_10167990
2170 Ga0105245_10210122
2171 Ga0114129_10000629
2172 Ga0114129_10015902
2173 Ga0114129_10091477
2174 Ga0105243_10000009
2175 Ga0105241_10000116
2176 Ga0105241_10000137
2177 Ga0105241_10000424
2178 Ga0105241_10001206
2179 Ga0105241_10002469
2180 Ga0105241_10006651
2181 Ga0105241_10006947
2182 Ga0105241_10010211
2183 Ga0105241_10010456
2184 Ga0105241_10010715
2185 Ga0105241_10013333
2186 Ga0105241_10027864
2187 Ga0105241_10038039
2188 Ga0105241_10155470
2189 Ga0105242_10005456
2190 Ga0105242_10016702
2191 Ga0105242_10094916
2192 Ga0105242_10130963
2193 Ga0105248_10005045
2194 Ga0105248_10014314
2195 Ga0105248_10046051
2196 Ga0105248_10093590
2197 Ga0105237_10000179
2198 Ga0105237_10000310
2199 Ga0105237_10000409
2200 Ga0105237_10000577
2201 Ga0105237_10001131
2202 Ga0105237_10001142
2203 Ga0105237_10001258
2204 Ga0105237_10001360
2205 Ga0105237_10001901
2206 Ga0105237_10002517
2207 Ga0105237_10005617
2208 Ga0105237_10010415
2209 Ga0105237_10013208
2210 Ga0105237_10014892
2211 Ga0105237_10018071
2212 Ga0105237_10033601
2213 Ga0105237_10035348
2214 Ga0105237_10035767
2215 Ga0105237_10064828
2216 Ga0105237_10071114
2217 Ga0105237_10071256
2218 Ga0105237_10099233
2219 Ga0105237_10196939
2220 Ga0105237_10228781
2221 Ga0105237_10314973
2222 Ga0105238_10007301
2223 Ga0105238_10029586
2224 Ga0105238_10031475
2225 Ga0105238_10034403
2226 Ga0105238_10385003
2227 Ga0105249_10007158
2228 Ga0105239_10000019
2229 Ga0105239_10000049
2230 Ga0105239_10000166
2231 Ga0105239_10000343
2232 Ga0105239_10000659
2233 Ga0105239_10000740
2234 Ga0105239_10000775
2235 Ga0105239_10001138
2236 Ga0105239_10001606
2237 Ga0105239_10003303
2238 Ga0105239_10012560
2239 Ga0105239_10014720
2240 Ga0105239_10014750
2241 Ga0105239_10018759
2242 Ga0105239_10026647
2243 Ga0105239_10041485
2244 Ga0105239_10042514
2245 Ga0105239_10042888
2246 Ga0105239_10070201
2247 Ga0105239_10084016
2248 Ga0105239_10193270
2249 Ga0105239_10207040
2250 Ga0105239_10210210
2251 Ga0105239_10221669
2252 Ga0105239_10309453
2253 Ga0105239_10468959
2254 Ga0105239_10507178
2255 Ga0105246_10013710
2256 Ga0105246_10027150
2257 Ga0105246_10067458
2258 Ga0157373_10000161
2259 Ga0157373_10000387
2260 Ga0157373_10000448
2261 Ga0157373_10004564
2262 Ga0157373_10006319
2263 Ga0157373_10032170
2264 Ga0157373_10041191
2265 Ga0157373_10052973
2266 Ga0157373_10068421
2267 Ga0157373_10102025
2268 Ga0157373_10121421
2269 Ga0157371_10000137
2270 Ga0157371_10000511
2271 Ga0157371_10000970
2272 Ga0157371_10001238
2273 Ga0157371_10002079
2274 Ga0157371_10004326
2275 Ga0157371_10068028
2276 Ga0157371_10071936
2277 Ga0157371_10072875
2278 Ga0157371_10090083
2279 Ga0157371_10153455
2280 Ga0157370_10000552
2281 Ga0157370_10000637
2282 Ga0157370_10001009
2283 Ga0157370_10001243
2284 Ga0157370_10001385
2285 Ga0157370_10002121
2286 Ga0157370_10004343
2287 Ga0157370_10010926
2288 Ga0157370_10015818
2289 Ga0157370_10019842
2290 Ga0157370_10021999
2291 Ga0157370_10025587
2292 Ga0157370_10026367
2293 Ga0157370_10029536
2294 Ga0157370_10032396
2295 Ga0157370_10035465
2296 Ga0157370_10042833
2297 Ga0157370_10420524
2298 Ga0157369_10000594
2299 Ga0157369_10003620
2300 Ga0157369_10022085
2301 Ga0157369_10027638
2302 Ga0157369_10039027
2303 Ga0157369_10039512
2304 Ga0157369_10078743
2305 Ga0157369_10118483
2306 Ga0157369_10239218
2307 Ga0157369_10326797
2308 Ga0157374_10000011
2309 Ga0157374_10000034
2310 Ga0157374_10000427
2311 Ga0157374_10000642
2312 Ga0157374_10000918
2313 Ga0157374_10004749
2314 Ga0157374_10005742
2315 Ga0157374_10008935
2316 Ga0157374_10016485
2317 Ga0157378_10015365
2318 Ga0157378_10016768
2319 Ga0157378_10019641
2320 Ga0157378_10064382
2321 Ga0157378_10070763
2322 Ga0163162_10000012
2323 Ga0163162_10000058
2324 Ga0163162_10000151
2325 Ga0163162_10000406
2326 Ga0163162_10000763
2327 Ga0163162_10000782
2328 Ga0163162_10000827
2329 Ga0163162_10001117
2330 Ga0163162_10001444
2331 Ga0163162_10009940
2332 Ga0163162_10010911
2333 Ga0163162_10014906
2334 Ga0163162_10015925
2335 Ga0163162_10016270
2336 Ga0163162_10024996
2337 Ga0163162_10034656
2338 Ga0163162_10037543
2339 Ga0163162_10333232
2340 Ga0163162_10355565
2341 Ga0157372_10000039
2342 Ga0157372_10000241
2343 Ga0157372_10000298
2344 Ga0157372_10000439
2345 Ga0157372_10000691
2346 Ga0157372_10001390
2347 Ga0157372_10002911
2348 Ga0157372_10003323
2349 Ga0157372_10003342
2350 Ga0157372_10005914
2351 Ga0157372_10007944
2352 Ga0157372_10012766
2353 Ga0157372_10020545
2354 Ga0157372_10040394
2355 Ga0157372_10047807
2356 Ga0157372_10269330
2357 Ga0157372_10310923
2358 Ga0157372_10507766
2359 Ga0157375_10000911
2360 Ga0157375_10008429
2361 Ga0157375_10012275
2362 Ga0157375_10016156
2363 Ga0157375_10044269
2364 Ga0157375_10079382
2365 Ga0157375_10108117
2366 Ga0157375_10129740
2367 Ga0157375_10140014
2368 Ga0157375_10183352
2369 Ga0157375_10262083
2370 Ga0157375_10287131
2371 Ga0163163_10000215
2372 Ga0163163_10007541
2373 Ga0163163_10091197
2374 Ga0163163_10147104
2375 Ga0163163_10258598
2376 Ga0163163_10488291
2377 Ga0157380_10000019
2378 Ga0157380_10004165
2379 Ga0182008_10000022
2380 Ga0182008_10000369
2381 Ga0182008_10000531
2382 Ga0182008_10008958
2383 Ga0182008_10009453
2384 Ga0157377_10002912
2385 Ga0157379_10002102
2386 Ga0157379_10003291
2387 Ga0157379_10004097
2388 Ga0157379_10031917
2389 Ga0157379_10346239
2390 Ga0157376_10000216
2391 Ga0157376_10005885
2392 Ga0157376_10015107
2393 Ga0157376_10031544
2394 Ga0157376_10043996
2395 Ga0157376_10107882
2396 Ga0157376_10121935
2397 Ga0157376_10219781
2398 Ga0182006_1000018
2399 Ga0182006_1000108
2400 Ga0182006_1000360
2401 Ga0182006_1001134
2402 Ga0182006_1006041
2403 Ga0182007_10000024
2404 Ga0182007_10001080
2405 Ga0182007_10013772
2406 Ga0182005_1000039
2407 Ga0182005_1000159
2408 Ga0183373_1002
2409 Ga0183361_10026
2410 Ga0163161_10000094
2411 Ga0163161_10000151
2412 Ga0163161_10000337
2413 Ga0163161_10001005
2414 Ga0163161_10007027
2415 Ga0163161_10012307
2416 Ga0163161_10013189
2417 Ga0163161_10013362
2418 Ga0163161_10026859
2419 Ga0163161_10052860
2420 Ga0197907_10239113
2421 Ga0206356_10813215
2422 Ga0206356_11215947
2423 Ga0206349_1290235
2424 Ga0206349_1400312
2425 Ga0206351_10526408
2426 Ga0206352_10200773
2427 Ga0206352_10597293
2428 Ga0206350_11468347
2429 Ga0154015_1171474
2430 Ga0213872_10004354
2431 Ga0213872_10008741
2432 Ga0213876_10000034
2433 Ga0213871_10032870
2434 Ga0224712_10009051
2435 Ga0209436_100146
2436 Ga0209436_100384
2437 Ga0209672_100135
2438 Ga0209672_100205
2439 Ga0209147_100187
2440 Ga0209563_107204
2441 Ga0207427_100309
2442 Ga0209437_100048
2443 Ga0209437_100119
2444 Ga0209437_100143
2445 Ga0209258_100129
2446 Ga0209258_100145
2447 Ga0209258_100320
2448 Ga0207425_1000051
2449 Ga0209646_1000002
2450 Ga0209646_1000004
2451 Ga0209646_1001703
2452 Ga0209026_1000132
2453 Ga0209026_1000178
2454 Ga0209026_1000463
2455 Ga0209026_1000753
2456 Ga0209026_1001439
2457 Ga0209026_1001474
2458 Ga0209026_1002731
2459 Ga0209148_1000177
2460 Ga0209148_1000477
2461 Ga0209759_1019981
2462 Ga0209129_1000077
2463 Ga0209129_1000395
2464 Ga0209129_1005440
2465 Ga0209129_1008773
2466 Ga0209233_1000029
2467 Ga0209233_1001087
2468 Ga0209565_1000368
2469 Ga0209455_1000291
2470 Ga0209455_1001556
2471 Ga0209455_1003124
2472 Ga0209673_1000183
2473 Ga0209673_1000483
2474 Ga0209673_1014060
2475 Ga0209130_1003186
2476 Ga0209130_1004353
2477 Ga0209675_1000070
2478 Ga0209675_1000092
2479 Ga0209675_1000383
2480 Ga0209676_1000022
2481 Ga0209676_1000480
2482 Ga0209676_1000587
2483 Ga0209676_1001144
2484 Ga0209025_1000160
2485 Ga0209025_1000628
2486 Ga0209025_1001088
2487 Ga0209564_1000380
2488 Ga0209564_1000497
2489 Ga0209564_1000561
2490 Ga0209564_1000848
2491 Ga0209564_1000882
2492 Ga0209564_1006913
2493 Ga0209564_1017925
2494 Ga0209564_1019370
2495 Ga0209758_1000147
2496 Ga0209758_1000912
2497 Ga0209758_1001298
2498 Ga0209758_1006687
2499 Ga0209758_1023027
2500 Ga0209050_1000020
2501 Ga0209050_1000160
2502 Ga0209050_1000879
2503 Ga0209256_1000059
2504 Ga0207426_1000033
2505 Ga0207426_1000037
2506 Ga0207426_1000051
2507 Ga0207426_1000104
2508 Ga0207426_1000360
2509 Ga0207426_1000681
2510 Ga0207426_1000904
2511 Ga0207426_1001364
2512 Ga0207426_1001887
2513 Ga0207426_1005820
2514 Ga0209051_1005127
2515 Ga0209257_1000001
2516 Ga0209257_1000006
2517 Ga0209257_1001540
2518 Ga0209257_1013542
2519 Ga0207656_10018488
2520 Ga0207696_1000053
2521 Ga0207713_1000124
2522 Ga0207680_10000177
2523 Ga0207680_10001858
2524 Ga0207680_10066260
2525 Ga0207647_10000018
2526 Ga0207647_10000256
2527 Ga0207647_10000761
2528 Ga0207647_10008403
2529 Ga0207647_10021677
2530 Ga0207647_10061409
2531 Ga0207647_10064599
2532 Ga0207647_10170934
2533 Ga0207645_10000172
2534 Ga0207645_10001507
2535 Ga0207645_10015742
2536 Ga0207645_10043803
2537 Ga0207645_10082486
2538 Ga0207645_10143044
2539 Ga0207705_10000015
2540 Ga0207705_10000035
2541 Ga0207705_10014374
2542 Ga0207705_10019160
2543 Ga0207705_10069946
2544 Ga0207654_10002002
2545 Ga0207654_10005471
2546 Ga0207654_10007056
2547 Ga0207654_10007062
2548 Ga0207654_10009147
2549 Ga0207654_10048805
2550 Ga0207654_10113827
2551 Ga0207654_10126344
2552 Ga0207654_10131425
2553 Ga0207707_10014259
2554 Ga0207707_10106546
2555 Ga0207695_10000053
2556 Ga0207695_10000060
2557 Ga0207695_10000212
2558 Ga0207695_10000276
2559 Ga0207695_10000313
2560 Ga0207695_10000346
2561 Ga0207695_10000797
2562 Ga0207695_10002702
2563 Ga0207695_10003291
2564 Ga0207695_10009664
2565 Ga0207695_10011959
2566 Ga0207695_10013946
2567 Ga0207695_10016403
2568 Ga0207695_10019413
2569 Ga0207695_10031895
2570 Ga0207695_10036487
2571 Ga0207695_10036596
2572 Ga0207695_10043620
2573 Ga0207695_10050530
2574 Ga0207695_10057323
2575 Ga0207695_10084279
2576 Ga0207695_10145181
2577 Ga0207695_10253318
2578 Ga0207695_10263354
2579 Ga0207671_10000366
2580 Ga0207671_10000402
2581 Ga0207671_10000987
2582 Ga0207671_10001317
2583 Ga0207671_10001776
2584 Ga0207671_10002743
2585 Ga0207671_10002977
2586 Ga0207671_10003165
2587 Ga0207671_10003926
2588 Ga0207671_10004651
2589 Ga0207671_10006511
2590 Ga0207671_10007415
2591 Ga0207671_10008823
2592 Ga0207671_10011907
2593 Ga0207671_10012752
2594 Ga0207671_10013351
2595 Ga0207671_10014991
2596 Ga0207671_10016271
2597 Ga0207671_10030252
2598 Ga0207671_10060246
2599 Ga0207671_10078303
2600 Ga0207671_10079920
2601 Ga0207660_10007400
2602 Ga0207657_10030704
2603 Ga0207657_10087727
2604 Ga0207657_10132526
2605 Ga0207649_10002116
2606 Ga0207649_10158694
2607 Ga0207652_10032151
2608 Ga0207652_10090893
2609 Ga0207652_10122743
2610 Ga0207652_10124777
2611 Ga0207652_10446331
2612 Ga0207646_10275168
2613 Ga0207694_10006626
2614 Ga0207694_10020764
2615 Ga0207694_10037765
2616 Ga0207694_10057179
2617 Ga0207694_10085662
2618 Ga0207650_10043496
2619 Ga0207659_10037293
2620 Ga0207687_10132380
2621 Ga0207700_10115822
2622 Ga0207644_10004990
2623 Ga0207644_10031025
2624 Ga0207644_10078531
2625 Ga0207644_10130032
2626 Ga0207690_10000253
2627 Ga0207690_10022000
2628 Ga0207690_10113539
2629 Ga0207706_10000013
2630 Ga0207706_10000646
2631 Ga0207706_10002185
2632 Ga0207706_10002489
2633 Ga0207706_10007739
2634 Ga0207706_10044505
2635 Ga0207686_10056620
2636 Ga0207686_10097721
2637 Ga0207709_10000026
2638 Ga0207670_10003877
2639 Ga0207704_10000094
2640 Ga0207704_10000354
2641 Ga0207704_10020620
2642 Ga0207691_10007032
2643 Ga0207691_10065691
2644 Ga0207711_10003663
2645 Ga0207689_10003255
2646 Ga0207689_10034678
2647 Ga0207661_10005203
2648 Ga0207661_10010722
2649 Ga0207679_10000915
2650 Ga0207667_10000020
2651 Ga0207667_10000274
2652 Ga0207667_10000394
2653 Ga0207667_10000414
2654 Ga0207667_10000597
2655 Ga0207667_10001034
2656 Ga0207667_10003766
2657 Ga0207667_10005885
2658 Ga0207667_10006159
2659 Ga0207667_10011198
2660 Ga0207667_10011442
2661 Ga0207667_10012737
2662 Ga0207667_10019599
2663 Ga0207667_10030965
2664 Ga0207667_10036938
2665 Ga0207667_10038904
2666 Ga0207667_10040451
2667 Ga0207667_10048241
2668 Ga0207667_10069970
2669 Ga0207667_10091554
2670 Ga0207667_10116630
2671 Ga0207667_10135296
2672 Ga0207667_10198302
2673 Ga0207667_10246734
2674 Ga0207667_10277004
2675 Ga0207651_10003979
2676 Ga0207651_10022953
2677 Ga0207712_10003067
2678 Ga0207640_10051724
2679 Ga0207640_10079304
2680 Ga0207640_10118303
2681 Ga0207658_10028460
2682 Ga0207658_10041566
2683 Ga0207658_10042617
2684 Ga0207658_10126200
2685 Ga0207677_10058309
2686 Ga0207703_10009385
2687 Ga0207703_10031728
2688 Ga0207639_10008408
2689 Ga0207639_10015099
2690 Ga0207639_10015873
2691 Ga0207639_10021989
2692 Ga0207639_10066764
2693 Ga0207639_10132897
2694 Ga0207639_10346100
2695 Ga0207678_10000115
2696 Ga0207678_10033705
2697 Ga0207678_10065348
2698 Ga0207678_10098019
2699 Ga0207678_10115568
2700 Ga0207702_10000223
2701 Ga0207702_10000278
2702 Ga0207702_10010340
2703 Ga0207702_10026381
2704 Ga0207702_10044099
2705 Ga0207702_10055284
2706 Ga0207702_10073026
2707 Ga0207702_10106833
2708 Ga0207702_10120895
2709 Ga0207702_10122639
2710 Ga0207702_10147581
2711 Ga0207702_10255378
2712 Ga0207702_10286576
2713 Ga0207641_10000090
2714 Ga0207641_10224369
2715 Ga0207641_10314318
2716 Ga0207641_10378529
2717 Ga0207641_10424194
2718 Ga0207648_10000081
2719 Ga0207648_10000307
2720 Ga0207648_10014112
2721 Ga0207648_10065581
2722 Ga0207648_10089865
2723 Ga0207676_10007606
2724 Ga0207676_10008833
2725 Ga0207676_10060106
2726 Ga0207674_10003090
2727 Ga0207674_10007260
2728 Ga0207674_10014469
2729 Ga0207674_10119057
2730 Ga0207674_10365954
2731 Ga0207675_100009737
2732 Ga0207683_10009701
2733 Ga0207683_10023168
2734 Ga0207683_10027808
2735 Ga0207683_10077563
2736 Ga0207683_10089229
2737 Ga0207698_10001331
2738 Ga0207698_10002895
2739 Ga0207698_10007919
2740 Ga0207698_10032367
2741 Ga0207698_10058884
2742 Ga0207698_10075410
2743 Ga0207698_10164250
2744 Ga0207698_10205885
2745 Ga0207698_10320444
2746 Ga0209281_1000014
2747 Ga0209281_1000257
2748 Ga0209371_1000002
2749 Ga0209371_1000015
2750 Ga0209970_1002110
2751 Ga0207428_10094128
2752 Ga0265354_1003144
2753 Ga0268266_10000052
2754 Ga0268266_10000053
2755 Ga0268266_10000068
2756 Ga0268266_10006444
2757 Ga0268266_10054246
2758 Ga0268266_10084381
2759 Ga0268266_10131819
2760 Ga0268266_10136815
2761 Ga0268266_10244818
2762 Ga0268265_10029603
2763 Ga0268264_10000079
2764 Ga0268264_10000517
2765 Ga0268264_10004288
2766 Ga0268264_10023200
2767 Ga0268264_10047692
2768 Ga0265334_10000965
2769 Ga0265318_10015182
2770 Ga0307517_10002947
2771 Ga0307515_10000078
2772 Ga0307515_10000290
2773 Ga0307515_10000316
2774 Ga0307515_10001308
2775 Ga0307515_10002255
2776 Ga0307515_10003180
2777 Ga0307515_10005687
2778 Ga0307515_10006021
2779 Ga0307515_10011199
2780 Ga0307515_10041765
2781 Ga0307515_10293472
2782 Ga0265338_10009682
2783 Ga0265338_10026234
2784 Ga0265338_10120944
2785 Ga0265338_10248223
2786 Ga0265324_10018052
2787 Ga0268256_1000002
2788 Ga0268256_1000018
2789 Ga0307511_10002426
2790 Ga0316177_1092983
2791 Ga0316176_1008738
2792 Ga0316183_1033300
2793 Ga0316181_1035519
2794 Ga0316182_1061293
2795 Ga0265325_10056010
2796 Ga0265331_10010586
2797 Ga0265331_10012971
2798 Ga0265327_10000283
2799 Ga0265327_10010964
2800 Ga0265327_10107237
2801 Ga0265316_10124755
2802 Ga0265316_10251951
2803 Ga0307513_10092041
2804 Ga0307509_10014794
2805 Ga0307509_10019232
2806 Ga0307509_10025814
2807 Ga0307509_10221424
2808 Ga0307408_100000035
2809 Ga0307408_100000468
2810 Ga0307408_100004638
2811 Ga0307408_100004866
2812 Ga0307408_100006865
2813 Ga0265313_10029396
2814 Ga0307508_10000123
2815 Ga0265342_10024105
2816 Ga0307516_10022679
2817 Ga0307516_10111009
2818 Ga0307405_10003512
2819 Ga0307413_10008054
2820 Ga0307413_10030828
2821 Ga0307410_10005100
2822 Ga0307406_10000127
2823 Ga0307406_10000193
2824 Ga0307406_10003065
2825 Ga0307406_10008797
2826 Ga0307407_10000163
2827 Ga0307407_10010668
2828 Ga0307412_10000001
2829 Ga0307412_10041210
2830 Ga0307412_10190096
2831 Ga0307409_100000039
2832 Ga0307409_100008002
2833 Ga0307409_100009599
2834 Ga0307409_100015145
2835 Ga0307409_100025308
2836 Ga0307416_100000050
2837 Ga0307416_100000054
2838 Ga0307416_100033586
2839 Ga0307416_100061955
2840 Ga0307414_10000074
2841 Ga0307414_10001174
2842 Ga0307414_10002273
2843 Ga0307414_10006497
2844 Ga0307414_10009537
2845 Ga0307414_10014424
2846 Ga0307414_10019606
2847 Ga0307414_10029263
2848 Ga0307414_10039907
2849 Ga0307414_10072171
2850 Ga0307414_10075590
2851 Ga0307414_10166772
2852 Ga0307414_10221589
2853 Ga0307414_10264903
2854 Ga0307414_10282629
2855 Ga0307411_10001193
2856 Ga0307411_10004116
2857 Ga0307411_10014649
2858 Ga0307415_100000659
2859 Ga0307415_100016006
2860 Ga0307507_10000032
2861 Ga0307507_10000337
2862 Ga0307510_10000774
2863 Ga0373953_0016898
2864 Ga0373927_0024612
2865 Ga0373933_0032011
2866 Ga0373937_0005416
2867 Ga0373937_0176034
2868 Ga0310110_011986
2869 Ga0395899_0000002
2870 Ga0395899_0000008
2871 Ga0395899_0000027
2872 Ga0395899_0000282
2873 Ga0395899_0000986
2874 Ga0395899_0001553
2875 Ga0395899_0002581
2876 Ga0395899_0007660
2877 Ga0395899_0023629
2878 Ga0395899_0049096
2879 Ga0395900_0000195
2880 Ga0395900_0000632
2881 Ga0395900_0001022
2882 Ga0395900_0001145
2883 Ga0395900_0002406
2884 Ga0395900_0002423
2885 Ga0395900_0089547
2886 Ga0395900_0264214
2887 Ga0395898_0000072
2888 Ga0395898_0007940
2889 Ga0395898_0009115
2890 Ga0395898_0013540
2891 Ga0395898_0030717
2892 Ga0395905_0000115
2893 Ga0395905_0000667
2894 Ga0395905_0001183
2895 Ga0395905_0001272
2896 Ga0395905_0002266
2897 Ga0395905_0002992
2898 Ga0395905_0003489
2899 Ga0395905_0016857
2900 Ga0395905_0017953
2901 Ga0395905_0023672
2902 Ga0395905_0174899
2903 Ga0395901_0000003
2904 Ga0395901_0000600
2905 Ga0395901_0000644
2906 Ga0395901_0002952
2907 Ga0395901_0154911
2908 Ga0395901_0180425
2909 Ga0400484_10965
2910 Ga0400490_19815
2911 Ga0400485_04164
2912 Ga0400486_17818
2913 Ga0400486_23005
2914 Ga0400483_181305
2915 Ga0400483_226464
2916 Ga0400489_17023
2917 Ga0400487_08555
2918 Ga0400487_33670
2919 Ga0436365_0965775
2920 Ga0436365_1777577
2921 Ga0436360_0204520
2922 Ga0436361_0246539
2923 Ga0436361_0324465
2924 Ga0436361_0434733
2925 Ga0436361_0468389
2926 Ga0436361_1126675
2927 Ga0436361_1202653
2928 Ga0439436_0012191
2929 Ga0439439_0037657
2930 Ga0451839_0925907
2931 Ga0451851_1126820
2932 Ga0439448_0002717
2933 Ga0439452_000002
2934 Ga0439452_000020
2935 Ga0439455_0000005
2936 Ga0439457_002931
2937 Ga0439462_0001872
2938 Ga0451577_0001858
2939 Ga0451577_0021656
2940 Ga0451577_0056657
2941 Ga0451577_0093008
2942 Ga0466969_0000072
2943 Ga0466969_0000836
2944 Ga0466969_0013340
2945 Ga0466969_0095624
2946 Ga0466972_0000166
2947 Ga0466972_0000433
2948 Ga0466972_0002124
2949 Ga0466972_0005460
2950 Ga0466972_0009300
2951 Ga0466972_0038480
2952 Ga0453683_0000054
2953 Ga0453683_0000112
2954 Ga0453683_0009980
2955 Ga0453683_0010198
2956 Ga0453683_0183508
2957 Ga0466965_0001104
2958 Ga0466965_0029997
2959 Ga0466965_0081925
2960 Ga0466965_0151229
2961 Ga0466966_0000047
2962 Ga0466966_0000055
2963 Ga0466966_0000323
2964 Ga0466966_0055559
2965 Ga0466961_0000288
2966 Ga0466961_0068518
2967 Ga0466964_0037363
2968 Ga0466964_0103879
2969 Ga0453684_0000206
2970 Ga0453684_0000273
2971 Ga0453684_0004800
2972 Ga0453684_0006454
2973 Ga0453684_0008233
2974 Ga0453684_0018008
2975 Ga0453684_0021215
2976 Ga0453684_0099837
2977 Ga0453684_0112056
2978 Ga0453684_0202073
2979 Ga0453684_0203651
2980 Ga0453684_0206744
2981 Ga0453684_0227808
2982 Ga0453684_0258840
2983 Ga0453684_0374860
2984 Ga0453684_0556903
2985 Ga0466971_0071275
2986 Ga0466968_0003012
2987 Ga0466968_0008819
2988 Ga0466968_0010641
2989 Ga0466968_0019578
2990 Ga0466968_0044812
2991 Ga0466957_0000096
2992 Ga0466957_0000937
2993 Ga0466957_0001190
2994 Ga0466957_0004449
2995 Ga0466957_0113876
2996 Ga0466959_0000065
2997 Ga0466959_0005837
2998 Ga0466959_0006101
2999 Ga0466959_0014230
3000 Ga0466959_0034646
3001 Ga0466959_0039845
3002 Ga0466959_0106962
3003 Ga0466959_0116585
3004 Ga0466959_0117112
3005 Ga0451576_0000072
3006 Ga0451576_0000687
3007 Ga0451576_0001003
3008 Ga0451576_0001140
3009 Ga0451576_0002396
3010 Ga0495627_000792
3011 Ga0495603_0019726
3012 Ga0495591_015588
3013 Ga0495629_0001523
3014 Ga0495629_0024999
3015 Ga0495638_0013150
3016 Ga0495638_0020710
3017 Ga0495638_0078026
3018 Ga0495638_0115978
3019 Ga0495653_0145108
3020 Ga0495650_0000003
3021 Ga0495650_0000144
3022 Ga0495650_0000162
3023 Ga0495650_0001307
3024 Ga0495650_0024473
3025 Ga0495580_0002422
3026 Ga0495580_0003588
3027 Ga0495580_0024285
3028 Ga0495605_0001846
3029 Ga0495585_0000091
3030 Ga0495585_0000426
3031 Ga0495585_0000470
3032 Ga0495585_0000596
3033 Ga0495585_0002119
3034 Ga0495585_0051427
3035 Ga0495585_0062395
3036 Ga0495596_0027536
3037 Ga0495607_0005412
3038 Ga0495607_0020750
3039 Ga0495583_0008946
3040 Ga0495583_0014992
3041 Ga0495583_0057341
3042 Ga0495583_0078397
3043 Ga0495606_0000553
3044 Ga0495606_0000919
3045 Ga0495606_0001495
3046 Ga0495606_0003323
3047 Ga0495606_0005759
3048 Ga0495606_0014783
3049 Ga0495606_0024974
3050 Ga0495606_0030291
3051 Ga0495606_0054968
3052 Ga0495606_0087866
3053 Ga0495606_0121284
3054 Ga0495608_0099447
3055 Ga0495610_0000815
3056 Ga0495610_0006223
3057 Ga0495610_0006790
3058 Ga0495610_0007529
3059 Ga0495610_0013940
3060 Ga0495616_0001963
3061 Ga0495616_0002520
3062 Ga0495616_0002531
3063 Ga0495616_0035438
3064 Ga0495616_0046738
3065 Ga0495628_0007406
3066 Ga0495628_0080442
3067 Ga0495630_0055754
3068 Ga0495630_0152144
3069 Ga0495631_0044829
3070 Ga0495632_0057823
3071 Ga0495632_0060773
3072 Ga0495643_0000051
3073 Ga0495643_0025899
3074 Ga0495644_0007728
3075 Ga0495648_0000851
3076 Ga0495648_0003925
3077 Ga0495648_0010599
3078 Ga0495648_0024944
3079 Ga0495648_0035510
3080 Ga0495648_0068329
3081 Ga0495648_0078321
3082 Ga0495663_0000093
3083 Ga0495652_0055952
3084 Ga0495654_0010683
3085 Ga0495665_0029537
3086 Ga0495640_0104526
3087 Ga0495586_0036116
3088 Ga0495586_0050248
3089 Ga0495587_0022367
3090 Ga0495587_0084533
3091 Ga0495609_0000003
3092 Ga0495609_0004681
3093 Ga0495609_0049094
3094 Ga0495597_0000308
3095 Ga0495597_0001174
3096 Ga0495645_0001552
3097 Ga0495645_0020210
3098 Ga0495645_0024578
3099 Ga0495622_0000579
3100 Ga0495622_0040619
3101 Ga0495633_0000005
3102 Ga0495633_0000021
3103 Ga0495633_0000026
3104 Ga0495633_0032843
3105 Ga0495633_0055893
3106 Ga0495667_0040877
3107 Ga0495667_0130820
3108 Ga0495667_0137930
3109 Ga0495668_0000009
3110 Ga0495668_0000012
3111 Ga0495668_0000054
3112 Ga0495634_0038993
3113 Ga0495611_0000435
3114 Ga0495625_0000059
3115 Ga0495625_0000175
3116 Ga0495625_0000515
3117 Ga0495625_0000534
3118 Ga0495625_0000719
3119 Ga0495625_0000907
3120 Ga0495625_0001227
3121 Ga0495625_0001942
3122 Ga0495625_0010378
3123 Ga0495625_0014323
3124 Ga0495625_0017125
3125 Ga0495625_0047988
3126 Ga0495625_0080640
3127 Ga0495625_0089737
3128 Ga0495625_0114513
3129 Ga0495661_0001605
3130 Ga0495661_0024433
3131 Ga0495623_0017966
3132 Ga0495658_0006565
3133 Ga0495658_0022658
3134 Ga0495669_0012930
3135 Ga0495671_0051763
3136 Ga0495649_0000009
3137 Ga0495649_0000031
3138 Ga0495649_0000037
3139 Ga0495649_0000926
3140 Ga0495649_0004071
3141 Ga0495649_0005835
3142 Ga0495649_0037571
3143 Ga0495589_0027271
3144 Ga0495660_0013025
3145 Ga0495660_0058093
3146 Ga0495581_0003610
3147 Ga0495672_0000030
3148 Ga0495672_0000093
3149 Ga0495672_0004809
3150 Ga0495676_0235223
3151 Ga0495683_0022308
3152 Ga0495683_0022362
3153 Ga0495683_0116666
3154 Ga0495687_000104
3155 Ga0495687_000741
3156 Ga0495687_000889
3157 Ga0495687_001385
3158 Ga0495687_004762
3159 Ga0495687_078170
3160 Ga0495681_0039289
3161 Ga0495686_0000005
3162 Ga0495686_0000210
3163 Ga0495686_0000247
3164 Ga0495686_0000468
3165 Ga0495686_0000621
3166 Ga0495686_0000821
3167 Ga0495686_0001919
3168 Ga0495686_0003426
3169 Ga0495686_0014895
3170 Ga0495686_0022680
3171 Ga0495686_0050721
3172 Ga0495614_0021813
3173 Ga0495626_0039077
3174 Ga0496102_0009318
3175 Ga0496102_0013721
3176 Ga0496102_0114340
3177 Ga0496102_0145241
3178 Ga0496103_0013479
3179 Ga0496104_0032067
3180 Ga0496104_0398025
3181 Ga0496106_0056702
3182 Ga0496107_0047859
3183 Ga0496107_0071737
3184 Ga0496108_0006039
3185 Ga0496108_0090271
3186 Ga0496111_0046852
3187 Ga0496113_0223788
3188 Ga0496114_0001462
3189 Ga0496114_0076633
3190 Ga0496115_0072774
3191 Ga0496116_0002509
3192 Ga0496116_0005392
3193 Ga0496116_0007473
3194 Ga0496117_0000209
3195 Ga0496117_0000850
3196 Ga0496117_0012827
3197 Ga0496117_0015973
3198 Ga0496118_0000019
3199 Ga0496118_0000895
3200 Ga0496118_0014190
3201 Ga0496118_0016166
3202 Ga0496119_0000049
3203 Ga0496119_0007161
3204 Ga0496119_0011523
3205 Ga0496119_0025414
3206 Ga0496120_0000649
3207 Ga0496120_0012032
3208 Ga0496121_0000024
3209 Ga0496121_0000669
3210 Ga0496121_0038803
3211 Ga0496121_0055043
3212 Ga0496122_0000088
3213 Ga0496122_0002429
3214 Ga0496122_0066390
3215 Ga0496123_0000139
3216 Ga0496123_0000945
3217 Ga0496123_0001057
3218 Ga0496124_0000045
3219 Ga0496124_0005207
3220 Ga0496124_0023711
3221 Ga0496124_0098633
3222 Ga0496125_0000065
3223 Ga0496125_0008498
3224 Ga0496125_0047533
3225 Ga0496125_0111143
3226 Ga0496126_0000739
3227 Ga0496126_0008429
3228 Ga0496126_0009193
3229 Ga0496126_0011254
3230 Ga0496126_0014302
3231 Ga0496126_0015139
3232 Ga0496126_0019853
3233 Ga0496126_0056394
3234 Ga0495678_000040
3235 Ga0495678_009963
3236 Ga0495678_010791
3237 Ga0495682_0004988
3238 Ga0495682_0011166
3239 Ga0501298_005586
3240 Ga0501031_0004060
3241 Ga0501032_0000170
3242 Ga0501032_0005161
3243 Ga0501032_0094739
3244 Ga0501033_0000004
3245 Ga0501034_0000007
3246 Ga0501034_0001804
3247 Ga0501034_0016304
3248 Ga0501034_0022036
3249 Ga0501034_0047251
3250 Ga0501034_0056617
3251 Ga0501034_0308818
3252 Ga0501034_0434964
3253 Ga0501036_0002845
3254 Ga0501036_0005475
3255 Ga0501036_0217031
3256 Ga0501037_0001925
3257 Ga0501037_0008556
3258 Ga0501038_0001517
3259 Ga0501038_0001903
3260 Ga0501038_0007369
3261 Ga0501039_0015765
3262 Ga0501039_0018601
3263 Ga0501040_0002525
3264 Ga0501042_0008404
3265 Ga0501043_0002109
3266 Ga0501043_0003067
3267 Ga0501043_0015026
3268 Ga0501043_0062787
3269 Ga0501043_0168338
3270 Ga0501046_0005766
3271 Ga0501046_0008014
3272 Ga0501047_0004779
3273 Ga0501047_0007622
3274 Ga0501047_0015554
3275 Ga0501047_0216101
3276 Ga0501069_0105134
3277 Ga0501202_016323
3278 Ga0501206_001534
3279 Ga0501223_000995
3280 Ga0501240_002278
3281 Ga0501257_001356
3282 Ga0501257_019450
3283 Ga0501225_0000330
3284 Ga0501080_0034125
3285 Ga0501083_0000212
3286 Ga0501241_000156
3287 Ga0501265_001916
3288 Ga0501280_000145
3289 Ga0501282_001182
3290 Ga0501035_0001627
3291 Ga0501035_0037561
3292 Ga0501035_0200260
3293 Ga0501044_0008288
3294 Ga0501044_0008832
3295 Ga0501044_0010895
3296 Ga0501044_0012157
3297 Ga0501044_0098841
3298 Ga0501045_0000002
3299 nmdc:mga03683_4691_c1
3300 nmdc:mga00v17_367_c1
3301 nmdc:mga0k408_162445_c1
3302 nmdc:mga0k408_30302_c1
3303 nmdc:mga0k408_44723_c1
3304 nmdc:mga0k408_78_c1
3305 nmdc:mga0k408_82_c1
3306 nmdc:mga0k408_85_c1
3307 nmdc:mga0k408_9453_c1
3308 nmdc:mga07m45_10615_c1
3309 nmdc:mga07m45_5753_c1
3310 nmdc:mga07m45_81812_c1
3311 nmdc:mga05p37_160869_c1
3312 nmdc:mga05p37_9734_c1
3313 nmdc:mga05p37_990_c2
3314 nmdc:mga09592_138309_c1
3315 nmdc:mga09592_48509_c1
3316 nmdc:mga0qj67_162693_c1
3317 nmdc:mga06r32_134893_c1
3318 nmdc:mga06r32_63551_c1
3319 nmdc:mga08y16_232600_c1
3320 nmdc:mga08y16_32146_c1
3321 nmdc:mga08y16_6512_c1
3322 Ga0500635_0000900
3323 Ga0500635_0002059
3324 Ga0500578_0000541
3325 Ga0500644_0000042
3326 Ga0500644_0000111
3327 Ga0500644_0032679
3328 Ga0500646_0000393
3329 Ga0500646_0001536
3330 Ga0500583_0000010
3331 Ga0500583_0000884
3332 Ga0500583_0001631
3333 Ga0500583_0010133
3334 Ga0500651_0000142
3335 Ga0500651_0001832
3336 Ga0500556_0015782
3337 Ga0500562_000098
3338 Ga0500562_000829
3339 Ga0500569_011508
3340 Ga0500607_084621
3341 Ga0500608_000428
3342 Ga0500614_017015
3343 Ga0500618_000009
3344 Ga0500618_000018
3345 Ga0500618_000080
3346 Ga0500618_026589
3347 Ga0500642_0026337
3348 Ga0500652_000050
3349 Ga0500652_025159
3350 Ga0500658_0001969
3351 Ga0500658_0004946
3352 Ga0500561_0032228
3353 Ga0500577_0000669
3354 Ga0500577_0005231
3355 Ga0500588_0048748
3356 Ga0500600_0006391
3357 Ga0500616_0000007
3358 Ga0500616_0001241
3359 Ga0500622_0000053
3360 Ga0500622_0000292
3361 Ga0500622_0000371
3362 Ga0500622_0000809
3363 Ga0500622_0001408
3364 Ga0500622_0002797
3365 Ga0500622_0003008
3366 Ga0500622_0005861
3367 Ga0500622_0022320
3368 Ga0500624_001241
3369 Ga0500627_0049882
3370 Ga0500634_0007544
3371 Ga0500634_0106142
3372 Ga0500645_000552
3373 Ga0500587_001403
3374 Ga0587083_0003735
3375 Ga0466962_0001301
3376 Ga0466962_0015777
3377 Ga0466962_0018366
3378 2512934704
3379 2512963059
3380 2513704636
3381 2514037797
3382 2514046315
3383 2515688612
3384 2516016973
3385 2522553591
3386 2535517772
3387 2547373875
3388 2547697200
3389 2562463356
3390 2563061934
3391 2585295464
3392 2585405341
3393 2586209654
3394 2599358158
3395 2599383323
3396 2599389770
3397 2599464973
3398 2599479134
3399 2599482006
3400 2599494112
3401 2599723275
3402 2600217705
3403 2601534840
3404 2601539531
3405 2601757881
3406 2601764239
3407 2601777872
3408 2603637049
3409 2609909831
3410 2644038817
3411 2644302900
3412 2644683424
3413 2712469400
3414 2713478230
3415 2722726212
3416 2738728971
3417 2738731588
3418 2738756143
3419 2738761306
3420 2738763253
3421 2738852403
3422 2739304225
3423 2739591474
3424 2739615281
3425 2739645512
3426 2739645590
3427 2740033392
3428 2756677029
3429 2776616182
3430 2792310330
3431 2792833043
3432 2793404909
3433 2802652694
3434 2813728059
3435 2814695614
3436 2817263401
3437 2817276779
3438 2817452852
3439 2819549520
3440 2819574077
3441 2819586371
3442 2819619657
3443 2819681555
3444 2821137396
3445 2821140729
3446 2835320254
3447 2839991510
3448 2840678446
3449 2842908268
3450 2842908667
3451 2846038048
3452 2849286615
3453 2852625536
3454 2852630623
3455 2856289163
3456 2857363466
3457 2857631587
3458 2857632424
3459 2858690602
3460 2869166330
3461 2876365311
3462 2881101154
3463 2883071363
3464 2884792474
3465 2884796383
3466 2884934540
3467 2885277216
3468 2888349984
3469 2890740545
3470 2891637063
3471 2895523354
3472 2896086263
3473 2896089148
3474 2896110263
3475 2896113478
3476 2898796440
3477 2903523663
3478 2903529962
3479 2904445304
3480 2904467863
3481 2904471231
3482 2904618851
3483 2904782822
3484 2910246547
3485 2911139402
3486 2919180433
3487 2919190583
3488 2919438235
3489 2919440547
3490 2919688631
3491 2921643673
3492 2928082115
3493 2928082551
3494 2928104519
3495 2928148861
3496 2928149307
3497 2929155156
3498 2929159936
3499 2929179121
3500 2929241723
3501 2929243993
3502 2929923662
3503 2932086347
3504 2932087957
3505 2935625940
3506 2939575129
3507 2939577838
3508 2939618310
3509 2939669207
3510 2945877036
3511 2945981521
3512 2946019073
3513 2954020846
3514 2958119968
3515 2963650913
3516 2974439101
3517 2977233768
3518 2977271209
3519 2977990060
3520 2984559212
3521 2993359865
3522 3003235921
3523 637077912
3524 642594261
3525 8001524284
3526 8002291396
3527 8003155203
3528 8004705220
3529 8019505353
3530 8020810562
3531 8040176311
3532 8055819702

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

74

321

0.98

PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

75

422

0.97

PF04321

RmlD_sub_bind

RmlD substrate binding domain

71

278

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
6gpj-assembly1.cif.gz_A crystal structure of human gdp-d-mannose 4,6-dehydratase in complex with gdp-4f-man 0.9869 3 356
6gpl-assembly1.cif.gz_B crystal structure of human gdp-d-mannose 4,6-dehydratase in complex with gdp-4k6d-man 0.9858 3 356
6gpk-assembly1.cif.gz_C crystal structure of human gdp-d-mannose 4,6-dehydratase (e157q) in complex with gdp-man 0.9794 3 356
6q94-assembly1.cif.gz_B-3 crystal structure of human gdp-d-mannose 4,6-dehydratase (s156d) in complex with gdp-man 0.9793 3 356
6q94-assembly2.cif.gz_D crystal structure of human gdp-d-mannose 4,6-dehydratase (s156d) in complex with gdp-man 0.9775 3 356
ID Description Score Start End Superfamily
af_P0AC88_3_270_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9935 3 270 3.40.50.720
af_P0AC88_3_270_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9898 3 270 3.40.50.720
af_Q4CM81_7_150_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9788 3 150 3.40.50.720
af_Q4CM81_8_135_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.977 3 134 3.40.50.720
af_Q4D941_50_182_3.90.25.10 Alpha Beta;Alpha-Beta Complex;UDP-galactose 4-epimerase; domain 1;UDP-galactose 4-epimerase, domain 1 0.9714 193 333 3.90.25.10
ID Description Score Start End GO Terms
AF-A0A730K5U1-F1-model_v4 GDP-mannose 4,6-dehydratase (EC 4.2.1.47) 1.002 185 301 GO:0008446
GO:0042351
AF-Q9Z6I3-F1-model_v4 GDP-mannose 4,6-dehydratase (EC 4.2.1.47) 1.001 75 258 GO:0008446
GO:0042351
AF-A0A447N801-F1-model_v4 GDP-mannose 4,6-dehydratase (EC 4.2.1.47) 0.9988 168 372 GO:0008446
GO:0042351
AF-A0A625RB69-F1-model_v4 GDP-mannose 4,6-dehydratase (EC 4.2.1.47) 0.9987 58 192 GO:0008446
GO:0042351
AF-A0A382CEB6-F1-model_v4 GDP-mannose 4,6-dehydratase (EC 4.2.1.47) 0.9978 61 229 GO:0008446
GO:0042351

Map