F495649
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1770 | 743 | 3540 | 229 |
Family's Representative Sequence
| Representative Sequence | 3300049579|Ga0501043_0390475|Ga0501043_0390475_61_774 |
| Length | 237 |
| Sequence | MMPPSDALLSPSSPSGLDAVEHEIARACRDARRDRASVTLIAVSKTFDAEAIKPAIAAGQRVFGENRVQEAKGKWPELMTAVPGIALHLIGPLQSNKVKEAVALFDAIHSVDRTSLCEALAKEFAKEVSRQPRRPELFVQINTGEEPQKAGVAPTEADAFIARCRDSYGLTISGLMCIPPADEAPAPHFALTAKIAARNGLTKLSMGMSADFATAIAFGATHVRVGSAIFGTRTKPL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 2 | 2010549000 | Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes | Metagenome | Endosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 5 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 6 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 7 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 8 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 9 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 10 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 11 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 12 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 13 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 14 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 16 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 57 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 64 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 66 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 67 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 68 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 70 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 71 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 72 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 73 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 74 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 75 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 76 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 77 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 78 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 79 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 80 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 81 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 82 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 83 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 85 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 86 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 87 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 88 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 89 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 90 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 91 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 92 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 93 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 94 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 96 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 97 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 98 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 99 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 100 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 101 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 102 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 103 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 104 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 106 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 107 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 108 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 109 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 110 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 111 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 125 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 140 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 141 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 142 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 143 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 144 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 145 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 146 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 147 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 148 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 150 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 155 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 156 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 158 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 223 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 224 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 225 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 226 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 228 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 232 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 233 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 234 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 235 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 236 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 237 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 238 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 239 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 240 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 241 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 242 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 243 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 244 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 245 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 246 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 247 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 248 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 249 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 250 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 251 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 252 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 253 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 254 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 255 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 256 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 257 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 258 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 259 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 260 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 261 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 262 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 263 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 264 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 265 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 266 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 267 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 268 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 269 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 270 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 271 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 272 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 273 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 274 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 275 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 276 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 277 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 278 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 279 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 280 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 281 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 282 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 283 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 284 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 285 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 286 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 287 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 288 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 289 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 290 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 291 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 292 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 293 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 294 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 295 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 296 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 297 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 298 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 299 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 300 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 301 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 302 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 303 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 304 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 305 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 306 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 307 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 308 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 309 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 310 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 311 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 312 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 313 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 314 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 315 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 316 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 317 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 318 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 319 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 320 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 414 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 415 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 416 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 417 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 418 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 419 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 420 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 421 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 422 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 423 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 424 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 425 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 426 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 427 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 428 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 429 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 430 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 431 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 432 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 433 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 434 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 435 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 436 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 437 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 438 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 439 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 440 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 442 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 443 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 444 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 445 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 446 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 447 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 448 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 449 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 450 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 451 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 452 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 453 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 454 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 455 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 456 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 457 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 458 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 459 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 460 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 461 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 462 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 463 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 464 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 465 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 466 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 467 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 468 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 469 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 470 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 471 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 472 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 473 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 474 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 475 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 476 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 477 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 478 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 479 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 480 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 481 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 482 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 483 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 484 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 485 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 486 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 487 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 488 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 489 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 490 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 491 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 492 | 3300053089 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere | Metagenome | Endosphere |
| 493 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 494 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 495 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 496 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 497 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 498 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 499 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 500 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 501 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 502 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 503 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 504 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 505 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 506 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 507 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 508 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 509 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 510 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 511 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 512 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 513 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 514 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 515 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 516 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 517 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 518 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 519 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 520 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 521 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 522 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 523 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 524 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 525 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 526 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 527 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 528 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 529 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 530 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 531 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 532 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 533 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 534 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 535 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 536 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 537 | 3300053722 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere | Metagenome | Endosphere |
| 538 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 539 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 540 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 541 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 542 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 543 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 544 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 545 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 546 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 547 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 548 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 549 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 550 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 551 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 552 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 553 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 554 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 555 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 556 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 557 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 558 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 559 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 560 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 561 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 562 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 563 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 564 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 565 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 566 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 567 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 568 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 569 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 570 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 571 | 2597490356 | Azospirillum brasilense sp7 | Isolate | Unclassified |
| 572 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 573 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 574 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 575 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 576 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 577 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 578 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 579 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 580 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 581 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 582 | 2791355199 | |||
| 583 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 584 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 585 | 2818991472 | Kitasatospora viridis DSM 44826 | Isolate | Rhizosphere |
| 586 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 587 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 588 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 589 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 590 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 591 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 592 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 593 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 594 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 595 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 596 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 597 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 598 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 599 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 600 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 601 | 2846952575 | Azospirillum brasilense sp7 | Isolate | Unclassified |
| 602 | 2848858292 | Azospirillum brasilense Az39 | Isolate | Unclassified |
| 603 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 604 | 2849560528 | Caulobacter zeae 410 | Isolate | Unclassified |
| 605 | 2849573788 | Caulobacter endophyticus 774 | Isolate | Unclassified |
| 606 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 607 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 608 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 609 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 610 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 611 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 612 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 613 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 614 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 615 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 616 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 617 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 618 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 619 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 620 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 621 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 622 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 623 | 2897803580 | Azospirillum doebereinerae GSF71 | Isolate | Unclassified |
| 624 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 625 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 626 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 627 | 2904699407 | |||
| 628 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 629 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 630 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 631 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 632 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 633 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 634 | 2922368715 | |||
| 635 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 636 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 637 | 2922425934 | |||
| 638 | 2924762789 | Mesorhizobium sp. WSM4303 | Isolate | Unclassified |
| 639 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 640 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 641 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 642 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 643 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 644 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 645 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 646 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 647 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 648 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 649 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 650 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 651 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 652 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 653 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 654 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 655 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 656 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 657 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 658 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 659 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 660 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 661 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 662 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 663 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 664 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 665 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 666 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 667 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 668 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 669 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 670 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 671 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 672 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 673 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 674 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 675 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 676 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 677 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 678 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 679 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 680 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 681 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 682 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 683 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 684 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 685 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 686 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 687 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 688 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 689 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 690 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 691 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 692 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 693 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 694 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 695 | 2937822353 | Mesorhizobium neociceri CCANP35 | Isolate | Nodule |
| 696 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 697 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 698 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 699 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 700 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 701 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 702 | 2987666974 | Mesorhizobium sp. WSM4306 | Isolate | Unclassified |
| 703 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 704 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 705 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 706 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 707 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 708 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 709 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 710 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 711 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 712 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 713 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 714 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 715 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 716 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 717 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 718 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 719 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 720 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 721 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 722 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 723 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 724 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 725 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 726 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 727 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 728 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 729 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 730 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 731 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 732 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 733 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 734 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 735 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 736 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 737 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 738 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 739 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 740 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 741 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 742 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 743 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 89.13 |
| Metatranscriptomes | 0.06 |
| Isolates | 10.82 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.88 |
| Nodule | 8.76 |
| Rhizoplane | 5.76 |
| Rhizosphere | 63.95 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501043_0390475 | 3300049579 | Bacteria | 1052 |
| 2 | RicEn_C7607 | 2010549000 | Bacteria | 1068 |
| 3 | JGI24740J21852_10001411 | 3300001979 | Bacteria | 11004 |
| 4 | JGI24739J22299_10009800 | 3300001989 | Bacteria | 3563 |
| 5 | JGI24739J22299_10075914 | 3300001989 | Bacteria | 1038 |
| 6 | JGI24737J22298_10010056 | 3300001990 | Bacteria | 3133 |
| 7 | JGI24735J21928_10023530 | 3300002067 | Bacteria | 1867 |
| 8 | JGI25406J46586_10000066 | 3300003203 | Bacteria | 48110 |
| 9 | JGI25406J46586_10103503 | 3300003203 | Bacteria | 847 |
| 10 | JGI25165J46597_1018237 | 3300003214 | Bacteria | 930 |
| 11 | JGI25153J46596_10003418 | 3300003215 | Bacteria | 8884 |
| 12 | JGI25153J46596_10003644 | 3300003215 | Bacteria | 8532 |
| 13 | JGI25153J46596_10003677 | 3300003215 | Bacteria | 8490 |
| 14 | JGI25153J46596_10003813 | 3300003215 | Bacteria | 8318 |
| 15 | JGI25153J46596_10010816 | 3300003215 | Bacteria | 4091 |
| 16 | JGI25160J50197_1005711 | 3300003354 | Bacteria | 5140 |
| 17 | JGI25160J50197_1006296 | 3300003354 | Bacteria | 4820 |
| 18 | Ga0055529_1009184 | 3300003763 | Bacteria | 1302 |
| 19 | Ga0055531_10020073 | 3300003794 | Bacteria | 2664 |
| 20 | Ga0065165_1079368 | 3300005262 | Bacteria | 855 |
| 21 | Ga0070658_10087184 | 3300005327 | Bacteria | 2569 |
| 22 | Ga0070658_10209512 | 3300005327 | Bacteria | 1646 |
| 23 | Ga0068869_100012453 | 3300005334 | Bacteria | 5622 |
| 24 | Ga0068869_100028971 | 3300005334 | Bacteria | 3874 |
| 25 | Ga0068869_100441270 | 3300005334 | Bacteria | 1077 |
| 26 | Ga0070666_10384409 | 3300005335 | Bacteria | 1008 |
| 27 | Ga0070680_100018862 | 3300005336 | Bacteria | 5457 |
| 28 | Ga0070680_100045679 | 3300005336 | Bacteria | 3561 |
| 29 | Ga0070680_100466528 | 3300005336 | Bacteria | 1079 |
| 30 | Ga0070682_100455655 | 3300005337 | Bacteria | 981 |
| 31 | Ga0068868_100019711 | 3300005338 | Bacteria | 5057 |
| 32 | Ga0068868_100051247 | 3300005338 | Bacteria | 3245 |
| 33 | Ga0068868_100394791 | 3300005338 | Bacteria | 1193 |
| 34 | Ga0068868_101029015 | 3300005338 | Bacteria | 755 |
| 35 | Ga0070660_100081631 | 3300005339 | Bacteria | 2538 |
| 36 | Ga0070660_100179225 | 3300005339 | Bacteria | 1714 |
| 37 | Ga0070691_10006835 | 3300005341 | Bacteria | 5215 |
| 38 | Ga0070661_100219487 | 3300005344 | Bacteria | 1458 |
| 39 | Ga0070661_100496161 | 3300005344 | Bacteria | 977 |
| 40 | Ga0070692_10064318 | 3300005345 | Bacteria | 1940 |
| 41 | Ga0070668_100042269 | 3300005347 | Bacteria | 3493 |
| 42 | Ga0070668_100069816 | 3300005347 | Bacteria | 2734 |
| 43 | Ga0070668_100111482 | 3300005347 | Bacteria | 2177 |
| 44 | Ga0070668_100119923 | 3300005347 | Bacteria | 2101 |
| 45 | Ga0070668_100296648 | 3300005347 | Bacteria | 1354 |
| 46 | Ga0070669_100136845 | 3300005353 | Bacteria | 1885 |
| 47 | Ga0070669_100339052 | 3300005353 | Bacteria | 1218 |
| 48 | Ga0070675_100881609 | 3300005354 | Bacteria | 820 |
| 49 | Ga0070671_100034389 | 3300005355 | Bacteria | 4195 |
| 50 | Ga0070671_100108745 | 3300005355 | Bacteria | 2328 |
| 51 | Ga0070674_100031797 | 3300005356 | Bacteria | 3500 |
| 52 | Ga0070673_100207371 | 3300005364 | Bacteria | 1691 |
| 53 | Ga0070673_100779680 | 3300005364 | Bacteria | 882 |
| 54 | Ga0070688_100529798 | 3300005365 | Bacteria | 893 |
| 55 | Ga0070659_100022664 | 3300005366 | Bacteria | 4796 |
| 56 | Ga0070667_100004267 | 3300005367 | Bacteria | 12069 |
| 57 | Ga0070667_100040946 | 3300005367 | Bacteria | 3886 |
| 58 | Ga0070667_100137152 | 3300005367 | Bacteria | 2139 |
| 59 | Ga0070667_100152826 | 3300005367 | Bacteria | 2028 |
| 60 | Ga0070667_100273618 | 3300005367 | Bacteria | 1515 |
| 61 | Ga0070703_10000735 | 3300005406 | Bacteria | 10951 |
| 62 | Ga0070709_10001880 | 3300005434 | Bacteria | 11387 |
| 63 | Ga0070709_10165113 | 3300005434 | Bacteria | 1543 |
| 64 | Ga0070709_10195373 | 3300005434 | Bacteria | 1430 |
| 65 | Ga0070709_10270004 | 3300005434 | Bacteria | 1232 |
| 66 | Ga0070709_10347446 | 3300005434 | Bacteria | 1095 |
| 67 | Ga0070714_100004568 | 3300005435 | Bacteria | 10439 |
| 68 | Ga0070714_100288015 | 3300005435 | Bacteria | 1528 |
| 69 | Ga0070713_100006874 | 3300005436 | Bacteria | 7932 |
| 70 | Ga0070713_100012950 | 3300005436 | Bacteria | 6140 |
| 71 | Ga0070713_100183809 | 3300005436 | Bacteria | 1880 |
| 72 | Ga0070713_100201247 | 3300005436 | Bacteria | 1799 |
| 73 | Ga0070713_100473660 | 3300005436 | Bacteria | 1179 |
| 74 | Ga0070710_10018606 | 3300005437 | Bacteria | 3576 |
| 75 | Ga0070710_10025030 | 3300005437 | Bacteria | 3156 |
| 76 | Ga0070710_10214322 | 3300005437 | Bacteria | 1222 |
| 77 | Ga0070710_10239060 | 3300005437 | Bacteria | 1163 |
| 78 | Ga0070710_10326665 | 3300005437 | Bacteria | 1009 |
| 79 | Ga0070701_10044934 | 3300005438 | Bacteria | 2265 |
| 80 | Ga0070701_10493376 | 3300005438 | Bacteria | 794 |
| 81 | Ga0070711_100000660 | 3300005439 | Bacteria | 18001 |
| 82 | Ga0070711_100020798 | 3300005439 | Bacteria | 4234 |
| 83 | Ga0070711_100479598 | 3300005439 | Bacteria | 1022 |
| 84 | Ga0070705_100001900 | 3300005440 | Bacteria | 10735 |
| 85 | Ga0070700_100000562 | 3300005441 | Bacteria | 18616 |
| 86 | Ga0070694_100001629 | 3300005444 | Bacteria | 13175 |
| 87 | Ga0070694_100102912 | 3300005444 | Bacteria | 2023 |
| 88 | Ga0070708_100010410 | 3300005445 | Bacteria | 7538 |
| 89 | Ga0070663_100004283 | 3300005455 | Bacteria | 8352 |
| 90 | Ga0070663_100007266 | 3300005455 | Bacteria | 6733 |
| 91 | Ga0070663_100029326 | 3300005455 | Bacteria | 3759 |
| 92 | Ga0070663_100031355 | 3300005455 | Bacteria | 3653 |
| 93 | Ga0070663_100070063 | 3300005455 | Bacteria | 2549 |
| 94 | Ga0070663_100091578 | 3300005455 | Bacteria | 2253 |
| 95 | Ga0070663_100144901 | 3300005455 | Bacteria | 1817 |
| 96 | Ga0070663_100174277 | 3300005455 | Bacteria | 1664 |
| 97 | Ga0070663_100524193 | 3300005455 | Bacteria | 987 |
| 98 | Ga0070663_100642748 | 3300005455 | Bacteria | 896 |
| 99 | Ga0070678_100293324 | 3300005456 | Bacteria | 1380 |
| 100 | Ga0070678_100319403 | 3300005456 | Bacteria | 1325 |
| 101 | Ga0070678_100358070 | 3300005456 | Bacteria | 1256 |
| 102 | Ga0070662_100021703 | 3300005457 | Bacteria | 4389 |
| 103 | Ga0070662_100134029 | 3300005457 | Bacteria | 1913 |
| 104 | Ga0070662_100165717 | 3300005457 | Bacteria | 1731 |
| 105 | Ga0070681_10003083 | 3300005458 | Bacteria | 15470 |
| 106 | Ga0070681_10031581 | 3300005458 | Bacteria | 5316 |
| 107 | Ga0070681_10263662 | 3300005458 | Bacteria | 1635 |
| 108 | Ga0070681_10493886 | 3300005458 | Bacteria | 1137 |
| 109 | Ga0070685_10202285 | 3300005466 | Bacteria | 1292 |
| 110 | Ga0070685_10289475 | 3300005466 | Bacteria | 1100 |
| 111 | Ga0070706_100119190 | 3300005467 | Bacteria | 2459 |
| 112 | Ga0070706_100698862 | 3300005467 | Bacteria | 940 |
| 113 | Ga0070707_100145827 | 3300005468 | Bacteria | 2304 |
| 114 | Ga0070698_100041805 | 3300005471 | Bacteria | 4706 |
| 115 | Ga0070698_100164021 | 3300005471 | Bacteria | 2165 |
| 116 | Ga0070699_100000345 | 3300005518 | Bacteria | 44889 |
| 117 | Ga0070699_100095600 | 3300005518 | Bacteria | 2601 |
| 118 | Ga0070699_100362997 | 3300005518 | Bacteria | 1306 |
| 119 | Ga0070699_100644224 | 3300005518 | Bacteria | 967 |
| 120 | Ga0070679_100060931 | 3300005530 | Bacteria | 3761 |
| 121 | Ga0070679_100121028 | 3300005530 | Bacteria | 2602 |
| 122 | Ga0070679_100132844 | 3300005530 | Bacteria | 2470 |
| 123 | Ga0070679_100501698 | 3300005530 | Bacteria | 1157 |
| 124 | Ga0070679_100546124 | 3300005530 | Bacteria | 1102 |
| 125 | Ga0070684_100028480 | 3300005535 | Bacteria | 4726 |
| 126 | Ga0070684_100031392 | 3300005535 | Bacteria | 4522 |
| 127 | Ga0070697_100023492 | 3300005536 | Bacteria | 4903 |
| 128 | Ga0070697_100065992 | 3300005536 | Bacteria | 2959 |
| 129 | Ga0070697_100272288 | 3300005536 | Bacteria | 1451 |
| 130 | Ga0068853_100001705 | 3300005539 | Bacteria | 16098 |
| 131 | Ga0068853_100073960 | 3300005539 | Bacteria | 2972 |
| 132 | Ga0070672_100193956 | 3300005543 | Bacteria | 1697 |
| 133 | Ga0070672_100208852 | 3300005543 | Bacteria | 1635 |
| 134 | Ga0070672_100289418 | 3300005543 | Bacteria | 1387 |
| 135 | Ga0070672_100590412 | 3300005543 | Bacteria | 967 |
| 136 | Ga0070695_100008517 | 3300005545 | Bacteria | 6088 |
| 137 | Ga0070696_100000049 | 3300005546 | Bacteria | 55513 |
| 138 | Ga0070696_100112180 | 3300005546 | Bacteria | 1964 |
| 139 | Ga0070693_100180957 | 3300005547 | Bacteria | 1357 |
| 140 | Ga0070665_100032443 | 3300005548 | Bacteria | 5256 |
| 141 | Ga0070665_100054594 | 3300005548 | Bacteria | 4007 |
| 142 | Ga0070665_100057903 | 3300005548 | Bacteria | 3885 |
| 143 | Ga0070665_100070382 | 3300005548 | Bacteria | 3505 |
| 144 | Ga0070665_100081190 | 3300005548 | Bacteria | 3248 |
| 145 | Ga0070665_100106820 | 3300005548 | Bacteria | 2801 |
| 146 | Ga0070665_100147802 | 3300005548 | Bacteria | 2353 |
| 147 | Ga0070665_100201905 | 3300005548 | Bacteria | 1989 |
| 148 | Ga0070665_100273643 | 3300005548 | Bacteria | 1690 |
| 149 | Ga0070665_100397511 | 3300005548 | Bacteria | 1386 |
| 150 | Ga0070665_100532171 | 3300005548 | Bacteria | 1187 |
| 151 | Ga0070665_100630790 | 3300005548 | Bacteria | 1085 |
| 152 | Ga0070704_100012188 | 3300005549 | Bacteria | 5304 |
| 153 | Ga0068855_100067879 | 3300005563 | Bacteria | 4152 |
| 154 | Ga0068855_100075904 | 3300005563 | Bacteria | 3901 |
| 155 | Ga0068855_100113103 | 3300005563 | Bacteria | 3115 |
| 156 | Ga0068855_100144127 | 3300005563 | Bacteria | 2713 |
| 157 | Ga0068855_100364925 | 3300005563 | Bacteria | 1588 |
| 158 | Ga0068855_100788281 | 3300005563 | Bacteria | 1011 |
| 159 | Ga0070664_100728380 | 3300005564 | Bacteria | 925 |
| 160 | Ga0068857_100003727 | 3300005577 | Bacteria | 12794 |
| 161 | Ga0068857_100027200 | 3300005577 | Bacteria | 5044 |
| 162 | Ga0068854_100003651 | 3300005578 | Bacteria | 9629 |
| 163 | Ga0068854_100054424 | 3300005578 | Bacteria | 2878 |
| 164 | Ga0068854_100158359 | 3300005578 | Bacteria | 1751 |
| 165 | Ga0068854_100382066 | 3300005578 | Bacteria | 1161 |
| 166 | Ga0068854_100474089 | 3300005578 | Bacteria | 1050 |
| 167 | Ga0068854_100699544 | 3300005578 | Bacteria | 875 |
| 168 | Ga0068856_100004410 | 3300005614 | Bacteria | 14027 |
| 169 | Ga0068856_100068205 | 3300005614 | Bacteria | 3515 |
| 170 | Ga0068856_100107777 | 3300005614 | Bacteria | 2782 |
| 171 | Ga0068856_100403503 | 3300005614 | Bacteria | 1386 |
| 172 | Ga0070702_100008465 | 3300005615 | Bacteria | 4984 |
| 173 | Ga0070702_100032484 | 3300005615 | Bacteria | 2864 |
| 174 | Ga0068852_100012568 | 3300005616 | Bacteria | 6432 |
| 175 | Ga0068852_100036955 | 3300005616 | Bacteria | 4092 |
| 176 | Ga0068852_100064229 | 3300005616 | Bacteria | 3199 |
| 177 | Ga0068852_100259654 | 3300005616 | Bacteria | 1667 |
| 178 | Ga0068852_100329260 | 3300005616 | Bacteria | 1486 |
| 179 | Ga0068852_100674443 | 3300005616 | Bacteria | 1043 |
| 180 | Ga0068859_100000552 | 3300005617 | Bacteria | 37180 |
| 181 | Ga0068864_100008679 | 3300005618 | Bacteria | 8386 |
| 182 | Ga0068864_100031888 | 3300005618 | Bacteria | 4473 |
| 183 | Ga0068864_100054927 | 3300005618 | Bacteria | 3437 |
| 184 | Ga0068864_100232178 | 3300005618 | Bacteria | 1707 |
| 185 | Ga0068864_100307299 | 3300005618 | Bacteria | 1486 |
| 186 | Ga0068866_10064108 | 3300005718 | Bacteria | 1918 |
| 187 | Ga0068866_10087844 | 3300005718 | Bacteria | 1686 |
| 188 | Ga0068861_100136010 | 3300005719 | Bacteria | 2000 |
| 189 | Ga0068851_10003678 | 3300005834 | Bacteria | 6845 |
| 190 | Ga0068851_10107691 | 3300005834 | Bacteria | 1485 |
| 191 | Ga0068870_10060138 | 3300005840 | Bacteria | 2039 |
| 192 | Ga0068863_100266311 | 3300005841 | Bacteria | 1658 |
| 193 | Ga0068863_100338765 | 3300005841 | Bacteria | 1463 |
| 194 | Ga0068858_100016049 | 3300005842 | Bacteria | 7036 |
| 195 | Ga0068858_100018320 | 3300005842 | Bacteria | 6557 |
| 196 | Ga0068858_100124806 | 3300005842 | Bacteria | 2409 |
| 197 | Ga0068858_100141835 | 3300005842 | Bacteria | 2256 |
| 198 | Ga0068860_100009725 | 3300005843 | Bacteria | 9550 |
| 199 | Ga0068860_100046811 | 3300005843 | Bacteria | 4123 |
| 200 | Ga0068860_100099409 | 3300005843 | Bacteria | 2775 |
| 201 | Ga0068860_100254028 | 3300005843 | Bacteria | 1712 |
| 202 | Ga0068860_100930836 | 3300005843 | Bacteria | 886 |
| 203 | Ga0068862_100002294 | 3300005844 | Bacteria | 17095 |
| 204 | Ga0068862_100092188 | 3300005844 | Bacteria | 2640 |
| 205 | Ga0068862_100209144 | 3300005844 | Bacteria | 1762 |
| 206 | Ga0068862_100271668 | 3300005844 | Bacteria | 1550 |
| 207 | Ga0081455_10002249 | 3300005937 | Bacteria | 22983 |
| 208 | Ga0081455_10005984 | 3300005937 | Bacteria | 13195 |
| 209 | Ga0081455_10069511 | 3300005937 | Bacteria | 2928 |
| 210 | Ga0081455_10108285 | 3300005937 | Bacteria | 2214 |
| 211 | Ga0081455_10114256 | 3300005937 | Bacteria | 2140 |
| 212 | Ga0081540_1001950 | 3300005983 | Bacteria | 17252 |
| 213 | Ga0081540_1010133 | 3300005983 | Bacteria | 6416 |
| 214 | Ga0081540_1018922 | 3300005983 | Bacteria | 4207 |
| 215 | Ga0081540_1025797 | 3300005983 | Bacteria | 3372 |
| 216 | Ga0081540_1030561 | 3300005983 | Bacteria | 2980 |
| 217 | Ga0081540_1042421 | 3300005983 | Bacteria | 2347 |
| 218 | Ga0081540_1112812 | 3300005983 | Bacteria | 1145 |
| 219 | Ga0081539_10000064 | 3300005985 | Bacteria | 247020 |
| 220 | Ga0081539_10001064 | 3300005985 | Bacteria | 50201 |
| 221 | Ga0081539_10018290 | 3300005985 | Bacteria | 4870 |
| 222 | Ga0081539_10029371 | 3300005985 | Bacteria | 3436 |
| 223 | Ga0081539_10049048 | 3300005985 | Bacteria | 2398 |
| 224 | Ga0070717_10000379 | 3300006028 | Bacteria | 28424 |
| 225 | Ga0070717_10005090 | 3300006028 | Bacteria | 9587 |
| 226 | Ga0070717_10069519 | 3300006028 | Bacteria | 2932 |
| 227 | Ga0070717_10383397 | 3300006028 | Bacteria | 1261 |
| 228 | Ga0075365_10007366 | 3300006038 | Bacteria | 6154 |
| 229 | Ga0075365_10081729 | 3300006038 | Bacteria | 2190 |
| 230 | Ga0075365_10084058 | 3300006038 | Bacteria | 2159 |
| 231 | Ga0075365_10167843 | 3300006038 | Bacteria | 1531 |
| 232 | Ga0075365_10236017 | 3300006038 | Bacteria | 1284 |
| 233 | Ga0075365_10269267 | 3300006038 | Bacteria | 1198 |
| 234 | Ga0075365_10336663 | 3300006038 | Bacteria | 1063 |
| 235 | Ga0075365_10382903 | 3300006038 | Bacteria | 992 |
| 236 | Ga0075365_10464795 | 3300006038 | Bacteria | 894 |
| 237 | Ga0075365_10488274 | 3300006038 | Bacteria | 870 |
| 238 | Ga0075365_10509708 | 3300006038 | Bacteria | 850 |
| 239 | Ga0075368_10001272 | 3300006042 | Bacteria | 7983 |
| 240 | Ga0075368_10105298 | 3300006042 | Bacteria | 1160 |
| 241 | Ga0075363_100004421 | 3300006048 | Bacteria | 6146 |
| 242 | Ga0075363_100055650 | 3300006048 | Bacteria | 2119 |
| 243 | Ga0075363_100071052 | 3300006048 | Bacteria | 1891 |
| 244 | Ga0075363_100145515 | 3300006048 | Bacteria | 1336 |
| 245 | Ga0075363_100149788 | 3300006048 | Bacteria | 1317 |
| 246 | Ga0075363_100183373 | 3300006048 | Bacteria | 1192 |
| 247 | Ga0075364_10018769 | 3300006051 | Bacteria | 4335 |
| 248 | Ga0075364_10032323 | 3300006051 | Bacteria | 3363 |
| 249 | Ga0070716_100002138 | 3300006173 | Bacteria | 9082 |
| 250 | Ga0070716_100075018 | 3300006173 | Bacteria | 2000 |
| 251 | Ga0070716_100079364 | 3300006173 | Bacteria | 1954 |
| 252 | Ga0070716_100191723 | 3300006173 | Bacteria | 1351 |
| 253 | Ga0070712_100020151 | 3300006175 | Bacteria | 4361 |
| 254 | Ga0070712_100031394 | 3300006175 | Bacteria | 3578 |
| 255 | Ga0070712_100063877 | 3300006175 | Bacteria | 2608 |
| 256 | Ga0075362_10127207 | 3300006177 | Bacteria | 1209 |
| 257 | Ga0075367_10026582 | 3300006178 | Bacteria | 3284 |
| 258 | Ga0075367_10035383 | 3300006178 | Bacteria | 2890 |
| 259 | Ga0075367_10051922 | 3300006178 | Bacteria | 2425 |
| 260 | Ga0075367_10091552 | 3300006178 | Bacteria | 1850 |
| 261 | Ga0075367_10150422 | 3300006178 | Bacteria | 1444 |
| 262 | Ga0075367_10171681 | 3300006178 | Bacteria | 1351 |
| 263 | Ga0075369_10052188 | 3300006186 | Bacteria | 1772 |
| 264 | Ga0075369_10068341 | 3300006186 | Bacteria | 1561 |
| 265 | Ga0075369_10098451 | 3300006186 | Bacteria | 1310 |
| 266 | Ga0075369_10111053 | 3300006186 | Bacteria | 1235 |
| 267 | Ga0075369_10160660 | 3300006186 | Bacteria | 1030 |
| 268 | Ga0075366_10006408 | 3300006195 | Bacteria | 6450 |
| 269 | Ga0075366_10271460 | 3300006195 | Bacteria | 1036 |
| 270 | Ga0097621_100158463 | 3300006237 | Bacteria | 1944 |
| 271 | Ga0097621_100501159 | 3300006237 | Bacteria | 1100 |
| 272 | Ga0097621_100551085 | 3300006237 | Bacteria | 1049 |
| 273 | Ga0075370_10038829 | 3300006353 | Bacteria | 2680 |
| 274 | Ga0075370_10221969 | 3300006353 | Bacteria | 1117 |
| 275 | Ga0075370_10233830 | 3300006353 | Bacteria | 1088 |
| 276 | Ga0075370_10289739 | 3300006353 | Bacteria | 973 |
| 277 | Ga0075370_10389473 | 3300006353 | Bacteria | 835 |
| 278 | Ga0068871_100023928 | 3300006358 | Bacteria | 4732 |
| 279 | Ga0068871_100196804 | 3300006358 | Bacteria | 1739 |
| 280 | Ga0075428_100003163 | 3300006844 | Bacteria | 17988 |
| 281 | Ga0075428_100327956 | 3300006844 | Bacteria | 1644 |
| 282 | Ga0075430_100079445 | 3300006846 | Bacteria | 2749 |
| 283 | Ga0075430_100143674 | 3300006846 | Bacteria | 1987 |
| 284 | Ga0075431_100140136 | 3300006847 | Bacteria | 2493 |
| 285 | Ga0075434_100118146 | 3300006871 | Bacteria | 2665 |
| 286 | Ga0075434_101024648 | 3300006871 | Bacteria | 839 |
| 287 | Ga0075429_100186434 | 3300006880 | Bacteria | 1818 |
| 288 | Ga0068865_100033374 | 3300006881 | Bacteria | 3446 |
| 289 | Ga0068865_100659721 | 3300006881 | Bacteria | 890 |
| 290 | Ga0068865_100690493 | 3300006881 | Bacteria | 871 |
| 291 | Ga0075436_100029854 | 3300006914 | Bacteria | 3750 |
| 292 | Ga0097620_100000552 | 3300006931 | Bacteria | 37180 |
| 293 | Ga0097620_100579120 | 3300006931 | Bacteria | 1216 |
| 294 | Ga0099824_1010514 | 3300006942 | Bacteria | 10865 |
| 295 | Ga0099822_1000007 | 3300006943 | Bacteria | 77453 |
| 296 | Ga0099823_1068738 | 3300006944 | Bacteria | 1627 |
| 297 | Ga0075435_100022140 | 3300007076 | Bacteria | 4900 |
| 298 | Ga0075435_100215709 | 3300007076 | Bacteria | 1629 |
| 299 | Ga0075435_100617734 | 3300007076 | Bacteria | 940 |
| 300 | Ga0099794_10054284 | 3300007265 | Bacteria | 1934 |
| 301 | Ga0099795_10004002 | 3300007788 | Bacteria | 3742 |
| 302 | Ga0105250_10018234 | 3300009092 | Bacteria | 2846 |
| 303 | Ga0105240_10004955 | 3300009093 | Bacteria | 20025 |
| 304 | Ga0105240_10024802 | 3300009093 | Bacteria | 7897 |
| 305 | Ga0105240_10060313 | 3300009093 | Bacteria | 4729 |
| 306 | Ga0111539_10383649 | 3300009094 | Bacteria | 1636 |
| 307 | Ga0105245_10068658 | 3300009098 | Bacteria | 3212 |
| 308 | Ga0105245_10250662 | 3300009098 | Bacteria | 1720 |
| 309 | Ga0105245_10320739 | 3300009098 | Bacteria | 1526 |
| 310 | Ga0105247_10013328 | 3300009101 | Bacteria | 4934 |
| 311 | Ga0105247_10040834 | 3300009101 | Bacteria | 2837 |
| 312 | Ga0105247_10041764 | 3300009101 | Bacteria | 2807 |
| 313 | Ga0105247_10081831 | 3300009101 | Bacteria | 2036 |
| 314 | Ga0114129_10109968 | 3300009147 | Bacteria | 3804 |
| 315 | Ga0114129_10169047 | 3300009147 | Bacteria | 2982 |
| 316 | Ga0114129_10512565 | 3300009147 | Bacteria | 1565 |
| 317 | Ga0114129_10894922 | 3300009147 | Bacteria | 1125 |
| 318 | Ga0105243_10131988 | 3300009148 | Bacteria | 2120 |
| 319 | Ga0105243_10304602 | 3300009148 | Bacteria | 1445 |
| 320 | Ga0105241_10002977 | 3300009174 | Bacteria | 12635 |
| 321 | Ga0105241_10112712 | 3300009174 | Bacteria | 2179 |
| 322 | Ga0105241_10165676 | 3300009174 | Bacteria | 1821 |
| 323 | Ga0105241_10237304 | 3300009174 | Bacteria | 1540 |
| 324 | Ga0105242_10072423 | 3300009176 | Bacteria | 2862 |
| 325 | Ga0105242_10483120 | 3300009176 | Bacteria | 1174 |
| 326 | Ga0105242_10821548 | 3300009176 | Bacteria | 922 |
| 327 | Ga0105248_10122665 | 3300009177 | Bacteria | 2931 |
| 328 | Ga0105248_10135059 | 3300009177 | Bacteria | 2783 |
| 329 | Ga0105248_10381948 | 3300009177 | Bacteria | 1586 |
| 330 | Ga0105237_10022854 | 3300009545 | Bacteria | 6414 |
| 331 | Ga0105237_10035721 | 3300009545 | Bacteria | 5028 |
| 332 | Ga0105237_10061282 | 3300009545 | Bacteria | 3762 |
| 333 | Ga0105237_10072136 | 3300009545 | Bacteria | 3447 |
| 334 | Ga0105237_10084285 | 3300009545 | Bacteria | 3169 |
| 335 | Ga0105237_10543896 | 3300009545 | Bacteria | 1168 |
| 336 | Ga0105237_10642574 | 3300009545 | Bacteria | 1068 |
| 337 | Ga0105237_11030567 | 3300009545 | Bacteria | 830 |
| 338 | Ga0105238_10000905 | 3300009551 | Bacteria | 30512 |
| 339 | Ga0105238_10052206 | 3300009551 | Bacteria | 4110 |
| 340 | Ga0105238_10142872 | 3300009551 | Bacteria | 2370 |
| 341 | Ga0105238_10176328 | 3300009551 | Bacteria | 2114 |
| 342 | Ga0105238_10179647 | 3300009551 | Bacteria | 2093 |
| 343 | Ga0105238_10960231 | 3300009551 | Bacteria | 875 |
| 344 | Ga0105238_11025786 | 3300009551 | Bacteria | 846 |
| 345 | Ga0105238_11039134 | 3300009551 | Bacteria | 841 |
| 346 | Ga0105249_10019788 | 3300009553 | Bacteria | 6009 |
| 347 | Ga0105249_10768850 | 3300009553 | Bacteria | 1026 |
| 348 | Ga0099796_10040034 | 3300010159 | Bacteria | 1580 |
| 349 | Ga0105239_10050601 | 3300010375 | Bacteria | 4557 |
| 350 | Ga0105239_10058274 | 3300010375 | Bacteria | 4238 |
| 351 | Ga0105239_10156490 | 3300010375 | Bacteria | 2545 |
| 352 | Ga0105239_10184109 | 3300010375 | Bacteria | 2337 |
| 353 | Ga0105239_10249142 | 3300010375 | Bacteria | 1995 |
| 354 | Ga0105239_10252241 | 3300010375 | Bacteria | 1982 |
| 355 | Ga0105239_10512499 | 3300010375 | Bacteria | 1364 |
| 356 | Ga0105239_10650354 | 3300010375 | Bacteria | 1204 |
| 357 | Ga0105239_10771866 | 3300010375 | Bacteria | 1101 |
| 358 | Ga0105239_10842182 | 3300010375 | Bacteria | 1052 |
| 359 | Ga0105246_10300405 | 3300011119 | Bacteria | 1296 |
| 360 | Ga0105246_10480271 | 3300011119 | Bacteria | 1051 |
| 361 | Ga0157370_10118471 | 3300013104 | Bacteria | 2473 |
| 362 | Ga0157370_10228965 | 3300013104 | Bacteria | 1721 |
| 363 | Ga0157369_10012163 | 3300013105 | Bacteria | 9768 |
| 364 | Ga0157369_10012723 | 3300013105 | Bacteria | 9543 |
| 365 | Ga0157369_10314320 | 3300013105 | Bacteria | 1629 |
| 366 | Ga0157369_10477983 | 3300013105 | Bacteria | 1289 |
| 367 | Ga0157374_10040671 | 3300013296 | Bacteria | 4282 |
| 368 | Ga0157374_10079260 | 3300013296 | Bacteria | 3112 |
| 369 | Ga0157374_10207460 | 3300013296 | Bacteria | 1921 |
| 370 | Ga0157378_10005478 | 3300013297 | Bacteria | 11123 |
| 371 | Ga0157378_10139561 | 3300013297 | Bacteria | 2250 |
| 372 | Ga0157378_10223052 | 3300013297 | Bacteria | 1793 |
| 373 | Ga0163162_10030064 | 3300013306 | Bacteria | 5380 |
| 374 | Ga0163162_10138945 | 3300013306 | Bacteria | 2541 |
| 375 | Ga0163162_10146801 | 3300013306 | Bacteria | 2475 |
| 376 | Ga0163162_10296887 | 3300013306 | Bacteria | 1747 |
| 377 | Ga0163162_10654073 | 3300013306 | Bacteria | 1174 |
| 378 | Ga0157372_10110926 | 3300013307 | Bacteria | 3142 |
| 379 | Ga0157375_10015063 | 3300013308 | Bacteria | 6915 |
| 380 | Ga0157375_10366657 | 3300013308 | Bacteria | 1607 |
| 381 | Ga0157375_10760094 | 3300013308 | Bacteria | 1120 |
| 382 | Ga0157375_11135778 | 3300013308 | Bacteria | 915 |
| 383 | Ga0163163_10002009 | 3300014325 | Bacteria | 17183 |
| 384 | Ga0163163_10052597 | 3300014325 | Bacteria | 4018 |
| 385 | Ga0163163_10243220 | 3300014325 | Bacteria | 1849 |
| 386 | Ga0157377_10029894 | 3300014745 | Bacteria | 2947 |
| 387 | Ga0157377_10062219 | 3300014745 | Bacteria | 2135 |
| 388 | Ga0157379_10018063 | 3300014968 | Bacteria | 6216 |
| 389 | Ga0157379_10219847 | 3300014968 | Bacteria | 1721 |
| 390 | Ga0157376_10017044 | 3300014969 | Bacteria | 5532 |
| 391 | Ga0157376_10480590 | 3300014969 | Bacteria | 1217 |
| 392 | Ga0157376_10998005 | 3300014969 | Bacteria | 859 |
| 393 | Ga0163161_10213800 | 3300017792 | Bacteria | 1490 |
| 394 | Ga0163161_10356814 | 3300017792 | Bacteria | 1163 |
| 395 | Ga0214544_1000016 | 3300021320 | Bacteria | 204278 |
| 396 | Ga0214542_1000016 | 3300021321 | Bacteria | 210332 |
| 397 | Ga0214545_1000008 | 3300021324 | Bacteria | 215190 |
| 398 | Ga0214543_1001466 | 3300021327 | Bacteria | 45567 |
| 399 | Ga0213873_10002209 | 3300021358 | Bacteria | 3344 |
| 400 | Ga0213874_10040486 | 3300021377 | Bacteria | 1391 |
| 401 | Ga0213876_10272946 | 3300021384 | Bacteria | 899 |
| 402 | Ga0213875_10038914 | 3300021388 | Bacteria | 2241 |
| 403 | Ga0224712_10123849 | 3300022467 | Bacteria | 1122 |
| 404 | Ga0209563_102498 | 3300025230 | Bacteria | 4137 |
| 405 | Ga0207425_1011367 | 3300025245 | Bacteria | 2128 |
| 406 | Ga0209677_101570 | 3300025253 | Bacteria | 9703 |
| 407 | Ga0209677_102974 | 3300025253 | Bacteria | 5892 |
| 408 | Ga0209148_1000282 | 3300025254 | Bacteria | 78016 |
| 409 | Ga0209233_1001514 | 3300025261 | Bacteria | 9126 |
| 410 | Ga0209233_1003283 | 3300025261 | Bacteria | 5735 |
| 411 | Ga0209233_1003656 | 3300025261 | Bacteria | 5381 |
| 412 | Ga0209233_1012897 | 3300025261 | Bacteria | 2406 |
| 413 | Ga0209455_1009197 | 3300025272 | Bacteria | 2612 |
| 414 | Ga0209455_1011450 | 3300025272 | Bacteria | 2182 |
| 415 | Ga0209673_1028152 | 3300025273 | Bacteria | 1814 |
| 416 | Ga0209564_1000321 | 3300025295 | Bacteria | 93331 |
| 417 | Ga0209564_1006353 | 3300025295 | Bacteria | 6410 |
| 418 | Ga0209564_1014084 | 3300025295 | Bacteria | 3351 |
| 419 | Ga0209758_1000069 | 3300025297 | Bacteria | 286161 |
| 420 | Ga0209758_1000635 | 3300025297 | Bacteria | 53736 |
| 421 | Ga0209758_1001996 | 3300025297 | Bacteria | 21984 |
| 422 | Ga0209758_1002493 | 3300025297 | Bacteria | 18700 |
| 423 | Ga0209758_1003344 | 3300025297 | Bacteria | 14725 |
| 424 | Ga0209758_1004028 | 3300025297 | Bacteria | 12675 |
| 425 | Ga0209758_1027951 | 3300025297 | Bacteria | 2398 |
| 426 | Ga0209758_1035951 | 3300025297 | Bacteria | 1942 |
| 427 | Ga0209758_1046433 | 3300025297 | Bacteria | 1566 |
| 428 | Ga0209758_1064202 | 3300025297 | Bacteria | 1191 |
| 429 | Ga0209256_1003057 | 3300025299 | Bacteria | 12322 |
| 430 | Ga0209256_1009466 | 3300025299 | Bacteria | 4266 |
| 431 | Ga0209256_1011111 | 3300025299 | Bacteria | 3650 |
| 432 | Ga0209256_1014872 | 3300025299 | Bacteria | 2763 |
| 433 | Ga0209256_1032861 | 3300025299 | Bacteria | 1403 |
| 434 | Ga0207426_1001557 | 3300025302 | Bacteria | 18603 |
| 435 | Ga0207426_1009357 | 3300025302 | Bacteria | 3882 |
| 436 | Ga0207426_1015096 | 3300025302 | Bacteria | 2811 |
| 437 | Ga0209257_1000473 | 3300025304 | Bacteria | 73323 |
| 438 | Ga0207656_10001411 | 3300025321 | Bacteria | 7940 |
| 439 | Ga0207656_10212278 | 3300025321 | Bacteria | 939 |
| 440 | Ga0207653_10001291 | 3300025885 | Bacteria | 8147 |
| 441 | Ga0207692_10000829 | 3300025898 | Bacteria | 11083 |
| 442 | Ga0207692_10011684 | 3300025898 | Bacteria | 3747 |
| 443 | Ga0207642_10039988 | 3300025899 | Bacteria | 2043 |
| 444 | Ga0207642_10059098 | 3300025899 | Bacteria | 1771 |
| 445 | Ga0207642_10092932 | 3300025899 | Bacteria | 1495 |
| 446 | Ga0207710_10023217 | 3300025900 | Bacteria | 2665 |
| 447 | Ga0207710_10077581 | 3300025900 | Bacteria | 1535 |
| 448 | Ga0207710_10139602 | 3300025900 | Bacteria | 1169 |
| 449 | Ga0207710_10205766 | 3300025900 | Bacteria | 973 |
| 450 | Ga0207710_10246596 | 3300025900 | Bacteria | 892 |
| 451 | Ga0207688_10310976 | 3300025901 | Bacteria | 965 |
| 452 | Ga0207680_10058234 | 3300025903 | Bacteria | 2341 |
| 453 | Ga0207647_10002640 | 3300025904 | Bacteria | 13547 |
| 454 | Ga0207647_10009924 | 3300025904 | Bacteria | 6745 |
| 455 | Ga0207647_10092513 | 3300025904 | Bacteria | 1803 |
| 456 | Ga0207647_10118295 | 3300025904 | Bacteria | 1563 |
| 457 | Ga0207647_10313245 | 3300025904 | Bacteria | 892 |
| 458 | Ga0207699_10279320 | 3300025906 | Bacteria | 1160 |
| 459 | Ga0207699_10356925 | 3300025906 | Bacteria | 1033 |
| 460 | Ga0207643_10015771 | 3300025908 | Bacteria | 4115 |
| 461 | Ga0207705_10044726 | 3300025909 | Bacteria | 3182 |
| 462 | Ga0207705_10115404 | 3300025909 | Bacteria | 1987 |
| 463 | Ga0207684_10093369 | 3300025910 | Bacteria | 2566 |
| 464 | Ga0207684_10599729 | 3300025910 | Bacteria | 941 |
| 465 | Ga0207654_10000058 | 3300025911 | Bacteria | 75628 |
| 466 | Ga0207654_10051935 | 3300025911 | Bacteria | 2361 |
| 467 | Ga0207654_10087010 | 3300025911 | Bacteria | 1895 |
| 468 | Ga0207654_10106655 | 3300025911 | Bacteria | 1736 |
| 469 | Ga0207707_10013527 | 3300025912 | Bacteria | 7112 |
| 470 | Ga0207707_10017839 | 3300025912 | Bacteria | 6190 |
| 471 | Ga0207707_10028421 | 3300025912 | Bacteria | 4888 |
| 472 | Ga0207707_10109818 | 3300025912 | Bacteria | 2411 |
| 473 | Ga0207707_10187675 | 3300025912 | Bacteria | 1804 |
| 474 | Ga0207695_10000107 | 3300025913 | Bacteria | 252606 |
| 475 | Ga0207695_10000453 | 3300025913 | Bacteria | 89314 |
| 476 | Ga0207695_10031082 | 3300025913 | Bacteria | 5866 |
| 477 | Ga0207695_10043718 | 3300025913 | Bacteria | 4772 |
| 478 | Ga0207695_10146973 | 3300025913 | Bacteria | 2300 |
| 479 | Ga0207695_10521443 | 3300025913 | Bacteria | 1070 |
| 480 | Ga0207671_10010799 | 3300025914 | Bacteria | 7492 |
| 481 | Ga0207671_10033398 | 3300025914 | Bacteria | 3828 |
| 482 | Ga0207671_10063842 | 3300025914 | Bacteria | 2737 |
| 483 | Ga0207671_10103876 | 3300025914 | Bacteria | 2155 |
| 484 | Ga0207671_10108006 | 3300025914 | Bacteria | 2115 |
| 485 | Ga0207671_10352206 | 3300025914 | Bacteria | 1168 |
| 486 | Ga0207693_10005993 | 3300025915 | Bacteria | 10080 |
| 487 | Ga0207693_10036014 | 3300025915 | Bacteria | 3900 |
| 488 | Ga0207693_10066025 | 3300025915 | Bacteria | 2833 |
| 489 | Ga0207693_10187863 | 3300025915 | Bacteria | 1626 |
| 490 | Ga0207663_10009652 | 3300025916 | Bacteria | 5107 |
| 491 | Ga0207663_10482355 | 3300025916 | Bacteria | 961 |
| 492 | Ga0207660_10024131 | 3300025917 | Bacteria | 4113 |
| 493 | Ga0207660_10052109 | 3300025917 | Bacteria | 2912 |
| 494 | Ga0207660_10144075 | 3300025917 | Bacteria | 1824 |
| 495 | Ga0207660_10171945 | 3300025917 | Bacteria | 1677 |
| 496 | Ga0207660_10297710 | 3300025917 | Bacteria | 1284 |
| 497 | Ga0207657_10030836 | 3300025919 | Bacteria | 4860 |
| 498 | Ga0207657_10165227 | 3300025919 | Bacteria | 1796 |
| 499 | Ga0207649_10072759 | 3300025920 | Bacteria | 2200 |
| 500 | Ga0207649_10129117 | 3300025920 | Bacteria | 1714 |
| 501 | Ga0207652_10053324 | 3300025921 | Bacteria | 3474 |
| 502 | Ga0207652_10115064 | 3300025921 | Bacteria | 2389 |
| 503 | Ga0207652_10211968 | 3300025921 | Bacteria | 1744 |
| 504 | Ga0207646_10018594 | 3300025922 | Bacteria | 6479 |
| 505 | Ga0207681_10141583 | 3300025923 | Bacteria | 1792 |
| 506 | Ga0207681_10348835 | 3300025923 | Bacteria | 1184 |
| 507 | Ga0207681_10582296 | 3300025923 | Bacteria | 923 |
| 508 | Ga0207694_10001009 | 3300025924 | Bacteria | 24556 |
| 509 | Ga0207694_10034962 | 3300025924 | Bacteria | 3853 |
| 510 | Ga0207694_10109571 | 3300025924 | Bacteria | 2196 |
| 511 | Ga0207694_10208492 | 3300025924 | Bacteria | 1591 |
| 512 | Ga0207694_10242338 | 3300025924 | Bacteria | 1474 |
| 513 | Ga0207694_10809670 | 3300025924 | Bacteria | 791 |
| 514 | Ga0207650_10040176 | 3300025925 | Bacteria | 3421 |
| 515 | Ga0207650_10521255 | 3300025925 | Bacteria | 995 |
| 516 | Ga0207659_10366350 | 3300025926 | Bacteria | 1199 |
| 517 | Ga0207659_10474223 | 3300025926 | Bacteria | 1056 |
| 518 | Ga0207687_10009731 | 3300025927 | Bacteria | 6289 |
| 519 | Ga0207687_10217459 | 3300025927 | Bacteria | 1502 |
| 520 | Ga0207700_10008018 | 3300025928 | Bacteria | 6511 |
| 521 | Ga0207700_10021866 | 3300025928 | Bacteria | 4377 |
| 522 | Ga0207700_10023612 | 3300025928 | Bacteria | 4244 |
| 523 | Ga0207700_10121194 | 3300025928 | Bacteria | 2121 |
| 524 | Ga0207700_10152606 | 3300025928 | Bacteria | 1910 |
| 525 | Ga0207664_10044473 | 3300025929 | Bacteria | 3478 |
| 526 | Ga0207664_10212597 | 3300025929 | Bacteria | 1674 |
| 527 | Ga0207664_10763008 | 3300025929 | Bacteria | 870 |
| 528 | Ga0207644_10025678 | 3300025931 | Bacteria | 4052 |
| 529 | Ga0207690_10245586 | 3300025932 | Bacteria | 1380 |
| 530 | Ga0207706_10029638 | 3300025933 | Bacteria | 4885 |
| 531 | Ga0207706_10151733 | 3300025933 | Bacteria | 2038 |
| 532 | Ga0207706_10309410 | 3300025933 | Bacteria | 1376 |
| 533 | Ga0207706_10403739 | 3300025933 | Bacteria | 1185 |
| 534 | Ga0207686_10360543 | 3300025934 | Bacteria | 1097 |
| 535 | Ga0207686_10670756 | 3300025934 | Bacteria | 822 |
| 536 | Ga0207709_10015439 | 3300025935 | Bacteria | 4235 |
| 537 | Ga0207709_10278026 | 3300025935 | Bacteria | 1235 |
| 538 | Ga0207709_10332769 | 3300025935 | Bacteria | 1140 |
| 539 | Ga0207709_10780677 | 3300025935 | Bacteria | 770 |
| 540 | Ga0207669_10024147 | 3300025937 | Bacteria | 3262 |
| 541 | Ga0207669_10257497 | 3300025937 | Bacteria | 1303 |
| 542 | Ga0207669_10318306 | 3300025937 | Bacteria | 1190 |
| 543 | Ga0207704_10324519 | 3300025938 | Bacteria | 1189 |
| 544 | Ga0207704_10440162 | 3300025938 | Bacteria | 1038 |
| 545 | Ga0207665_10003377 | 3300025939 | Bacteria | 10687 |
| 546 | Ga0207665_10028331 | 3300025939 | Bacteria | 3699 |
| 547 | Ga0207665_10058458 | 3300025939 | Bacteria | 2607 |
| 548 | Ga0207665_10295674 | 3300025939 | Bacteria | 1209 |
| 549 | Ga0207665_10362814 | 3300025939 | Bacteria | 1096 |
| 550 | Ga0207691_10064010 | 3300025940 | Bacteria | 3333 |
| 551 | Ga0207691_10248585 | 3300025940 | Bacteria | 1536 |
| 552 | Ga0207711_10125984 | 3300025941 | Bacteria | 2291 |
| 553 | Ga0207711_10144901 | 3300025941 | Bacteria | 2139 |
| 554 | Ga0207711_10146472 | 3300025941 | Bacteria | 2128 |
| 555 | Ga0207711_10162548 | 3300025941 | Bacteria | 2022 |
| 556 | Ga0207689_10031383 | 3300025942 | Bacteria | 4424 |
| 557 | Ga0207689_10052519 | 3300025942 | Bacteria | 3358 |
| 558 | Ga0207689_10055221 | 3300025942 | Bacteria | 3269 |
| 559 | Ga0207689_10181973 | 3300025942 | Bacteria | 1733 |
| 560 | Ga0207689_10203277 | 3300025942 | Bacteria | 1635 |
| 561 | Ga0207689_10407015 | 3300025942 | Bacteria | 1134 |
| 562 | Ga0207661_10143290 | 3300025944 | Bacteria | 2058 |
| 563 | Ga0207661_10228193 | 3300025944 | Bacteria | 1648 |
| 564 | Ga0207661_10626874 | 3300025944 | Bacteria | 988 |
| 565 | Ga0207679_10870463 | 3300025945 | Bacteria | 823 |
| 566 | Ga0207667_10006596 | 3300025949 | Bacteria | 14034 |
| 567 | Ga0207667_10037711 | 3300025949 | Bacteria | 5165 |
| 568 | Ga0207667_10105813 | 3300025949 | Bacteria | 2903 |
| 569 | Ga0207667_10193127 | 3300025949 | Bacteria | 2089 |
| 570 | Ga0207667_10352964 | 3300025949 | Bacteria | 1500 |
| 571 | Ga0207667_11052624 | 3300025949 | Bacteria | 799 |
| 572 | Ga0207651_10376984 | 3300025960 | Bacteria | 1201 |
| 573 | Ga0207712_10028935 | 3300025961 | Bacteria | 3712 |
| 574 | Ga0207712_10113707 | 3300025961 | Bacteria | 2035 |
| 575 | Ga0207712_10748922 | 3300025961 | Bacteria | 856 |
| 576 | Ga0207668_10027531 | 3300025972 | Bacteria | 3703 |
| 577 | Ga0207668_10075178 | 3300025972 | Bacteria | 2428 |
| 578 | Ga0207668_10090395 | 3300025972 | Bacteria | 2247 |
| 579 | Ga0207668_10170900 | 3300025972 | Bacteria | 1704 |
| 580 | Ga0207668_10184240 | 3300025972 | Bacteria | 1649 |
| 581 | Ga0207668_10281417 | 3300025972 | Bacteria | 1364 |
| 582 | Ga0207668_10289273 | 3300025972 | Bacteria | 1347 |
| 583 | Ga0207668_10304916 | 3300025972 | Bacteria | 1315 |
| 584 | Ga0207640_10022087 | 3300025981 | Bacteria | 3803 |
| 585 | Ga0207640_10311597 | 3300025981 | Bacteria | 1249 |
| 586 | Ga0207640_10649869 | 3300025981 | Bacteria | 898 |
| 587 | Ga0207658_10041912 | 3300025986 | Bacteria | 3318 |
| 588 | Ga0207677_10073034 | 3300026023 | Bacteria | 2428 |
| 589 | Ga0207677_10196236 | 3300026023 | Bacteria | 1601 |
| 590 | Ga0207677_10247050 | 3300026023 | Bacteria | 1447 |
| 591 | Ga0207703_10038395 | 3300026035 | Bacteria | 3821 |
| 592 | Ga0207703_10108532 | 3300026035 | Bacteria | 2364 |
| 593 | Ga0207703_10437051 | 3300026035 | Bacteria | 1220 |
| 594 | Ga0207639_10006610 | 3300026041 | Bacteria | 7886 |
| 595 | Ga0207639_10165446 | 3300026041 | Bacteria | 1868 |
| 596 | Ga0207639_10226004 | 3300026041 | Bacteria | 1619 |
| 597 | Ga0207639_10264035 | 3300026041 | Bacteria | 1507 |
| 598 | Ga0207639_10680816 | 3300026041 | Bacteria | 953 |
| 599 | Ga0207678_10003936 | 3300026067 | Bacteria | 13364 |
| 600 | Ga0207678_10008827 | 3300026067 | Bacteria | 8872 |
| 601 | Ga0207678_10035234 | 3300026067 | Bacteria | 4357 |
| 602 | Ga0207678_10048383 | 3300026067 | Bacteria | 3675 |
| 603 | Ga0207678_10064168 | 3300026067 | Bacteria | 3156 |
| 604 | Ga0207678_10108573 | 3300026067 | Bacteria | 2367 |
| 605 | Ga0207678_10225927 | 3300026067 | Bacteria | 1603 |
| 606 | Ga0207678_10240076 | 3300026067 | Bacteria | 1552 |
| 607 | Ga0207678_10263171 | 3300026067 | Bacteria | 1478 |
| 608 | Ga0207678_10377778 | 3300026067 | Bacteria | 1225 |
| 609 | Ga0207678_10515548 | 3300026067 | Bacteria | 1043 |
| 610 | Ga0207708_10000637 | 3300026075 | Bacteria | 26948 |
| 611 | Ga0207708_10069101 | 3300026075 | Bacteria | 2704 |
| 612 | Ga0207702_10000004 | 3300026078 | Bacteria | 422182 |
| 613 | Ga0207702_10000559 | 3300026078 | Bacteria | 41394 |
| 614 | Ga0207702_10051440 | 3300026078 | Bacteria | 3481 |
| 615 | Ga0207702_10264986 | 3300026078 | Bacteria | 1619 |
| 616 | Ga0207702_10488838 | 3300026078 | Bacteria | 1199 |
| 617 | Ga0207641_10411949 | 3300026088 | Bacteria | 1300 |
| 618 | Ga0207648_10243993 | 3300026089 | Bacteria | 1600 |
| 619 | Ga0207648_10256305 | 3300026089 | Bacteria | 1560 |
| 620 | Ga0207676_10031791 | 3300026095 | Bacteria | 3971 |
| 621 | Ga0207676_10052297 | 3300026095 | Bacteria | 3192 |
| 622 | Ga0207676_10059998 | 3300026095 | Bacteria | 3006 |
| 623 | Ga0207676_10190154 | 3300026095 | Bacteria | 1806 |
| 624 | Ga0207676_10278695 | 3300026095 | Bacteria | 1517 |
| 625 | Ga0207674_10002298 | 3300026116 | Bacteria | 24210 |
| 626 | Ga0207674_10002522 | 3300026116 | Bacteria | 23081 |
| 627 | Ga0207674_10008231 | 3300026116 | Bacteria | 12077 |
| 628 | Ga0207674_10234853 | 3300026116 | Bacteria | 1781 |
| 629 | Ga0207674_10298802 | 3300026116 | Bacteria | 1559 |
| 630 | Ga0207674_10645327 | 3300026116 | Bacteria | 1022 |
| 631 | Ga0207674_10875719 | 3300026116 | Bacteria | 866 |
| 632 | Ga0207675_100047846 | 3300026118 | Bacteria | 3992 |
| 633 | Ga0207675_100084190 | 3300026118 | Bacteria | 2984 |
| 634 | Ga0207675_100106861 | 3300026118 | Bacteria | 2639 |
| 635 | Ga0207675_100243210 | 3300026118 | Bacteria | 1739 |
| 636 | Ga0207683_10318085 | 3300026121 | Bacteria | 1425 |
| 637 | Ga0207683_10345208 | 3300026121 | Bacteria | 1366 |
| 638 | Ga0207683_10422781 | 3300026121 | Bacteria | 1227 |
| 639 | Ga0207698_10092147 | 3300026142 | Bacteria | 2483 |
| 640 | Ga0207698_10458540 | 3300026142 | Bacteria | 1232 |
| 641 | Ga0207698_10590230 | 3300026142 | Bacteria | 1094 |
| 642 | Ga0207698_10653924 | 3300026142 | Bacteria | 1041 |
| 643 | Ga0209389_1000033 | 3300027296 | Bacteria | 131516 |
| 644 | Ga0209389_1000071 | 3300027296 | Bacteria | 97411 |
| 645 | Ga0209589_1000021 | 3300027357 | Bacteria | 186431 |
| 646 | Ga0209589_1000040 | 3300027357 | Bacteria | 126550 |
| 647 | Ga0209489_100028 | 3300027361 | Bacteria | 186431 |
| 648 | Ga0209489_100045 | 3300027361 | Bacteria | 158225 |
| 649 | Ga0209489_100209 | 3300027361 | Bacteria | 96349 |
| 650 | Ga0209700_100011 | 3300027363 | Bacteria | 362159 |
| 651 | Ga0209700_100037 | 3300027363 | Bacteria | 186431 |
| 652 | Ga0209588_1001299 | 3300027671 | Bacteria | 6490 |
| 653 | Ga0209588_1019980 | 3300027671 | Bacteria | 2095 |
| 654 | Ga0209813_10000201 | 3300027866 | Bacteria | 18489 |
| 655 | Ga0209813_10064936 | 3300027866 | Bacteria | 1174 |
| 656 | Ga0268266_10001190 | 3300028379 | Bacteria | 32120 |
| 657 | Ga0268266_10024290 | 3300028379 | Bacteria | 5156 |
| 658 | Ga0268266_10026628 | 3300028379 | Bacteria | 4920 |
| 659 | Ga0268266_10034776 | 3300028379 | Bacteria | 4286 |
| 660 | Ga0268266_10045773 | 3300028379 | Bacteria | 3744 |
| 661 | Ga0268266_10203004 | 3300028379 | Bacteria | 1815 |
| 662 | Ga0268266_10272296 | 3300028379 | Bacteria | 1572 |
| 663 | Ga0268266_10307893 | 3300028379 | Bacteria | 1479 |
| 664 | Ga0268266_10372513 | 3300028379 | Bacteria | 1345 |
| 665 | Ga0268266_10485275 | 3300028379 | Bacteria | 1178 |
| 666 | Ga0268266_10895502 | 3300028379 | Bacteria | 858 |
| 667 | Ga0268265_10000577 | 3300028380 | Bacteria | 37110 |
| 668 | Ga0268265_10077153 | 3300028380 | Bacteria | 2616 |
| 669 | Ga0268265_10368038 | 3300028380 | Bacteria | 1318 |
| 670 | Ga0268264_10001716 | 3300028381 | Bacteria | 20182 |
| 671 | Ga0268264_10239887 | 3300028381 | Bacteria | 1678 |
| 672 | Ga0268264_10469921 | 3300028381 | Bacteria | 1222 |
| 673 | Ga0268264_10475295 | 3300028381 | Bacteria | 1215 |
| 674 | Ga0265319_1006443 | 3300028563 | Bacteria | 5435 |
| 675 | Ga0265323_10018813 | 3300028653 | Bacteria | 2669 |
| 676 | Ga0265336_10000561 | 3300028666 | Bacteria | 21059 |
| 677 | Ga0307517_10001338 | 3300028786 | Bacteria | 41372 |
| 678 | Ga0307515_10142658 | 3300028794 | Bacteria | 2559 |
| 679 | Ga0307515_10405672 | 3300028794 | Bacteria | 987 |
| 680 | Ga0265338_10000598 | 3300028800 | Bacteria | 63497 |
| 681 | Ga0265324_10005564 | 3300029957 | Bacteria | 5419 |
| 682 | Ga0265330_10026023 | 3300031235 | Bacteria | 2650 |
| 683 | Ga0265330_10036526 | 3300031235 | Bacteria | 2189 |
| 684 | Ga0265340_10004461 | 3300031247 | Bacteria | 7825 |
| 685 | Ga0265339_10068118 | 3300031249 | Bacteria | 1903 |
| 686 | Ga0265331_10000700 | 3300031250 | Bacteria | 28604 |
| 687 | Ga0265316_10149532 | 3300031344 | Bacteria | 1750 |
| 688 | Ga0307513_10068868 | 3300031456 | Bacteria | 3705 |
| 689 | Ga0307509_10211654 | 3300031507 | Bacteria | 1762 |
| 690 | Ga0265313_10000325 | 3300031595 | Bacteria | 51942 |
| 691 | Ga0307508_10000002 | 3300031616 | Bacteria | 407635 |
| 692 | Ga0307508_10087616 | 3300031616 | Bacteria | 2697 |
| 693 | Ga0307508_10199084 | 3300031616 | Bacteria | 1604 |
| 694 | Ga0307508_10241422 | 3300031616 | Bacteria | 1404 |
| 695 | Ga0307508_10393947 | 3300031616 | Bacteria | 976 |
| 696 | Ga0265314_10019063 | 3300031711 | Bacteria | 5323 |
| 697 | Ga0265342_10007101 | 3300031712 | Bacteria | 8248 |
| 698 | Ga0265342_10119391 | 3300031712 | Bacteria | 1486 |
| 699 | Ga0265342_10155282 | 3300031712 | Bacteria | 1268 |
| 700 | Ga0316578_10289696 | 3300031728 | Bacteria | 980 |
| 701 | Ga0307516_10026599 | 3300031730 | Bacteria | 5874 |
| 702 | Ga0307516_10345552 | 3300031730 | Bacteria | 1154 |
| 703 | Ga0307405_10097272 | 3300031731 | Bacteria | 1965 |
| 704 | Ga0316577_10118269 | 3300031733 | Bacteria | 1489 |
| 705 | Ga0307413_10202590 | 3300031824 | Bacteria | 1434 |
| 706 | Ga0307518_10295003 | 3300031838 | Bacteria | 991 |
| 707 | Ga0307406_10267896 | 3300031901 | Bacteria | 1296 |
| 708 | Ga0307412_10172095 | 3300031911 | Bacteria | 1620 |
| 709 | Ga0307412_10694922 | 3300031911 | Bacteria | 872 |
| 710 | Ga0307409_100048824 | 3300031995 | Bacteria | 3223 |
| 711 | Ga0307416_100859551 | 3300032002 | Bacteria | 1005 |
| 712 | Ga0307411_10252908 | 3300032005 | Bacteria | 1386 |
| 713 | Ga0307415_100095379 | 3300032126 | Bacteria | 2165 |
| 714 | Ga0307510_10016711 | 3300033180 | Bacteria | 8658 |
| 715 | Ga0307510_10018241 | 3300033180 | Bacteria | 8262 |
| 716 | Ga0307510_10022224 | 3300033180 | Bacteria | 7372 |
| 717 | Ga0307510_10047066 | 3300033180 | Bacteria | 4627 |
| 718 | Ga0315911_1000008 | 3300033442 | Bacteria | 381285 |
| 719 | Ga0373926_0163504 | 3300035083 | Bacteria | 850 |
| 720 | Ga0373934_0001837 | 3300035086 | Bacteria | 7804 |
| 721 | Ga0373934_0002847 | 3300035086 | Bacteria | 6327 |
| 722 | Ga0373944_0129169 | 3300035089 | Bacteria | 877 |
| 723 | Ga0373923_0000584 | 3300035111 | Bacteria | 9020 |
| 724 | Ga0373923_0125509 | 3300035111 | Bacteria | 1150 |
| 725 | Ga0373932_0016536 | 3300035112 | Bacteria | 1884 |
| 726 | Ga0373936_0031970 | 3300035113 | Bacteria | 2080 |
| 727 | Ga0373936_0088046 | 3300035113 | Bacteria | 1299 |
| 728 | Ga0373936_0126658 | 3300035113 | Bacteria | 1095 |
| 729 | Ga0373936_0139402 | 3300035113 | Bacteria | 1046 |
| 730 | Ga0373936_0190110 | 3300035113 | Bacteria | 903 |
| 731 | Ga0373939_0003296 | 3300035114 | Bacteria | 3790 |
| 732 | Ga0373939_0168086 | 3300035114 | Bacteria | 810 |
| 733 | Ga0373945_0027218 | 3300035116 | Bacteria | 1996 |
| 734 | Ga0373945_0153580 | 3300035116 | Bacteria | 934 |
| 735 | Ga0373953_0004679 | 3300035117 | Bacteria | 4382 |
| 736 | Ga0373953_0018328 | 3300035117 | Bacteria | 2588 |
| 737 | Ga0373954_0000457 | 3300035118 | Bacteria | 15282 |
| 738 | Ga0373956_0002107 | 3300035119 | Bacteria | 8239 |
| 739 | Ga0373956_0083129 | 3300035119 | Bacteria | 1471 |
| 740 | Ga0373957_0015297 | 3300035120 | Bacteria | 2638 |
| 741 | Ga0373960_0078815 | 3300035121 | Bacteria | 1033 |
| 742 | Ga0373943_0001945 | 3300035170 | Bacteria | 9358 |
| 743 | Ga0373943_0062532 | 3300035170 | Bacteria | 1864 |
| 744 | Ga0373946_0195388 | 3300035171 | Bacteria | 967 |
| 745 | Ga0373955_0001753 | 3300035172 | Bacteria | 9318 |
| 746 | Ga0373955_0063919 | 3300035172 | Bacteria | 2038 |
| 747 | Ga0316574_0002266 | 3300035398 | Bacteria | 9590 |
| 748 | Ga0373924_0000541 | 3300035410 | Bacteria | 11623 |
| 749 | Ga0373924_0021576 | 3300035410 | Bacteria | 2512 |
| 750 | Ga0373931_0003137 | 3300035691 | Bacteria | 7381 |
| 751 | Ga0373931_0479520 | 3300035691 | Bacteria | 799 |
| 752 | Ga0373935_0000557 | 3300035692 | Bacteria | 19409 |
| 753 | Ga0373935_0388131 | 3300035692 | Bacteria | 1001 |
| 754 | Ga0373935_0474525 | 3300035692 | Bacteria | 906 |
| 755 | Ga0373927_0003023 | 3300035695 | Bacteria | 12202 |
| 756 | Ga0373927_0004813 | 3300035695 | Bacteria | 9384 |
| 757 | Ga0373927_0058310 | 3300035695 | Bacteria | 2497 |
| 758 | Ga0373927_0096117 | 3300035695 | Bacteria | 1926 |
| 759 | Ga0373927_0187577 | 3300035695 | Bacteria | 1356 |
| 760 | Ga0373933_0000031 | 3300035724 | Bacteria | 85038 |
| 761 | Ga0373933_0004255 | 3300035724 | Bacteria | 7878 |
| 762 | Ga0373933_0011282 | 3300035724 | Bacteria | 4919 |
| 763 | Ga0373947_0000509 | 3300035725 | Bacteria | 22579 |
| 764 | Ga0373947_0035886 | 3300035725 | Bacteria | 2937 |
| 765 | Ga0373937_0079894 | 3300036401 | Bacteria | 3023 |
| 766 | Ga0373937_0127768 | 3300036401 | Bacteria | 2372 |
| 767 | Ga0316582_0084703 | 3300036647 | Bacteria | 2076 |
| 768 | Ga0373925_0004758 | 3300037068 | Bacteria | 10224 |
| 769 | Ga0373925_0017744 | 3300037068 | Bacteria | 5165 |
| 770 | Ga0373925_0099882 | 3300037068 | Bacteria | 2229 |
| 771 | Ga0373925_0460784 | 3300037068 | Bacteria | 1042 |
| 772 | Ga0395899_0360909 | 3300037312 | Bacteria | 970 |
| 773 | Ga0395899_0482907 | 3300037312 | Bacteria | 806 |
| 774 | Ga0395900_0001984 | 3300037418 | Bacteria | 23107 |
| 775 | Ga0395900_0028654 | 3300037418 | Bacteria | 5707 |
| 776 | Ga0395900_0072755 | 3300037418 | Bacteria | 3534 |
| 777 | Ga0395900_0199514 | 3300037418 | Bacteria | 2025 |
| 778 | Ga0395900_0261538 | 3300037418 | Bacteria | 1728 |
| 779 | Ga0395900_0388182 | 3300037418 | Bacteria | 1363 |
| 780 | Ga0395900_0391262 | 3300037418 | Bacteria | 1356 |
| 781 | Ga0395900_0505065 | 3300037418 | Bacteria | 1159 |
| 782 | Ga0395898_0058535 | 3300037466 | Bacteria | 3751 |
| 783 | Ga0395898_0066890 | 3300037466 | Bacteria | 3480 |
| 784 | Ga0395898_0072108 | 3300037466 | Bacteria | 3337 |
| 785 | Ga0395898_0101184 | 3300037466 | Bacteria | 2767 |
| 786 | Ga0395898_0113725 | 3300037466 | Bacteria | 2594 |
| 787 | Ga0395898_0160769 | 3300037466 | Bacteria | 2148 |
| 788 | Ga0395898_0206756 | 3300037466 | Bacteria | 1873 |
| 789 | Ga0395898_0506185 | 3300037466 | Bacteria | 1148 |
| 790 | Ga0395905_0005856 | 3300037471 | Bacteria | 12492 |
| 791 | Ga0395905_0225768 | 3300037471 | Bacteria | 1752 |
| 792 | Ga0395905_0401113 | 3300037471 | Bacteria | 1266 |
| 793 | Ga0395905_0529380 | 3300037471 | Bacteria | 1079 |
| 794 | Ga0436364_1438024 | 3300037853 | Bacteria | 2957 |
| 795 | Ga0395901_0014044 | 3300038443 | Bacteria | 8151 |
| 796 | Ga0395901_0107414 | 3300038443 | Bacteria | 2929 |
| 797 | Ga0395901_0189853 | 3300038443 | Bacteria | 2155 |
| 798 | Ga0395901_0898643 | 3300038443 | Bacteria | 868 |
| 799 | Ga0400483_033818 | 3300039062 | Bacteria | 9422 |
| 800 | Ga0436365_0195546 | 3300039437 | Bacteria | 3325 |
| 801 | Ga0436365_0729277 | 3300039437 | Bacteria | 2080 |
| 802 | Ga0436365_1220818 | 3300039437 | Bacteria | 916 |
| 803 | Ga0436365_1292002 | 3300039437 | Bacteria | 1153 |
| 804 | Ga0436365_1496897 | 3300039437 | Bacteria | 1952 |
| 805 | Ga0436360_0889414 | 3300039438 | Bacteria | 2278 |
| 806 | Ga0436360_0928292 | 3300039438 | Bacteria | 1962 |
| 807 | Ga0436361_0341305 | 3300039447 | Bacteria | 1173 |
| 808 | Ga0436361_0355131 | 3300039447 | Bacteria | 3646 |
| 809 | Ga0436361_0442239 | 3300039447 | Bacteria | 3042 |
| 810 | Ga0436361_0533066 | 3300039447 | Bacteria | 3361 |
| 811 | Ga0436363_0403775 | 3300039450 | Bacteria | 729 |
| 812 | Ga0436363_0932690 | 3300039450 | Bacteria | 894 |
| 813 | Ga0436363_1449980 | 3300039450 | Bacteria | 3526 |
| 814 | Ga0436362_0490728 | 3300039453 | Bacteria | 4488 |
| 815 | Ga0439465_0033404 | 3300041413 | Bacteria | 1645 |
| 816 | Ga0451789_1337613 | 3300041443 | Bacteria | 1182 |
| 817 | Ga0451793_0572232 | 3300041452 | Bacteria | 1177 |
| 818 | Ga0451797_0433956 | 3300041453 | Bacteria | 1041 |
| 819 | Ga0451800_0679019 | 3300041459 | Bacteria | 1909 |
| 820 | Ga0451851_0220444 | 3300041507 | Bacteria | 1615 |
| 821 | Ga0451853_0380659 | 3300041512 | Bacteria | 2150 |
| 822 | Ga0439455_0027240 | 3300042012 | Bacteria | 1400 |
| 823 | Ga0466969_0253060 | 3300044656 | Bacteria | 798 |
| 824 | Ga0466972_0000119 | 3300044658 | Bacteria | 66620 |
| 825 | Ga0466972_0004617 | 3300044658 | Bacteria | 6897 |
| 826 | Ga0466972_0058819 | 3300044658 | Bacteria | 1845 |
| 827 | Ga0466972_0085741 | 3300044658 | Bacteria | 1497 |
| 828 | Ga0466961_0000139 | 3300044693 | Bacteria | 48781 |
| 829 | Ga0466961_0098994 | 3300044693 | Bacteria | 1838 |
| 830 | Ga0466963_0325288 | 3300044694 | Bacteria | 1082 |
| 831 | Ga0466964_0160025 | 3300044706 | Bacteria | 1051 |
| 832 | Ga0466964_0173420 | 3300044706 | Bacteria | 1017 |
| 833 | Ga0466968_0023996 | 3300044735 | Bacteria | 2490 |
| 834 | Ga0466968_0178539 | 3300044735 | Bacteria | 986 |
| 835 | Ga0466968_0197652 | 3300044735 | Bacteria | 941 |
| 836 | Ga0466957_0020746 | 3300044842 | Bacteria | 3867 |
| 837 | Ga0466957_0175921 | 3300044842 | Bacteria | 1396 |
| 838 | Ga0466960_0000848 | 3300044901 | Bacteria | 10813 |
| 839 | Ga0466959_0009300 | 3300045049 | Bacteria | 6983 |
| 840 | Ga0466958_0031879 | 3300045836 | Bacteria | 3133 |
| 841 | Ga0466967_0068408 | 3300045976 | Bacteria | 3171 |
| 842 | Ga0466967_0109024 | 3300045976 | Bacteria | 2541 |
| 843 | Ga0466967_0557124 | 3300045976 | Bacteria | 1128 |
| 844 | Ga0466967_0682387 | 3300045976 | Bacteria | 1017 |
| 845 | Ga0495617_021654 | 3300046452 | Bacteria | 2171 |
| 846 | Ga0495592_0005520 | 3300046454 | Bacteria | 9352 |
| 847 | Ga0495592_0046164 | 3300046454 | Bacteria | 3248 |
| 848 | Ga0495592_0067710 | 3300046454 | Bacteria | 2608 |
| 849 | Ga0495592_0200493 | 3300046454 | Bacteria | 1347 |
| 850 | Ga0495592_0253690 | 3300046454 | Bacteria | 1161 |
| 851 | Ga0495603_0000047 | 3300046455 | Bacteria | 53081 |
| 852 | Ga0495603_0008529 | 3300046455 | Bacteria | 6193 |
| 853 | Ga0495603_0107144 | 3300046455 | Bacteria | 1631 |
| 854 | Ga0495603_0162890 | 3300046455 | Bacteria | 1293 |
| 855 | Ga0495590_0052595 | 3300046457 | Bacteria | 1422 |
| 856 | Ga0495590_0109016 | 3300046457 | Bacteria | 987 |
| 857 | Ga0495629_0000124 | 3300046459 | Bacteria | 68796 |
| 858 | Ga0495629_0000412 | 3300046459 | Bacteria | 35827 |
| 859 | Ga0495629_0100107 | 3300046459 | Bacteria | 2023 |
| 860 | Ga0495629_0198429 | 3300046459 | Bacteria | 1388 |
| 861 | Ga0495629_0222311 | 3300046459 | Bacteria | 1302 |
| 862 | Ga0495638_0011840 | 3300046460 | Bacteria | 6001 |
| 863 | Ga0495641_0245720 | 3300046461 | Bacteria | 804 |
| 864 | Ga0495651_0001844 | 3300046462 | Bacteria | 16386 |
| 865 | Ga0495651_0041553 | 3300046462 | Bacteria | 3571 |
| 866 | Ga0495651_0143270 | 3300046462 | Bacteria | 1730 |
| 867 | Ga0495651_0182137 | 3300046462 | Bacteria | 1486 |
| 868 | Ga0495653_0003027 | 3300046463 | Bacteria | 13478 |
| 869 | Ga0495653_0133112 | 3300046463 | Bacteria | 1757 |
| 870 | Ga0495653_0184152 | 3300046463 | Bacteria | 1430 |
| 871 | Ga0495650_0070929 | 3300046471 | Bacteria | 1367 |
| 872 | Ga0495580_0001798 | 3300046472 | Bacteria | 18843 |
| 873 | Ga0495580_0150829 | 3300046472 | Bacteria | 1610 |
| 874 | Ga0495580_0234416 | 3300046472 | Bacteria | 1259 |
| 875 | Ga0495582_0000043 | 3300046473 | Bacteria | 63647 |
| 876 | Ga0495605_0190928 | 3300046474 | Bacteria | 896 |
| 877 | Ga0495639_0000091 | 3300046475 | Bacteria | 44027 |
| 878 | Ga0495639_0077374 | 3300046475 | Bacteria | 1544 |
| 879 | Ga0495662_0000128 | 3300046476 | Bacteria | 28645 |
| 880 | Ga0495664_0018008 | 3300046477 | Bacteria | 4040 |
| 881 | Ga0495664_0018674 | 3300046477 | Bacteria | 3977 |
| 882 | Ga0495664_0040679 | 3300046477 | Bacteria | 2749 |
| 883 | Ga0495664_0068058 | 3300046477 | Bacteria | 2125 |
| 884 | Ga0495664_0202272 | 3300046477 | Bacteria | 1203 |
| 885 | Ga0495584_0119345 | 3300046491 | Bacteria | 1335 |
| 886 | Ga0495585_0042226 | 3300046492 | Bacteria | 2555 |
| 887 | Ga0495585_0048141 | 3300046492 | Bacteria | 2371 |
| 888 | Ga0495585_0173329 | 3300046492 | Bacteria | 1113 |
| 889 | Ga0495585_0178127 | 3300046492 | Bacteria | 1094 |
| 890 | Ga0495594_0000710 | 3300046499 | Bacteria | 17143 |
| 891 | Ga0495594_0056271 | 3300046499 | Bacteria | 2170 |
| 892 | Ga0495594_0144129 | 3300046499 | Bacteria | 1351 |
| 893 | Ga0495594_0187144 | 3300046499 | Bacteria | 1179 |
| 894 | Ga0495607_0064946 | 3300046501 | Bacteria | 2060 |
| 895 | Ga0495607_0204727 | 3300046501 | Bacteria | 974 |
| 896 | Ga0495583_0043267 | 3300046506 | Bacteria | 2098 |
| 897 | Ga0495583_0088040 | 3300046506 | Bacteria | 1341 |
| 898 | Ga0495606_0000252 | 3300046507 | Bacteria | 94511 |
| 899 | Ga0495606_0027929 | 3300046507 | Bacteria | 3989 |
| 900 | Ga0495606_0138653 | 3300046507 | Bacteria | 1438 |
| 901 | Ga0495606_0173910 | 3300046507 | Bacteria | 1247 |
| 902 | Ga0495608_0005047 | 3300046511 | Bacteria | 9439 |
| 903 | Ga0495608_0018263 | 3300046511 | Bacteria | 4839 |
| 904 | Ga0495608_0064744 | 3300046511 | Bacteria | 2396 |
| 905 | Ga0495610_0031944 | 3300046512 | Bacteria | 2741 |
| 906 | Ga0495616_0005758 | 3300046513 | Bacteria | 7578 |
| 907 | Ga0495616_0046885 | 3300046513 | Bacteria | 2179 |
| 908 | Ga0495616_0094318 | 3300046513 | Bacteria | 1412 |
| 909 | Ga0495616_0127896 | 3300046513 | Bacteria | 1167 |
| 910 | Ga0495618_0008644 | 3300046514 | Bacteria | 6154 |
| 911 | Ga0495618_0028334 | 3300046514 | Bacteria | 3490 |
| 912 | Ga0495618_0042509 | 3300046514 | Bacteria | 2865 |
| 913 | Ga0495620_0041922 | 3300046515 | Bacteria | 2004 |
| 914 | Ga0495620_0086070 | 3300046515 | Bacteria | 1266 |
| 915 | Ga0495620_0132582 | 3300046515 | Bacteria | 977 |
| 916 | Ga0495620_0157811 | 3300046515 | Bacteria | 882 |
| 917 | Ga0495628_0005453 | 3300046516 | Bacteria | 11146 |
| 918 | Ga0495628_0010523 | 3300046516 | Bacteria | 7852 |
| 919 | Ga0495628_0055934 | 3300046516 | Bacteria | 3107 |
| 920 | Ga0495630_0000409 | 3300046517 | Bacteria | 33418 |
| 921 | Ga0495631_0035038 | 3300046518 | Bacteria | 2247 |
| 922 | Ga0495632_0067438 | 3300046519 | Bacteria | 1725 |
| 923 | Ga0495632_0189778 | 3300046519 | Bacteria | 939 |
| 924 | Ga0495637_0066063 | 3300046520 | Bacteria | 1471 |
| 925 | Ga0495643_0008158 | 3300046522 | Bacteria | 6663 |
| 926 | Ga0495643_0013337 | 3300046522 | Bacteria | 4923 |
| 927 | Ga0495643_0056515 | 3300046522 | Bacteria | 2094 |
| 928 | Ga0495643_0066401 | 3300046522 | Bacteria | 1903 |
| 929 | Ga0495644_0072873 | 3300046523 | Bacteria | 1291 |
| 930 | Ga0495644_0198607 | 3300046523 | Bacteria | 773 |
| 931 | Ga0495648_0000286 | 3300046524 | Bacteria | 57430 |
| 932 | Ga0495648_0013656 | 3300046524 | Bacteria | 5989 |
| 933 | Ga0495648_0029843 | 3300046524 | Bacteria | 3613 |
| 934 | Ga0495648_0035024 | 3300046524 | Bacteria | 3259 |
| 935 | Ga0495663_0014215 | 3300046525 | Bacteria | 2230 |
| 936 | Ga0495666_0270016 | 3300046526 | Bacteria | 772 |
| 937 | Ga0495642_0063578 | 3300046528 | Bacteria | 1534 |
| 938 | Ga0495652_0016312 | 3300046529 | Bacteria | 6644 |
| 939 | Ga0495652_0025438 | 3300046529 | Bacteria | 5238 |
| 940 | Ga0495652_0034509 | 3300046529 | Bacteria | 4408 |
| 941 | Ga0495652_0192811 | 3300046529 | Bacteria | 1553 |
| 942 | Ga0495652_0332104 | 3300046529 | Bacteria | 1095 |
| 943 | Ga0495654_0062024 | 3300046530 | Bacteria | 1793 |
| 944 | Ga0495654_0132946 | 3300046530 | Bacteria | 1115 |
| 945 | Ga0495665_0000051 | 3300046531 | Bacteria | 46836 |
| 946 | Ga0495665_0162928 | 3300046531 | Bacteria | 1162 |
| 947 | Ga0495640_0018056 | 3300046533 | Bacteria | 5243 |
| 948 | Ga0495640_0025585 | 3300046533 | Bacteria | 4278 |
| 949 | Ga0495640_0027089 | 3300046533 | Bacteria | 4137 |
| 950 | Ga0495640_0031307 | 3300046533 | Bacteria | 3798 |
| 951 | Ga0495640_0035828 | 3300046533 | Bacteria | 3510 |
| 952 | Ga0495640_0043249 | 3300046533 | Bacteria | 3138 |
| 953 | Ga0495640_0234618 | 3300046533 | Bacteria | 1153 |
| 954 | Ga0495587_0015106 | 3300046536 | Bacteria | 4825 |
| 955 | Ga0495587_0016155 | 3300046536 | Bacteria | 4646 |
| 956 | Ga0495587_0041570 | 3300046536 | Bacteria | 2742 |
| 957 | Ga0495587_0371553 | 3300046536 | Bacteria | 796 |
| 958 | Ga0495598_0011776 | 3300046537 | Bacteria | 2128 |
| 959 | Ga0495609_0226895 | 3300046538 | Bacteria | 774 |
| 960 | Ga0495621_0047012 | 3300046539 | Bacteria | 1533 |
| 961 | Ga0495597_0003622 | 3300046542 | Bacteria | 8887 |
| 962 | Ga0495597_0065994 | 3300046542 | Bacteria | 1569 |
| 963 | Ga0495645_0006035 | 3300046543 | Bacteria | 8380 |
| 964 | Ga0495645_0016860 | 3300046543 | Bacteria | 5228 |
| 965 | Ga0495645_0098789 | 3300046543 | Bacteria | 2077 |
| 966 | Ga0495622_0001949 | 3300046557 | Bacteria | 10132 |
| 967 | Ga0495622_0002870 | 3300046557 | Bacteria | 8227 |
| 968 | Ga0495622_0011450 | 3300046557 | Bacteria | 4099 |
| 969 | Ga0495622_0038866 | 3300046557 | Bacteria | 2215 |
| 970 | Ga0495622_0201031 | 3300046557 | Bacteria | 888 |
| 971 | Ga0495633_0060892 | 3300046558 | Bacteria | 1768 |
| 972 | Ga0495633_0101430 | 3300046558 | Bacteria | 1336 |
| 973 | Ga0495633_0237612 | 3300046558 | Bacteria | 832 |
| 974 | Ga0495667_0000551 | 3300046559 | Bacteria | 23946 |
| 975 | Ga0495667_0011016 | 3300046559 | Bacteria | 6113 |
| 976 | Ga0495667_0129900 | 3300046559 | Bacteria | 1625 |
| 977 | Ga0495656_0022981 | 3300046615 | Bacteria | 2448 |
| 978 | Ga0495656_0080058 | 3300046615 | Bacteria | 1472 |
| 979 | Ga0495656_0318560 | 3300046615 | Bacteria | 800 |
| 980 | Ga0495668_0040761 | 3300046616 | Bacteria | 2589 |
| 981 | Ga0495668_0059795 | 3300046616 | Bacteria | 2102 |
| 982 | Ga0495668_0109596 | 3300046616 | Bacteria | 1510 |
| 983 | Ga0495668_0124093 | 3300046616 | Bacteria | 1413 |
| 984 | Ga0495668_0125432 | 3300046616 | Bacteria | 1405 |
| 985 | Ga0495668_0145384 | 3300046616 | Bacteria | 1298 |
| 986 | Ga0495634_0000400 | 3300046642 | Bacteria | 42620 |
| 987 | Ga0495634_0022290 | 3300046642 | Bacteria | 4463 |
| 988 | Ga0495634_0078140 | 3300046642 | Bacteria | 2169 |
| 989 | Ga0495611_0120300 | 3300046648 | Bacteria | 1224 |
| 990 | Ga0495625_0011373 | 3300046660 | Bacteria | 7262 |
| 991 | Ga0495625_0053812 | 3300046660 | Bacteria | 2877 |
| 992 | Ga0495625_0076103 | 3300046660 | Bacteria | 2347 |
| 993 | Ga0495625_0088384 | 3300046660 | Bacteria | 2147 |
| 994 | Ga0495625_0089998 | 3300046660 | Bacteria | 2124 |
| 995 | Ga0495625_0136450 | 3300046660 | Bacteria | 1658 |
| 996 | Ga0495625_0157385 | 3300046660 | Bacteria | 1524 |
| 997 | Ga0495625_0260041 | 3300046660 | Bacteria | 1123 |
| 998 | Ga0495625_0361352 | 3300046660 | Bacteria | 915 |
| 999 | Ga0495635_0000620 | 3300046663 | Bacteria | 22835 |
| 1000 | Ga0495635_0023042 | 3300046663 | Bacteria | 4340 |
| 1001 | Ga0495635_0047375 | 3300046663 | Bacteria | 2965 |
| 1002 | Ga0495635_0066447 | 3300046663 | Bacteria | 2473 |
| 1003 | Ga0495659_0033909 | 3300046664 | Bacteria | 1793 |
| 1004 | Ga0495661_0014712 | 3300046665 | Bacteria | 5239 |
| 1005 | Ga0495588_0002713 | 3300046674 | Bacteria | 7586 |
| 1006 | Ga0495588_0005933 | 3300046674 | Bacteria | 5476 |
| 1007 | Ga0495588_0008572 | 3300046674 | Bacteria | 4696 |
| 1008 | Ga0495588_0157934 | 3300046674 | Bacteria | 1199 |
| 1009 | Ga0495657_0019076 | 3300046675 | Bacteria | 4953 |
| 1010 | Ga0495657_0119111 | 3300046675 | Bacteria | 1664 |
| 1011 | Ga0495599_0009152 | 3300046678 | Bacteria | 6041 |
| 1012 | Ga0495599_0124776 | 3300046678 | Bacteria | 1600 |
| 1013 | Ga0495623_0048735 | 3300046679 | Bacteria | 2686 |
| 1014 | Ga0495623_0050484 | 3300046679 | Bacteria | 2634 |
| 1015 | Ga0495623_0060554 | 3300046679 | Bacteria | 2375 |
| 1016 | Ga0495623_0155632 | 3300046679 | Bacteria | 1347 |
| 1017 | Ga0495646_0000643 | 3300046680 | Bacteria | 19081 |
| 1018 | Ga0495646_0025658 | 3300046680 | Bacteria | 3706 |
| 1019 | Ga0495646_0287961 | 3300046680 | Bacteria | 871 |
| 1020 | Ga0495647_0104602 | 3300046681 | Bacteria | 1175 |
| 1021 | Ga0495658_0000499 | 3300046683 | Bacteria | 21574 |
| 1022 | Ga0495658_0047627 | 3300046683 | Bacteria | 2415 |
| 1023 | Ga0495658_0339022 | 3300046683 | Bacteria | 955 |
| 1024 | Ga0495658_0429762 | 3300046683 | Bacteria | 843 |
| 1025 | Ga0495669_0091278 | 3300046684 | Bacteria | 1406 |
| 1026 | Ga0495669_0217009 | 3300046684 | Bacteria | 916 |
| 1027 | Ga0495613_0001280 | 3300046689 | Bacteria | 19201 |
| 1028 | Ga0495613_0064643 | 3300046689 | Bacteria | 2675 |
| 1029 | Ga0495613_0190097 | 3300046689 | Bacteria | 1451 |
| 1030 | Ga0495624_0003551 | 3300046690 | Bacteria | 11552 |
| 1031 | Ga0495624_0030201 | 3300046690 | Bacteria | 3531 |
| 1032 | Ga0495670_0003877 | 3300046691 | Bacteria | 7348 |
| 1033 | Ga0495670_0041117 | 3300046691 | Bacteria | 2306 |
| 1034 | Ga0495670_0088780 | 3300046691 | Bacteria | 1580 |
| 1035 | Ga0495671_0050005 | 3300046692 | Bacteria | 2083 |
| 1036 | Ga0495671_0104761 | 3300046692 | Bacteria | 1381 |
| 1037 | Ga0495671_0131066 | 3300046692 | Bacteria | 1223 |
| 1038 | Ga0495649_0066921 | 3300046694 | Bacteria | 1927 |
| 1039 | Ga0495649_0079820 | 3300046694 | Bacteria | 1750 |
| 1040 | Ga0495589_0226029 | 3300046794 | Bacteria | 878 |
| 1041 | Ga0495600_0001007 | 3300046809 | Bacteria | 15210 |
| 1042 | Ga0495600_0010354 | 3300046809 | Bacteria | 5786 |
| 1043 | Ga0495600_0087489 | 3300046809 | Bacteria | 2032 |
| 1044 | Ga0495660_0013521 | 3300046810 | Bacteria | 4729 |
| 1045 | Ga0495581_0003073 | 3300047315 | Bacteria | 9546 |
| 1046 | Ga0495581_0005324 | 3300047315 | Bacteria | 7441 |
| 1047 | Ga0495581_0091986 | 3300047315 | Bacteria | 1760 |
| 1048 | Ga0495581_0224865 | 3300047315 | Bacteria | 1098 |
| 1049 | Ga0495604_0005813 | 3300047317 | Bacteria | 9784 |
| 1050 | Ga0495604_0023465 | 3300047317 | Bacteria | 4921 |
| 1051 | Ga0495604_0135784 | 3300047317 | Bacteria | 1762 |
| 1052 | Ga0495604_0263505 | 3300047317 | Bacteria | 1170 |
| 1053 | Ga0495636_0114024 | 3300047318 | Bacteria | 1191 |
| 1054 | Ga0495674_0003683 | 3300047319 | Bacteria | 14908 |
| 1055 | Ga0495674_0005428 | 3300047319 | Bacteria | 12243 |
| 1056 | Ga0495674_0016652 | 3300047319 | Bacteria | 6858 |
| 1057 | Ga0495674_0064675 | 3300047319 | Bacteria | 3179 |
| 1058 | Ga0495674_0271751 | 3300047319 | Bacteria | 1390 |
| 1059 | Ga0495674_0444038 | 3300047319 | Bacteria | 1043 |
| 1060 | Ga0495674_0450403 | 3300047319 | Bacteria | 1034 |
| 1061 | Ga0495672_0030899 | 3300047320 | Bacteria | 3350 |
| 1062 | Ga0495672_0050522 | 3300047320 | Bacteria | 2453 |
| 1063 | Ga0495676_0062800 | 3300047321 | Bacteria | 2898 |
| 1064 | Ga0495676_0075836 | 3300047321 | Bacteria | 2570 |
| 1065 | Ga0495676_0102860 | 3300047321 | Bacteria | 2110 |
| 1066 | Ga0495676_0113187 | 3300047321 | Bacteria | 1987 |
| 1067 | Ga0495676_0203431 | 3300047321 | Bacteria | 1375 |
| 1068 | Ga0495676_0439825 | 3300047321 | Bacteria | 861 |
| 1069 | Ga0495680_0000689 | 3300047322 | Bacteria | 37846 |
| 1070 | Ga0495680_0001909 | 3300047322 | Bacteria | 21876 |
| 1071 | Ga0495680_0046311 | 3300047322 | Bacteria | 3429 |
| 1072 | Ga0495675_0001972 | 3300047444 | Bacteria | 12248 |
| 1073 | Ga0495675_0005931 | 3300047444 | Bacteria | 7465 |
| 1074 | Ga0495677_0074890 | 3300047445 | Bacteria | 1264 |
| 1075 | Ga0495685_033954 | 3300047447 | Bacteria | 1753 |
| 1076 | Ga0495673_0053426 | 3300047469 | Bacteria | 1761 |
| 1077 | Ga0495673_0077871 | 3300047469 | Bacteria | 1380 |
| 1078 | Ga0495681_0050784 | 3300047470 | Bacteria | 1953 |
| 1079 | Ga0495684_0000313 | 3300047471 | Bacteria | 39705 |
| 1080 | Ga0495684_0033360 | 3300047471 | Bacteria | 3949 |
| 1081 | Ga0495684_0035943 | 3300047471 | Bacteria | 3798 |
| 1082 | Ga0495686_0082012 | 3300047472 | Bacteria | 1968 |
| 1083 | Ga0495686_0087503 | 3300047472 | Bacteria | 1895 |
| 1084 | Ga0495686_0097506 | 3300047472 | Bacteria | 1777 |
| 1085 | Ga0495593_0000222 | 3300047673 | Bacteria | 30282 |
| 1086 | Ga0495593_0001524 | 3300047673 | Bacteria | 13627 |
| 1087 | Ga0495593_0027368 | 3300047673 | Bacteria | 3140 |
| 1088 | Ga0495593_0114504 | 3300047673 | Bacteria | 1375 |
| 1089 | Ga0495602_0018371 | 3300048088 | Bacteria | 6986 |
| 1090 | Ga0495602_0024168 | 3300048088 | Bacteria | 5899 |
| 1091 | Ga0495602_0057923 | 3300048088 | Bacteria | 3395 |
| 1092 | Ga0495602_0069055 | 3300048088 | Bacteria | 3031 |
| 1093 | Ga0495614_0006067 | 3300048089 | Bacteria | 5431 |
| 1094 | Ga0495626_0049424 | 3300048091 | Bacteria | 1947 |
| 1095 | Ga0495626_0064388 | 3300048091 | Bacteria | 1661 |
| 1096 | Ga0495626_0214570 | 3300048091 | Bacteria | 784 |
| 1097 | Ga0496100_0044305 | 3300048903 | Bacteria | 2849 |
| 1098 | Ga0496100_0116571 | 3300048903 | Bacteria | 1864 |
| 1099 | Ga0496100_0459090 | 3300048903 | Bacteria | 977 |
| 1100 | Ga0496101_0097458 | 3300048904 | Bacteria | 2196 |
| 1101 | Ga0496101_0166902 | 3300048904 | Bacteria | 1690 |
| 1102 | Ga0496101_0320306 | 3300048904 | Bacteria | 1216 |
| 1103 | Ga0496102_0001314 | 3300048905 | Bacteria | 22298 |
| 1104 | Ga0496102_0018104 | 3300048905 | Bacteria | 6183 |
| 1105 | Ga0496102_0040673 | 3300048905 | Bacteria | 4206 |
| 1106 | Ga0496102_0114052 | 3300048905 | Bacteria | 2521 |
| 1107 | Ga0496102_0188326 | 3300048905 | Bacteria | 1945 |
| 1108 | Ga0496102_0657923 | 3300048905 | Bacteria | 971 |
| 1109 | Ga0496102_1121886 | 3300048905 | Bacteria | 706 |
| 1110 | Ga0496103_0006816 | 3300048906 | Bacteria | 6819 |
| 1111 | Ga0496103_0029272 | 3300048906 | Bacteria | 3346 |
| 1112 | Ga0496103_0202767 | 3300048906 | Bacteria | 1275 |
| 1113 | Ga0496103_0454926 | 3300048906 | Bacteria | 821 |
| 1114 | Ga0496104_0036120 | 3300048907 | Bacteria | 4616 |
| 1115 | Ga0496104_0065339 | 3300048907 | Bacteria | 3452 |
| 1116 | Ga0496104_0100894 | 3300048907 | Bacteria | 2763 |
| 1117 | Ga0496104_0111801 | 3300048907 | Bacteria | 2619 |
| 1118 | Ga0496104_0139175 | 3300048907 | Bacteria | 2333 |
| 1119 | Ga0496104_0303036 | 3300048907 | Bacteria | 1510 |
| 1120 | Ga0496104_0303070 | 3300048907 | Bacteria | 1510 |
| 1121 | Ga0496104_0351132 | 3300048907 | Bacteria | 1387 |
| 1122 | Ga0496104_0628144 | 3300048907 | Bacteria | 983 |
| 1123 | Ga0496105_0002433 | 3300048908 | Bacteria | 13493 |
| 1124 | Ga0496105_0003051 | 3300048908 | Bacteria | 12313 |
| 1125 | Ga0496105_0007056 | 3300048908 | Bacteria | 8659 |
| 1126 | Ga0496105_0020689 | 3300048908 | Bacteria | 5319 |
| 1127 | Ga0496105_0041194 | 3300048908 | Bacteria | 3806 |
| 1128 | Ga0496105_0089019 | 3300048908 | Bacteria | 2550 |
| 1129 | Ga0496105_0127168 | 3300048908 | Bacteria | 2101 |
| 1130 | Ga0496105_0199912 | 3300048908 | Bacteria | 1631 |
| 1131 | Ga0496106_0000236 | 3300048909 | Bacteria | 38678 |
| 1132 | Ga0496106_0002924 | 3300048909 | Bacteria | 12709 |
| 1133 | Ga0496106_0038952 | 3300048909 | Bacteria | 3559 |
| 1134 | Ga0496106_0145494 | 3300048909 | Bacteria | 1866 |
| 1135 | Ga0496106_0252341 | 3300048909 | Bacteria | 1410 |
| 1136 | Ga0496107_0001397 | 3300048910 | Bacteria | 14891 |
| 1137 | Ga0496107_0002944 | 3300048910 | Bacteria | 11270 |
| 1138 | Ga0496107_0003292 | 3300048910 | Bacteria | 10781 |
| 1139 | Ga0496107_0012539 | 3300048910 | Bacteria | 5917 |
| 1140 | Ga0496107_0227020 | 3300048910 | Bacteria | 1389 |
| 1141 | Ga0496107_0231076 | 3300048910 | Bacteria | 1376 |
| 1142 | Ga0496107_0416530 | 3300048910 | Bacteria | 999 |
| 1143 | Ga0496108_0001079 | 3300048911 | Bacteria | 21295 |
| 1144 | Ga0496108_0008725 | 3300048911 | Bacteria | 8218 |
| 1145 | Ga0496108_0011914 | 3300048911 | Bacteria | 7074 |
| 1146 | Ga0496108_0047386 | 3300048911 | Bacteria | 3593 |
| 1147 | Ga0496108_0200867 | 3300048911 | Bacteria | 1730 |
| 1148 | Ga0496108_0481121 | 3300048911 | Bacteria | 1085 |
| 1149 | Ga0496108_0948339 | 3300048911 | Bacteria | 737 |
| 1150 | Ga0496109_0000224 | 3300048912 | Bacteria | 55854 |
| 1151 | Ga0496109_0011741 | 3300048912 | Bacteria | 7537 |
| 1152 | Ga0496109_0023768 | 3300048912 | Bacteria | 5440 |
| 1153 | Ga0496109_0026996 | 3300048912 | Bacteria | 5122 |
| 1154 | Ga0496109_0275040 | 3300048912 | Bacteria | 1587 |
| 1155 | Ga0496109_0355175 | 3300048912 | Bacteria | 1385 |
| 1156 | Ga0496109_0782951 | 3300048912 | Bacteria | 892 |
| 1157 | Ga0496110_0000798 | 3300048913 | Bacteria | 22017 |
| 1158 | Ga0496110_0023351 | 3300048913 | Bacteria | 5258 |
| 1159 | Ga0496110_0075893 | 3300048913 | Bacteria | 2987 |
| 1160 | Ga0496110_0103119 | 3300048913 | Bacteria | 2558 |
| 1161 | Ga0496110_0131325 | 3300048913 | Bacteria | 2262 |
| 1162 | Ga0496110_0323011 | 3300048913 | Bacteria | 1406 |
| 1163 | Ga0496110_0324478 | 3300048913 | Bacteria | 1402 |
| 1164 | Ga0496111_0026727 | 3300048914 | Bacteria | 4076 |
| 1165 | Ga0496111_0036689 | 3300048914 | Bacteria | 3506 |
| 1166 | Ga0496111_0172239 | 3300048914 | Bacteria | 1608 |
| 1167 | Ga0496112_0014051 | 3300048915 | Bacteria | 7412 |
| 1168 | Ga0496112_0027365 | 3300048915 | Bacteria | 5497 |
| 1169 | Ga0496112_0039208 | 3300048915 | Bacteria | 4628 |
| 1170 | Ga0496112_0102462 | 3300048915 | Bacteria | 2832 |
| 1171 | Ga0496112_0399221 | 3300048915 | Bacteria | 1315 |
| 1172 | Ga0496112_0854036 | 3300048915 | Bacteria | 833 |
| 1173 | Ga0496113_0013547 | 3300048916 | Bacteria | 5531 |
| 1174 | Ga0496113_0013955 | 3300048916 | Bacteria | 5464 |
| 1175 | Ga0496113_0022543 | 3300048916 | Bacteria | 4456 |
| 1176 | Ga0496113_0142151 | 3300048916 | Bacteria | 1889 |
| 1177 | Ga0496113_0230719 | 3300048916 | Bacteria | 1476 |
| 1178 | Ga0496113_0301595 | 3300048916 | Bacteria | 1283 |
| 1179 | Ga0496114_0017033 | 3300048917 | Bacteria | 5861 |
| 1180 | Ga0496114_0029828 | 3300048917 | Bacteria | 4484 |
| 1181 | Ga0496114_0062219 | 3300048917 | Bacteria | 3124 |
| 1182 | Ga0496114_0292694 | 3300048917 | Bacteria | 1437 |
| 1183 | Ga0496114_0347910 | 3300048917 | Bacteria | 1311 |
| 1184 | Ga0496115_0008934 | 3300048918 | Bacteria | 7432 |
| 1185 | Ga0496115_0018663 | 3300048918 | Bacteria | 5331 |
| 1186 | Ga0496115_0022918 | 3300048918 | Bacteria | 4843 |
| 1187 | Ga0496115_0099478 | 3300048918 | Bacteria | 2383 |
| 1188 | Ga0496115_0178831 | 3300048918 | Bacteria | 1754 |
| 1189 | Ga0496115_0181341 | 3300048918 | Bacteria | 1740 |
| 1190 | Ga0496115_0248995 | 3300048918 | Bacteria | 1463 |
| 1191 | Ga0496115_0300383 | 3300048918 | Bacteria | 1316 |
| 1192 | Ga0496115_0315566 | 3300048918 | Bacteria | 1279 |
| 1193 | Ga0496116_0007668 | 3300048919 | Bacteria | 9520 |
| 1194 | Ga0496116_0028346 | 3300048919 | Bacteria | 4058 |
| 1195 | Ga0496116_0118605 | 3300048919 | Bacteria | 1537 |
| 1196 | Ga0496116_0266998 | 3300048919 | Bacteria | 839 |
| 1197 | Ga0496117_0081884 | 3300048920 | Bacteria | 2116 |
| 1198 | Ga0496117_0148733 | 3300048920 | Bacteria | 1390 |
| 1199 | Ga0496117_0224588 | 3300048920 | Bacteria | 1042 |
| 1200 | Ga0496117_0240449 | 3300048920 | Bacteria | 994 |
| 1201 | Ga0496118_0037627 | 3300048921 | Bacteria | 3891 |
| 1202 | Ga0496118_0060082 | 3300048921 | Bacteria | 2825 |
| 1203 | Ga0496118_0067888 | 3300048921 | Bacteria | 2592 |
| 1204 | Ga0496118_0101707 | 3300048921 | Bacteria | 1939 |
| 1205 | Ga0496118_0151088 | 3300048921 | Bacteria | 1454 |
| 1206 | Ga0496119_0034536 | 3300048922 | Bacteria | 3327 |
| 1207 | Ga0496119_0150095 | 3300048922 | Bacteria | 1250 |
| 1208 | Ga0496120_0006920 | 3300048923 | Bacteria | 8556 |
| 1209 | Ga0496120_0015604 | 3300048923 | Bacteria | 5002 |
| 1210 | Ga0496120_0024117 | 3300048923 | Bacteria | 3797 |
| 1211 | Ga0496120_0074701 | 3300048923 | Bacteria | 1851 |
| 1212 | Ga0496121_0002323 | 3300048924 | Bacteria | 29460 |
| 1213 | Ga0496121_0002352 | 3300048924 | Bacteria | 29158 |
| 1214 | Ga0496121_0007860 | 3300048924 | Bacteria | 12755 |
| 1215 | Ga0496121_0012178 | 3300048924 | Bacteria | 9432 |
| 1216 | Ga0496121_0042287 | 3300048924 | Bacteria | 3966 |
| 1217 | Ga0496121_0069408 | 3300048924 | Bacteria | 2844 |
| 1218 | Ga0496121_0078931 | 3300048924 | Bacteria | 2614 |
| 1219 | Ga0496121_0080763 | 3300048924 | Bacteria | 2576 |
| 1220 | Ga0496121_0085511 | 3300048924 | Bacteria | 2482 |
| 1221 | Ga0496121_0087028 | 3300048924 | Bacteria | 2454 |
| 1222 | Ga0496121_0094046 | 3300048924 | Bacteria | 2332 |
| 1223 | Ga0496121_0098955 | 3300048924 | Bacteria | 2255 |
| 1224 | Ga0496121_0104777 | 3300048924 | Bacteria | 2172 |
| 1225 | Ga0496121_0129450 | 3300048924 | Bacteria | 1892 |
| 1226 | Ga0496121_0204333 | 3300048924 | Bacteria | 1405 |
| 1227 | Ga0496121_0380006 | 3300048924 | Bacteria | 932 |
| 1228 | Ga0496122_0015029 | 3300048925 | Bacteria | 7433 |
| 1229 | Ga0496122_0088360 | 3300048925 | Bacteria | 2124 |
| 1230 | Ga0496122_0230964 | 3300048925 | Bacteria | 1052 |
| 1231 | Ga0496123_0032736 | 3300048926 | Bacteria | 3755 |
| 1232 | Ga0496124_0072081 | 3300048927 | Bacteria | 2861 |
| 1233 | Ga0496124_0085676 | 3300048927 | Bacteria | 2581 |
| 1234 | Ga0496124_0086524 | 3300048927 | Bacteria | 2565 |
| 1235 | Ga0496125_0000407 | 3300048928 | Bacteria | 80570 |
| 1236 | Ga0496125_0003549 | 3300048928 | Bacteria | 18787 |
| 1237 | Ga0496125_0019012 | 3300048928 | Bacteria | 6501 |
| 1238 | Ga0496125_0025501 | 3300048928 | Bacteria | 5412 |
| 1239 | Ga0496125_0031546 | 3300048928 | Bacteria | 4721 |
| 1240 | Ga0496125_0054919 | 3300048928 | Bacteria | 3251 |
| 1241 | Ga0496125_0105053 | 3300048928 | Bacteria | 2066 |
| 1242 | Ga0496126_0010557 | 3300048929 | Bacteria | 9661 |
| 1243 | Ga0496126_0016898 | 3300048929 | Bacteria | 7280 |
| 1244 | Ga0496126_0039405 | 3300048929 | Bacteria | 4384 |
| 1245 | Ga0496126_0040373 | 3300048929 | Bacteria | 4326 |
| 1246 | Ga0496126_0040699 | 3300048929 | Bacteria | 4307 |
| 1247 | Ga0496126_0044612 | 3300048929 | Bacteria | 4081 |
| 1248 | Ga0496126_0044894 | 3300048929 | Bacteria | 4066 |
| 1249 | Ga0496126_0074908 | 3300048929 | Bacteria | 3005 |
| 1250 | Ga0496126_0107475 | 3300048929 | Bacteria | 2433 |
| 1251 | Ga0496126_0131289 | 3300048929 | Bacteria | 2164 |
| 1252 | Ga0496126_0143060 | 3300048929 | Bacteria | 2057 |
| 1253 | Ga0496126_0186534 | 3300048929 | Bacteria | 1759 |
| 1254 | Ga0496126_0195295 | 3300048929 | Bacteria | 1712 |
| 1255 | Ga0496126_0215509 | 3300048929 | Bacteria | 1615 |
| 1256 | Ga0496126_0327641 | 3300048929 | Bacteria | 1257 |
| 1257 | Ga0496126_0365611 | 3300048929 | Bacteria | 1177 |
| 1258 | Ga0496126_0406927 | 3300048929 | Bacteria | 1102 |
| 1259 | Ga0496126_0480168 | 3300048929 | Bacteria | 996 |
| 1260 | Ga0496126_0574219 | 3300048929 | Bacteria | 892 |
| 1261 | Ga0495682_0015666 | 3300049460 | Bacteria | 2872 |
| 1262 | Ga0495682_0037049 | 3300049460 | Bacteria | 1795 |
| 1263 | Ga0501031_0003271 | 3300049568 | Bacteria | 10408 |
| 1264 | Ga0501031_0008880 | 3300049568 | Bacteria | 6534 |
| 1265 | Ga0501031_0059238 | 3300049568 | Bacteria | 2495 |
| 1266 | Ga0501031_0263702 | 3300049568 | Bacteria | 1119 |
| 1267 | Ga0501032_0000475 | 3300049569 | Bacteria | 32423 |
| 1268 | Ga0501032_0007908 | 3300049569 | Bacteria | 7741 |
| 1269 | Ga0501032_0019827 | 3300049569 | Bacteria | 4695 |
| 1270 | Ga0501032_0085580 | 3300049569 | Bacteria | 2095 |
| 1271 | Ga0501032_0177110 | 3300049569 | Bacteria | 1397 |
| 1272 | Ga0501033_0000440 | 3300049570 | Bacteria | 39822 |
| 1273 | Ga0501033_0007523 | 3300049570 | Bacteria | 8478 |
| 1274 | Ga0501033_0021041 | 3300049570 | Bacteria | 4924 |
| 1275 | Ga0501033_0043858 | 3300049570 | Bacteria | 3329 |
| 1276 | Ga0501033_0052371 | 3300049570 | Bacteria | 3025 |
| 1277 | Ga0501033_0207421 | 3300049570 | Bacteria | 1398 |
| 1278 | Ga0501033_0248717 | 3300049570 | Bacteria | 1260 |
| 1279 | Ga0501034_0000250 | 3300049571 | Bacteria | 99407 |
| 1280 | Ga0501034_0150015 | 3300049571 | Bacteria | 2307 |
| 1281 | Ga0501034_0446392 | 3300049571 | Bacteria | 1211 |
| 1282 | Ga0501036_0000098 | 3300049572 | Bacteria | 54252 |
| 1283 | Ga0501036_0013189 | 3300049572 | Bacteria | 6864 |
| 1284 | Ga0501036_0024488 | 3300049572 | Bacteria | 5089 |
| 1285 | Ga0501036_0258387 | 3300049572 | Bacteria | 1459 |
| 1286 | Ga0501036_0336625 | 3300049572 | Bacteria | 1260 |
| 1287 | Ga0501036_0392966 | 3300049572 | Bacteria | 1157 |
| 1288 | Ga0501037_0000092 | 3300049573 | Bacteria | 83924 |
| 1289 | Ga0501037_0007646 | 3300049573 | Bacteria | 7911 |
| 1290 | Ga0501037_0137125 | 3300049573 | Bacteria | 1752 |
| 1291 | Ga0501037_0230497 | 3300049573 | Bacteria | 1300 |
| 1292 | Ga0501037_0231510 | 3300049573 | Bacteria | 1297 |
| 1293 | Ga0501037_0243807 | 3300049573 | Bacteria | 1259 |
| 1294 | Ga0501038_0000059 | 3300049574 | Bacteria | 92319 |
| 1295 | Ga0501038_0000626 | 3300049574 | Bacteria | 31388 |
| 1296 | Ga0501038_0016665 | 3300049574 | Bacteria | 6659 |
| 1297 | Ga0501038_0037290 | 3300049574 | Bacteria | 4262 |
| 1298 | Ga0501038_0072557 | 3300049574 | Bacteria | 2917 |
| 1299 | Ga0501038_0099333 | 3300049574 | Bacteria | 2426 |
| 1300 | Ga0501038_0157875 | 3300049574 | Bacteria | 1845 |
| 1301 | Ga0501038_0356366 | 3300049574 | Bacteria | 1138 |
| 1302 | Ga0501038_0512244 | 3300049574 | Bacteria | 916 |
| 1303 | Ga0501038_0556662 | 3300049574 | Bacteria | 871 |
| 1304 | Ga0501039_0000085 | 3300049575 | Bacteria | 70306 |
| 1305 | Ga0501039_0014414 | 3300049575 | Bacteria | 6052 |
| 1306 | Ga0501039_0023629 | 3300049575 | Bacteria | 4718 |
| 1307 | Ga0501039_0044669 | 3300049575 | Bacteria | 3423 |
| 1308 | Ga0501039_0091001 | 3300049575 | Bacteria | 2377 |
| 1309 | Ga0501039_0171832 | 3300049575 | Bacteria | 1704 |
| 1310 | Ga0501039_0280549 | 3300049575 | Bacteria | 1310 |
| 1311 | Ga0501039_0542531 | 3300049575 | Bacteria | 912 |
| 1312 | Ga0501040_0017697 | 3300049576 | Bacteria | 4730 |
| 1313 | Ga0501040_0523548 | 3300049576 | Bacteria | 855 |
| 1314 | Ga0501041_0054567 | 3300049577 | Bacteria | 2438 |
| 1315 | Ga0501041_0249745 | 3300049577 | Bacteria | 1115 |
| 1316 | Ga0501042_0008012 | 3300049578 | Bacteria | 6952 |
| 1317 | Ga0501042_0021877 | 3300049578 | Bacteria | 4462 |
| 1318 | Ga0501042_0273993 | 3300049578 | Bacteria | 1218 |
| 1319 | Ga0501043_0000460 | 3300049579 | Bacteria | 36273 |
| 1320 | Ga0501043_0019148 | 3300049579 | Bacteria | 5373 |
| 1321 | Ga0501043_0022917 | 3300049579 | Bacteria | 4896 |
| 1322 | Ga0501043_0047574 | 3300049579 | Bacteria | 3372 |
| 1323 | Ga0501043_0057636 | 3300049579 | Bacteria | 3050 |
| 1324 | Ga0501043_0111668 | 3300049579 | Bacteria | 2146 |
| 1325 | Ga0501043_0162663 | 3300049579 | Bacteria | 1743 |
| 1326 | Ga0501043_0220258 | 3300049579 | Bacteria | 1468 |
| 1327 | Ga0501046_0000483 | 3300049580 | Bacteria | 39806 |
| 1328 | Ga0501046_0006417 | 3300049580 | Bacteria | 10423 |
| 1329 | Ga0501046_0015232 | 3300049580 | Bacteria | 6466 |
| 1330 | Ga0501046_0036002 | 3300049580 | Bacteria | 3985 |
| 1331 | Ga0501046_0228883 | 3300049580 | Bacteria | 1374 |
| 1332 | Ga0501047_0000022 | 3300049581 | Bacteria | 249062 |
| 1333 | Ga0501047_0027820 | 3300049581 | Bacteria | 5448 |
| 1334 | Ga0501047_0028171 | 3300049581 | Bacteria | 5413 |
| 1335 | Ga0501047_0031699 | 3300049581 | Bacteria | 5099 |
| 1336 | Ga0501047_0108097 | 3300049581 | Bacteria | 2663 |
| 1337 | Ga0501047_0183016 | 3300049581 | Bacteria | 1961 |
| 1338 | Ga0501048_0070204 | 3300049582 | Bacteria | 2474 |
| 1339 | Ga0501048_0460893 | 3300049582 | Bacteria | 910 |
| 1340 | Ga0501067_0000599 | 3300049583 | Bacteria | 19412 |
| 1341 | Ga0501067_0005409 | 3300049583 | Bacteria | 7091 |
| 1342 | Ga0501067_0022281 | 3300049583 | Bacteria | 3506 |
| 1343 | Ga0501067_0180998 | 3300049583 | Bacteria | 1174 |
| 1344 | Ga0501067_0467881 | 3300049583 | Bacteria | 704 |
| 1345 | Ga0501068_0002124 | 3300049584 | Bacteria | 10553 |
| 1346 | Ga0501068_0049644 | 3300049584 | Bacteria | 2535 |
| 1347 | Ga0501068_0241474 | 3300049584 | Bacteria | 1150 |
| 1348 | Ga0501069_0001547 | 3300049585 | Bacteria | 11368 |
| 1349 | Ga0501069_0024367 | 3300049585 | Bacteria | 3300 |
| 1350 | Ga0501069_0086739 | 3300049585 | Bacteria | 1767 |
| 1351 | Ga0501069_0200118 | 3300049585 | Bacteria | 1157 |
| 1352 | Ga0501069_0392619 | 3300049585 | Bacteria | 820 |
| 1353 | Ga0501070_0003550 | 3300049586 | Bacteria | 13489 |
| 1354 | Ga0501070_0004250 | 3300049586 | Bacteria | 12312 |
| 1355 | Ga0501070_0022819 | 3300049586 | Bacteria | 5238 |
| 1356 | Ga0501070_0101512 | 3300049586 | Bacteria | 2379 |
| 1357 | Ga0501070_0228606 | 3300049586 | Bacteria | 1524 |
| 1358 | Ga0501070_0238693 | 3300049586 | Bacteria | 1488 |
| 1359 | Ga0501071_0143112 | 3300049587 | Bacteria | 1781 |
| 1360 | Ga0501071_0249340 | 3300049587 | Bacteria | 1340 |
| 1361 | Ga0501071_0424480 | 3300049587 | Bacteria | 1016 |
| 1362 | Ga0501072_0017008 | 3300049588 | Bacteria | 5588 |
| 1363 | Ga0501072_0126132 | 3300049588 | Bacteria | 2039 |
| 1364 | Ga0501072_0187915 | 3300049588 | Bacteria | 1648 |
| 1365 | Ga0501073_0000109 | 3300049589 | Bacteria | 53094 |
| 1366 | Ga0501073_0040830 | 3300049589 | Bacteria | 3281 |
| 1367 | Ga0501073_0042240 | 3300049589 | Bacteria | 3219 |
| 1368 | Ga0501073_0460563 | 3300049589 | Bacteria | 879 |
| 1369 | Ga0501074_0040467 | 3300049590 | Bacteria | 3375 |
| 1370 | Ga0501074_0077505 | 3300049590 | Bacteria | 2385 |
| 1371 | Ga0501074_0203953 | 3300049590 | Bacteria | 1409 |
| 1372 | Ga0501074_0374928 | 3300049590 | Bacteria | 1009 |
| 1373 | Ga0501076_0075443 | 3300049592 | Bacteria | 2703 |
| 1374 | Ga0501076_0291958 | 3300049592 | Bacteria | 1336 |
| 1375 | Ga0501076_0369700 | 3300049592 | Bacteria | 1178 |
| 1376 | Ga0501077_0018113 | 3300049593 | Bacteria | 4452 |
| 1377 | Ga0501079_0002132 | 3300049741 | Bacteria | 14228 |
| 1378 | Ga0501079_0070799 | 3300049741 | Bacteria | 2693 |
| 1379 | Ga0501079_0111381 | 3300049741 | Bacteria | 2127 |
| 1380 | Ga0501080_0073683 | 3300049742 | Bacteria | 3176 |
| 1381 | Ga0501080_0179593 | 3300049742 | Bacteria | 1948 |
| 1382 | Ga0501080_0510856 | 3300049742 | Bacteria | 1073 |
| 1383 | Ga0501080_0609678 | 3300049742 | Bacteria | 968 |
| 1384 | Ga0501081_0582750 | 3300049743 | Bacteria | 837 |
| 1385 | Ga0501083_0000618 | 3300049744 | Bacteria | 22913 |
| 1386 | Ga0501083_0036945 | 3300049744 | Bacteria | 3328 |
| 1387 | Ga0501035_0001471 | 3300049822 | Bacteria | 24145 |
| 1388 | Ga0501035_0006779 | 3300049822 | Bacteria | 10704 |
| 1389 | Ga0501035_0015506 | 3300049822 | Bacteria | 7030 |
| 1390 | Ga0501035_0055771 | 3300049822 | Bacteria | 3528 |
| 1391 | Ga0501035_0083623 | 3300049822 | Bacteria | 2816 |
| 1392 | Ga0501035_0132055 | 3300049822 | Bacteria | 2176 |
| 1393 | Ga0501035_0159634 | 3300049822 | Bacteria | 1952 |
| 1394 | Ga0501035_0346209 | 3300049822 | Bacteria | 1244 |
| 1395 | Ga0501035_0347213 | 3300049822 | Bacteria | 1242 |
| 1396 | Ga0501035_0457491 | 3300049822 | Bacteria | 1055 |
| 1397 | Ga0501035_0510678 | 3300049822 | Bacteria | 988 |
| 1398 | Ga0501035_0760126 | 3300049822 | Bacteria | 777 |
| 1399 | Ga0501044_0000072 | 3300049823 | Bacteria | 124143 |
| 1400 | Ga0501044_0001765 | 3300049823 | Bacteria | 25275 |
| 1401 | Ga0501044_0010833 | 3300049823 | Bacteria | 9891 |
| 1402 | Ga0501044_0012151 | 3300049823 | Bacteria | 9324 |
| 1403 | Ga0501044_0046031 | 3300049823 | Bacteria | 4518 |
| 1404 | Ga0501044_0113631 | 3300049823 | Bacteria | 2714 |
| 1405 | Ga0501044_0168157 | 3300049823 | Bacteria | 2165 |
| 1406 | Ga0501044_0646328 | 3300049823 | Bacteria | 947 |
| 1407 | Ga0501045_0005982 | 3300049824 | Bacteria | 8415 |
| 1408 | Ga0501045_0098580 | 3300049824 | Bacteria | 2162 |
| 1409 | Ga0501045_0167849 | 3300049824 | Bacteria | 1634 |
| 1410 | nmdc:mga03683_15913_c2 | 3300050489 | Bacteria | 1739 |
| 1411 | nmdc:mga03683_65846_c1 | 3300050489 | Bacteria | 1539 |
| 1412 | nmdc:mga03n38_120499_c1 | 3300050490 | Bacteria | 1289 |
| 1413 | nmdc:mga03n38_13311_c1 | 3300050490 | Bacteria | 3120 |
| 1414 | nmdc:mga03n38_244868_c1 | 3300050490 | Bacteria | 945 |
| 1415 | nmdc:mga03n38_38012_c1 | 3300050490 | Bacteria | 2079 |
| 1416 | nmdc:mga03n38_61619_c1 | 3300050490 | Bacteria | 1709 |
| 1417 | nmdc:mga03n38_73378_c1 | 3300050490 | Bacteria | 1589 |
| 1418 | nmdc:mga03n38_9102_c1 | 3300050490 | Bacteria | 3594 |
| 1419 | nmdc:mga00v17_257616_c1 | 3300050491 | Bacteria | 1131 |
| 1420 | nmdc:mga00v17_556949_c1 | 3300050491 | Bacteria | 741 |
| 1421 | nmdc:mga00v17_76819_c1 | 3300050491 | Bacteria | 2078 |
| 1422 | nmdc:mga0yw44_12937_c1 | 3300050492 | Bacteria | 4371 |
| 1423 | nmdc:mga0yw44_132394_c1 | 3300050492 | Bacteria | 1615 |
| 1424 | nmdc:mga0yw44_242599_c1 | 3300050492 | Bacteria | 1198 |
| 1425 | nmdc:mga0yw44_265859_c1 | 3300050492 | Bacteria | 1144 |
| 1426 | nmdc:mga0yw44_32572_c1 | 3300050492 | Bacteria | 3038 |
| 1427 | nmdc:mga0yw44_44328_c1 | 3300050492 | Bacteria | 2660 |
| 1428 | nmdc:mga0yw44_58078_c1 | 3300050492 | Bacteria | 2363 |
| 1429 | nmdc:mga0yw44_67739_c1 | 3300050492 | Bacteria | 2207 |
| 1430 | nmdc:mga0k408_40380_c1 | 3300050493 | Bacteria | 2685 |
| 1431 | nmdc:mga0k408_62125_c1 | 3300050493 | Bacteria | 2172 |
| 1432 | nmdc:mga06z11_113_c1 | 3300050494 | Bacteria | 33262 |
| 1433 | nmdc:mga06z11_11996_c1 | 3300050494 | Bacteria | 3757 |
| 1434 | nmdc:mga06z11_268283_c1 | 3300050494 | Bacteria | 1009 |
| 1435 | nmdc:mga06z11_75863_c1 | 3300050494 | Bacteria | 1791 |
| 1436 | nmdc:mga06z11_89081_c1 | 3300050494 | Bacteria | 1672 |
| 1437 | nmdc:mga04h51_79892_c1 | 3300050495 | Bacteria | 1159 |
| 1438 | nmdc:mga04h51_834_c1 | 3300050495 | Bacteria | 7130 |
| 1439 | nmdc:mga07m45_131212_c1 | 3300050496 | Bacteria | 1450 |
| 1440 | nmdc:mga07m45_174619_c1 | 3300050496 | Bacteria | 1249 |
| 1441 | nmdc:mga07m45_175785_c1 | 3300050496 | Bacteria | 1245 |
| 1442 | nmdc:mga07m45_233642_c1 | 3300050496 | Bacteria | 1070 |
| 1443 | nmdc:mga07m45_235776_c1 | 3300050496 | Bacteria | 1065 |
| 1444 | nmdc:mga07m45_268401_c1 | 3300050496 | Bacteria | 993 |
| 1445 | nmdc:mga05p37_87698_c1 | 3300050507 | Bacteria | 3835 |
| 1446 | nmdc:mga09592_398762_c1 | 3300050508 | Bacteria | 1189 |
| 1447 | nmdc:mga0qj67_297192_c1 | 3300050509 | Bacteria | 1308 |
| 1448 | nmdc:mga0n895_309934_c1 | 3300050512 | Bacteria | 1600 |
| 1449 | nmdc:mga0n895_33846_c1 | 3300050512 | Bacteria | 4913 |
| 1450 | nmdc:mga08x19_210180_c1 | 3300050514 | Bacteria | 1335 |
| 1451 | nmdc:mga08x19_564614_c1 | 3300050514 | Bacteria | 806 |
| 1452 | nmdc:mga0sz30_100138_c1 | 3300050516 | Bacteria | 1266 |
| 1453 | nmdc:mga0sz30_158063_c1 | 3300050516 | Bacteria | 1004 |
| 1454 | Ga0495601_0045957 | 3300053077 | Bacteria | 2747 |
| 1455 | Ga0495601_0070203 | 3300053077 | Bacteria | 2236 |
| 1456 | Ga0495601_0258776 | 3300053077 | Bacteria | 1136 |
| 1457 | Ga0495612_0016378 | 3300053078 | Bacteria | 2971 |
| 1458 | Ga0495612_0027352 | 3300053078 | Bacteria | 2293 |
| 1459 | Ga0495612_0081201 | 3300053078 | Bacteria | 1362 |
| 1460 | Ga0500610_0109747 | 3300053079 | Bacteria | 1420 |
| 1461 | Ga0495595_0000445 | 3300053084 | Bacteria | 15683 |
| 1462 | Ga0495595_0287128 | 3300053084 | Bacteria | 826 |
| 1463 | Ga0495619_0001995 | 3300053085 | Bacteria | 13585 |
| 1464 | Ga0495619_0018307 | 3300053085 | Bacteria | 4445 |
| 1465 | Ga0495619_0018895 | 3300053085 | Bacteria | 4376 |
| 1466 | Ga0495619_0021121 | 3300053085 | Bacteria | 4154 |
| 1467 | Ga0495619_0380863 | 3300053085 | Bacteria | 975 |
| 1468 | Ga0500578_0074151 | 3300053086 | Bacteria | 2168 |
| 1469 | Ga0500578_0213448 | 3300053086 | Bacteria | 1176 |
| 1470 | Ga0500581_166108 | 3300053089 | Bacteria | 1019 |
| 1471 | Ga0500646_0036316 | 3300053090 | Bacteria | 1372 |
| 1472 | Ga0500646_0113518 | 3300053090 | Bacteria | 864 |
| 1473 | Ga0500583_0002683 | 3300053092 | Bacteria | 5417 |
| 1474 | Ga0500583_0060771 | 3300053092 | Bacteria | 1783 |
| 1475 | Ga0500651_0004547 | 3300053093 | Bacteria | 7785 |
| 1476 | Ga0500651_0195539 | 3300053093 | Bacteria | 1195 |
| 1477 | Ga0500566_0000247 | 3300053094 | Bacteria | 28953 |
| 1478 | Ga0500566_0006158 | 3300053094 | Bacteria | 7131 |
| 1479 | Ga0500641_0005003 | 3300053096 | Bacteria | 4699 |
| 1480 | Ga0500641_0007847 | 3300053096 | Bacteria | 3804 |
| 1481 | Ga0500650_0011875 | 3300053098 | Bacteria | 3605 |
| 1482 | Ga0500650_0031600 | 3300053098 | Bacteria | 2408 |
| 1483 | Ga0500650_0114199 | 3300053098 | Bacteria | 1260 |
| 1484 | Ga0500554_004619 | 3300053102 | Bacteria | 2933 |
| 1485 | Ga0500554_118232 | 3300053102 | Bacteria | 893 |
| 1486 | Ga0500555_014114 | 3300053103 | Bacteria | 2303 |
| 1487 | Ga0500555_061055 | 3300053103 | Bacteria | 1014 |
| 1488 | Ga0500556_0000006 | 3300053104 | Bacteria | 453982 |
| 1489 | Ga0500562_047244 | 3300053108 | Bacteria | 1148 |
| 1490 | Ga0500562_064590 | 3300053108 | Bacteria | 985 |
| 1491 | Ga0500569_004586 | 3300053109 | Bacteria | 2913 |
| 1492 | Ga0500569_016235 | 3300053109 | Bacteria | 1882 |
| 1493 | Ga0500569_020846 | 3300053109 | Bacteria | 1725 |
| 1494 | Ga0500572_000191 | 3300053111 | Bacteria | 21667 |
| 1495 | Ga0500572_001378 | 3300053111 | Bacteria | 6707 |
| 1496 | Ga0500572_010768 | 3300053111 | Bacteria | 2197 |
| 1497 | Ga0500592_001937 | 3300053116 | Bacteria | 3331 |
| 1498 | Ga0500595_000477 | 3300053119 | Bacteria | 24734 |
| 1499 | Ga0500595_002332 | 3300053119 | Bacteria | 9491 |
| 1500 | Ga0500595_006612 | 3300053119 | Bacteria | 4895 |
| 1501 | Ga0500595_015504 | 3300053119 | Bacteria | 2858 |
| 1502 | Ga0500607_081462 | 3300053121 | Bacteria | 1649 |
| 1503 | Ga0500608_000959 | 3300053122 | Bacteria | 10339 |
| 1504 | Ga0500608_001167 | 3300053122 | Bacteria | 9352 |
| 1505 | Ga0500608_001751 | 3300053122 | Bacteria | 7757 |
| 1506 | Ga0500614_001663 | 3300053123 | Bacteria | 5210 |
| 1507 | Ga0500614_013202 | 3300053123 | Bacteria | 1812 |
| 1508 | Ga0500618_028535 | 3300053125 | Bacteria | 1321 |
| 1509 | Ga0500621_106379 | 3300053126 | Bacteria | 1101 |
| 1510 | Ga0500642_0000004 | 3300053130 | Bacteria | 433122 |
| 1511 | Ga0500642_0000062 | 3300053130 | Bacteria | 58970 |
| 1512 | Ga0500652_000867 | 3300053131 | Bacteria | 10020 |
| 1513 | Ga0500652_088688 | 3300053131 | Bacteria | 1291 |
| 1514 | Ga0500655_024428 | 3300053133 | Bacteria | 1144 |
| 1515 | Ga0500658_0217986 | 3300053134 | Bacteria | 874 |
| 1516 | Ga0500559_0000398 | 3300053136 | Bacteria | 31511 |
| 1517 | Ga0500559_0000465 | 3300053136 | Bacteria | 28853 |
| 1518 | Ga0500559_0002732 | 3300053136 | Bacteria | 8957 |
| 1519 | Ga0500559_0039527 | 3300053136 | Bacteria | 2052 |
| 1520 | Ga0500559_0095968 | 3300053136 | Bacteria | 1361 |
| 1521 | Ga0500561_0050219 | 3300053137 | Bacteria | 1135 |
| 1522 | Ga0500568_0000790 | 3300053139 | Bacteria | 22337 |
| 1523 | Ga0500568_0028293 | 3300053139 | Bacteria | 2337 |
| 1524 | Ga0500577_0000042 | 3300053142 | Bacteria | 28486 |
| 1525 | Ga0500586_000798 | 3300053145 | Bacteria | 6448 |
| 1526 | Ga0500588_0032851 | 3300053146 | Bacteria | 1509 |
| 1527 | Ga0500588_0035912 | 3300053146 | Bacteria | 1462 |
| 1528 | Ga0500589_121723 | 3300053147 | Bacteria | 1104 |
| 1529 | Ga0500590_212474 | 3300053148 | Bacteria | 806 |
| 1530 | Ga0500590_225838 | 3300053148 | Bacteria | 767 |
| 1531 | Ga0500603_000446 | 3300053150 | Bacteria | 10658 |
| 1532 | Ga0500603_002753 | 3300053150 | Bacteria | 3821 |
| 1533 | Ga0500603_003956 | 3300053150 | Bacteria | 3172 |
| 1534 | Ga0500604_0024492 | 3300053151 | Bacteria | 1728 |
| 1535 | Ga0500616_0000022 | 3300053153 | Bacteria | 460463 |
| 1536 | Ga0500620_000526 | 3300053155 | Bacteria | 6682 |
| 1537 | Ga0500620_018637 | 3300053155 | Bacteria | 2025 |
| 1538 | Ga0500622_0023515 | 3300053156 | Bacteria | 3263 |
| 1539 | Ga0500622_0093811 | 3300053156 | Bacteria | 1485 |
| 1540 | Ga0500627_0063034 | 3300053158 | Bacteria | 1633 |
| 1541 | Ga0500630_004139 | 3300053159 | Bacteria | 7055 |
| 1542 | Ga0500633_0011875 | 3300053160 | Bacteria | 2385 |
| 1543 | Ga0500634_0093812 | 3300053161 | Bacteria | 1517 |
| 1544 | Ga0500638_005633 | 3300053162 | Bacteria | 5020 |
| 1545 | Ga0500638_015608 | 3300053162 | Bacteria | 3488 |
| 1546 | Ga0500638_093553 | 3300053162 | Bacteria | 1412 |
| 1547 | Ga0500638_104835 | 3300053162 | Bacteria | 1314 |
| 1548 | Ga0500639_001790 | 3300053163 | Bacteria | 10765 |
| 1549 | Ga0500639_020355 | 3300053163 | Bacteria | 3500 |
| 1550 | Ga0500639_199538 | 3300053163 | Bacteria | 861 |
| 1551 | Ga0500636_0001376 | 3300053177 | Bacteria | 13203 |
| 1552 | Ga0500636_0011956 | 3300053177 | Bacteria | 5084 |
| 1553 | Ga0500636_0012855 | 3300053177 | Bacteria | 4908 |
| 1554 | Ga0500636_0125424 | 3300053177 | Bacteria | 1436 |
| 1555 | Ga0500637_0029883 | 3300053178 | Bacteria | 3026 |
| 1556 | Ga0500637_0089328 | 3300053178 | Bacteria | 1783 |
| 1557 | Ga0500649_142510 | 3300053722 | Bacteria | 876 |
| 1558 | Ga0500570_089903 | 3300053724 | Bacteria | 1342 |
| 1559 | Ga0500570_118516 | 3300053724 | Bacteria | 1048 |
| 1560 | Ga0500576_002221 | 3300053725 | Bacteria | 7072 |
| 1561 | Ga0500625_012431 | 3300053729 | Bacteria | 3892 |
| 1562 | Ga0500645_007993 | 3300053730 | Bacteria | 3644 |
| 1563 | Ga0500645_013362 | 3300053730 | Bacteria | 2635 |
| 1564 | Ga0500645_034977 | 3300053730 | Bacteria | 1498 |
| 1565 | Ga0500596_000309 | 3300053735 | Bacteria | 8710 |
| 1566 | Ga0500596_000393 | 3300053735 | Bacteria | 7980 |
| 1567 | Ga0500599_002602 | 3300053736 | Bacteria | 2171 |
| 1568 | Ga0500601_000064 | 3300053737 | Bacteria | 22081 |
| 1569 | Ga0501084_0033847 | 3300054114 | Bacteria | 4274 |
| 1570 | Ga0501084_0149941 | 3300054114 | Bacteria | 1965 |
| 1571 | Ga0500661_004388 | 3300055283 | Bacteria | 2642 |
| 1572 | Ga0501082_0002455 | 3300060353 | Bacteria | 16279 |
| 1573 | Ga0501082_0038821 | 3300060353 | Bacteria | 4107 |
| 1574 | Ga0501082_0115979 | 3300060353 | Bacteria | 2319 |
| 1575 | Ga0530510_0115778 | 3300061734 | Bacteria | 1965 |
| 1576 | 2507505252 | 2507262055 | Bacteria | 8048963 |
| 1577 | 2508539173 | 2508501009 | Bacteria | 7784016 |
| 1578 | 2508695491 | 2508501042 | Bacteria | 8719808 |
| 1579 | 2509152638 | 2508501128 | Bacteria | 8613869 |
| 1580 | 2511400215 | 2511231028 | Bacteria | 8046582 |
| 1581 | 2513625351 | 2513237092 | Bacteria | 8341956 |
| 1582 | 2513644170 | 2513237094 | Bacteria | 8789602 |
| 1583 | 2513651509 | 2513237095 | Bacteria | 8976980 |
| 1584 | 2513658818 | 2513237096 | Bacteria | 8722461 |
| 1585 | 2513695117 | 2513237101 | Bacteria | 7952346 |
| 1586 | 2513705297 | 2513237102 | Bacteria | 7703324 |
| 1587 | 2513720299 | 2513237104 | Bacteria | 10034502 |
| 1588 | 2513860825 | 2513237137 | Bacteria | 9558895 |
| 1589 | 2513873522 | 2513237139 | Bacteria | 8737671 |
| 1590 | 2513921082 | 2513237145 | Bacteria | 8979722 |
| 1591 | 2514012491 | 2513237161 | Bacteria | 8871253 |
| 1592 | 2515627447 | 2515154112 | Bacteria | 8294334 |
| 1593 | 2517107705 | 2517093001 | Bacteria | 9002274 |
| 1594 | 2517888847 | 2517572143 | Bacteria | 9484767 |
| 1595 | 2524469474 | 2524023210 | Bacteria | 9029266 |
| 1596 | 2524537039 | 2524023228 | Bacteria | 10118060 |
| 1597 | 2528852944 | 2528768022 | Bacteria | 10457665 |
| 1598 | 2599102765 | 2597490356 | Bacteria | 7030811 |
| 1599 | 2603858532 | 2602042107 | Bacteria | 6226103 |
| 1600 | 2617352404 | 2617270735 | Bacteria | 9163226 |
| 1601 | 2617373767 | 2617270741 | Bacteria | 8201522 |
| 1602 | 2643757966 | 2643221547 | Bacteria | 4740017 |
| 1603 | 2671122453 | 2667528175 | Bacteria | 7532676 |
| 1604 | 2723841648 | 2721755755 | Bacteria | 8322773 |
| 1605 | 2728754996 | 2728368998 | Bacteria | 8720350 |
| 1606 | 2745081694 | 2744054633 | Bacteria | 8678936 |
| 1607 | 2793062048 | 2791355196 | Bacteria | 7323613 |
| 1608 | 2793072935 | 2791355197 | Bacteria | 8420563 |
| 1609 | 2793082745 | |||
| 1610 | 2805915606 | 2802429603 | Bacteria | 8777136 |
| 1611 | 2818237656 | 2816332527 | Bacteria | 8933356 |
| 1612 | 2819739741 | 2818991472 | Bacteria | 10089953 |
| 1613 | 2824604578 | 2824600985 | Bacteria | 8488197 |
| 1614 | 2824624506 | 2824617872 | Bacteria | 8814715 |
| 1615 | 2824633421 | 2824626560 | Bacteria | 8813858 |
| 1616 | 2824640282 | 2824635225 | Bacteria | 8785348 |
| 1617 | 2824647284 | 2824644064 | Bacteria | 8743947 |
| 1618 | 2824667565 | 2824661429 | Bacteria | 9877870 |
| 1619 | 2824678920 | 2824671348 | Bacteria | 8369588 |
| 1620 | 2824684236 | 2824679649 | Bacteria | 8248951 |
| 1621 | 2824695466 | 2824687955 | Bacteria | 8360029 |
| 1622 | 2824717400 | 2824714736 | Bacteria | 8717648 |
| 1623 | 2824727637 | 2824723954 | Bacteria | 8758240 |
| 1624 | 2824737789 | 2824732956 | Bacteria | 7810675 |
| 1625 | 2824752221 | 2824746037 | Bacteria | 7911610 |
| 1626 | 2841965440 | 2841957949 | Bacteria | 8652217 |
| 1627 | 2841979966 | 2841974524 | Bacteria | 8931498 |
| 1628 | 2846952639 | 2846952575 | Bacteria | 6587527 |
| 1629 | 2848861130 | 2848858292 | Bacteria | 7391279 |
| 1630 | 2849083041 | 2849076700 | Bacteria | 7039503 |
| 1631 | 2849561165 | 2849560528 | Bacteria | 5393480 |
| 1632 | 2849576146 | 2849573788 | Bacteria | 5421256 |
| 1633 | 2857511931 | 2857509624 | Bacteria | 7472071 |
| 1634 | 2857526346 | 2857524615 | Bacteria | 6615449 |
| 1635 | 2874608059 | 2874604998 | Bacteria | 7834745 |
| 1636 | 2874613430 | 2874612657 | Bacteria | 8252029 |
| 1637 | 2874628789 | 2874628541 | Bacteria | 8630250 |
| 1638 | 2876815499 | 2876808645 | Bacteria | 8824342 |
| 1639 | 2879085913 | 2879083081 | Bacteria | 8587928 |
| 1640 | 2879106016 | 2879099564 | Bacteria | 10442239 |
| 1641 | 2879112176 | 2879110137 | Bacteria | 8907982 |
| 1642 | 2881668179 | 2881665667 | Bacteria | 8175609 |
| 1643 | 2885371022 | 2885366525 | Bacteria | 8326213 |
| 1644 | 2885382844 | 2885374607 | Bacteria | 8927485 |
| 1645 | 2885411656 | 2885409591 | Bacteria | 9235467 |
| 1646 | 2888379586 | 2888378607 | Bacteria | 9652610 |
| 1647 | 2888390675 | 2888388044 | Bacteria | 7304136 |
| 1648 | 2889035484 | 2889033259 | Bacteria | 9099371 |
| 1649 | 2893067383 | 2893066018 | Bacteria | 6158120 |
| 1650 | 2897808779 | 2897803580 | Bacteria | 7000062 |
| 1651 | 2903753528 | 2903748898 | Bacteria | 9972761 |
| 1652 | 2903771853 | 2903768456 | Bacteria | 9749579 |
| 1653 | 2904691186 | 2904690495 | Bacteria | 9412302 |
| 1654 | 2904708699 | |||
| 1655 | 2906628952 | 2906626472 | Bacteria | 8826946 |
| 1656 | 2906642327 | 2906635258 | Bacteria | 8601019 |
| 1657 | 2906667355 | 2906660503 | Bacteria | 8595048 |
| 1658 | 2908756582 | 2908756301 | Bacteria | 8864324 |
| 1659 | 2908776283 | 2908775508 | Bacteria | 8092255 |
| 1660 | 2919073807 | 2919073203 | Bacteria | 6531949 |
| 1661 | 2922368930 | |||
| 1662 | 2922392571 | 2922386360 | Bacteria | 7017218 |
| 1663 | 2922394245 | 2922393267 | Bacteria | 8285685 |
| 1664 | 2922434219 | |||
| 1665 | 2924765446 | 2924762789 | Bacteria | 6561353 |
| 1666 | 2929618607 | 2929615660 | Bacteria | 9193770 |
| 1667 | 2929628708 | 2929624759 | Bacteria | 9339455 |
| 1668 | 2932792929 | 2932784394 | Bacteria | 9704911 |
| 1669 | 2932794312 | 2932794094 | Bacteria | 7915132 |
| 1670 | 2932808094 | 2932801729 | Bacteria | 7987968 |
| 1671 | 2932812159 | 2932809354 | Bacteria | 9135765 |
| 1672 | 2932823149 | 2932818245 | Bacteria | 9955613 |
| 1673 | 2932836066 | 2932828146 | Bacteria | 9745859 |
| 1674 | 2933580681 | 2933577622 | Bacteria | 9116884 |
| 1675 | 2935615719 | 2935608549 | Bacteria | 8203142 |
| 1676 | 2935618527 | 2935616580 | Bacteria | 9032984 |
| 1677 | 2935636534 | 2935630451 | Bacteria | 8169952 |
| 1678 | 2935641072 | 2935638405 | Bacteria | 10015038 |
| 1679 | 2935662385 | 2935656913 | Bacteria | 8965014 |
| 1680 | 2935669988 | 2935665750 | Bacteria | 9571747 |
| 1681 | 2935679162 | 2935675223 | Bacteria | 9928132 |
| 1682 | 2935686408 | 2935684952 | Bacteria | 9590419 |
| 1683 | 2935700190 | 2935694250 | Bacteria | 9291695 |
| 1684 | 2935711487 | 2935703347 | Bacteria | 10242284 |
| 1685 | 2935716096 | 2935713505 | Bacteria | 9608509 |
| 1686 | 2935723780 | 2935722832 | Bacteria | 9608746 |
| 1687 | 2935735335 | 2935732158 | Bacteria | 9706831 |
| 1688 | 2935743874 | 2935741537 | Bacteria | 9707219 |
| 1689 | 2935752374 | 2935750917 | Bacteria | 9590372 |
| 1690 | 2935763529 | 2935760218 | Bacteria | 9817913 |
| 1691 | 2935782979 | 2935777560 | Bacteria | 8077691 |
| 1692 | 2935787975 | 2935785616 | Bacteria | 7962367 |
| 1693 | 2935796449 | 2935793552 | Bacteria | 8012592 |
| 1694 | 2935809952 | 2935801545 | Bacteria | 9301974 |
| 1695 | 2935816258 | 2935810662 | Bacteria | 9401221 |
| 1696 | 2935825483 | 2935819856 | Bacteria | 8261050 |
| 1697 | 2935835651 | 2935827899 | Bacteria | 10038562 |
| 1698 | 2935844602 | 2935837841 | Bacteria | 9454360 |
| 1699 | 2935853272 | 2935847175 | Bacteria | 8228321 |
| 1700 | 2935862952 | 2935855204 | Bacteria | 9035059 |
| 1701 | 2935866694 | 2935864058 | Bacteria | 9784707 |
| 1702 | 2935875001 | 2935873716 | Bacteria | 9632195 |
| 1703 | 2935890154 | 2935883170 | Bacteria | 7964738 |
| 1704 | 2935914745 | 2935908558 | Bacteria | 8568796 |
| 1705 | 2935918721 | 2935916978 | Bacteria | 9113783 |
| 1706 | 2935931562 | 2935926038 | Bacteria | 8601059 |
| 1707 | 2935940159 | 2935934488 | Bacteria | 8602579 |
| 1708 | 2935947494 | 2935942939 | Bacteria | 8599779 |
| 1709 | 2935956266 | 2935951376 | Bacteria | 8602333 |
| 1710 | 2935962642 | 2935959822 | Bacteria | 7869783 |
| 1711 | 2935973059 | 2935967501 | Bacteria | 8603075 |
| 1712 | 2935980699 | 2935975950 | Bacteria | 8347125 |
| 1713 | 2935985148 | 2935984226 | Bacteria | 8302647 |
| 1714 | 2935999723 | 2935992306 | Bacteria | 9802711 |
| 1715 | 2936010580 | 2936002035 | Bacteria | 9362176 |
| 1716 | 2936016687 | 2936011229 | Bacteria | 8801034 |
| 1717 | 2936025320 | 2936019824 | Bacteria | 8804134 |
| 1718 | 2936034162 | 2936028420 | Bacteria | 8965941 |
| 1719 | 2936041263 | 2936037263 | Bacteria | 9446081 |
| 1720 | 2936052219 | 2936046547 | Bacteria | 8903709 |
| 1721 | 2936056320 | 2936055302 | Bacteria | 8785755 |
| 1722 | 2937825399 | 2937822353 | Bacteria | 7290551 |
| 1723 | 2940558287 | 2940556831 | Bacteria | 9590747 |
| 1724 | 2941513169 | 2941507105 | Bacteria | 8166816 |
| 1725 | 2941521176 | 2941515067 | Bacteria | 8166720 |
| 1726 | 2941528887 | 2941523033 | Bacteria | 8169134 |
| 1727 | 2941535508 | 2941531003 | Bacteria | 7653939 |
| 1728 | 2941543213 | 2941538514 | Bacteria | 9402094 |
| 1729 | 2987669790 | 2987666974 | Bacteria | 6509233 |
| 1730 | 3005475069 | 3005474847 | Bacteria | 9259049 |
| 1731 | 3005489064 | 3005483717 | Bacteria | 7877331 |
| 1732 | 3005509154 | 3005506211 | Bacteria | 6943378 |
| 1733 | 3005592205 | 3005587118 | Bacteria | 7794411 |
| 1734 | 3005595056 | 3005594810 | Bacteria | 8716512 |
| 1735 | 3005711004 | 3005710791 | Bacteria | 7622528 |
| 1736 | 3005718309 | 3005718088 | Bacteria | 8283608 |
| 1737 | 8006927895 | 8006926726 | Bacteria | 6749210 |
| 1738 | 8006936217 | 8006933436 | Bacteria | 10410654 |
| 1739 | 8006967462 | 8006964411 | Bacteria | 8966052 |
| 1740 | 8006976163 | 8006973647 | Bacteria | 10679141 |
| 1741 | 8006990927 | 8006984368 | Bacteria | 9651211 |
| 1742 | 8006996506 | 8006994254 | Bacteria | 8309700 |
| 1743 | 8016518175 | 8016511872 | Bacteria | 9921665 |
| 1744 | 8016526145 | 8016522445 | Bacteria | 8156687 |
| 1745 | 8016539758 | 8016530956 | Bacteria | 8155261 |
| 1746 | 8016544064 | 8016539877 | Bacteria | 8155419 |
| 1747 | 8016549245 | 8016548790 | Bacteria | 8155074 |
| 1748 | 8016557669 | 8016557553 | Bacteria | 8154380 |
| 1749 | 8016586365 | 8016583857 | Bacteria | 10421953 |
| 1750 | 8016595704 | 8016595262 | Bacteria | 8149947 |
| 1751 | 8016623153 | 8016622563 | Bacteria | 7999408 |
| 1752 | 8016635621 | 8016630954 | Bacteria | 9217207 |
| 1753 | 8017058471 | 8017057580 | Bacteria | 10023680 |
| 1754 | 8019550166 | 8019547302 | Bacteria | 7996444 |
| 1755 | 8019572488 | 8019565922 | Bacteria | 9639779 |
| 1756 | 8019577224 | 8019576017 | Bacteria | 10049540 |
| 1757 | 8019595304 | 8019586578 | Bacteria | 10212056 |
| 1758 | 8019606453 | 8019597564 | Bacteria | 10041141 |
| 1759 | 8019622976 | 8019619141 | Bacteria | 9218857 |
| 1760 | 8019630131 | 8019629233 | Bacteria | 8687553 |
| 1761 | 8019640485 | 8019638758 | Bacteria | 9062356 |
| 1762 | 8019652463 | 8019648815 | Bacteria | 10014479 |
| 1763 | 8019666964 | 8019659431 | Bacteria | 8577854 |
| 1764 | 8019676722 | 8019668869 | Bacteria | 8791617 |
| 1765 | 8019696233 | 8019687851 | Bacteria | 8712826 |
| 1766 | 8055742457 | 8055742211 | Bacteria | 9226248 |
| 1767 | 8056675748 | 8056673599 | Bacteria | 7871253 |
| 1768 | 8056686539 | 8056681323 | Bacteria | 8472857 |
| 1769 | 8056690963 | 8056689827 | Bacteria | 6712655 |
| 1770 | 8056971294 | 8056967851 | Bacteria | 9038162 |
| 1771 | Ga0501043_0390475 | |||
| 1772 | RicEn_C7607 | |||
| 1773 | JGI24740J21852_10001411 | |||
| 1774 | JGI24739J22299_10009800 | |||
| 1775 | JGI24739J22299_10075914 | |||
| 1776 | JGI24737J22298_10010056 | |||
| 1777 | JGI24735J21928_10023530 | |||
| 1778 | JGI25406J46586_10000066 | |||
| 1779 | JGI25406J46586_10103503 | |||
| 1780 | JGI25165J46597_1018237 | |||
| 1781 | JGI25153J46596_10003418 | |||
| 1782 | JGI25153J46596_10003644 | |||
| 1783 | JGI25153J46596_10003677 | |||
| 1784 | JGI25153J46596_10003813 | |||
| 1785 | JGI25153J46596_10010816 | |||
| 1786 | JGI25160J50197_1005711 | |||
| 1787 | JGI25160J50197_1006296 | |||
| 1788 | Ga0055529_1009184 | |||
| 1789 | Ga0055531_10020073 | |||
| 1790 | Ga0065165_1079368 | |||
| 1791 | Ga0070658_10087184 | |||
| 1792 | Ga0070658_10209512 | |||
| 1793 | Ga0068869_100012453 | |||
| 1794 | Ga0068869_100028971 | |||
| 1795 | Ga0068869_100441270 | |||
| 1796 | Ga0070666_10384409 | |||
| 1797 | Ga0070680_100018862 | |||
| 1798 | Ga0070680_100045679 | |||
| 1799 | Ga0070680_100466528 | |||
| 1800 | Ga0070682_100455655 | |||
| 1801 | Ga0068868_100019711 | |||
| 1802 | Ga0068868_100051247 | |||
| 1803 | Ga0068868_100394791 | |||
| 1804 | Ga0068868_101029015 | |||
| 1805 | Ga0070660_100081631 | |||
| 1806 | Ga0070660_100179225 | |||
| 1807 | Ga0070691_10006835 | |||
| 1808 | Ga0070661_100219487 | |||
| 1809 | Ga0070661_100496161 | |||
| 1810 | Ga0070692_10064318 | |||
| 1811 | Ga0070668_100042269 | |||
| 1812 | Ga0070668_100069816 | |||
| 1813 | Ga0070668_100111482 | |||
| 1814 | Ga0070668_100119923 | |||
| 1815 | Ga0070668_100296648 | |||
| 1816 | Ga0070669_100136845 | |||
| 1817 | Ga0070669_100339052 | |||
| 1818 | Ga0070675_100881609 | |||
| 1819 | Ga0070671_100034389 | |||
| 1820 | Ga0070671_100108745 | |||
| 1821 | Ga0070674_100031797 | |||
| 1822 | Ga0070673_100207371 | |||
| 1823 | Ga0070673_100779680 | |||
| 1824 | Ga0070688_100529798 | |||
| 1825 | Ga0070659_100022664 | |||
| 1826 | Ga0070667_100004267 | |||
| 1827 | Ga0070667_100040946 | |||
| 1828 | Ga0070667_100137152 | |||
| 1829 | Ga0070667_100152826 | |||
| 1830 | Ga0070667_100273618 | |||
| 1831 | Ga0070703_10000735 | |||
| 1832 | Ga0070709_10001880 | |||
| 1833 | Ga0070709_10165113 | |||
| 1834 | Ga0070709_10195373 | |||
| 1835 | Ga0070709_10270004 | |||
| 1836 | Ga0070709_10347446 | |||
| 1837 | Ga0070714_100004568 | |||
| 1838 | Ga0070714_100288015 | |||
| 1839 | Ga0070713_100006874 | |||
| 1840 | Ga0070713_100012950 | |||
| 1841 | Ga0070713_100183809 | |||
| 1842 | Ga0070713_100201247 | |||
| 1843 | Ga0070713_100473660 | |||
| 1844 | Ga0070710_10018606 | |||
| 1845 | Ga0070710_10025030 | |||
| 1846 | Ga0070710_10214322 | |||
| 1847 | Ga0070710_10239060 | |||
| 1848 | Ga0070710_10326665 | |||
| 1849 | Ga0070701_10044934 | |||
| 1850 | Ga0070701_10493376 | |||
| 1851 | Ga0070711_100000660 | |||
| 1852 | Ga0070711_100020798 | |||
| 1853 | Ga0070711_100479598 | |||
| 1854 | Ga0070705_100001900 | |||
| 1855 | Ga0070700_100000562 | |||
| 1856 | Ga0070694_100001629 | |||
| 1857 | Ga0070694_100102912 | |||
| 1858 | Ga0070708_100010410 | |||
| 1859 | Ga0070663_100004283 | |||
| 1860 | Ga0070663_100007266 | |||
| 1861 | Ga0070663_100029326 | |||
| 1862 | Ga0070663_100031355 | |||
| 1863 | Ga0070663_100070063 | |||
| 1864 | Ga0070663_100091578 | |||
| 1865 | Ga0070663_100144901 | |||
| 1866 | Ga0070663_100174277 | |||
| 1867 | Ga0070663_100524193 | |||
| 1868 | Ga0070663_100642748 | |||
| 1869 | Ga0070678_100293324 | |||
| 1870 | Ga0070678_100319403 | |||
| 1871 | Ga0070678_100358070 | |||
| 1872 | Ga0070662_100021703 | |||
| 1873 | Ga0070662_100134029 | |||
| 1874 | Ga0070662_100165717 | |||
| 1875 | Ga0070681_10003083 | |||
| 1876 | Ga0070681_10031581 | |||
| 1877 | Ga0070681_10263662 | |||
| 1878 | Ga0070681_10493886 | |||
| 1879 | Ga0070685_10202285 | |||
| 1880 | Ga0070685_10289475 | |||
| 1881 | Ga0070706_100119190 | |||
| 1882 | Ga0070706_100698862 | |||
| 1883 | Ga0070707_100145827 | |||
| 1884 | Ga0070698_100041805 | |||
| 1885 | Ga0070698_100164021 | |||
| 1886 | Ga0070699_100000345 | |||
| 1887 | Ga0070699_100095600 | |||
| 1888 | Ga0070699_100362997 | |||
| 1889 | Ga0070699_100644224 | |||
| 1890 | Ga0070679_100060931 | |||
| 1891 | Ga0070679_100121028 | |||
| 1892 | Ga0070679_100132844 | |||
| 1893 | Ga0070679_100501698 | |||
| 1894 | Ga0070679_100546124 | |||
| 1895 | Ga0070684_100028480 | |||
| 1896 | Ga0070684_100031392 | |||
| 1897 | Ga0070697_100023492 | |||
| 1898 | Ga0070697_100065992 | |||
| 1899 | Ga0070697_100272288 | |||
| 1900 | Ga0068853_100001705 | |||
| 1901 | Ga0068853_100073960 | |||
| 1902 | Ga0070672_100193956 | |||
| 1903 | Ga0070672_100208852 | |||
| 1904 | Ga0070672_100289418 | |||
| 1905 | Ga0070672_100590412 | |||
| 1906 | Ga0070695_100008517 | |||
| 1907 | Ga0070696_100000049 | |||
| 1908 | Ga0070696_100112180 | |||
| 1909 | Ga0070693_100180957 | |||
| 1910 | Ga0070665_100032443 | |||
| 1911 | Ga0070665_100054594 | |||
| 1912 | Ga0070665_100057903 | |||
| 1913 | Ga0070665_100070382 | |||
| 1914 | Ga0070665_100081190 | |||
| 1915 | Ga0070665_100106820 | |||
| 1916 | Ga0070665_100147802 | |||
| 1917 | Ga0070665_100201905 | |||
| 1918 | Ga0070665_100273643 | |||
| 1919 | Ga0070665_100397511 | |||
| 1920 | Ga0070665_100532171 | |||
| 1921 | Ga0070665_100630790 | |||
| 1922 | Ga0070704_100012188 | |||
| 1923 | Ga0068855_100067879 | |||
| 1924 | Ga0068855_100075904 | |||
| 1925 | Ga0068855_100113103 | |||
| 1926 | Ga0068855_100144127 | |||
| 1927 | Ga0068855_100364925 | |||
| 1928 | Ga0068855_100788281 | |||
| 1929 | Ga0070664_100728380 | |||
| 1930 | Ga0068857_100003727 | |||
| 1931 | Ga0068857_100027200 | |||
| 1932 | Ga0068854_100003651 | |||
| 1933 | Ga0068854_100054424 | |||
| 1934 | Ga0068854_100158359 | |||
| 1935 | Ga0068854_100382066 | |||
| 1936 | Ga0068854_100474089 | |||
| 1937 | Ga0068854_100699544 | |||
| 1938 | Ga0068856_100004410 | |||
| 1939 | Ga0068856_100068205 | |||
| 1940 | Ga0068856_100107777 | |||
| 1941 | Ga0068856_100403503 | |||
| 1942 | Ga0070702_100008465 | |||
| 1943 | Ga0070702_100032484 | |||
| 1944 | Ga0068852_100012568 | |||
| 1945 | Ga0068852_100036955 | |||
| 1946 | Ga0068852_100064229 | |||
| 1947 | Ga0068852_100259654 | |||
| 1948 | Ga0068852_100329260 | |||
| 1949 | Ga0068852_100674443 | |||
| 1950 | Ga0068859_100000552 | |||
| 1951 | Ga0068864_100008679 | |||
| 1952 | Ga0068864_100031888 | |||
| 1953 | Ga0068864_100054927 | |||
| 1954 | Ga0068864_100232178 | |||
| 1955 | Ga0068864_100307299 | |||
| 1956 | Ga0068866_10064108 | |||
| 1957 | Ga0068866_10087844 | |||
| 1958 | Ga0068861_100136010 | |||
| 1959 | Ga0068851_10003678 | |||
| 1960 | Ga0068851_10107691 | |||
| 1961 | Ga0068870_10060138 | |||
| 1962 | Ga0068863_100266311 | |||
| 1963 | Ga0068863_100338765 | |||
| 1964 | Ga0068858_100016049 | |||
| 1965 | Ga0068858_100018320 | |||
| 1966 | Ga0068858_100124806 | |||
| 1967 | Ga0068858_100141835 | |||
| 1968 | Ga0068860_100009725 | |||
| 1969 | Ga0068860_100046811 | |||
| 1970 | Ga0068860_100099409 | |||
| 1971 | Ga0068860_100254028 | |||
| 1972 | Ga0068860_100930836 | |||
| 1973 | Ga0068862_100002294 | |||
| 1974 | Ga0068862_100092188 | |||
| 1975 | Ga0068862_100209144 | |||
| 1976 | Ga0068862_100271668 | |||
| 1977 | Ga0081455_10002249 | |||
| 1978 | Ga0081455_10005984 | |||
| 1979 | Ga0081455_10069511 | |||
| 1980 | Ga0081455_10108285 | |||
| 1981 | Ga0081455_10114256 | |||
| 1982 | Ga0081540_1001950 | |||
| 1983 | Ga0081540_1010133 | |||
| 1984 | Ga0081540_1018922 | |||
| 1985 | Ga0081540_1025797 | |||
| 1986 | Ga0081540_1030561 | |||
| 1987 | Ga0081540_1042421 | |||
| 1988 | Ga0081540_1112812 | |||
| 1989 | Ga0081539_10000064 | |||
| 1990 | Ga0081539_10001064 | |||
| 1991 | Ga0081539_10018290 | |||
| 1992 | Ga0081539_10029371 | |||
| 1993 | Ga0081539_10049048 | |||
| 1994 | Ga0070717_10000379 | |||
| 1995 | Ga0070717_10005090 | |||
| 1996 | Ga0070717_10069519 | |||
| 1997 | Ga0070717_10383397 | |||
| 1998 | Ga0075365_10007366 | |||
| 1999 | Ga0075365_10081729 | |||
| 2000 | Ga0075365_10084058 | |||
| 2001 | Ga0075365_10167843 | |||
| 2002 | Ga0075365_10236017 | |||
| 2003 | Ga0075365_10269267 | |||
| 2004 | Ga0075365_10336663 | |||
| 2005 | Ga0075365_10382903 | |||
| 2006 | Ga0075365_10464795 | |||
| 2007 | Ga0075365_10488274 | |||
| 2008 | Ga0075365_10509708 | |||
| 2009 | Ga0075368_10001272 | |||
| 2010 | Ga0075368_10105298 | |||
| 2011 | Ga0075363_100004421 | |||
| 2012 | Ga0075363_100055650 | |||
| 2013 | Ga0075363_100071052 | |||
| 2014 | Ga0075363_100145515 | |||
| 2015 | Ga0075363_100149788 | |||
| 2016 | Ga0075363_100183373 | |||
| 2017 | Ga0075364_10018769 | |||
| 2018 | Ga0075364_10032323 | |||
| 2019 | Ga0070716_100002138 | |||
| 2020 | Ga0070716_100075018 | |||
| 2021 | Ga0070716_100079364 | |||
| 2022 | Ga0070716_100191723 | |||
| 2023 | Ga0070712_100020151 | |||
| 2024 | Ga0070712_100031394 | |||
| 2025 | Ga0070712_100063877 | |||
| 2026 | Ga0075362_10127207 | |||
| 2027 | Ga0075367_10026582 | |||
| 2028 | Ga0075367_10035383 | |||
| 2029 | Ga0075367_10051922 | |||
| 2030 | Ga0075367_10091552 | |||
| 2031 | Ga0075367_10150422 | |||
| 2032 | Ga0075367_10171681 | |||
| 2033 | Ga0075369_10052188 | |||
| 2034 | Ga0075369_10068341 | |||
| 2035 | Ga0075369_10098451 | |||
| 2036 | Ga0075369_10111053 | |||
| 2037 | Ga0075369_10160660 | |||
| 2038 | Ga0075366_10006408 | |||
| 2039 | Ga0075366_10271460 | |||
| 2040 | Ga0097621_100158463 | |||
| 2041 | Ga0097621_100501159 | |||
| 2042 | Ga0097621_100551085 | |||
| 2043 | Ga0075370_10038829 | |||
| 2044 | Ga0075370_10221969 | |||
| 2045 | Ga0075370_10233830 | |||
| 2046 | Ga0075370_10289739 | |||
| 2047 | Ga0075370_10389473 | |||
| 2048 | Ga0068871_100023928 | |||
| 2049 | Ga0068871_100196804 | |||
| 2050 | Ga0075428_100003163 | |||
| 2051 | Ga0075428_100327956 | |||
| 2052 | Ga0075430_100079445 | |||
| 2053 | Ga0075430_100143674 | |||
| 2054 | Ga0075431_100140136 | |||
| 2055 | Ga0075434_100118146 | |||
| 2056 | Ga0075434_101024648 | |||
| 2057 | Ga0075429_100186434 | |||
| 2058 | Ga0068865_100033374 | |||
| 2059 | Ga0068865_100659721 | |||
| 2060 | Ga0068865_100690493 | |||
| 2061 | Ga0075436_100029854 | |||
| 2062 | Ga0097620_100000552 | |||
| 2063 | Ga0097620_100579120 | |||
| 2064 | Ga0099824_1010514 | |||
| 2065 | Ga0099822_1000007 | |||
| 2066 | Ga0099823_1068738 | |||
| 2067 | Ga0075435_100022140 | |||
| 2068 | Ga0075435_100215709 | |||
| 2069 | Ga0075435_100617734 | |||
| 2070 | Ga0099794_10054284 | |||
| 2071 | Ga0099795_10004002 | |||
| 2072 | Ga0105250_10018234 | |||
| 2073 | Ga0105240_10004955 | |||
| 2074 | Ga0105240_10024802 | |||
| 2075 | Ga0105240_10060313 | |||
| 2076 | Ga0111539_10383649 | |||
| 2077 | Ga0105245_10068658 | |||
| 2078 | Ga0105245_10250662 | |||
| 2079 | Ga0105245_10320739 | |||
| 2080 | Ga0105247_10013328 | |||
| 2081 | Ga0105247_10040834 | |||
| 2082 | Ga0105247_10041764 | |||
| 2083 | Ga0105247_10081831 | |||
| 2084 | Ga0114129_10109968 | |||
| 2085 | Ga0114129_10169047 | |||
| 2086 | Ga0114129_10512565 | |||
| 2087 | Ga0114129_10894922 | |||
| 2088 | Ga0105243_10131988 | |||
| 2089 | Ga0105243_10304602 | |||
| 2090 | Ga0105241_10002977 | |||
| 2091 | Ga0105241_10112712 | |||
| 2092 | Ga0105241_10165676 | |||
| 2093 | Ga0105241_10237304 | |||
| 2094 | Ga0105242_10072423 | |||
| 2095 | Ga0105242_10483120 | |||
| 2096 | Ga0105242_10821548 | |||
| 2097 | Ga0105248_10122665 | |||
| 2098 | Ga0105248_10135059 | |||
| 2099 | Ga0105248_10381948 | |||
| 2100 | Ga0105237_10022854 | |||
| 2101 | Ga0105237_10035721 | |||
| 2102 | Ga0105237_10061282 | |||
| 2103 | Ga0105237_10072136 | |||
| 2104 | Ga0105237_10084285 | |||
| 2105 | Ga0105237_10543896 | |||
| 2106 | Ga0105237_10642574 | |||
| 2107 | Ga0105237_11030567 | |||
| 2108 | Ga0105238_10000905 | |||
| 2109 | Ga0105238_10052206 | |||
| 2110 | Ga0105238_10142872 | |||
| 2111 | Ga0105238_10176328 | |||
| 2112 | Ga0105238_10179647 | |||
| 2113 | Ga0105238_10960231 | |||
| 2114 | Ga0105238_11025786 | |||
| 2115 | Ga0105238_11039134 | |||
| 2116 | Ga0105249_10019788 | |||
| 2117 | Ga0105249_10768850 | |||
| 2118 | Ga0099796_10040034 | |||
| 2119 | Ga0105239_10050601 | |||
| 2120 | Ga0105239_10058274 | |||
| 2121 | Ga0105239_10156490 | |||
| 2122 | Ga0105239_10184109 | |||
| 2123 | Ga0105239_10249142 | |||
| 2124 | Ga0105239_10252241 | |||
| 2125 | Ga0105239_10512499 | |||
| 2126 | Ga0105239_10650354 | |||
| 2127 | Ga0105239_10771866 | |||
| 2128 | Ga0105239_10842182 | |||
| 2129 | Ga0105246_10300405 | |||
| 2130 | Ga0105246_10480271 | |||
| 2131 | Ga0157370_10118471 | |||
| 2132 | Ga0157370_10228965 | |||
| 2133 | Ga0157369_10012163 | |||
| 2134 | Ga0157369_10012723 | |||
| 2135 | Ga0157369_10314320 | |||
| 2136 | Ga0157369_10477983 | |||
| 2137 | Ga0157374_10040671 | |||
| 2138 | Ga0157374_10079260 | |||
| 2139 | Ga0157374_10207460 | |||
| 2140 | Ga0157378_10005478 | |||
| 2141 | Ga0157378_10139561 | |||
| 2142 | Ga0157378_10223052 | |||
| 2143 | Ga0163162_10030064 | |||
| 2144 | Ga0163162_10138945 | |||
| 2145 | Ga0163162_10146801 | |||
| 2146 | Ga0163162_10296887 | |||
| 2147 | Ga0163162_10654073 | |||
| 2148 | Ga0157372_10110926 | |||
| 2149 | Ga0157375_10015063 | |||
| 2150 | Ga0157375_10366657 | |||
| 2151 | Ga0157375_10760094 | |||
| 2152 | Ga0157375_11135778 | |||
| 2153 | Ga0163163_10002009 | |||
| 2154 | Ga0163163_10052597 | |||
| 2155 | Ga0163163_10243220 | |||
| 2156 | Ga0157377_10029894 | |||
| 2157 | Ga0157377_10062219 | |||
| 2158 | Ga0157379_10018063 | |||
| 2159 | Ga0157379_10219847 | |||
| 2160 | Ga0157376_10017044 | |||
| 2161 | Ga0157376_10480590 | |||
| 2162 | Ga0157376_10998005 | |||
| 2163 | Ga0163161_10213800 | |||
| 2164 | Ga0163161_10356814 | |||
| 2165 | Ga0214544_1000016 | |||
| 2166 | Ga0214542_1000016 | |||
| 2167 | Ga0214545_1000008 | |||
| 2168 | Ga0214543_1001466 | |||
| 2169 | Ga0213873_10002209 | |||
| 2170 | Ga0213874_10040486 | |||
| 2171 | Ga0213876_10272946 | |||
| 2172 | Ga0213875_10038914 | |||
| 2173 | Ga0224712_10123849 | |||
| 2174 | Ga0209563_102498 | |||
| 2175 | Ga0207425_1011367 | |||
| 2176 | Ga0209677_101570 | |||
| 2177 | Ga0209677_102974 | |||
| 2178 | Ga0209148_1000282 | |||
| 2179 | Ga0209233_1001514 | |||
| 2180 | Ga0209233_1003283 | |||
| 2181 | Ga0209233_1003656 | |||
| 2182 | Ga0209233_1012897 | |||
| 2183 | Ga0209455_1009197 | |||
| 2184 | Ga0209455_1011450 | |||
| 2185 | Ga0209673_1028152 | |||
| 2186 | Ga0209564_1000321 | |||
| 2187 | Ga0209564_1006353 | |||
| 2188 | Ga0209564_1014084 | |||
| 2189 | Ga0209758_1000069 | |||
| 2190 | Ga0209758_1000635 | |||
| 2191 | Ga0209758_1001996 | |||
| 2192 | Ga0209758_1002493 | |||
| 2193 | Ga0209758_1003344 | |||
| 2194 | Ga0209758_1004028 | |||
| 2195 | Ga0209758_1027951 | |||
| 2196 | Ga0209758_1035951 | |||
| 2197 | Ga0209758_1046433 | |||
| 2198 | Ga0209758_1064202 | |||
| 2199 | Ga0209256_1003057 | |||
| 2200 | Ga0209256_1009466 | |||
| 2201 | Ga0209256_1011111 | |||
| 2202 | Ga0209256_1014872 | |||
| 2203 | Ga0209256_1032861 | |||
| 2204 | Ga0207426_1001557 | |||
| 2205 | Ga0207426_1009357 | |||
| 2206 | Ga0207426_1015096 | |||
| 2207 | Ga0209257_1000473 | |||
| 2208 | Ga0207656_10001411 | |||
| 2209 | Ga0207656_10212278 | |||
| 2210 | Ga0207653_10001291 | |||
| 2211 | Ga0207692_10000829 | |||
| 2212 | Ga0207692_10011684 | |||
| 2213 | Ga0207642_10039988 | |||
| 2214 | Ga0207642_10059098 | |||
| 2215 | Ga0207642_10092932 | |||
| 2216 | Ga0207710_10023217 | |||
| 2217 | Ga0207710_10077581 | |||
| 2218 | Ga0207710_10139602 | |||
| 2219 | Ga0207710_10205766 | |||
| 2220 | Ga0207710_10246596 | |||
| 2221 | Ga0207688_10310976 | |||
| 2222 | Ga0207680_10058234 | |||
| 2223 | Ga0207647_10002640 | |||
| 2224 | Ga0207647_10009924 | |||
| 2225 | Ga0207647_10092513 | |||
| 2226 | Ga0207647_10118295 | |||
| 2227 | Ga0207647_10313245 | |||
| 2228 | Ga0207699_10279320 | |||
| 2229 | Ga0207699_10356925 | |||
| 2230 | Ga0207643_10015771 | |||
| 2231 | Ga0207705_10044726 | |||
| 2232 | Ga0207705_10115404 | |||
| 2233 | Ga0207684_10093369 | |||
| 2234 | Ga0207684_10599729 | |||
| 2235 | Ga0207654_10000058 | |||
| 2236 | Ga0207654_10051935 | |||
| 2237 | Ga0207654_10087010 | |||
| 2238 | Ga0207654_10106655 | |||
| 2239 | Ga0207707_10013527 | |||
| 2240 | Ga0207707_10017839 | |||
| 2241 | Ga0207707_10028421 | |||
| 2242 | Ga0207707_10109818 | |||
| 2243 | Ga0207707_10187675 | |||
| 2244 | Ga0207695_10000107 | |||
| 2245 | Ga0207695_10000453 | |||
| 2246 | Ga0207695_10031082 | |||
| 2247 | Ga0207695_10043718 | |||
| 2248 | Ga0207695_10146973 | |||
| 2249 | Ga0207695_10521443 | |||
| 2250 | Ga0207671_10010799 | |||
| 2251 | Ga0207671_10033398 | |||
| 2252 | Ga0207671_10063842 | |||
| 2253 | Ga0207671_10103876 | |||
| 2254 | Ga0207671_10108006 | |||
| 2255 | Ga0207671_10352206 | |||
| 2256 | Ga0207693_10005993 | |||
| 2257 | Ga0207693_10036014 | |||
| 2258 | Ga0207693_10066025 | |||
| 2259 | Ga0207693_10187863 | |||
| 2260 | Ga0207663_10009652 | |||
| 2261 | Ga0207663_10482355 | |||
| 2262 | Ga0207660_10024131 | |||
| 2263 | Ga0207660_10052109 | |||
| 2264 | Ga0207660_10144075 | |||
| 2265 | Ga0207660_10171945 | |||
| 2266 | Ga0207660_10297710 | |||
| 2267 | Ga0207657_10030836 | |||
| 2268 | Ga0207657_10165227 | |||
| 2269 | Ga0207649_10072759 | |||
| 2270 | Ga0207649_10129117 | |||
| 2271 | Ga0207652_10053324 | |||
| 2272 | Ga0207652_10115064 | |||
| 2273 | Ga0207652_10211968 | |||
| 2274 | Ga0207646_10018594 | |||
| 2275 | Ga0207681_10141583 | |||
| 2276 | Ga0207681_10348835 | |||
| 2277 | Ga0207681_10582296 | |||
| 2278 | Ga0207694_10001009 | |||
| 2279 | Ga0207694_10034962 | |||
| 2280 | Ga0207694_10109571 | |||
| 2281 | Ga0207694_10208492 | |||
| 2282 | Ga0207694_10242338 | |||
| 2283 | Ga0207694_10809670 | |||
| 2284 | Ga0207650_10040176 | |||
| 2285 | Ga0207650_10521255 | |||
| 2286 | Ga0207659_10366350 | |||
| 2287 | Ga0207659_10474223 | |||
| 2288 | Ga0207687_10009731 | |||
| 2289 | Ga0207687_10217459 | |||
| 2290 | Ga0207700_10008018 | |||
| 2291 | Ga0207700_10021866 | |||
| 2292 | Ga0207700_10023612 | |||
| 2293 | Ga0207700_10121194 | |||
| 2294 | Ga0207700_10152606 | |||
| 2295 | Ga0207664_10044473 | |||
| 2296 | Ga0207664_10212597 | |||
| 2297 | Ga0207664_10763008 | |||
| 2298 | Ga0207644_10025678 | |||
| 2299 | Ga0207690_10245586 | |||
| 2300 | Ga0207706_10029638 | |||
| 2301 | Ga0207706_10151733 | |||
| 2302 | Ga0207706_10309410 | |||
| 2303 | Ga0207706_10403739 | |||
| 2304 | Ga0207686_10360543 | |||
| 2305 | Ga0207686_10670756 | |||
| 2306 | Ga0207709_10015439 | |||
| 2307 | Ga0207709_10278026 | |||
| 2308 | Ga0207709_10332769 | |||
| 2309 | Ga0207709_10780677 | |||
| 2310 | Ga0207669_10024147 | |||
| 2311 | Ga0207669_10257497 | |||
| 2312 | Ga0207669_10318306 | |||
| 2313 | Ga0207704_10324519 | |||
| 2314 | Ga0207704_10440162 | |||
| 2315 | Ga0207665_10003377 | |||
| 2316 | Ga0207665_10028331 | |||
| 2317 | Ga0207665_10058458 | |||
| 2318 | Ga0207665_10295674 | |||
| 2319 | Ga0207665_10362814 | |||
| 2320 | Ga0207691_10064010 | |||
| 2321 | Ga0207691_10248585 | |||
| 2322 | Ga0207711_10125984 | |||
| 2323 | Ga0207711_10144901 | |||
| 2324 | Ga0207711_10146472 | |||
| 2325 | Ga0207711_10162548 | |||
| 2326 | Ga0207689_10031383 | |||
| 2327 | Ga0207689_10052519 | |||
| 2328 | Ga0207689_10055221 | |||
| 2329 | Ga0207689_10181973 | |||
| 2330 | Ga0207689_10203277 | |||
| 2331 | Ga0207689_10407015 | |||
| 2332 | Ga0207661_10143290 | |||
| 2333 | Ga0207661_10228193 | |||
| 2334 | Ga0207661_10626874 | |||
| 2335 | Ga0207679_10870463 | |||
| 2336 | Ga0207667_10006596 | |||
| 2337 | Ga0207667_10037711 | |||
| 2338 | Ga0207667_10105813 | |||
| 2339 | Ga0207667_10193127 | |||
| 2340 | Ga0207667_10352964 | |||
| 2341 | Ga0207667_11052624 | |||
| 2342 | Ga0207651_10376984 | |||
| 2343 | Ga0207712_10028935 | |||
| 2344 | Ga0207712_10113707 | |||
| 2345 | Ga0207712_10748922 | |||
| 2346 | Ga0207668_10027531 | |||
| 2347 | Ga0207668_10075178 | |||
| 2348 | Ga0207668_10090395 | |||
| 2349 | Ga0207668_10170900 | |||
| 2350 | Ga0207668_10184240 | |||
| 2351 | Ga0207668_10281417 | |||
| 2352 | Ga0207668_10289273 | |||
| 2353 | Ga0207668_10304916 | |||
| 2354 | Ga0207640_10022087 | |||
| 2355 | Ga0207640_10311597 | |||
| 2356 | Ga0207640_10649869 | |||
| 2357 | Ga0207658_10041912 | |||
| 2358 | Ga0207677_10073034 | |||
| 2359 | Ga0207677_10196236 | |||
| 2360 | Ga0207677_10247050 | |||
| 2361 | Ga0207703_10038395 | |||
| 2362 | Ga0207703_10108532 | |||
| 2363 | Ga0207703_10437051 | |||
| 2364 | Ga0207639_10006610 | |||
| 2365 | Ga0207639_10165446 | |||
| 2366 | Ga0207639_10226004 | |||
| 2367 | Ga0207639_10264035 | |||
| 2368 | Ga0207639_10680816 | |||
| 2369 | Ga0207678_10003936 | |||
| 2370 | Ga0207678_10008827 | |||
| 2371 | Ga0207678_10035234 | |||
| 2372 | Ga0207678_10048383 | |||
| 2373 | Ga0207678_10064168 | |||
| 2374 | Ga0207678_10108573 | |||
| 2375 | Ga0207678_10225927 | |||
| 2376 | Ga0207678_10240076 | |||
| 2377 | Ga0207678_10263171 | |||
| 2378 | Ga0207678_10377778 | |||
| 2379 | Ga0207678_10515548 | |||
| 2380 | Ga0207708_10000637 | |||
| 2381 | Ga0207708_10069101 | |||
| 2382 | Ga0207702_10000004 | |||
| 2383 | Ga0207702_10000559 | |||
| 2384 | Ga0207702_10051440 | |||
| 2385 | Ga0207702_10264986 | |||
| 2386 | Ga0207702_10488838 | |||
| 2387 | Ga0207641_10411949 | |||
| 2388 | Ga0207648_10243993 | |||
| 2389 | Ga0207648_10256305 | |||
| 2390 | Ga0207676_10031791 | |||
| 2391 | Ga0207676_10052297 | |||
| 2392 | Ga0207676_10059998 | |||
| 2393 | Ga0207676_10190154 | |||
| 2394 | Ga0207676_10278695 | |||
| 2395 | Ga0207674_10002298 | |||
| 2396 | Ga0207674_10002522 | |||
| 2397 | Ga0207674_10008231 | |||
| 2398 | Ga0207674_10234853 | |||
| 2399 | Ga0207674_10298802 | |||
| 2400 | Ga0207674_10645327 | |||
| 2401 | Ga0207674_10875719 | |||
| 2402 | Ga0207675_100047846 | |||
| 2403 | Ga0207675_100084190 | |||
| 2404 | Ga0207675_100106861 | |||
| 2405 | Ga0207675_100243210 | |||
| 2406 | Ga0207683_10318085 | |||
| 2407 | Ga0207683_10345208 | |||
| 2408 | Ga0207683_10422781 | |||
| 2409 | Ga0207698_10092147 | |||
| 2410 | Ga0207698_10458540 | |||
| 2411 | Ga0207698_10590230 | |||
| 2412 | Ga0207698_10653924 | |||
| 2413 | Ga0209389_1000033 | |||
| 2414 | Ga0209389_1000071 | |||
| 2415 | Ga0209589_1000021 | |||
| 2416 | Ga0209589_1000040 | |||
| 2417 | Ga0209489_100028 | |||
| 2418 | Ga0209489_100045 | |||
| 2419 | Ga0209489_100209 | |||
| 2420 | Ga0209700_100011 | |||
| 2421 | Ga0209700_100037 | |||
| 2422 | Ga0209588_1001299 | |||
| 2423 | Ga0209588_1019980 | |||
| 2424 | Ga0209813_10000201 | |||
| 2425 | Ga0209813_10064936 | |||
| 2426 | Ga0268266_10001190 | |||
| 2427 | Ga0268266_10024290 | |||
| 2428 | Ga0268266_10026628 | |||
| 2429 | Ga0268266_10034776 | |||
| 2430 | Ga0268266_10045773 | |||
| 2431 | Ga0268266_10203004 | |||
| 2432 | Ga0268266_10272296 | |||
| 2433 | Ga0268266_10307893 | |||
| 2434 | Ga0268266_10372513 | |||
| 2435 | Ga0268266_10485275 | |||
| 2436 | Ga0268266_10895502 | |||
| 2437 | Ga0268265_10000577 | |||
| 2438 | Ga0268265_10077153 | |||
| 2439 | Ga0268265_10368038 | |||
| 2440 | Ga0268264_10001716 | |||
| 2441 | Ga0268264_10239887 | |||
| 2442 | Ga0268264_10469921 | |||
| 2443 | Ga0268264_10475295 | |||
| 2444 | Ga0265319_1006443 | |||
| 2445 | Ga0265323_10018813 | |||
| 2446 | Ga0265336_10000561 | |||
| 2447 | Ga0307517_10001338 | |||
| 2448 | Ga0307515_10142658 | |||
| 2449 | Ga0307515_10405672 | |||
| 2450 | Ga0265338_10000598 | |||
| 2451 | Ga0265324_10005564 | |||
| 2452 | Ga0265330_10026023 | |||
| 2453 | Ga0265330_10036526 | |||
| 2454 | Ga0265340_10004461 | |||
| 2455 | Ga0265339_10068118 | |||
| 2456 | Ga0265331_10000700 | |||
| 2457 | Ga0265316_10149532 | |||
| 2458 | Ga0307513_10068868 | |||
| 2459 | Ga0307509_10211654 | |||
| 2460 | Ga0265313_10000325 | |||
| 2461 | Ga0307508_10000002 | |||
| 2462 | Ga0307508_10087616 | |||
| 2463 | Ga0307508_10199084 | |||
| 2464 | Ga0307508_10241422 | |||
| 2465 | Ga0307508_10393947 | |||
| 2466 | Ga0265314_10019063 | |||
| 2467 | Ga0265342_10007101 | |||
| 2468 | Ga0265342_10119391 | |||
| 2469 | Ga0265342_10155282 | |||
| 2470 | Ga0316578_10289696 | |||
| 2471 | Ga0307516_10026599 | |||
| 2472 | Ga0307516_10345552 | |||
| 2473 | Ga0307405_10097272 | |||
| 2474 | Ga0316577_10118269 | |||
| 2475 | Ga0307413_10202590 | |||
| 2476 | Ga0307518_10295003 | |||
| 2477 | Ga0307406_10267896 | |||
| 2478 | Ga0307412_10172095 | |||
| 2479 | Ga0307412_10694922 | |||
| 2480 | Ga0307409_100048824 | |||
| 2481 | Ga0307416_100859551 | |||
| 2482 | Ga0307411_10252908 | |||
| 2483 | Ga0307415_100095379 | |||
| 2484 | Ga0307510_10016711 | |||
| 2485 | Ga0307510_10018241 | |||
| 2486 | Ga0307510_10022224 | |||
| 2487 | Ga0307510_10047066 | |||
| 2488 | Ga0315911_1000008 | |||
| 2489 | Ga0373926_0163504 | |||
| 2490 | Ga0373934_0001837 | |||
| 2491 | Ga0373934_0002847 | |||
| 2492 | Ga0373944_0129169 | |||
| 2493 | Ga0373923_0000584 | |||
| 2494 | Ga0373923_0125509 | |||
| 2495 | Ga0373932_0016536 | |||
| 2496 | Ga0373936_0031970 | |||
| 2497 | Ga0373936_0088046 | |||
| 2498 | Ga0373936_0126658 | |||
| 2499 | Ga0373936_0139402 | |||
| 2500 | Ga0373936_0190110 | |||
| 2501 | Ga0373939_0003296 | |||
| 2502 | Ga0373939_0168086 | |||
| 2503 | Ga0373945_0027218 | |||
| 2504 | Ga0373945_0153580 | |||
| 2505 | Ga0373953_0004679 | |||
| 2506 | Ga0373953_0018328 | |||
| 2507 | Ga0373954_0000457 | |||
| 2508 | Ga0373956_0002107 | |||
| 2509 | Ga0373956_0083129 | |||
| 2510 | Ga0373957_0015297 | |||
| 2511 | Ga0373960_0078815 | |||
| 2512 | Ga0373943_0001945 | |||
| 2513 | Ga0373943_0062532 | |||
| 2514 | Ga0373946_0195388 | |||
| 2515 | Ga0373955_0001753 | |||
| 2516 | Ga0373955_0063919 | |||
| 2517 | Ga0316574_0002266 | |||
| 2518 | Ga0373924_0000541 | |||
| 2519 | Ga0373924_0021576 | |||
| 2520 | Ga0373931_0003137 | |||
| 2521 | Ga0373931_0479520 | |||
| 2522 | Ga0373935_0000557 | |||
| 2523 | Ga0373935_0388131 | |||
| 2524 | Ga0373935_0474525 | |||
| 2525 | Ga0373927_0003023 | |||
| 2526 | Ga0373927_0004813 | |||
| 2527 | Ga0373927_0058310 | |||
| 2528 | Ga0373927_0096117 | |||
| 2529 | Ga0373927_0187577 | |||
| 2530 | Ga0373933_0000031 | |||
| 2531 | Ga0373933_0004255 | |||
| 2532 | Ga0373933_0011282 | |||
| 2533 | Ga0373947_0000509 | |||
| 2534 | Ga0373947_0035886 | |||
| 2535 | Ga0373937_0079894 | |||
| 2536 | Ga0373937_0127768 | |||
| 2537 | Ga0316582_0084703 | |||
| 2538 | Ga0373925_0004758 | |||
| 2539 | Ga0373925_0017744 | |||
| 2540 | Ga0373925_0099882 | |||
| 2541 | Ga0373925_0460784 | |||
| 2542 | Ga0395899_0360909 | |||
| 2543 | Ga0395899_0482907 | |||
| 2544 | Ga0395900_0001984 | |||
| 2545 | Ga0395900_0028654 | |||
| 2546 | Ga0395900_0072755 | |||
| 2547 | Ga0395900_0199514 | |||
| 2548 | Ga0395900_0261538 | |||
| 2549 | Ga0395900_0388182 | |||
| 2550 | Ga0395900_0391262 | |||
| 2551 | Ga0395900_0505065 | |||
| 2552 | Ga0395898_0058535 | |||
| 2553 | Ga0395898_0066890 | |||
| 2554 | Ga0395898_0072108 | |||
| 2555 | Ga0395898_0101184 | |||
| 2556 | Ga0395898_0113725 | |||
| 2557 | Ga0395898_0160769 | |||
| 2558 | Ga0395898_0206756 | |||
| 2559 | Ga0395898_0506185 | |||
| 2560 | Ga0395905_0005856 | |||
| 2561 | Ga0395905_0225768 | |||
| 2562 | Ga0395905_0401113 | |||
| 2563 | Ga0395905_0529380 | |||
| 2564 | Ga0436364_1438024 | |||
| 2565 | Ga0395901_0014044 | |||
| 2566 | Ga0395901_0107414 | |||
| 2567 | Ga0395901_0189853 | |||
| 2568 | Ga0395901_0898643 | |||
| 2569 | Ga0400483_033818 | |||
| 2570 | Ga0436365_0195546 | |||
| 2571 | Ga0436365_0729277 | |||
| 2572 | Ga0436365_1220818 | |||
| 2573 | Ga0436365_1292002 | |||
| 2574 | Ga0436365_1496897 | |||
| 2575 | Ga0436360_0889414 | |||
| 2576 | Ga0436360_0928292 | |||
| 2577 | Ga0436361_0341305 | |||
| 2578 | Ga0436361_0355131 | |||
| 2579 | Ga0436361_0442239 | |||
| 2580 | Ga0436361_0533066 | |||
| 2581 | Ga0436363_0403775 | |||
| 2582 | Ga0436363_0932690 | |||
| 2583 | Ga0436363_1449980 | |||
| 2584 | Ga0436362_0490728 | |||
| 2585 | Ga0439465_0033404 | |||
| 2586 | Ga0451789_1337613 | |||
| 2587 | Ga0451793_0572232 | |||
| 2588 | Ga0451797_0433956 | |||
| 2589 | Ga0451800_0679019 | |||
| 2590 | Ga0451851_0220444 | |||
| 2591 | Ga0451853_0380659 | |||
| 2592 | Ga0439455_0027240 | |||
| 2593 | Ga0466969_0253060 | |||
| 2594 | Ga0466972_0000119 | |||
| 2595 | Ga0466972_0004617 | |||
| 2596 | Ga0466972_0058819 | |||
| 2597 | Ga0466972_0085741 | |||
| 2598 | Ga0466961_0000139 | |||
| 2599 | Ga0466961_0098994 | |||
| 2600 | Ga0466963_0325288 | |||
| 2601 | Ga0466964_0160025 | |||
| 2602 | Ga0466964_0173420 | |||
| 2603 | Ga0466968_0023996 | |||
| 2604 | Ga0466968_0178539 | |||
| 2605 | Ga0466968_0197652 | |||
| 2606 | Ga0466957_0020746 | |||
| 2607 | Ga0466957_0175921 | |||
| 2608 | Ga0466960_0000848 | |||
| 2609 | Ga0466959_0009300 | |||
| 2610 | Ga0466958_0031879 | |||
| 2611 | Ga0466967_0068408 | |||
| 2612 | Ga0466967_0109024 | |||
| 2613 | Ga0466967_0557124 | |||
| 2614 | Ga0466967_0682387 | |||
| 2615 | Ga0495617_021654 | |||
| 2616 | Ga0495592_0005520 | |||
| 2617 | Ga0495592_0046164 | |||
| 2618 | Ga0495592_0067710 | |||
| 2619 | Ga0495592_0200493 | |||
| 2620 | Ga0495592_0253690 | |||
| 2621 | Ga0495603_0000047 | |||
| 2622 | Ga0495603_0008529 | |||
| 2623 | Ga0495603_0107144 | |||
| 2624 | Ga0495603_0162890 | |||
| 2625 | Ga0495590_0052595 | |||
| 2626 | Ga0495590_0109016 | |||
| 2627 | Ga0495629_0000124 | |||
| 2628 | Ga0495629_0000412 | |||
| 2629 | Ga0495629_0100107 | |||
| 2630 | Ga0495629_0198429 | |||
| 2631 | Ga0495629_0222311 | |||
| 2632 | Ga0495638_0011840 | |||
| 2633 | Ga0495641_0245720 | |||
| 2634 | Ga0495651_0001844 | |||
| 2635 | Ga0495651_0041553 | |||
| 2636 | Ga0495651_0143270 | |||
| 2637 | Ga0495651_0182137 | |||
| 2638 | Ga0495653_0003027 | |||
| 2639 | Ga0495653_0133112 | |||
| 2640 | Ga0495653_0184152 | |||
| 2641 | Ga0495650_0070929 | |||
| 2642 | Ga0495580_0001798 | |||
| 2643 | Ga0495580_0150829 | |||
| 2644 | Ga0495580_0234416 | |||
| 2645 | Ga0495582_0000043 | |||
| 2646 | Ga0495605_0190928 | |||
| 2647 | Ga0495639_0000091 | |||
| 2648 | Ga0495639_0077374 | |||
| 2649 | Ga0495662_0000128 | |||
| 2650 | Ga0495664_0018008 | |||
| 2651 | Ga0495664_0018674 | |||
| 2652 | Ga0495664_0040679 | |||
| 2653 | Ga0495664_0068058 | |||
| 2654 | Ga0495664_0202272 | |||
| 2655 | Ga0495584_0119345 | |||
| 2656 | Ga0495585_0042226 | |||
| 2657 | Ga0495585_0048141 | |||
| 2658 | Ga0495585_0173329 | |||
| 2659 | Ga0495585_0178127 | |||
| 2660 | Ga0495594_0000710 | |||
| 2661 | Ga0495594_0056271 | |||
| 2662 | Ga0495594_0144129 | |||
| 2663 | Ga0495594_0187144 | |||
| 2664 | Ga0495607_0064946 | |||
| 2665 | Ga0495607_0204727 | |||
| 2666 | Ga0495583_0043267 | |||
| 2667 | Ga0495583_0088040 | |||
| 2668 | Ga0495606_0000252 | |||
| 2669 | Ga0495606_0027929 | |||
| 2670 | Ga0495606_0138653 | |||
| 2671 | Ga0495606_0173910 | |||
| 2672 | Ga0495608_0005047 | |||
| 2673 | Ga0495608_0018263 | |||
| 2674 | Ga0495608_0064744 | |||
| 2675 | Ga0495610_0031944 | |||
| 2676 | Ga0495616_0005758 | |||
| 2677 | Ga0495616_0046885 | |||
| 2678 | Ga0495616_0094318 | |||
| 2679 | Ga0495616_0127896 | |||
| 2680 | Ga0495618_0008644 | |||
| 2681 | Ga0495618_0028334 | |||
| 2682 | Ga0495618_0042509 | |||
| 2683 | Ga0495620_0041922 | |||
| 2684 | Ga0495620_0086070 | |||
| 2685 | Ga0495620_0132582 | |||
| 2686 | Ga0495620_0157811 | |||
| 2687 | Ga0495628_0005453 | |||
| 2688 | Ga0495628_0010523 | |||
| 2689 | Ga0495628_0055934 | |||
| 2690 | Ga0495630_0000409 | |||
| 2691 | Ga0495631_0035038 | |||
| 2692 | Ga0495632_0067438 | |||
| 2693 | Ga0495632_0189778 | |||
| 2694 | Ga0495637_0066063 | |||
| 2695 | Ga0495643_0008158 | |||
| 2696 | Ga0495643_0013337 | |||
| 2697 | Ga0495643_0056515 | |||
| 2698 | Ga0495643_0066401 | |||
| 2699 | Ga0495644_0072873 | |||
| 2700 | Ga0495644_0198607 | |||
| 2701 | Ga0495648_0000286 | |||
| 2702 | Ga0495648_0013656 | |||
| 2703 | Ga0495648_0029843 | |||
| 2704 | Ga0495648_0035024 | |||
| 2705 | Ga0495663_0014215 | |||
| 2706 | Ga0495666_0270016 | |||
| 2707 | Ga0495642_0063578 | |||
| 2708 | Ga0495652_0016312 | |||
| 2709 | Ga0495652_0025438 | |||
| 2710 | Ga0495652_0034509 | |||
| 2711 | Ga0495652_0192811 | |||
| 2712 | Ga0495652_0332104 | |||
| 2713 | Ga0495654_0062024 | |||
| 2714 | Ga0495654_0132946 | |||
| 2715 | Ga0495665_0000051 | |||
| 2716 | Ga0495665_0162928 | |||
| 2717 | Ga0495640_0018056 | |||
| 2718 | Ga0495640_0025585 | |||
| 2719 | Ga0495640_0027089 | |||
| 2720 | Ga0495640_0031307 | |||
| 2721 | Ga0495640_0035828 | |||
| 2722 | Ga0495640_0043249 | |||
| 2723 | Ga0495640_0234618 | |||
| 2724 | Ga0495587_0015106 | |||
| 2725 | Ga0495587_0016155 | |||
| 2726 | Ga0495587_0041570 | |||
| 2727 | Ga0495587_0371553 | |||
| 2728 | Ga0495598_0011776 | |||
| 2729 | Ga0495609_0226895 | |||
| 2730 | Ga0495621_0047012 | |||
| 2731 | Ga0495597_0003622 | |||
| 2732 | Ga0495597_0065994 | |||
| 2733 | Ga0495645_0006035 | |||
| 2734 | Ga0495645_0016860 | |||
| 2735 | Ga0495645_0098789 | |||
| 2736 | Ga0495622_0001949 | |||
| 2737 | Ga0495622_0002870 | |||
| 2738 | Ga0495622_0011450 | |||
| 2739 | Ga0495622_0038866 | |||
| 2740 | Ga0495622_0201031 | |||
| 2741 | Ga0495633_0060892 | |||
| 2742 | Ga0495633_0101430 | |||
| 2743 | Ga0495633_0237612 | |||
| 2744 | Ga0495667_0000551 | |||
| 2745 | Ga0495667_0011016 | |||
| 2746 | Ga0495667_0129900 | |||
| 2747 | Ga0495656_0022981 | |||
| 2748 | Ga0495656_0080058 | |||
| 2749 | Ga0495656_0318560 | |||
| 2750 | Ga0495668_0040761 | |||
| 2751 | Ga0495668_0059795 | |||
| 2752 | Ga0495668_0109596 | |||
| 2753 | Ga0495668_0124093 | |||
| 2754 | Ga0495668_0125432 | |||
| 2755 | Ga0495668_0145384 | |||
| 2756 | Ga0495634_0000400 | |||
| 2757 | Ga0495634_0022290 | |||
| 2758 | Ga0495634_0078140 | |||
| 2759 | Ga0495611_0120300 | |||
| 2760 | Ga0495625_0011373 | |||
| 2761 | Ga0495625_0053812 | |||
| 2762 | Ga0495625_0076103 | |||
| 2763 | Ga0495625_0088384 | |||
| 2764 | Ga0495625_0089998 | |||
| 2765 | Ga0495625_0136450 | |||
| 2766 | Ga0495625_0157385 | |||
| 2767 | Ga0495625_0260041 | |||
| 2768 | Ga0495625_0361352 | |||
| 2769 | Ga0495635_0000620 | |||
| 2770 | Ga0495635_0023042 | |||
| 2771 | Ga0495635_0047375 | |||
| 2772 | Ga0495635_0066447 | |||
| 2773 | Ga0495659_0033909 | |||
| 2774 | Ga0495661_0014712 | |||
| 2775 | Ga0495588_0002713 | |||
| 2776 | Ga0495588_0005933 | |||
| 2777 | Ga0495588_0008572 | |||
| 2778 | Ga0495588_0157934 | |||
| 2779 | Ga0495657_0019076 | |||
| 2780 | Ga0495657_0119111 | |||
| 2781 | Ga0495599_0009152 | |||
| 2782 | Ga0495599_0124776 | |||
| 2783 | Ga0495623_0048735 | |||
| 2784 | Ga0495623_0050484 | |||
| 2785 | Ga0495623_0060554 | |||
| 2786 | Ga0495623_0155632 | |||
| 2787 | Ga0495646_0000643 | |||
| 2788 | Ga0495646_0025658 | |||
| 2789 | Ga0495646_0287961 | |||
| 2790 | Ga0495647_0104602 | |||
| 2791 | Ga0495658_0000499 | |||
| 2792 | Ga0495658_0047627 | |||
| 2793 | Ga0495658_0339022 | |||
| 2794 | Ga0495658_0429762 | |||
| 2795 | Ga0495669_0091278 | |||
| 2796 | Ga0495669_0217009 | |||
| 2797 | Ga0495613_0001280 | |||
| 2798 | Ga0495613_0064643 | |||
| 2799 | Ga0495613_0190097 | |||
| 2800 | Ga0495624_0003551 | |||
| 2801 | Ga0495624_0030201 | |||
| 2802 | Ga0495670_0003877 | |||
| 2803 | Ga0495670_0041117 | |||
| 2804 | Ga0495670_0088780 | |||
| 2805 | Ga0495671_0050005 | |||
| 2806 | Ga0495671_0104761 | |||
| 2807 | Ga0495671_0131066 | |||
| 2808 | Ga0495649_0066921 | |||
| 2809 | Ga0495649_0079820 | |||
| 2810 | Ga0495589_0226029 | |||
| 2811 | Ga0495600_0001007 | |||
| 2812 | Ga0495600_0010354 | |||
| 2813 | Ga0495600_0087489 | |||
| 2814 | Ga0495660_0013521 | |||
| 2815 | Ga0495581_0003073 | |||
| 2816 | Ga0495581_0005324 | |||
| 2817 | Ga0495581_0091986 | |||
| 2818 | Ga0495581_0224865 | |||
| 2819 | Ga0495604_0005813 | |||
| 2820 | Ga0495604_0023465 | |||
| 2821 | Ga0495604_0135784 | |||
| 2822 | Ga0495604_0263505 | |||
| 2823 | Ga0495636_0114024 | |||
| 2824 | Ga0495674_0003683 | |||
| 2825 | Ga0495674_0005428 | |||
| 2826 | Ga0495674_0016652 | |||
| 2827 | Ga0495674_0064675 | |||
| 2828 | Ga0495674_0271751 | |||
| 2829 | Ga0495674_0444038 | |||
| 2830 | Ga0495674_0450403 | |||
| 2831 | Ga0495672_0030899 | |||
| 2832 | Ga0495672_0050522 | |||
| 2833 | Ga0495676_0062800 | |||
| 2834 | Ga0495676_0075836 | |||
| 2835 | Ga0495676_0102860 | |||
| 2836 | Ga0495676_0113187 | |||
| 2837 | Ga0495676_0203431 | |||
| 2838 | Ga0495676_0439825 | |||
| 2839 | Ga0495680_0000689 | |||
| 2840 | Ga0495680_0001909 | |||
| 2841 | Ga0495680_0046311 | |||
| 2842 | Ga0495675_0001972 | |||
| 2843 | Ga0495675_0005931 | |||
| 2844 | Ga0495677_0074890 | |||
| 2845 | Ga0495685_033954 | |||
| 2846 | Ga0495673_0053426 | |||
| 2847 | Ga0495673_0077871 | |||
| 2848 | Ga0495681_0050784 | |||
| 2849 | Ga0495684_0000313 | |||
| 2850 | Ga0495684_0033360 | |||
| 2851 | Ga0495684_0035943 | |||
| 2852 | Ga0495686_0082012 | |||
| 2853 | Ga0495686_0087503 | |||
| 2854 | Ga0495686_0097506 | |||
| 2855 | Ga0495593_0000222 | |||
| 2856 | Ga0495593_0001524 | |||
| 2857 | Ga0495593_0027368 | |||
| 2858 | Ga0495593_0114504 | |||
| 2859 | Ga0495602_0018371 | |||
| 2860 | Ga0495602_0024168 | |||
| 2861 | Ga0495602_0057923 | |||
| 2862 | Ga0495602_0069055 | |||
| 2863 | Ga0495614_0006067 | |||
| 2864 | Ga0495626_0049424 | |||
| 2865 | Ga0495626_0064388 | |||
| 2866 | Ga0495626_0214570 | |||
| 2867 | Ga0496100_0044305 | |||
| 2868 | Ga0496100_0116571 | |||
| 2869 | Ga0496100_0459090 | |||
| 2870 | Ga0496101_0097458 | |||
| 2871 | Ga0496101_0166902 | |||
| 2872 | Ga0496101_0320306 | |||
| 2873 | Ga0496102_0001314 | |||
| 2874 | Ga0496102_0018104 | |||
| 2875 | Ga0496102_0040673 | |||
| 2876 | Ga0496102_0114052 | |||
| 2877 | Ga0496102_0188326 | |||
| 2878 | Ga0496102_0657923 | |||
| 2879 | Ga0496102_1121886 | |||
| 2880 | Ga0496103_0006816 | |||
| 2881 | Ga0496103_0029272 | |||
| 2882 | Ga0496103_0202767 | |||
| 2883 | Ga0496103_0454926 | |||
| 2884 | Ga0496104_0036120 | |||
| 2885 | Ga0496104_0065339 | |||
| 2886 | Ga0496104_0100894 | |||
| 2887 | Ga0496104_0111801 | |||
| 2888 | Ga0496104_0139175 | |||
| 2889 | Ga0496104_0303036 | |||
| 2890 | Ga0496104_0303070 | |||
| 2891 | Ga0496104_0351132 | |||
| 2892 | Ga0496104_0628144 | |||
| 2893 | Ga0496105_0002433 | |||
| 2894 | Ga0496105_0003051 | |||
| 2895 | Ga0496105_0007056 | |||
| 2896 | Ga0496105_0020689 | |||
| 2897 | Ga0496105_0041194 | |||
| 2898 | Ga0496105_0089019 | |||
| 2899 | Ga0496105_0127168 | |||
| 2900 | Ga0496105_0199912 | |||
| 2901 | Ga0496106_0000236 | |||
| 2902 | Ga0496106_0002924 | |||
| 2903 | Ga0496106_0038952 | |||
| 2904 | Ga0496106_0145494 | |||
| 2905 | Ga0496106_0252341 | |||
| 2906 | Ga0496107_0001397 | |||
| 2907 | Ga0496107_0002944 | |||
| 2908 | Ga0496107_0003292 | |||
| 2909 | Ga0496107_0012539 | |||
| 2910 | Ga0496107_0227020 | |||
| 2911 | Ga0496107_0231076 | |||
| 2912 | Ga0496107_0416530 | |||
| 2913 | Ga0496108_0001079 | |||
| 2914 | Ga0496108_0008725 | |||
| 2915 | Ga0496108_0011914 | |||
| 2916 | Ga0496108_0047386 | |||
| 2917 | Ga0496108_0200867 | |||
| 2918 | Ga0496108_0481121 | |||
| 2919 | Ga0496108_0948339 | |||
| 2920 | Ga0496109_0000224 | |||
| 2921 | Ga0496109_0011741 | |||
| 2922 | Ga0496109_0023768 | |||
| 2923 | Ga0496109_0026996 | |||
| 2924 | Ga0496109_0275040 | |||
| 2925 | Ga0496109_0355175 | |||
| 2926 | Ga0496109_0782951 | |||
| 2927 | Ga0496110_0000798 | |||
| 2928 | Ga0496110_0023351 | |||
| 2929 | Ga0496110_0075893 | |||
| 2930 | Ga0496110_0103119 | |||
| 2931 | Ga0496110_0131325 | |||
| 2932 | Ga0496110_0323011 | |||
| 2933 | Ga0496110_0324478 | |||
| 2934 | Ga0496111_0026727 | |||
| 2935 | Ga0496111_0036689 | |||
| 2936 | Ga0496111_0172239 | |||
| 2937 | Ga0496112_0014051 | |||
| 2938 | Ga0496112_0027365 | |||
| 2939 | Ga0496112_0039208 | |||
| 2940 | Ga0496112_0102462 | |||
| 2941 | Ga0496112_0399221 | |||
| 2942 | Ga0496112_0854036 | |||
| 2943 | Ga0496113_0013547 | |||
| 2944 | Ga0496113_0013955 | |||
| 2945 | Ga0496113_0022543 | |||
| 2946 | Ga0496113_0142151 | |||
| 2947 | Ga0496113_0230719 | |||
| 2948 | Ga0496113_0301595 | |||
| 2949 | Ga0496114_0017033 | |||
| 2950 | Ga0496114_0029828 | |||
| 2951 | Ga0496114_0062219 | |||
| 2952 | Ga0496114_0292694 | |||
| 2953 | Ga0496114_0347910 | |||
| 2954 | Ga0496115_0008934 | |||
| 2955 | Ga0496115_0018663 | |||
| 2956 | Ga0496115_0022918 | |||
| 2957 | Ga0496115_0099478 | |||
| 2958 | Ga0496115_0178831 | |||
| 2959 | Ga0496115_0181341 | |||
| 2960 | Ga0496115_0248995 | |||
| 2961 | Ga0496115_0300383 | |||
| 2962 | Ga0496115_0315566 | |||
| 2963 | Ga0496116_0007668 | |||
| 2964 | Ga0496116_0028346 | |||
| 2965 | Ga0496116_0118605 | |||
| 2966 | Ga0496116_0266998 | |||
| 2967 | Ga0496117_0081884 | |||
| 2968 | Ga0496117_0148733 | |||
| 2969 | Ga0496117_0224588 | |||
| 2970 | Ga0496117_0240449 | |||
| 2971 | Ga0496118_0037627 | |||
| 2972 | Ga0496118_0060082 | |||
| 2973 | Ga0496118_0067888 | |||
| 2974 | Ga0496118_0101707 | |||
| 2975 | Ga0496118_0151088 | |||
| 2976 | Ga0496119_0034536 | |||
| 2977 | Ga0496119_0150095 | |||
| 2978 | Ga0496120_0006920 | |||
| 2979 | Ga0496120_0015604 | |||
| 2980 | Ga0496120_0024117 | |||
| 2981 | Ga0496120_0074701 | |||
| 2982 | Ga0496121_0002323 | |||
| 2983 | Ga0496121_0002352 | |||
| 2984 | Ga0496121_0007860 | |||
| 2985 | Ga0496121_0012178 | |||
| 2986 | Ga0496121_0042287 | |||
| 2987 | Ga0496121_0069408 | |||
| 2988 | Ga0496121_0078931 | |||
| 2989 | Ga0496121_0080763 | |||
| 2990 | Ga0496121_0085511 | |||
| 2991 | Ga0496121_0087028 | |||
| 2992 | Ga0496121_0094046 | |||
| 2993 | Ga0496121_0098955 | |||
| 2994 | Ga0496121_0104777 | |||
| 2995 | Ga0496121_0129450 | |||
| 2996 | Ga0496121_0204333 | |||
| 2997 | Ga0496121_0380006 | |||
| 2998 | Ga0496122_0015029 | |||
| 2999 | Ga0496122_0088360 | |||
| 3000 | Ga0496122_0230964 | |||
| 3001 | Ga0496123_0032736 | |||
| 3002 | Ga0496124_0072081 | |||
| 3003 | Ga0496124_0085676 | |||
| 3004 | Ga0496124_0086524 | |||
| 3005 | Ga0496125_0000407 | |||
| 3006 | Ga0496125_0003549 | |||
| 3007 | Ga0496125_0019012 | |||
| 3008 | Ga0496125_0025501 | |||
| 3009 | Ga0496125_0031546 | |||
| 3010 | Ga0496125_0054919 | |||
| 3011 | Ga0496125_0105053 | |||
| 3012 | Ga0496126_0010557 | |||
| 3013 | Ga0496126_0016898 | |||
| 3014 | Ga0496126_0039405 | |||
| 3015 | Ga0496126_0040373 | |||
| 3016 | Ga0496126_0040699 | |||
| 3017 | Ga0496126_0044612 | |||
| 3018 | Ga0496126_0044894 | |||
| 3019 | Ga0496126_0074908 | |||
| 3020 | Ga0496126_0107475 | |||
| 3021 | Ga0496126_0131289 | |||
| 3022 | Ga0496126_0143060 | |||
| 3023 | Ga0496126_0186534 | |||
| 3024 | Ga0496126_0195295 | |||
| 3025 | Ga0496126_0215509 | |||
| 3026 | Ga0496126_0327641 | |||
| 3027 | Ga0496126_0365611 | |||
| 3028 | Ga0496126_0406927 | |||
| 3029 | Ga0496126_0480168 | |||
| 3030 | Ga0496126_0574219 | |||
| 3031 | Ga0495682_0015666 | |||
| 3032 | Ga0495682_0037049 | |||
| 3033 | Ga0501031_0003271 | |||
| 3034 | Ga0501031_0008880 | |||
| 3035 | Ga0501031_0059238 | |||
| 3036 | Ga0501031_0263702 | |||
| 3037 | Ga0501032_0000475 | |||
| 3038 | Ga0501032_0007908 | |||
| 3039 | Ga0501032_0019827 | |||
| 3040 | Ga0501032_0085580 | |||
| 3041 | Ga0501032_0177110 | |||
| 3042 | Ga0501033_0000440 | |||
| 3043 | Ga0501033_0007523 | |||
| 3044 | Ga0501033_0021041 | |||
| 3045 | Ga0501033_0043858 | |||
| 3046 | Ga0501033_0052371 | |||
| 3047 | Ga0501033_0207421 | |||
| 3048 | Ga0501033_0248717 | |||
| 3049 | Ga0501034_0000250 | |||
| 3050 | Ga0501034_0150015 | |||
| 3051 | Ga0501034_0446392 | |||
| 3052 | Ga0501036_0000098 | |||
| 3053 | Ga0501036_0013189 | |||
| 3054 | Ga0501036_0024488 | |||
| 3055 | Ga0501036_0258387 | |||
| 3056 | Ga0501036_0336625 | |||
| 3057 | Ga0501036_0392966 | |||
| 3058 | Ga0501037_0000092 | |||
| 3059 | Ga0501037_0007646 | |||
| 3060 | Ga0501037_0137125 | |||
| 3061 | Ga0501037_0230497 | |||
| 3062 | Ga0501037_0231510 | |||
| 3063 | Ga0501037_0243807 | |||
| 3064 | Ga0501038_0000059 | |||
| 3065 | Ga0501038_0000626 | |||
| 3066 | Ga0501038_0016665 | |||
| 3067 | Ga0501038_0037290 | |||
| 3068 | Ga0501038_0072557 | |||
| 3069 | Ga0501038_0099333 | |||
| 3070 | Ga0501038_0157875 | |||
| 3071 | Ga0501038_0356366 | |||
| 3072 | Ga0501038_0512244 | |||
| 3073 | Ga0501038_0556662 | |||
| 3074 | Ga0501039_0000085 | |||
| 3075 | Ga0501039_0014414 | |||
| 3076 | Ga0501039_0023629 | |||
| 3077 | Ga0501039_0044669 | |||
| 3078 | Ga0501039_0091001 | |||
| 3079 | Ga0501039_0171832 | |||
| 3080 | Ga0501039_0280549 | |||
| 3081 | Ga0501039_0542531 | |||
| 3082 | Ga0501040_0017697 | |||
| 3083 | Ga0501040_0523548 | |||
| 3084 | Ga0501041_0054567 | |||
| 3085 | Ga0501041_0249745 | |||
| 3086 | Ga0501042_0008012 | |||
| 3087 | Ga0501042_0021877 | |||
| 3088 | Ga0501042_0273993 | |||
| 3089 | Ga0501043_0000460 | |||
| 3090 | Ga0501043_0019148 | |||
| 3091 | Ga0501043_0022917 | |||
| 3092 | Ga0501043_0047574 | |||
| 3093 | Ga0501043_0057636 | |||
| 3094 | Ga0501043_0111668 | |||
| 3095 | Ga0501043_0162663 | |||
| 3096 | Ga0501043_0220258 | |||
| 3097 | Ga0501046_0000483 | |||
| 3098 | Ga0501046_0006417 | |||
| 3099 | Ga0501046_0015232 | |||
| 3100 | Ga0501046_0036002 | |||
| 3101 | Ga0501046_0228883 | |||
| 3102 | Ga0501047_0000022 | |||
| 3103 | Ga0501047_0027820 | |||
| 3104 | Ga0501047_0028171 | |||
| 3105 | Ga0501047_0031699 | |||
| 3106 | Ga0501047_0108097 | |||
| 3107 | Ga0501047_0183016 | |||
| 3108 | Ga0501048_0070204 | |||
| 3109 | Ga0501048_0460893 | |||
| 3110 | Ga0501067_0000599 | |||
| 3111 | Ga0501067_0005409 | |||
| 3112 | Ga0501067_0022281 | |||
| 3113 | Ga0501067_0180998 | |||
| 3114 | Ga0501067_0467881 | |||
| 3115 | Ga0501068_0002124 | |||
| 3116 | Ga0501068_0049644 | |||
| 3117 | Ga0501068_0241474 | |||
| 3118 | Ga0501069_0001547 | |||
| 3119 | Ga0501069_0024367 | |||
| 3120 | Ga0501069_0086739 | |||
| 3121 | Ga0501069_0200118 | |||
| 3122 | Ga0501069_0392619 | |||
| 3123 | Ga0501070_0003550 | |||
| 3124 | Ga0501070_0004250 | |||
| 3125 | Ga0501070_0022819 | |||
| 3126 | Ga0501070_0101512 | |||
| 3127 | Ga0501070_0228606 | |||
| 3128 | Ga0501070_0238693 | |||
| 3129 | Ga0501071_0143112 | |||
| 3130 | Ga0501071_0249340 | |||
| 3131 | Ga0501071_0424480 | |||
| 3132 | Ga0501072_0017008 | |||
| 3133 | Ga0501072_0126132 | |||
| 3134 | Ga0501072_0187915 | |||
| 3135 | Ga0501073_0000109 | |||
| 3136 | Ga0501073_0040830 | |||
| 3137 | Ga0501073_0042240 | |||
| 3138 | Ga0501073_0460563 | |||
| 3139 | Ga0501074_0040467 | |||
| 3140 | Ga0501074_0077505 | |||
| 3141 | Ga0501074_0203953 | |||
| 3142 | Ga0501074_0374928 | |||
| 3143 | Ga0501076_0075443 | |||
| 3144 | Ga0501076_0291958 | |||
| 3145 | Ga0501076_0369700 | |||
| 3146 | Ga0501077_0018113 | |||
| 3147 | Ga0501079_0002132 | |||
| 3148 | Ga0501079_0070799 | |||
| 3149 | Ga0501079_0111381 | |||
| 3150 | Ga0501080_0073683 | |||
| 3151 | Ga0501080_0179593 | |||
| 3152 | Ga0501080_0510856 | |||
| 3153 | Ga0501080_0609678 | |||
| 3154 | Ga0501081_0582750 | |||
| 3155 | Ga0501083_0000618 | |||
| 3156 | Ga0501083_0036945 | |||
| 3157 | Ga0501035_0001471 | |||
| 3158 | Ga0501035_0006779 | |||
| 3159 | Ga0501035_0015506 | |||
| 3160 | Ga0501035_0055771 | |||
| 3161 | Ga0501035_0083623 | |||
| 3162 | Ga0501035_0132055 | |||
| 3163 | Ga0501035_0159634 | |||
| 3164 | Ga0501035_0346209 | |||
| 3165 | Ga0501035_0347213 | |||
| 3166 | Ga0501035_0457491 | |||
| 3167 | Ga0501035_0510678 | |||
| 3168 | Ga0501035_0760126 | |||
| 3169 | Ga0501044_0000072 | |||
| 3170 | Ga0501044_0001765 | |||
| 3171 | Ga0501044_0010833 | |||
| 3172 | Ga0501044_0012151 | |||
| 3173 | Ga0501044_0046031 | |||
| 3174 | Ga0501044_0113631 | |||
| 3175 | Ga0501044_0168157 | |||
| 3176 | Ga0501044_0646328 | |||
| 3177 | Ga0501045_0005982 | |||
| 3178 | Ga0501045_0098580 | |||
| 3179 | Ga0501045_0167849 | |||
| 3180 | nmdc:mga03683_15913_c2 | |||
| 3181 | nmdc:mga03683_65846_c1 | |||
| 3182 | nmdc:mga03n38_120499_c1 | |||
| 3183 | nmdc:mga03n38_13311_c1 | |||
| 3184 | nmdc:mga03n38_244868_c1 | |||
| 3185 | nmdc:mga03n38_38012_c1 | |||
| 3186 | nmdc:mga03n38_61619_c1 | |||
| 3187 | nmdc:mga03n38_73378_c1 | |||
| 3188 | nmdc:mga03n38_9102_c1 | |||
| 3189 | nmdc:mga00v17_257616_c1 | |||
| 3190 | nmdc:mga00v17_556949_c1 | |||
| 3191 | nmdc:mga00v17_76819_c1 | |||
| 3192 | nmdc:mga0yw44_12937_c1 | |||
| 3193 | nmdc:mga0yw44_132394_c1 | |||
| 3194 | nmdc:mga0yw44_242599_c1 | |||
| 3195 | nmdc:mga0yw44_265859_c1 | |||
| 3196 | nmdc:mga0yw44_32572_c1 | |||
| 3197 | nmdc:mga0yw44_44328_c1 | |||
| 3198 | nmdc:mga0yw44_58078_c1 | |||
| 3199 | nmdc:mga0yw44_67739_c1 | |||
| 3200 | nmdc:mga0k408_40380_c1 | |||
| 3201 | nmdc:mga0k408_62125_c1 | |||
| 3202 | nmdc:mga06z11_113_c1 | |||
| 3203 | nmdc:mga06z11_11996_c1 | |||
| 3204 | nmdc:mga06z11_268283_c1 | |||
| 3205 | nmdc:mga06z11_75863_c1 | |||
| 3206 | nmdc:mga06z11_89081_c1 | |||
| 3207 | nmdc:mga04h51_79892_c1 | |||
| 3208 | nmdc:mga04h51_834_c1 | |||
| 3209 | nmdc:mga07m45_131212_c1 | |||
| 3210 | nmdc:mga07m45_174619_c1 | |||
| 3211 | nmdc:mga07m45_175785_c1 | |||
| 3212 | nmdc:mga07m45_233642_c1 | |||
| 3213 | nmdc:mga07m45_235776_c1 | |||
| 3214 | nmdc:mga07m45_268401_c1 | |||
| 3215 | nmdc:mga05p37_87698_c1 | |||
| 3216 | nmdc:mga09592_398762_c1 | |||
| 3217 | nmdc:mga0qj67_297192_c1 | |||
| 3218 | nmdc:mga0n895_309934_c1 | |||
| 3219 | nmdc:mga0n895_33846_c1 | |||
| 3220 | nmdc:mga08x19_210180_c1 | |||
| 3221 | nmdc:mga08x19_564614_c1 | |||
| 3222 | nmdc:mga0sz30_100138_c1 | |||
| 3223 | nmdc:mga0sz30_158063_c1 | |||
| 3224 | Ga0495601_0045957 | |||
| 3225 | Ga0495601_0070203 | |||
| 3226 | Ga0495601_0258776 | |||
| 3227 | Ga0495612_0016378 | |||
| 3228 | Ga0495612_0027352 | |||
| 3229 | Ga0495612_0081201 | |||
| 3230 | Ga0500610_0109747 | |||
| 3231 | Ga0495595_0000445 | |||
| 3232 | Ga0495595_0287128 | |||
| 3233 | Ga0495619_0001995 | |||
| 3234 | Ga0495619_0018307 | |||
| 3235 | Ga0495619_0018895 | |||
| 3236 | Ga0495619_0021121 | |||
| 3237 | Ga0495619_0380863 | |||
| 3238 | Ga0500578_0074151 | |||
| 3239 | Ga0500578_0213448 | |||
| 3240 | Ga0500581_166108 | |||
| 3241 | Ga0500646_0036316 | |||
| 3242 | Ga0500646_0113518 | |||
| 3243 | Ga0500583_0002683 | |||
| 3244 | Ga0500583_0060771 | |||
| 3245 | Ga0500651_0004547 | |||
| 3246 | Ga0500651_0195539 | |||
| 3247 | Ga0500566_0000247 | |||
| 3248 | Ga0500566_0006158 | |||
| 3249 | Ga0500641_0005003 | |||
| 3250 | Ga0500641_0007847 | |||
| 3251 | Ga0500650_0011875 | |||
| 3252 | Ga0500650_0031600 | |||
| 3253 | Ga0500650_0114199 | |||
| 3254 | Ga0500554_004619 | |||
| 3255 | Ga0500554_118232 | |||
| 3256 | Ga0500555_014114 | |||
| 3257 | Ga0500555_061055 | |||
| 3258 | Ga0500556_0000006 | |||
| 3259 | Ga0500562_047244 | |||
| 3260 | Ga0500562_064590 | |||
| 3261 | Ga0500569_004586 | |||
| 3262 | Ga0500569_016235 | |||
| 3263 | Ga0500569_020846 | |||
| 3264 | Ga0500572_000191 | |||
| 3265 | Ga0500572_001378 | |||
| 3266 | Ga0500572_010768 | |||
| 3267 | Ga0500592_001937 | |||
| 3268 | Ga0500595_000477 | |||
| 3269 | Ga0500595_002332 | |||
| 3270 | Ga0500595_006612 | |||
| 3271 | Ga0500595_015504 | |||
| 3272 | Ga0500607_081462 | |||
| 3273 | Ga0500608_000959 | |||
| 3274 | Ga0500608_001167 | |||
| 3275 | Ga0500608_001751 | |||
| 3276 | Ga0500614_001663 | |||
| 3277 | Ga0500614_013202 | |||
| 3278 | Ga0500618_028535 | |||
| 3279 | Ga0500621_106379 | |||
| 3280 | Ga0500642_0000004 | |||
| 3281 | Ga0500642_0000062 | |||
| 3282 | Ga0500652_000867 | |||
| 3283 | Ga0500652_088688 | |||
| 3284 | Ga0500655_024428 | |||
| 3285 | Ga0500658_0217986 | |||
| 3286 | Ga0500559_0000398 | |||
| 3287 | Ga0500559_0000465 | |||
| 3288 | Ga0500559_0002732 | |||
| 3289 | Ga0500559_0039527 | |||
| 3290 | Ga0500559_0095968 | |||
| 3291 | Ga0500561_0050219 | |||
| 3292 | Ga0500568_0000790 | |||
| 3293 | Ga0500568_0028293 | |||
| 3294 | Ga0500577_0000042 | |||
| 3295 | Ga0500586_000798 | |||
| 3296 | Ga0500588_0032851 | |||
| 3297 | Ga0500588_0035912 | |||
| 3298 | Ga0500589_121723 | |||
| 3299 | Ga0500590_212474 | |||
| 3300 | Ga0500590_225838 | |||
| 3301 | Ga0500603_000446 | |||
| 3302 | Ga0500603_002753 | |||
| 3303 | Ga0500603_003956 | |||
| 3304 | Ga0500604_0024492 | |||
| 3305 | Ga0500616_0000022 | |||
| 3306 | Ga0500620_000526 | |||
| 3307 | Ga0500620_018637 | |||
| 3308 | Ga0500622_0023515 | |||
| 3309 | Ga0500622_0093811 | |||
| 3310 | Ga0500627_0063034 | |||
| 3311 | Ga0500630_004139 | |||
| 3312 | Ga0500633_0011875 | |||
| 3313 | Ga0500634_0093812 | |||
| 3314 | Ga0500638_005633 | |||
| 3315 | Ga0500638_015608 | |||
| 3316 | Ga0500638_093553 | |||
| 3317 | Ga0500638_104835 | |||
| 3318 | Ga0500639_001790 | |||
| 3319 | Ga0500639_020355 | |||
| 3320 | Ga0500639_199538 | |||
| 3321 | Ga0500636_0001376 | |||
| 3322 | Ga0500636_0011956 | |||
| 3323 | Ga0500636_0012855 | |||
| 3324 | Ga0500636_0125424 | |||
| 3325 | Ga0500637_0029883 | |||
| 3326 | Ga0500637_0089328 | |||
| 3327 | Ga0500649_142510 | |||
| 3328 | Ga0500570_089903 | |||
| 3329 | Ga0500570_118516 | |||
| 3330 | Ga0500576_002221 | |||
| 3331 | Ga0500625_012431 | |||
| 3332 | Ga0500645_007993 | |||
| 3333 | Ga0500645_013362 | |||
| 3334 | Ga0500645_034977 | |||
| 3335 | Ga0500596_000309 | |||
| 3336 | Ga0500596_000393 | |||
| 3337 | Ga0500599_002602 | |||
| 3338 | Ga0500601_000064 | |||
| 3339 | Ga0501084_0033847 | |||
| 3340 | Ga0501084_0149941 | |||
| 3341 | Ga0500661_004388 | |||
| 3342 | Ga0501082_0002455 | |||
| 3343 | Ga0501082_0038821 | |||
| 3344 | Ga0501082_0115979 | |||
| 3345 | Ga0530510_0115778 | |||
| 3346 | 2507505252 | |||
| 3347 | 2508539173 | |||
| 3348 | 2508695491 | |||
| 3349 | 2509152638 | |||
| 3350 | 2511400215 | |||
| 3351 | 2513625351 | |||
| 3352 | 2513644170 | |||
| 3353 | 2513651509 | |||
| 3354 | 2513658818 | |||
| 3355 | 2513695117 | |||
| 3356 | 2513705297 | |||
| 3357 | 2513720299 | |||
| 3358 | 2513860825 | |||
| 3359 | 2513873522 | |||
| 3360 | 2513921082 | |||
| 3361 | 2514012491 | |||
| 3362 | 2515627447 | |||
| 3363 | 2517107705 | |||
| 3364 | 2517888847 | |||
| 3365 | 2524469474 | |||
| 3366 | 2524537039 | |||
| 3367 | 2528852944 | |||
| 3368 | 2599102765 | |||
| 3369 | 2603858532 | |||
| 3370 | 2617352404 | |||
| 3371 | 2617373767 | |||
| 3372 | 2643757966 | |||
| 3373 | 2671122453 | |||
| 3374 | 2723841648 | |||
| 3375 | 2728754996 | |||
| 3376 | 2745081694 | |||
| 3377 | 2793062048 | |||
| 3378 | 2793072935 | |||
| 3379 | 2793082745 | |||
| 3380 | 2805915606 | |||
| 3381 | 2818237656 | |||
| 3382 | 2819739741 | |||
| 3383 | 2824604578 | |||
| 3384 | 2824624506 | |||
| 3385 | 2824633421 | |||
| 3386 | 2824640282 | |||
| 3387 | 2824647284 | |||
| 3388 | 2824667565 | |||
| 3389 | 2824678920 | |||
| 3390 | 2824684236 | |||
| 3391 | 2824695466 | |||
| 3392 | 2824717400 | |||
| 3393 | 2824727637 | |||
| 3394 | 2824737789 | |||
| 3395 | 2824752221 | |||
| 3396 | 2841965440 | |||
| 3397 | 2841979966 | |||
| 3398 | 2846952639 | |||
| 3399 | 2848861130 | |||
| 3400 | 2849083041 | |||
| 3401 | 2849561165 | |||
| 3402 | 2849576146 | |||
| 3403 | 2857511931 | |||
| 3404 | 2857526346 | |||
| 3405 | 2874608059 | |||
| 3406 | 2874613430 | |||
| 3407 | 2874628789 | |||
| 3408 | 2876815499 | |||
| 3409 | 2879085913 | |||
| 3410 | 2879106016 | |||
| 3411 | 2879112176 | |||
| 3412 | 2881668179 | |||
| 3413 | 2885371022 | |||
| 3414 | 2885382844 | |||
| 3415 | 2885411656 | |||
| 3416 | 2888379586 | |||
| 3417 | 2888390675 | |||
| 3418 | 2889035484 | |||
| 3419 | 2893067383 | |||
| 3420 | 2897808779 | |||
| 3421 | 2903753528 | |||
| 3422 | 2903771853 | |||
| 3423 | 2904691186 | |||
| 3424 | 2904708699 | |||
| 3425 | 2906628952 | |||
| 3426 | 2906642327 | |||
| 3427 | 2906667355 | |||
| 3428 | 2908756582 | |||
| 3429 | 2908776283 | |||
| 3430 | 2919073807 | |||
| 3431 | 2922368930 | |||
| 3432 | 2922392571 | |||
| 3433 | 2922394245 | |||
| 3434 | 2922434219 | |||
| 3435 | 2924765446 | |||
| 3436 | 2929618607 | |||
| 3437 | 2929628708 | |||
| 3438 | 2932792929 | |||
| 3439 | 2932794312 | |||
| 3440 | 2932808094 | |||
| 3441 | 2932812159 | |||
| 3442 | 2932823149 | |||
| 3443 | 2932836066 | |||
| 3444 | 2933580681 | |||
| 3445 | 2935615719 | |||
| 3446 | 2935618527 | |||
| 3447 | 2935636534 | |||
| 3448 | 2935641072 | |||
| 3449 | 2935662385 | |||
| 3450 | 2935669988 | |||
| 3451 | 2935679162 | |||
| 3452 | 2935686408 | |||
| 3453 | 2935700190 | |||
| 3454 | 2935711487 | |||
| 3455 | 2935716096 | |||
| 3456 | 2935723780 | |||
| 3457 | 2935735335 | |||
| 3458 | 2935743874 | |||
| 3459 | 2935752374 | |||
| 3460 | 2935763529 | |||
| 3461 | 2935782979 | |||
| 3462 | 2935787975 | |||
| 3463 | 2935796449 | |||
| 3464 | 2935809952 | |||
| 3465 | 2935816258 | |||
| 3466 | 2935825483 | |||
| 3467 | 2935835651 | |||
| 3468 | 2935844602 | |||
| 3469 | 2935853272 | |||
| 3470 | 2935862952 | |||
| 3471 | 2935866694 | |||
| 3472 | 2935875001 | |||
| 3473 | 2935890154 | |||
| 3474 | 2935914745 | |||
| 3475 | 2935918721 | |||
| 3476 | 2935931562 | |||
| 3477 | 2935940159 | |||
| 3478 | 2935947494 | |||
| 3479 | 2935956266 | |||
| 3480 | 2935962642 | |||
| 3481 | 2935973059 | |||
| 3482 | 2935980699 | |||
| 3483 | 2935985148 | |||
| 3484 | 2935999723 | |||
| 3485 | 2936010580 | |||
| 3486 | 2936016687 | |||
| 3487 | 2936025320 | |||
| 3488 | 2936034162 | |||
| 3489 | 2936041263 | |||
| 3490 | 2936052219 | |||
| 3491 | 2936056320 | |||
| 3492 | 2937825399 | |||
| 3493 | 2940558287 | |||
| 3494 | 2941513169 | |||
| 3495 | 2941521176 | |||
| 3496 | 2941528887 | |||
| 3497 | 2941535508 | |||
| 3498 | 2941543213 | |||
| 3499 | 2987669790 | |||
| 3500 | 3005475069 | |||
| 3501 | 3005489064 | |||
| 3502 | 3005509154 | |||
| 3503 | 3005592205 | |||
| 3504 | 3005595056 | |||
| 3505 | 3005711004 | |||
| 3506 | 3005718309 | |||
| 3507 | 8006927895 | |||
| 3508 | 8006936217 | |||
| 3509 | 8006967462 | |||
| 3510 | 8006976163 | |||
| 3511 | 8006990927 | |||
| 3512 | 8006996506 | |||
| 3513 | 8016518175 | |||
| 3514 | 8016526145 | |||
| 3515 | 8016539758 | |||
| 3516 | 8016544064 | |||
| 3517 | 8016549245 | |||
| 3518 | 8016557669 | |||
| 3519 | 8016586365 | |||
| 3520 | 8016595704 | |||
| 3521 | 8016623153 | |||
| 3522 | 8016635621 | |||
| 3523 | 8017058471 | |||
| 3524 | 8019550166 | |||
| 3525 | 8019572488 | |||
| 3526 | 8019577224 | |||
| 3527 | 8019595304 | |||
| 3528 | 8019606453 | |||
| 3529 | 8019622976 | |||
| 3530 | 8019630131 | |||
| 3531 | 8019640485 | |||
| 3532 | 8019652463 | |||
| 3533 | 8019666964 | |||
| 3534 | 8019676722 | |||
| 3535 | 8019696233 | |||
| 3536 | 8055742457 | |||
| 3537 | 8056675748 | |||
| 3538 | 8056686539 | |||
| 3539 | 8056690963 | |||
| 3540 | 8056971294 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3r79-assembly3.cif.gz_A-2 | crystal structure of an uncharactertized protein from agrobacterium tumefaciens | 0.9801 | 14 | 229 |
| 3r79-assembly3.cif.gz_B | crystal structure of an uncharactertized protein from agrobacterium tumefaciens | 0.9801 | 14 | 228 |
| 3r79-assembly3.cif.gz_B | crystal structure of an uncharactertized protein from agrobacterium tumefaciens | 0.9365 | 14 | 228 |
| 1w8g-assembly1.cif.gz_A | crystal structure of e. coli k-12 yggs | 0.9301 | 14 | 228 |
| 3sy1-assembly1.cif.gz_A | crystal structure of engineered protein. northeast structural genomics consortium target or70 | 0.9275 | 14 | 228 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3r79B00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase | 0.9735 | 14 | 228 | 3.20.20.10 |
| 1w8gA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase | 0.9301 | 14 | 228 | 3.20.20.10 |
| 3r79B00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase | 0.9297 | 14 | 228 | 3.20.20.10 |
| af_P9WFQ7_2_257_3.20.20.10 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase | 0.9127 | 14 | 229 | 3.20.20.10 |
| af_Q9Z2Y8_11_258_3.20.20.10 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase | 0.9045 | 14 | 229 | 3.20.20.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A833NL93-F1-model_v4 | deleted | 0.9997 | 61 | 203 |
|
| AF-H0TJX0-F1-model_v4 | Pyridoxal phosphate homeostasis protein (PLP homeostasis protein) | 0.9987 | 26 | 229 |
GO:0030170
|
| AF-A0A7Y9USJ2-F1-model_v4 | Alanine racemase N-terminal domain-containing protein | 0.9984 | 38 | 229 |
GO:0030170
|
| AF-A0A537Q2J4-F1-model_v4 | Pyridoxal phosphate homeostasis protein (PLP homeostasis protein) | 0.9971 | 21 | 229 |
GO:0030170
|
| AF-A0A418VIM3-F1-model_v4 | Pyridoxal phosphate homeostasis protein (PLP homeostasis protein) | 0.9969 | 14 | 229 |
GO:0030170
|