F495651
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1772 | 484 | 3544 | 259 |
Family's Representative Sequence
| Representative Sequence | 3300013296|Ga0157374_10130183|Ga0157374_101301832 |
| Length | 297 |
| Sequence | LSGLLAHVYTESGPGETDPPTVLVRNAQSIYDRRSRVVMMPHIEVADVSLTYDTPSGQVPGVDGVSIDIEASEFLCIVGPSGCGKSTLLNIIAGFLSPTAGEIRIGGKVVTGHGLDRGVVFQDFAQLFPWRTALGNVTFGLEMKGIGKAEREEIALRQLRLVKLEKFVQSYPHHLSGGMQQRVAIARALAYNPSVLLMDEPFAALDALTRDDMQRLLADVWRETRKTVIYVTHNVAEAVYLADRVVVMTPHPGRVKIELPIPLALPRYPLSVDVLKYQKSLLQHLGQQAVAAVDAKS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 2 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 3 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 4 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 5 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 6 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 7 | 3300000045 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere | Metagenome | Rhizosphere |
| 8 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 9 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 10 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 11 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 12 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 13 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 14 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 15 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 16 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 17 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 18 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 19 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 20 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 21 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 22 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 23 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 24 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 25 | 3300005277 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) | Metagenome | Rhizosphere |
| 26 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 27 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 28 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 34 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 38 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 40 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 51 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 68 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 69 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 70 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 73 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 74 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 76 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 78 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 83 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 84 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 86 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 87 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 88 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 90 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 91 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 92 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 93 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 94 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 95 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 96 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 97 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 98 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 99 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 100 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 101 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 102 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 103 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 105 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 106 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 107 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 108 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 109 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 110 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 111 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 112 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 113 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 114 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 115 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 116 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 117 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 119 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 120 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 121 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 122 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 123 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 124 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 125 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 126 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 127 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 128 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 130 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 131 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 145 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300012492 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 | Metagenome | Rhizosphere |
| 148 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 149 | 3300012510 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 | Metagenome | Rhizosphere |
| 150 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 151 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 166 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 167 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 168 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 170 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 247 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 249 | 3300028023 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 | Metagenome | Rhizosphere |
| 250 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 254 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 255 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 256 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 257 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 258 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 259 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 260 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 261 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 262 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 263 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 264 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 265 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 266 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 267 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 268 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 269 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 270 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 271 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 272 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 273 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 274 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 275 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 276 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 277 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 278 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 279 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 280 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 281 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 282 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 283 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 284 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 285 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 286 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 287 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 288 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 289 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 290 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 291 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 292 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 293 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 294 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 295 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 296 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 297 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 298 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 299 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 300 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 301 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 302 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 303 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 304 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 305 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 306 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 307 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 308 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 309 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 310 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 311 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 312 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 313 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 314 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 315 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 316 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 317 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 318 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 319 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 320 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 321 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 322 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 323 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 324 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 325 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 326 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 327 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 328 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 329 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 330 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 331 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 332 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 333 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 334 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 335 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 404 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 405 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 406 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 407 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 408 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 409 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 410 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 411 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 412 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 413 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 414 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 415 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 416 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 417 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 418 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 419 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 420 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 421 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 422 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 423 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 424 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 425 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 426 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 427 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 428 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 429 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 430 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 431 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 432 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 433 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 434 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 435 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 436 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 437 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 438 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 439 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 440 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 441 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 442 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 443 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 444 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 445 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 446 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 447 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 448 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 449 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 450 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 451 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 452 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 453 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 454 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 455 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 456 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 457 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 458 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 459 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 460 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 461 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 462 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 463 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 464 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 465 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 466 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 467 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 468 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 469 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 470 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 471 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 472 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 473 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 474 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 475 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 476 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 477 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 478 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 479 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 480 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 481 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 482 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 483 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 484 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.94 |
| Metatranscriptomes | 0.06 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.82 |
| Nodule | 0 |
| Rhizoplane | 7.84 |
| Rhizosphere | 89 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0157374_10130183 | 3300013296 | Bacteria | 2435 |
| 2 | 2214772980 | 2209111006 | Bacteria | 12584 |
| 3 | ARcpr5oldR_c000026 | 3300000041 | Bacteria | 30226 |
| 4 | ARSoilYngRDRAFT_c00029 | 3300000042 | Bacteria | 22121 |
| 5 | ARcpr5yngRDRAFT_c000044 | 3300000043 | Bacteria | 19945 |
| 6 | ARSoilOldRDRAFT_c000037 | 3300000044 | Bacteria | 30277 |
| 7 | ARCol0oldRDRAFT_c01671 | 3300000045 | Bacteria | 1310 |
| 8 | ARCol0yngRDRAFT_1000020 | 3300000652 | Bacteria | 30273 |
| 9 | JGI24746J21847_1005093 | 3300001977 | Bacteria | 2057 |
| 10 | JGI24747J21853_1006822 | 3300001978 | Bacteria | 1088 |
| 11 | JGI24740J21852_10036806 | 3300001979 | Bacteria | 1516 |
| 12 | JGI24739J22299_10004550 | 3300001989 | Bacteria | 5302 |
| 13 | JGI24739J22299_10008850 | 3300001989 | Bacteria | 3753 |
| 14 | JGI24737J22298_10001930 | 3300001990 | Bacteria | 7416 |
| 15 | JGI24743J22301_10003452 | 3300001991 | Bacteria | 2502 |
| 16 | JGI24750J21931_1000586 | 3300002070 | Bacteria | 5547 |
| 17 | JGI24745J21846_1000864 | 3300002073 | Bacteria | 2808 |
| 18 | JGI24749J21850_1001223 | 3300002076 | Bacteria | 3648 |
| 19 | JGI24744J21845_10000745 | 3300002077 | Bacteria | 6048 |
| 20 | JGI24035J26624_1001145 | 3300002126 | Bacteria | 2512 |
| 21 | JGI24742J22300_10000139 | 3300002244 | Bacteria | 10736 |
| 22 | JGI24751J29686_10015704 | 3300002459 | Bacteria | 1561 |
| 23 | JGI25406J46586_10009736 | 3300003203 | Bacteria | 4295 |
| 24 | JGI25153J46596_10002462 | 3300003215 | Bacteria | 10656 |
| 25 | JGI25405J52794_10004616 | 3300003911 | Bacteria | 2461 |
| 26 | Ga0065716_1001673 | 3300005277 | Bacteria | 4322 |
| 27 | Ga0065712_10071735 | 3300005290 | Bacteria | 5090 |
| 28 | Ga0065712_10077193 | 3300005290 | Bacteria | 3510 |
| 29 | Ga0065715_10038352 | 3300005293 | Bacteria | 1274 |
| 30 | Ga0065715_10092917 | 3300005293 | Bacteria | 4880 |
| 31 | Ga0065715_10113387 | 3300005293 | Bacteria | 2491 |
| 32 | Ga0070658_10021114 | 3300005327 | Bacteria | 5216 |
| 33 | Ga0070658_10048153 | 3300005327 | Bacteria | 3450 |
| 34 | Ga0070658_10191350 | 3300005327 | Bacteria | 1724 |
| 35 | Ga0070676_10001078 | 3300005328 | Bacteria | 13598 |
| 36 | Ga0070676_10079340 | 3300005328 | Bacteria | 1988 |
| 37 | Ga0070676_10107334 | 3300005328 | Bacteria | 1733 |
| 38 | Ga0070676_10188872 | 3300005328 | Bacteria | 1344 |
| 39 | Ga0070683_100007390 | 3300005329 | Bacteria | 9282 |
| 40 | Ga0070683_100138777 | 3300005329 | Bacteria | 2303 |
| 41 | Ga0070683_100228105 | 3300005329 | Bacteria | 1770 |
| 42 | Ga0070683_100400610 | 3300005329 | Bacteria | 1309 |
| 43 | Ga0070690_100076879 | 3300005330 | Bacteria | 2178 |
| 44 | Ga0070690_100104406 | 3300005330 | Bacteria | 1882 |
| 45 | Ga0070690_100193295 | 3300005330 | Bacteria | 1412 |
| 46 | Ga0070690_100303803 | 3300005330 | Bacteria | 1145 |
| 47 | Ga0070670_100037546 | 3300005331 | Bacteria | 4168 |
| 48 | Ga0070670_100215578 | 3300005331 | Bacteria | 1670 |
| 49 | Ga0068869_100051408 | 3300005334 | Bacteria | 2990 |
| 50 | Ga0068869_100176034 | 3300005334 | Bacteria | 1674 |
| 51 | Ga0068869_100193995 | 3300005334 | Bacteria | 1598 |
| 52 | Ga0070666_10162832 | 3300005335 | Bacteria | 1559 |
| 53 | Ga0070680_100004715 | 3300005336 | Bacteria | 10260 |
| 54 | Ga0070680_100021923 | 3300005336 | Bacteria | 5080 |
| 55 | Ga0070680_100026870 | 3300005336 | Bacteria | 4605 |
| 56 | Ga0070680_100094650 | 3300005336 | Bacteria | 2476 |
| 57 | Ga0070682_100001091 | 3300005337 | Bacteria | 15614 |
| 58 | Ga0070682_100048274 | 3300005337 | Bacteria | 2650 |
| 59 | Ga0070682_100108168 | 3300005337 | Bacteria | 1848 |
| 60 | Ga0068868_100037790 | 3300005338 | Bacteria | 3744 |
| 61 | Ga0068868_100305139 | 3300005338 | Bacteria | 1353 |
| 62 | Ga0070660_100001398 | 3300005339 | Bacteria | 16443 |
| 63 | Ga0070660_100058854 | 3300005339 | Bacteria | 2979 |
| 64 | Ga0070660_100189907 | 3300005339 | Bacteria | 1664 |
| 65 | Ga0070660_100219760 | 3300005339 | Bacteria | 1544 |
| 66 | Ga0070660_100244998 | 3300005339 | Bacteria | 1460 |
| 67 | Ga0070660_100249932 | 3300005339 | Bacteria | 1446 |
| 68 | Ga0070660_100409626 | 3300005339 | Bacteria | 1122 |
| 69 | Ga0070660_100418893 | 3300005339 | Bacteria | 1109 |
| 70 | Ga0070689_100008504 | 3300005340 | Bacteria | 7234 |
| 71 | Ga0070689_100017677 | 3300005340 | Bacteria | 5243 |
| 72 | Ga0070689_100063151 | 3300005340 | Bacteria | 2882 |
| 73 | Ga0070689_100086925 | 3300005340 | Bacteria | 2459 |
| 74 | Ga0070689_100138970 | 3300005340 | Bacteria | 1952 |
| 75 | Ga0070689_100316812 | 3300005340 | Bacteria | 1301 |
| 76 | Ga0070689_100488322 | 3300005340 | Bacteria | 1053 |
| 77 | Ga0070691_10000769 | 3300005341 | Bacteria | 12720 |
| 78 | Ga0070691_10205457 | 3300005341 | Bacteria | 1037 |
| 79 | Ga0070687_100177502 | 3300005343 | Bacteria | 1273 |
| 80 | Ga0070687_100206503 | 3300005343 | Bacteria | 1194 |
| 81 | Ga0070687_100209803 | 3300005343 | Bacteria | 1186 |
| 82 | Ga0070661_100001076 | 3300005344 | Bacteria | 19335 |
| 83 | Ga0070661_100061169 | 3300005344 | Bacteria | 2764 |
| 84 | Ga0070661_100061862 | 3300005344 | Bacteria | 2748 |
| 85 | Ga0070661_100187879 | 3300005344 | Bacteria | 1575 |
| 86 | Ga0070692_10015532 | 3300005345 | Bacteria | 3603 |
| 87 | Ga0070692_10210532 | 3300005345 | Bacteria | 1144 |
| 88 | Ga0070668_100012317 | 3300005347 | Bacteria | 6370 |
| 89 | Ga0070668_100330193 | 3300005347 | Bacteria | 1286 |
| 90 | Ga0070668_100415475 | 3300005347 | Bacteria | 1151 |
| 91 | Ga0070669_100005888 | 3300005353 | Bacteria | 8845 |
| 92 | Ga0070669_100045834 | 3300005353 | Bacteria | 3187 |
| 93 | Ga0070669_100129722 | 3300005353 | Bacteria | 1933 |
| 94 | Ga0070669_100141434 | 3300005353 | Bacteria | 1855 |
| 95 | Ga0070669_100161681 | 3300005353 | Bacteria | 1740 |
| 96 | Ga0070675_100000727 | 3300005354 | Bacteria | 22927 |
| 97 | Ga0070675_100189878 | 3300005354 | Bacteria | 1780 |
| 98 | Ga0070671_100000438 | 3300005355 | Bacteria | 28920 |
| 99 | Ga0070671_100017456 | 3300005355 | Bacteria | 5813 |
| 100 | Ga0070671_100018195 | 3300005355 | Bacteria | 5704 |
| 101 | Ga0070671_100146871 | 3300005355 | Bacteria | 1990 |
| 102 | Ga0070674_100001976 | 3300005356 | Bacteria | 11215 |
| 103 | Ga0070674_100023669 | 3300005356 | Bacteria | 3978 |
| 104 | Ga0070674_100076955 | 3300005356 | Bacteria | 2374 |
| 105 | Ga0070673_100001186 | 3300005364 | Bacteria | 14992 |
| 106 | Ga0070673_100064845 | 3300005364 | Bacteria | 2911 |
| 107 | Ga0070673_100086664 | 3300005364 | Bacteria | 2551 |
| 108 | Ga0070673_100231226 | 3300005364 | Bacteria | 1604 |
| 109 | Ga0070688_100022325 | 3300005365 | Bacteria | 3706 |
| 110 | Ga0070688_100064296 | 3300005365 | Bacteria | 2328 |
| 111 | Ga0070688_100082189 | 3300005365 | Bacteria | 2087 |
| 112 | Ga0070688_100116948 | 3300005365 | Bacteria | 1781 |
| 113 | Ga0070688_100170191 | 3300005365 | Bacteria | 1503 |
| 114 | Ga0070659_100005874 | 3300005366 | Bacteria | 8843 |
| 115 | Ga0070659_100058285 | 3300005366 | Bacteria | 3048 |
| 116 | Ga0070659_100159515 | 3300005366 | Bacteria | 1844 |
| 117 | Ga0070667_100005963 | 3300005367 | Bacteria | 10128 |
| 118 | Ga0070667_100150888 | 3300005367 | Bacteria | 2041 |
| 119 | Ga0070667_100329662 | 3300005367 | Bacteria | 1379 |
| 120 | Ga0070703_10002528 | 3300005406 | Bacteria | 5263 |
| 121 | Ga0070703_10014584 | 3300005406 | Bacteria | 2240 |
| 122 | Ga0070703_10027328 | 3300005406 | Bacteria | 1700 |
| 123 | Ga0070709_10015469 | 3300005434 | Bacteria | 4342 |
| 124 | Ga0070709_10089303 | 3300005434 | Bacteria | 2029 |
| 125 | Ga0070709_10199392 | 3300005434 | Bacteria | 1416 |
| 126 | Ga0070709_10223114 | 3300005434 | Bacteria | 1345 |
| 127 | Ga0070714_100085977 | 3300005435 | Bacteria | 2748 |
| 128 | Ga0070714_100111046 | 3300005435 | Bacteria | 2427 |
| 129 | Ga0070714_100258646 | 3300005435 | Bacteria | 1611 |
| 130 | Ga0070714_100623688 | 3300005435 | Bacteria | 1037 |
| 131 | Ga0070713_100005553 | 3300005436 | Bacteria | 8640 |
| 132 | Ga0070713_100015791 | 3300005436 | Bacteria | 5658 |
| 133 | Ga0070713_100028859 | 3300005436 | Bacteria | 4385 |
| 134 | Ga0070713_100108048 | 3300005436 | Bacteria | 2421 |
| 135 | Ga0070713_100296394 | 3300005436 | Bacteria | 1488 |
| 136 | Ga0070710_10010566 | 3300005437 | Bacteria | 4538 |
| 137 | Ga0070710_10082207 | 3300005437 | Bacteria | 1883 |
| 138 | Ga0070701_10000339 | 3300005438 | Bacteria | 15527 |
| 139 | Ga0070701_10238564 | 3300005438 | Bacteria | 1092 |
| 140 | Ga0070711_100027442 | 3300005439 | Bacteria | 3738 |
| 141 | Ga0070711_100073831 | 3300005439 | Bacteria | 2411 |
| 142 | Ga0070711_100090812 | 3300005439 | Bacteria | 2200 |
| 143 | Ga0070711_100146211 | 3300005439 | Bacteria | 1778 |
| 144 | Ga0070711_100163297 | 3300005439 | Bacteria | 1690 |
| 145 | Ga0070711_100384579 | 3300005439 | Bacteria | 1136 |
| 146 | Ga0070705_100000010 | 3300005440 | Bacteria | 102079 |
| 147 | Ga0070705_100005352 | 3300005440 | Bacteria | 6249 |
| 148 | Ga0070700_100000783 | 3300005441 | Bacteria | 15666 |
| 149 | Ga0070700_100076044 | 3300005441 | Bacteria | 2155 |
| 150 | Ga0070700_100203189 | 3300005441 | Bacteria | 1393 |
| 151 | Ga0070700_100337910 | 3300005441 | Bacteria | 1112 |
| 152 | Ga0070700_100417352 | 3300005441 | Bacteria | 1013 |
| 153 | Ga0070694_100006633 | 3300005444 | Bacteria | 7034 |
| 154 | Ga0070694_100155140 | 3300005444 | Bacteria | 1675 |
| 155 | Ga0070694_100183756 | 3300005444 | Bacteria | 1548 |
| 156 | Ga0070708_100179279 | 3300005445 | Bacteria | 1980 |
| 157 | Ga0070708_100249728 | 3300005445 | Bacteria | 1666 |
| 158 | Ga0070663_100017471 | 3300005455 | Bacteria | 4682 |
| 159 | Ga0070663_100025858 | 3300005455 | Bacteria | 3968 |
| 160 | Ga0070663_100028384 | 3300005455 | Bacteria | 3810 |
| 161 | Ga0070663_100033005 | 3300005455 | Bacteria | 3573 |
| 162 | Ga0070678_100011564 | 3300005456 | Bacteria | 5451 |
| 163 | Ga0070678_100054346 | 3300005456 | Bacteria | 2917 |
| 164 | Ga0070678_100160180 | 3300005456 | Bacteria | 1822 |
| 165 | Ga0070678_100401004 | 3300005456 | Bacteria | 1191 |
| 166 | Ga0070662_100017941 | 3300005457 | Bacteria | 4778 |
| 167 | Ga0070662_100093667 | 3300005457 | Bacteria | 2260 |
| 168 | Ga0070662_100103866 | 3300005457 | Bacteria | 2155 |
| 169 | Ga0070662_100176643 | 3300005457 | Bacteria | 1681 |
| 170 | Ga0070662_100253104 | 3300005457 | Bacteria | 1417 |
| 171 | Ga0070681_10013836 | 3300005458 | Bacteria | 8031 |
| 172 | Ga0070681_10051242 | 3300005458 | Bacteria | 4117 |
| 173 | Ga0070681_10070525 | 3300005458 | Bacteria | 3460 |
| 174 | Ga0070681_10089994 | 3300005458 | Bacteria | 3020 |
| 175 | Ga0070681_10133426 | 3300005458 | Bacteria | 2414 |
| 176 | Ga0070681_10457310 | 3300005458 | Bacteria | 1189 |
| 177 | Ga0070681_10502254 | 3300005458 | Bacteria | 1126 |
| 178 | Ga0068867_100047346 | 3300005459 | Bacteria | 3160 |
| 179 | Ga0068867_100277257 | 3300005459 | Bacteria | 1374 |
| 180 | Ga0068867_100504535 | 3300005459 | Bacteria | 1040 |
| 181 | Ga0068867_100552296 | 3300005459 | Bacteria | 998 |
| 182 | Ga0070685_10005962 | 3300005466 | Bacteria | 6203 |
| 183 | Ga0070685_10022940 | 3300005466 | Bacteria | 3410 |
| 184 | Ga0070685_10023443 | 3300005466 | Bacteria | 3380 |
| 185 | Ga0070685_10164789 | 3300005466 | Bacteria | 1416 |
| 186 | Ga0070707_100232584 | 3300005468 | Bacteria | 1794 |
| 187 | Ga0070699_100001314 | 3300005518 | Bacteria | 22902 |
| 188 | Ga0070699_100010423 | 3300005518 | Bacteria | 8044 |
| 189 | Ga0070699_100318041 | 3300005518 | Bacteria | 1398 |
| 190 | Ga0070679_100021002 | 3300005530 | Bacteria | 6371 |
| 191 | Ga0070679_100034318 | 3300005530 | Bacteria | 5027 |
| 192 | Ga0070679_100056408 | 3300005530 | Bacteria | 3914 |
| 193 | Ga0070679_100127315 | 3300005530 | Bacteria | 2528 |
| 194 | Ga0070679_100212152 | 3300005530 | Bacteria | 1900 |
| 195 | Ga0070679_100222677 | 3300005530 | Bacteria | 1847 |
| 196 | Ga0070679_100348569 | 3300005530 | Bacteria | 1429 |
| 197 | Ga0070679_100457082 | 3300005530 | Bacteria | 1221 |
| 198 | Ga0070684_100142264 | 3300005535 | Bacteria | 2169 |
| 199 | Ga0070684_100326179 | 3300005535 | Bacteria | 1411 |
| 200 | Ga0070684_100345226 | 3300005535 | Bacteria | 1369 |
| 201 | Ga0070697_100039300 | 3300005536 | Bacteria | 3825 |
| 202 | Ga0070697_100236973 | 3300005536 | Bacteria | 1558 |
| 203 | Ga0068853_100004375 | 3300005539 | Bacteria | 10933 |
| 204 | Ga0070672_100011149 | 3300005543 | Bacteria | 6259 |
| 205 | Ga0070672_100022463 | 3300005543 | Bacteria | 4635 |
| 206 | Ga0070686_100006762 | 3300005544 | Bacteria | 6383 |
| 207 | Ga0070686_100262531 | 3300005544 | Bacteria | 1266 |
| 208 | Ga0070695_100001719 | 3300005545 | Bacteria | 12317 |
| 209 | Ga0070695_100030227 | 3300005545 | Bacteria | 3371 |
| 210 | Ga0070696_100002812 | 3300005546 | Bacteria | 11557 |
| 211 | Ga0070696_100029222 | 3300005546 | Bacteria | 3766 |
| 212 | Ga0070696_100045814 | 3300005546 | Bacteria | 3031 |
| 213 | Ga0070696_100246747 | 3300005546 | Bacteria | 1349 |
| 214 | Ga0070693_100000577 | 3300005547 | Bacteria | 16215 |
| 215 | Ga0070693_100010134 | 3300005547 | Bacteria | 4709 |
| 216 | Ga0070693_100023786 | 3300005547 | Bacteria | 3279 |
| 217 | Ga0070693_100131349 | 3300005547 | Bacteria | 1566 |
| 218 | Ga0070665_100076321 | 3300005548 | Bacteria | 3358 |
| 219 | Ga0070665_100199540 | 3300005548 | Bacteria | 2001 |
| 220 | Ga0070665_100231865 | 3300005548 | Bacteria | 1846 |
| 221 | Ga0070704_100013846 | 3300005549 | Bacteria | 5022 |
| 222 | Ga0070704_100028556 | 3300005549 | Bacteria | 3713 |
| 223 | Ga0070704_100126371 | 3300005549 | Bacteria | 1974 |
| 224 | Ga0068855_100014148 | 3300005563 | Bacteria | 9611 |
| 225 | Ga0068855_100031300 | 3300005563 | Bacteria | 6354 |
| 226 | Ga0068855_100409055 | 3300005563 | Bacteria | 1486 |
| 227 | Ga0068855_100462066 | 3300005563 | Bacteria | 1384 |
| 228 | Ga0070664_100002073 | 3300005564 | Bacteria | 16008 |
| 229 | Ga0070664_100070153 | 3300005564 | Bacteria | 3000 |
| 230 | Ga0070664_100076795 | 3300005564 | Bacteria | 2871 |
| 231 | Ga0070664_100145042 | 3300005564 | Bacteria | 2093 |
| 232 | Ga0070664_100167671 | 3300005564 | Bacteria | 1946 |
| 233 | Ga0070664_100175888 | 3300005564 | Bacteria | 1900 |
| 234 | Ga0070664_100268699 | 3300005564 | Bacteria | 1536 |
| 235 | Ga0070664_100341265 | 3300005564 | Bacteria | 1361 |
| 236 | Ga0070664_100374759 | 3300005564 | Bacteria | 1298 |
| 237 | Ga0068857_100008536 | 3300005577 | Bacteria | 8859 |
| 238 | Ga0068857_100011549 | 3300005577 | Bacteria | 7685 |
| 239 | Ga0068857_100622489 | 3300005577 | Bacteria | 1021 |
| 240 | Ga0068854_100001074 | 3300005578 | Bacteria | 16449 |
| 241 | Ga0068854_100074407 | 3300005578 | Bacteria | 2492 |
| 242 | Ga0068854_100581300 | 3300005578 | Bacteria | 954 |
| 243 | Ga0068856_100026335 | 3300005614 | Bacteria | 5671 |
| 244 | Ga0068856_100039625 | 3300005614 | Bacteria | 4625 |
| 245 | Ga0068856_100475444 | 3300005614 | Bacteria | 1270 |
| 246 | Ga0068856_100485250 | 3300005614 | Bacteria | 1257 |
| 247 | Ga0068856_100554185 | 3300005614 | Bacteria | 1171 |
| 248 | Ga0070702_100005245 | 3300005615 | Bacteria | 6011 |
| 249 | Ga0070702_100023173 | 3300005615 | Bacteria | 3295 |
| 250 | Ga0070702_100184462 | 3300005615 | Bacteria | 1368 |
| 251 | Ga0070702_100258096 | 3300005615 | Bacteria | 1185 |
| 252 | Ga0070702_100269451 | 3300005615 | Bacteria | 1164 |
| 253 | Ga0068852_100001086 | 3300005616 | Bacteria | 17979 |
| 254 | Ga0068852_100054483 | 3300005616 | Bacteria | 3447 |
| 255 | Ga0068852_100284846 | 3300005616 | Bacteria | 1594 |
| 256 | Ga0068852_100436738 | 3300005616 | Bacteria | 1293 |
| 257 | Ga0068859_100023234 | 3300005617 | Bacteria | 6221 |
| 258 | Ga0068859_100087792 | 3300005617 | Bacteria | 3159 |
| 259 | Ga0068859_100104533 | 3300005617 | Bacteria | 2891 |
| 260 | Ga0068859_100108837 | 3300005617 | Bacteria | 2832 |
| 261 | Ga0068859_100161472 | 3300005617 | Bacteria | 2320 |
| 262 | Ga0068859_100242104 | 3300005617 | Bacteria | 1893 |
| 263 | Ga0068859_100825794 | 3300005617 | Bacteria | 1013 |
| 264 | Ga0068864_100021486 | 3300005618 | Bacteria | 5408 |
| 265 | Ga0068864_100025772 | 3300005618 | Bacteria | 4956 |
| 266 | Ga0068864_100053465 | 3300005618 | Bacteria | 3484 |
| 267 | Ga0068864_100070454 | 3300005618 | Bacteria | 3042 |
| 268 | Ga0068864_100197788 | 3300005618 | Bacteria | 1845 |
| 269 | Ga0068866_10000403 | 3300005718 | Bacteria | 20138 |
| 270 | Ga0068866_10083848 | 3300005718 | Bacteria | 1718 |
| 271 | Ga0068866_10089937 | 3300005718 | Bacteria | 1669 |
| 272 | Ga0068866_10152188 | 3300005718 | Bacteria | 1341 |
| 273 | Ga0068861_100001047 | 3300005719 | Bacteria | 16998 |
| 274 | Ga0068861_100112392 | 3300005719 | Bacteria | 2184 |
| 275 | Ga0068870_10000860 | 3300005840 | Bacteria | 11868 |
| 276 | Ga0068870_10087983 | 3300005840 | Bacteria | 1730 |
| 277 | Ga0068863_100003728 | 3300005841 | Bacteria | 15069 |
| 278 | Ga0068863_100184737 | 3300005841 | Bacteria | 2002 |
| 279 | Ga0068863_100248601 | 3300005841 | Bacteria | 1717 |
| 280 | Ga0068858_100032605 | 3300005842 | Bacteria | 4837 |
| 281 | Ga0068858_100051742 | 3300005842 | Bacteria | 3800 |
| 282 | Ga0068858_100098651 | 3300005842 | Bacteria | 2723 |
| 283 | Ga0068858_100201782 | 3300005842 | Bacteria | 1881 |
| 284 | Ga0068858_100391148 | 3300005842 | Bacteria | 1335 |
| 285 | Ga0068858_100398192 | 3300005842 | Bacteria | 1323 |
| 286 | Ga0068860_100013440 | 3300005843 | Bacteria | 8028 |
| 287 | Ga0068860_100023327 | 3300005843 | Bacteria | 5980 |
| 288 | Ga0068860_100223447 | 3300005843 | Bacteria | 1829 |
| 289 | Ga0068862_100003043 | 3300005844 | Bacteria | 14604 |
| 290 | Ga0068862_100024080 | 3300005844 | Bacteria | 5105 |
| 291 | Ga0068862_100216773 | 3300005844 | Bacteria | 1731 |
| 292 | Ga0068862_100223767 | 3300005844 | Bacteria | 1704 |
| 293 | Ga0068862_100242962 | 3300005844 | Bacteria | 1638 |
| 294 | Ga0081455_10000012 | 3300005937 | Bacteria | 201668 |
| 295 | Ga0081455_10003284 | 3300005937 | Bacteria | 18715 |
| 296 | Ga0081455_10007017 | 3300005937 | Bacteria | 11967 |
| 297 | Ga0081455_10007967 | 3300005937 | Bacteria | 11076 |
| 298 | Ga0081455_10016936 | 3300005937 | Bacteria | 7006 |
| 299 | Ga0081455_10054157 | 3300005937 | Bacteria | 3421 |
| 300 | Ga0081455_10186527 | 3300005937 | Bacteria | 1566 |
| 301 | Ga0081538_10017736 | 3300005981 | Bacteria | 5386 |
| 302 | Ga0081538_10018338 | 3300005981 | Bacteria | 5260 |
| 303 | Ga0081538_10068602 | 3300005981 | Bacteria | 1970 |
| 304 | Ga0081540_1000185 | 3300005983 | Bacteria | 64858 |
| 305 | Ga0081540_1002413 | 3300005983 | Bacteria | 15223 |
| 306 | Ga0081540_1005241 | 3300005983 | Bacteria | 9701 |
| 307 | Ga0081540_1011112 | 3300005983 | Bacteria | 6044 |
| 308 | Ga0081539_10008542 | 3300005985 | Bacteria | 8868 |
| 309 | Ga0070717_10007114 | 3300006028 | Bacteria | 8292 |
| 310 | Ga0070717_10010759 | 3300006028 | Bacteria | 6925 |
| 311 | Ga0070717_10635447 | 3300006028 | Bacteria | 969 |
| 312 | Ga0075365_10040270 | 3300006038 | Bacteria | 3047 |
| 313 | Ga0075365_10054308 | 3300006038 | Bacteria | 2656 |
| 314 | Ga0075365_10118964 | 3300006038 | Bacteria | 1821 |
| 315 | Ga0075365_10133288 | 3300006038 | Bacteria | 1720 |
| 316 | Ga0075365_10256126 | 3300006038 | Bacteria | 1230 |
| 317 | Ga0075368_10034063 | 3300006042 | Bacteria | 1983 |
| 318 | Ga0075368_10125050 | 3300006042 | Bacteria | 1067 |
| 319 | Ga0075363_100033082 | 3300006048 | Bacteria | 2690 |
| 320 | Ga0075364_10008816 | 3300006051 | Bacteria | 6037 |
| 321 | Ga0075364_10057317 | 3300006051 | Bacteria | 2551 |
| 322 | Ga0075432_10001490 | 3300006058 | Bacteria | 7644 |
| 323 | Ga0075432_10043086 | 3300006058 | Bacteria | 1581 |
| 324 | Ga0070715_10015144 | 3300006163 | Bacteria | 2870 |
| 325 | Ga0070716_100047381 | 3300006173 | Bacteria | 2424 |
| 326 | Ga0070712_100001328 | 3300006175 | Bacteria | 14997 |
| 327 | Ga0070712_100025089 | 3300006175 | Bacteria | 3958 |
| 328 | Ga0070712_100227496 | 3300006175 | Bacteria | 1479 |
| 329 | Ga0070712_100449611 | 3300006175 | Bacteria | 1072 |
| 330 | Ga0075362_10014874 | 3300006177 | Bacteria | 3153 |
| 331 | Ga0075362_10171211 | 3300006177 | Bacteria | 1049 |
| 332 | Ga0075367_10039470 | 3300006178 | Bacteria | 2753 |
| 333 | Ga0075367_10124156 | 3300006178 | Bacteria | 1592 |
| 334 | Ga0075367_10186253 | 3300006178 | Bacteria | 1295 |
| 335 | Ga0075367_10408182 | 3300006178 | Bacteria | 859 |
| 336 | Ga0075369_10016633 | 3300006186 | Bacteria | 2971 |
| 337 | Ga0075427_10001112 | 3300006194 | Bacteria | 3382 |
| 338 | Ga0075366_10001687 | 3300006195 | Bacteria | 11092 |
| 339 | Ga0097621_100000421 | 3300006237 | Bacteria | 29460 |
| 340 | Ga0097621_100008029 | 3300006237 | Bacteria | 7577 |
| 341 | Ga0075370_10163989 | 3300006353 | Bacteria | 1305 |
| 342 | Ga0068871_100000515 | 3300006358 | Bacteria | 26586 |
| 343 | Ga0068871_100012948 | 3300006358 | Bacteria | 6177 |
| 344 | Ga0075428_100007282 | 3300006844 | Bacteria | 12256 |
| 345 | Ga0075428_100013216 | 3300006844 | Bacteria | 9185 |
| 346 | Ga0075428_100068287 | 3300006844 | Bacteria | 3888 |
| 347 | Ga0075428_100069359 | 3300006844 | Bacteria | 3854 |
| 348 | Ga0075428_100099013 | 3300006844 | Bacteria | 3179 |
| 349 | Ga0075428_100124513 | 3300006844 | Bacteria | 2805 |
| 350 | Ga0075428_100124758 | 3300006844 | Bacteria | 2803 |
| 351 | Ga0075428_100245919 | 3300006844 | Bacteria | 1929 |
| 352 | Ga0075428_100598426 | 3300006844 | Bacteria | 1178 |
| 353 | Ga0075430_100000223 | 3300006846 | Bacteria | 39224 |
| 354 | Ga0075430_100021979 | 3300006846 | Bacteria | 5422 |
| 355 | Ga0075430_100028858 | 3300006846 | Bacteria | 4711 |
| 356 | Ga0075430_100285844 | 3300006846 | Bacteria | 1364 |
| 357 | Ga0075431_100001810 | 3300006847 | Bacteria | 20184 |
| 358 | Ga0075431_100002413 | 3300006847 | Bacteria | 17988 |
| 359 | Ga0075431_100072177 | 3300006847 | Bacteria | 3562 |
| 360 | Ga0075431_100143787 | 3300006847 | Bacteria | 2458 |
| 361 | Ga0075431_100505165 | 3300006847 | Bacteria | 1200 |
| 362 | Ga0075433_10002034 | 3300006852 | Bacteria | 15272 |
| 363 | Ga0075433_10006137 | 3300006852 | Bacteria | 9468 |
| 364 | Ga0075433_10008633 | 3300006852 | Bacteria | 8131 |
| 365 | Ga0075433_10036232 | 3300006852 | Bacteria | 4248 |
| 366 | Ga0075433_10062911 | 3300006852 | Bacteria | 3250 |
| 367 | Ga0075433_10270158 | 3300006852 | Bacteria | 1507 |
| 368 | Ga0075434_100000007 | 3300006871 | Bacteria | 95975 |
| 369 | Ga0075434_100000693 | 3300006871 | Bacteria | 26314 |
| 370 | Ga0075434_100001159 | 3300006871 | Bacteria | 21806 |
| 371 | Ga0075434_100005025 | 3300006871 | Bacteria | 12006 |
| 372 | Ga0075434_100020496 | 3300006871 | Bacteria | 6414 |
| 373 | Ga0075434_100038594 | 3300006871 | Bacteria | 4730 |
| 374 | Ga0075434_100082088 | 3300006871 | Bacteria | 3221 |
| 375 | Ga0075434_100096480 | 3300006871 | Bacteria | 2961 |
| 376 | Ga0075434_100152317 | 3300006871 | Bacteria | 2332 |
| 377 | Ga0075434_100577216 | 3300006871 | Bacteria | 1144 |
| 378 | Ga0075429_100004783 | 3300006880 | Bacteria | 11659 |
| 379 | Ga0075429_100006663 | 3300006880 | Bacteria | 10011 |
| 380 | Ga0075429_100021886 | 3300006880 | Bacteria | 5542 |
| 381 | Ga0075429_100026387 | 3300006880 | Bacteria | 5044 |
| 382 | Ga0075429_100119201 | 3300006880 | Bacteria | 2306 |
| 383 | Ga0075429_100271459 | 3300006880 | Bacteria | 1485 |
| 384 | Ga0075429_100353876 | 3300006880 | Bacteria | 1286 |
| 385 | Ga0068865_100002115 | 3300006881 | Bacteria | 11728 |
| 386 | Ga0075436_100002192 | 3300006914 | Bacteria | 13473 |
| 387 | Ga0075436_100014836 | 3300006914 | Bacteria | 5340 |
| 388 | Ga0075436_100037473 | 3300006914 | Bacteria | 3348 |
| 389 | Ga0075436_100052910 | 3300006914 | Bacteria | 2803 |
| 390 | Ga0075436_100116949 | 3300006914 | Bacteria | 1864 |
| 391 | Ga0075436_100155144 | 3300006914 | Bacteria | 1612 |
| 392 | Ga0097620_100023234 | 3300006931 | Bacteria | 6221 |
| 393 | Ga0097620_100087787 | 3300006931 | Bacteria | 3159 |
| 394 | Ga0097620_100104537 | 3300006931 | Bacteria | 2891 |
| 395 | Ga0097620_100108838 | 3300006931 | Bacteria | 2832 |
| 396 | Ga0097620_100161476 | 3300006931 | Bacteria | 2320 |
| 397 | Ga0097620_100242115 | 3300006931 | Bacteria | 1893 |
| 398 | Ga0097620_100825766 | 3300006931 | Bacteria | 1013 |
| 399 | Ga0075435_100000432 | 3300007076 | Bacteria | 25629 |
| 400 | Ga0075435_100025823 | 3300007076 | Bacteria | 4577 |
| 401 | Ga0075435_100039209 | 3300007076 | Bacteria | 3780 |
| 402 | Ga0075435_100049630 | 3300007076 | Bacteria | 3375 |
| 403 | Ga0075435_100149194 | 3300007076 | Bacteria | 1965 |
| 404 | Ga0075435_100698182 | 3300007076 | Bacteria | 882 |
| 405 | Ga0099794_10018222 | 3300007265 | Bacteria | 3145 |
| 406 | Ga0105251_10040087 | 3300009011 | Bacteria | 2284 |
| 407 | Ga0105240_10037315 | 3300009093 | Bacteria | 6246 |
| 408 | Ga0105240_10146994 | 3300009093 | Bacteria | 2811 |
| 409 | Ga0111539_10004448 | 3300009094 | Bacteria | 18316 |
| 410 | Ga0111539_10005607 | 3300009094 | Bacteria | 16233 |
| 411 | Ga0111539_10013539 | 3300009094 | Bacteria | 10195 |
| 412 | Ga0111539_10017591 | 3300009094 | Bacteria | 8846 |
| 413 | Ga0111539_10019998 | 3300009094 | Bacteria | 8247 |
| 414 | Ga0111539_10022696 | 3300009094 | Bacteria | 7708 |
| 415 | Ga0111539_10108411 | 3300009094 | Bacteria | 3259 |
| 416 | Ga0111539_10146086 | 3300009094 | Bacteria | 2769 |
| 417 | Ga0111539_10197563 | 3300009094 | Bacteria | 2346 |
| 418 | Ga0111539_10358184 | 3300009094 | Bacteria | 1698 |
| 419 | Ga0111539_10409294 | 3300009094 | Bacteria | 1580 |
| 420 | Ga0111539_10642777 | 3300009094 | Bacteria | 1235 |
| 421 | Ga0111539_11070617 | 3300009094 | Bacteria | 937 |
| 422 | Ga0105245_10069147 | 3300009098 | Bacteria | 3202 |
| 423 | Ga0105245_10183449 | 3300009098 | Bacteria | 2001 |
| 424 | Ga0105245_10536001 | 3300009098 | Bacteria | 1191 |
| 425 | Ga0105247_10011296 | 3300009101 | Bacteria | 5386 |
| 426 | Ga0105247_10012837 | 3300009101 | Bacteria | 5028 |
| 427 | Ga0105247_10135646 | 3300009101 | Bacteria | 1608 |
| 428 | Ga0114129_10000742 | 3300009147 | Bacteria | 41451 |
| 429 | Ga0114129_10008001 | 3300009147 | Bacteria | 15058 |
| 430 | Ga0114129_10059035 | 3300009147 | Bacteria | 5364 |
| 431 | Ga0114129_10065278 | 3300009147 | Bacteria | 5080 |
| 432 | Ga0114129_10072693 | 3300009147 | Bacteria | 4794 |
| 433 | Ga0114129_10097190 | 3300009147 | Bacteria | 4076 |
| 434 | Ga0114129_10105879 | 3300009147 | Bacteria | 3886 |
| 435 | Ga0114129_10148174 | 3300009147 | Bacteria | 3213 |
| 436 | Ga0114129_10240682 | 3300009147 | Bacteria | 2433 |
| 437 | Ga0114129_10260479 | 3300009147 | Bacteria | 2325 |
| 438 | Ga0105243_10002574 | 3300009148 | Bacteria | 15152 |
| 439 | Ga0105243_10011951 | 3300009148 | Bacteria | 6563 |
| 440 | Ga0105243_10209355 | 3300009148 | Bacteria | 1716 |
| 441 | Ga0105243_10319277 | 3300009148 | Bacteria | 1414 |
| 442 | Ga0105243_10774371 | 3300009148 | Bacteria | 943 |
| 443 | Ga0105241_10110703 | 3300009174 | Bacteria | 2197 |
| 444 | Ga0105241_10111008 | 3300009174 | Bacteria | 2194 |
| 445 | Ga0105241_10235651 | 3300009174 | Bacteria | 1545 |
| 446 | Ga0105242_10056433 | 3300009176 | Bacteria | 3214 |
| 447 | Ga0105242_10282850 | 3300009176 | Bacteria | 1507 |
| 448 | Ga0105248_10000821 | 3300009177 | Bacteria | 34849 |
| 449 | Ga0105248_10076409 | 3300009177 | Bacteria | 3764 |
| 450 | Ga0105248_10084997 | 3300009177 | Bacteria | 3561 |
| 451 | Ga0105248_10121013 | 3300009177 | Bacteria | 2953 |
| 452 | Ga0105248_10196174 | 3300009177 | Bacteria | 2275 |
| 453 | Ga0105248_10204882 | 3300009177 | Bacteria | 2223 |
| 454 | Ga0105248_10451642 | 3300009177 | Bacteria | 1448 |
| 455 | Ga0105237_10128596 | 3300009545 | Bacteria | 2527 |
| 456 | Ga0105237_10262560 | 3300009545 | Bacteria | 1729 |
| 457 | Ga0105238_10009936 | 3300009551 | Bacteria | 9542 |
| 458 | Ga0105238_10011216 | 3300009551 | Bacteria | 9016 |
| 459 | Ga0105238_10535685 | 3300009551 | Bacteria | 1174 |
| 460 | Ga0105238_10732457 | 3300009551 | Bacteria | 1002 |
| 461 | Ga0105249_10015879 | 3300009553 | Bacteria | 6674 |
| 462 | Ga0105249_10017602 | 3300009553 | Bacteria | 6345 |
| 463 | Ga0105249_10084737 | 3300009553 | Bacteria | 2952 |
| 464 | Ga0105249_10319768 | 3300009553 | Bacteria | 1563 |
| 465 | Ga0099796_10005153 | 3300010159 | Bacteria | 3238 |
| 466 | Ga0105239_10004537 | 3300010375 | Bacteria | 16545 |
| 467 | Ga0105239_10196874 | 3300010375 | Bacteria | 2257 |
| 468 | Ga0105239_10405567 | 3300010375 | Bacteria | 1543 |
| 469 | Ga0105239_10698425 | 3300010375 | Bacteria | 1160 |
| 470 | Ga0105246_10001092 | 3300011119 | Bacteria | 15711 |
| 471 | Ga0105246_10097849 | 3300011119 | Bacteria | 2130 |
| 472 | Ga0105246_10147153 | 3300011119 | Bacteria | 1779 |
| 473 | Ga0157335_1001913 | 3300012492 | Bacteria | 1197 |
| 474 | Ga0157345_1001831 | 3300012498 | Bacteria | 1489 |
| 475 | Ga0157316_1006538 | 3300012510 | Bacteria | 960 |
| 476 | Ga0157338_1014273 | 3300012515 | Bacteria | 854 |
| 477 | Ga0157373_10188691 | 3300013100 | Bacteria | 1452 |
| 478 | Ga0157373_10239296 | 3300013100 | Bacteria | 1283 |
| 479 | Ga0157373_10448647 | 3300013100 | Bacteria | 928 |
| 480 | Ga0157371_10007315 | 3300013102 | Bacteria | 8965 |
| 481 | Ga0157371_10248820 | 3300013102 | Bacteria | 1279 |
| 482 | Ga0157370_10158470 | 3300013104 | Bacteria | 2106 |
| 483 | Ga0157370_10180697 | 3300013104 | Bacteria | 1960 |
| 484 | Ga0157369_10312214 | 3300013105 | Bacteria | 1635 |
| 485 | Ga0157369_10870663 | 3300013105 | Bacteria | 924 |
| 486 | Ga0157374_10002049 | 3300013296 | Bacteria | 16945 |
| 487 | Ga0157374_10032857 | 3300013296 | Bacteria | 4729 |
| 488 | Ga0157374_10527076 | 3300013296 | Bacteria | 1188 |
| 489 | Ga0157378_10007541 | 3300013297 | Bacteria | 9498 |
| 490 | Ga0157378_10213406 | 3300013297 | Bacteria | 1831 |
| 491 | Ga0157378_10229704 | 3300013297 | Bacteria | 1768 |
| 492 | Ga0157378_10312686 | 3300013297 | Bacteria | 1524 |
| 493 | Ga0157378_10325547 | 3300013297 | Bacteria | 1494 |
| 494 | Ga0157378_10573049 | 3300013297 | Bacteria | 1137 |
| 495 | Ga0163162_10005029 | 3300013306 | Bacteria | 12738 |
| 496 | Ga0163162_10077208 | 3300013306 | Bacteria | 3394 |
| 497 | Ga0163162_10077995 | 3300013306 | Bacteria | 3377 |
| 498 | Ga0163162_10218623 | 3300013306 | Bacteria | 2035 |
| 499 | Ga0157372_10012748 | 3300013307 | Bacteria | 8955 |
| 500 | Ga0157372_10343424 | 3300013307 | Bacteria | 1739 |
| 501 | Ga0157372_11036284 | 3300013307 | Bacteria | 950 |
| 502 | Ga0157375_10005227 | 3300013308 | Bacteria | 11266 |
| 503 | Ga0157375_10019784 | 3300013308 | Bacteria | 6134 |
| 504 | Ga0157375_10180264 | 3300013308 | Bacteria | 2263 |
| 505 | Ga0157375_10191934 | 3300013308 | Bacteria | 2197 |
| 506 | Ga0157375_10207198 | 3300013308 | Bacteria | 2117 |
| 507 | Ga0157375_10538422 | 3300013308 | Bacteria | 1330 |
| 508 | Ga0163163_10005574 | 3300014325 | Bacteria | 10905 |
| 509 | Ga0163163_10084887 | 3300014325 | Bacteria | 3174 |
| 510 | Ga0157380_10001279 | 3300014326 | Bacteria | 16357 |
| 511 | Ga0157380_10167974 | 3300014326 | Bacteria | 1914 |
| 512 | Ga0157380_10726026 | 3300014326 | Bacteria | 1002 |
| 513 | Ga0157377_10000312 | 3300014745 | Bacteria | 22340 |
| 514 | Ga0157377_10284684 | 3300014745 | Bacteria | 1085 |
| 515 | Ga0157379_10001989 | 3300014968 | Bacteria | 16918 |
| 516 | Ga0157379_10029559 | 3300014968 | Bacteria | 4872 |
| 517 | Ga0157379_10063884 | 3300014968 | Bacteria | 3291 |
| 518 | Ga0157379_10387290 | 3300014968 | Bacteria | 1283 |
| 519 | Ga0157376_10001372 | 3300014969 | Bacteria | 16037 |
| 520 | Ga0157376_10019925 | 3300014969 | Bacteria | 5179 |
| 521 | Ga0157376_10054749 | 3300014969 | Bacteria | 3327 |
| 522 | Ga0157376_10440512 | 3300014969 | Bacteria | 1269 |
| 523 | Ga0163161_10003480 | 3300017792 | Bacteria | 11037 |
| 524 | Ga0213872_10111987 | 3300021361 | Bacteria | 1212 |
| 525 | Ga0224572_1013150 | 3300024225 | Bacteria | 1577 |
| 526 | Ga0228598_1016476 | 3300024227 | Bacteria | 1459 |
| 527 | Ga0207666_1000038 | 3300025271 | Bacteria | 26508 |
| 528 | Ga0207666_1000670 | 3300025271 | Bacteria | 4106 |
| 529 | Ga0209758_1000079 | 3300025297 | Bacteria | 262874 |
| 530 | Ga0207697_10000373 | 3300025315 | Bacteria | 25127 |
| 531 | Ga0207656_10080070 | 3300025321 | Bacteria | 1466 |
| 532 | Ga0207653_10000559 | 3300025885 | Bacteria | 13532 |
| 533 | Ga0207653_10005254 | 3300025885 | Bacteria | 4046 |
| 534 | Ga0207653_10009753 | 3300025885 | Bacteria | 2993 |
| 535 | Ga0207682_10000071 | 3300025893 | Bacteria | 44843 |
| 536 | Ga0207692_10010499 | 3300025898 | Bacteria | 3906 |
| 537 | Ga0207692_10051167 | 3300025898 | Bacteria | 2093 |
| 538 | Ga0207692_10076273 | 3300025898 | Bacteria | 1780 |
| 539 | Ga0207692_10080845 | 3300025898 | Bacteria | 1738 |
| 540 | Ga0207642_10004072 | 3300025899 | Bacteria | 4683 |
| 541 | Ga0207710_10007122 | 3300025900 | Bacteria | 4745 |
| 542 | Ga0207710_10018719 | 3300025900 | Bacteria | 2947 |
| 543 | Ga0207710_10125777 | 3300025900 | Bacteria | 1228 |
| 544 | Ga0207688_10000237 | 3300025901 | Bacteria | 25119 |
| 545 | Ga0207688_10002075 | 3300025901 | Bacteria | 10771 |
| 546 | Ga0207688_10062115 | 3300025901 | Bacteria | 2106 |
| 547 | Ga0207680_10016997 | 3300025903 | Bacteria | 3834 |
| 548 | Ga0207680_10037949 | 3300025903 | Bacteria | 2785 |
| 549 | Ga0207647_10009005 | 3300025904 | Bacteria | 7113 |
| 550 | Ga0207647_10064700 | 3300025904 | Bacteria | 2222 |
| 551 | Ga0207647_10080366 | 3300025904 | Bacteria | 1955 |
| 552 | Ga0207685_10043200 | 3300025905 | Bacteria | 1697 |
| 553 | Ga0207699_10073451 | 3300025906 | Bacteria | 2098 |
| 554 | Ga0207699_10126789 | 3300025906 | Bacteria | 1659 |
| 555 | Ga0207645_10000779 | 3300025907 | Bacteria | 26604 |
| 556 | Ga0207645_10027896 | 3300025907 | Bacteria | 3645 |
| 557 | Ga0207645_10036138 | 3300025907 | Bacteria | 3172 |
| 558 | Ga0207645_10093669 | 3300025907 | Bacteria | 1933 |
| 559 | Ga0207643_10000276 | 3300025908 | Bacteria | 35671 |
| 560 | Ga0207643_10002314 | 3300025908 | Bacteria | 10366 |
| 561 | Ga0207643_10032530 | 3300025908 | Bacteria | 2914 |
| 562 | Ga0207705_10077767 | 3300025909 | Bacteria | 2414 |
| 563 | Ga0207705_10103433 | 3300025909 | Bacteria | 2098 |
| 564 | Ga0207705_10223975 | 3300025909 | Bacteria | 1429 |
| 565 | Ga0207684_10119069 | 3300025910 | Bacteria | 2263 |
| 566 | Ga0207654_10014702 | 3300025911 | Bacteria | 4048 |
| 567 | Ga0207654_10093334 | 3300025911 | Bacteria | 1840 |
| 568 | Ga0207654_10361226 | 3300025911 | Bacteria | 1002 |
| 569 | Ga0207707_10000454 | 3300025912 | Bacteria | 42654 |
| 570 | Ga0207707_10069691 | 3300025912 | Bacteria | 3065 |
| 571 | Ga0207707_10070862 | 3300025912 | Bacteria | 3037 |
| 572 | Ga0207707_10080459 | 3300025912 | Bacteria | 2845 |
| 573 | Ga0207707_10207864 | 3300025912 | Bacteria | 1706 |
| 574 | Ga0207707_10236855 | 3300025912 | Bacteria | 1588 |
| 575 | Ga0207707_10361291 | 3300025912 | Bacteria | 1250 |
| 576 | Ga0207695_10213968 | 3300025913 | Bacteria | 1837 |
| 577 | Ga0207671_10016484 | 3300025914 | Bacteria | 5741 |
| 578 | Ga0207671_10037376 | 3300025914 | Bacteria | 3601 |
| 579 | Ga0207671_10211283 | 3300025914 | Bacteria | 1518 |
| 580 | Ga0207693_10005073 | 3300025915 | Bacteria | 11046 |
| 581 | Ga0207693_10007312 | 3300025915 | Bacteria | 9084 |
| 582 | Ga0207693_10010113 | 3300025915 | Bacteria | 7663 |
| 583 | Ga0207693_10010718 | 3300025915 | Bacteria | 7439 |
| 584 | Ga0207693_10021275 | 3300025915 | Bacteria | 5154 |
| 585 | Ga0207693_10031132 | 3300025915 | Bacteria | 4215 |
| 586 | Ga0207693_10073450 | 3300025915 | Bacteria | 2677 |
| 587 | Ga0207693_10097721 | 3300025915 | Bacteria | 2302 |
| 588 | Ga0207663_10072881 | 3300025916 | Bacteria | 2221 |
| 589 | Ga0207663_10118857 | 3300025916 | Bacteria | 1806 |
| 590 | Ga0207663_10141582 | 3300025916 | Bacteria | 1676 |
| 591 | Ga0207663_10166343 | 3300025916 | Bacteria | 1562 |
| 592 | Ga0207663_10183783 | 3300025916 | Bacteria | 1495 |
| 593 | Ga0207663_10247050 | 3300025916 | Bacteria | 1311 |
| 594 | Ga0207660_10000087 | 3300025917 | Bacteria | 49552 |
| 595 | Ga0207660_10018065 | 3300025917 | Bacteria | 4696 |
| 596 | Ga0207660_10035293 | 3300025917 | Bacteria | 3471 |
| 597 | Ga0207660_10065427 | 3300025917 | Bacteria | 2627 |
| 598 | Ga0207660_10107168 | 3300025917 | Bacteria | 2096 |
| 599 | Ga0207660_10398957 | 3300025917 | Bacteria | 1107 |
| 600 | Ga0207662_10000659 | 3300025918 | Bacteria | 15653 |
| 601 | Ga0207662_10009020 | 3300025918 | Bacteria | 5479 |
| 602 | Ga0207662_10022432 | 3300025918 | Bacteria | 3620 |
| 603 | Ga0207662_10108986 | 3300025918 | Bacteria | 1725 |
| 604 | Ga0207662_10244695 | 3300025918 | Bacteria | 1175 |
| 605 | Ga0207657_10003101 | 3300025919 | Bacteria | 17768 |
| 606 | Ga0207657_10005173 | 3300025919 | Bacteria | 13682 |
| 607 | Ga0207657_10035321 | 3300025919 | Bacteria | 4483 |
| 608 | Ga0207657_10090738 | 3300025919 | Bacteria | 2550 |
| 609 | Ga0207657_10189285 | 3300025919 | Bacteria | 1661 |
| 610 | Ga0207657_10440634 | 3300025919 | Bacteria | 1023 |
| 611 | Ga0207649_10000662 | 3300025920 | Bacteria | 22982 |
| 612 | Ga0207649_10039165 | 3300025920 | Bacteria | 2872 |
| 613 | Ga0207652_10001908 | 3300025921 | Bacteria | 18069 |
| 614 | Ga0207652_10008147 | 3300025921 | Bacteria | 8415 |
| 615 | Ga0207652_10023549 | 3300025921 | Bacteria | 5101 |
| 616 | Ga0207652_10111416 | 3300025921 | Bacteria | 2427 |
| 617 | Ga0207652_10133337 | 3300025921 | Bacteria | 2217 |
| 618 | Ga0207652_10257875 | 3300025921 | Bacteria | 1573 |
| 619 | Ga0207652_10323990 | 3300025921 | Bacteria | 1391 |
| 620 | Ga0207652_10385849 | 3300025921 | Bacteria | 1264 |
| 621 | Ga0207652_10576436 | 3300025921 | Bacteria | 1010 |
| 622 | Ga0207681_10001262 | 3300025923 | Bacteria | 16334 |
| 623 | Ga0207681_10151297 | 3300025923 | Bacteria | 1739 |
| 624 | Ga0207681_10253399 | 3300025923 | Bacteria | 1375 |
| 625 | Ga0207694_10017984 | 3300025924 | Bacteria | 5342 |
| 626 | Ga0207694_10044775 | 3300025924 | Bacteria | 3417 |
| 627 | Ga0207694_10182297 | 3300025924 | Bacteria | 1703 |
| 628 | Ga0207694_10435899 | 3300025924 | Bacteria | 1093 |
| 629 | Ga0207650_10005107 | 3300025925 | Bacteria | 8956 |
| 630 | Ga0207650_10015020 | 3300025925 | Bacteria | 5386 |
| 631 | Ga0207650_10097382 | 3300025925 | Bacteria | 2258 |
| 632 | Ga0207650_10178535 | 3300025925 | Bacteria | 1691 |
| 633 | Ga0207659_10000143 | 3300025926 | Bacteria | 42200 |
| 634 | Ga0207659_10026549 | 3300025926 | Bacteria | 3909 |
| 635 | Ga0207659_10145896 | 3300025926 | Bacteria | 1842 |
| 636 | Ga0207687_10000865 | 3300025927 | Bacteria | 20461 |
| 637 | Ga0207687_10030379 | 3300025927 | Bacteria | 3643 |
| 638 | Ga0207687_10052245 | 3300025927 | Bacteria | 2852 |
| 639 | Ga0207687_10122905 | 3300025927 | Bacteria | 1944 |
| 640 | Ga0207687_10246166 | 3300025927 | Bacteria | 1419 |
| 641 | Ga0207700_10000323 | 3300025928 | Bacteria | 28133 |
| 642 | Ga0207700_10276966 | 3300025928 | Bacteria | 1442 |
| 643 | Ga0207700_10293094 | 3300025928 | Bacteria | 1403 |
| 644 | Ga0207664_10075293 | 3300025929 | Bacteria | 2729 |
| 645 | Ga0207664_10092332 | 3300025929 | Bacteria | 2484 |
| 646 | Ga0207664_10104335 | 3300025929 | Bacteria | 2347 |
| 647 | Ga0207664_10337725 | 3300025929 | Bacteria | 1332 |
| 648 | Ga0207664_10388968 | 3300025929 | Bacteria | 1239 |
| 649 | Ga0207664_10403389 | 3300025929 | Bacteria | 1216 |
| 650 | Ga0207644_10000532 | 3300025931 | Bacteria | 24677 |
| 651 | Ga0207644_10042290 | 3300025931 | Bacteria | 3228 |
| 652 | Ga0207644_10243525 | 3300025931 | Bacteria | 1432 |
| 653 | Ga0207644_10378619 | 3300025931 | Bacteria | 1154 |
| 654 | Ga0207690_10000409 | 3300025932 | Bacteria | 28156 |
| 655 | Ga0207690_10127841 | 3300025932 | Bacteria | 1855 |
| 656 | Ga0207690_10269905 | 3300025932 | Bacteria | 1321 |
| 657 | Ga0207706_10001338 | 3300025933 | Bacteria | 24639 |
| 658 | Ga0207706_10006705 | 3300025933 | Bacteria | 10645 |
| 659 | Ga0207706_10058641 | 3300025933 | Bacteria | 3390 |
| 660 | Ga0207706_10138699 | 3300025933 | Bacteria | 2139 |
| 661 | Ga0207706_10300810 | 3300025933 | Bacteria | 1398 |
| 662 | Ga0207686_10000500 | 3300025934 | Bacteria | 25713 |
| 663 | Ga0207686_10042200 | 3300025934 | Bacteria | 2786 |
| 664 | Ga0207686_10097295 | 3300025934 | Bacteria | 1958 |
| 665 | Ga0207686_10141181 | 3300025934 | Bacteria | 1665 |
| 666 | Ga0207686_10322567 | 3300025934 | Bacteria | 1154 |
| 667 | Ga0207709_10001266 | 3300025935 | Bacteria | 18089 |
| 668 | Ga0207709_10037338 | 3300025935 | Bacteria | 2886 |
| 669 | Ga0207709_10062539 | 3300025935 | Bacteria | 2330 |
| 670 | Ga0207709_10131293 | 3300025935 | Bacteria | 1708 |
| 671 | Ga0207670_10007354 | 3300025936 | Bacteria | 6140 |
| 672 | Ga0207670_10016040 | 3300025936 | Bacteria | 4493 |
| 673 | Ga0207670_10207631 | 3300025936 | Bacteria | 1492 |
| 674 | Ga0207670_10229327 | 3300025936 | Bacteria | 1425 |
| 675 | Ga0207670_10249011 | 3300025936 | Bacteria | 1372 |
| 676 | Ga0207669_10001125 | 3300025937 | Bacteria | 11423 |
| 677 | Ga0207669_10015259 | 3300025937 | Bacteria | 3870 |
| 678 | Ga0207669_10397944 | 3300025937 | Bacteria | 1078 |
| 679 | Ga0207669_10539886 | 3300025937 | Bacteria | 939 |
| 680 | Ga0207704_10000613 | 3300025938 | Bacteria | 15794 |
| 681 | Ga0207704_10075416 | 3300025938 | Bacteria | 2156 |
| 682 | Ga0207704_10266244 | 3300025938 | Bacteria | 1295 |
| 683 | Ga0207665_10001192 | 3300025939 | Bacteria | 17511 |
| 684 | Ga0207665_10003934 | 3300025939 | Bacteria | 9947 |
| 685 | Ga0207665_10052253 | 3300025939 | Bacteria | 2753 |
| 686 | Ga0207665_10133806 | 3300025939 | Bacteria | 1762 |
| 687 | Ga0207665_10327524 | 3300025939 | Bacteria | 1151 |
| 688 | Ga0207691_10002493 | 3300025940 | Bacteria | 18001 |
| 689 | Ga0207691_10003339 | 3300025940 | Bacteria | 15624 |
| 690 | Ga0207691_10024434 | 3300025940 | Bacteria | 5683 |
| 691 | Ga0207691_10130622 | 3300025940 | Bacteria | 2219 |
| 692 | Ga0207691_10193211 | 3300025940 | Bacteria | 1775 |
| 693 | Ga0207711_10003987 | 3300025941 | Bacteria | 12681 |
| 694 | Ga0207711_10029326 | 3300025941 | Bacteria | 4640 |
| 695 | Ga0207711_10032877 | 3300025941 | Bacteria | 4387 |
| 696 | Ga0207711_10041693 | 3300025941 | Bacteria | 3909 |
| 697 | Ga0207711_10050370 | 3300025941 | Bacteria | 3565 |
| 698 | Ga0207711_10162221 | 3300025941 | Bacteria | 2024 |
| 699 | Ga0207711_10469127 | 3300025941 | Bacteria | 1172 |
| 700 | Ga0207689_10000440 | 3300025942 | Bacteria | 38932 |
| 701 | Ga0207689_10021598 | 3300025942 | Bacteria | 5412 |
| 702 | Ga0207689_10064489 | 3300025942 | Bacteria | 3014 |
| 703 | Ga0207689_10065413 | 3300025942 | Bacteria | 2990 |
| 704 | Ga0207689_10248080 | 3300025942 | Bacteria | 1472 |
| 705 | Ga0207689_10445733 | 3300025942 | Bacteria | 1082 |
| 706 | Ga0207661_10059018 | 3300025944 | Bacteria | 3090 |
| 707 | Ga0207661_10061762 | 3300025944 | Bacteria | 3028 |
| 708 | Ga0207661_10320955 | 3300025944 | Bacteria | 1392 |
| 709 | Ga0207679_10000131 | 3300025945 | Bacteria | 61363 |
| 710 | Ga0207679_10016049 | 3300025945 | Bacteria | 4965 |
| 711 | Ga0207679_10203794 | 3300025945 | Bacteria | 1654 |
| 712 | Ga0207667_10088810 | 3300025949 | Bacteria | 3196 |
| 713 | Ga0207667_10092846 | 3300025949 | Bacteria | 3117 |
| 714 | Ga0207667_10724036 | 3300025949 | Bacteria | 996 |
| 715 | Ga0207651_10000335 | 3300025960 | Bacteria | 19911 |
| 716 | Ga0207651_10298458 | 3300025960 | Bacteria | 1339 |
| 717 | Ga0207712_10002448 | 3300025961 | Bacteria | 11985 |
| 718 | Ga0207712_10004065 | 3300025961 | Bacteria | 9233 |
| 719 | Ga0207712_10030909 | 3300025961 | Bacteria | 3604 |
| 720 | Ga0207712_10048380 | 3300025961 | Bacteria | 2958 |
| 721 | Ga0207712_10305140 | 3300025961 | Bacteria | 1308 |
| 722 | Ga0207712_10395616 | 3300025961 | Bacteria | 1160 |
| 723 | Ga0207668_10000065 | 3300025972 | Bacteria | 86273 |
| 724 | Ga0207668_10100099 | 3300025972 | Bacteria | 2152 |
| 725 | Ga0207640_10000339 | 3300025981 | Bacteria | 31004 |
| 726 | Ga0207640_10031052 | 3300025981 | Bacteria | 3297 |
| 727 | Ga0207640_10086417 | 3300025981 | Bacteria | 2159 |
| 728 | Ga0207658_10004428 | 3300025986 | Bacteria | 9771 |
| 729 | Ga0207658_10034444 | 3300025986 | Bacteria | 3620 |
| 730 | Ga0207677_10003580 | 3300026023 | Bacteria | 8226 |
| 731 | Ga0207677_10458159 | 3300026023 | Bacteria | 1094 |
| 732 | Ga0207703_10001885 | 3300026035 | Bacteria | 18620 |
| 733 | Ga0207703_10056702 | 3300026035 | Bacteria | 3192 |
| 734 | Ga0207703_10124556 | 3300026035 | Bacteria | 2217 |
| 735 | Ga0207703_10141154 | 3300026035 | Bacteria | 2091 |
| 736 | Ga0207703_10413126 | 3300026035 | Bacteria | 1254 |
| 737 | Ga0207703_10423763 | 3300026035 | Bacteria | 1239 |
| 738 | Ga0207639_10041384 | 3300026041 | Bacteria | 3447 |
| 739 | Ga0207639_10209690 | 3300026041 | Bacteria | 1676 |
| 740 | Ga0207639_10436969 | 3300026041 | Bacteria | 1186 |
| 741 | Ga0207678_10000944 | 3300026067 | Bacteria | 26538 |
| 742 | Ga0207678_10006342 | 3300026067 | Bacteria | 10500 |
| 743 | Ga0207678_10019284 | 3300026067 | Bacteria | 5990 |
| 744 | Ga0207678_10036592 | 3300026067 | Bacteria | 4273 |
| 745 | Ga0207678_10056937 | 3300026067 | Bacteria | 3364 |
| 746 | Ga0207678_10058587 | 3300026067 | Bacteria | 3314 |
| 747 | Ga0207678_10086398 | 3300026067 | Bacteria | 2681 |
| 748 | Ga0207678_10160477 | 3300026067 | Bacteria | 1920 |
| 749 | Ga0207708_10002019 | 3300026075 | Bacteria | 14954 |
| 750 | Ga0207708_10002166 | 3300026075 | Bacteria | 14494 |
| 751 | Ga0207708_10041728 | 3300026075 | Bacteria | 3497 |
| 752 | Ga0207708_10067796 | 3300026075 | Bacteria | 2730 |
| 753 | Ga0207708_10206842 | 3300026075 | Bacteria | 1568 |
| 754 | Ga0207708_10237196 | 3300026075 | Bacteria | 1466 |
| 755 | Ga0207708_10419328 | 3300026075 | Bacteria | 1110 |
| 756 | Ga0207702_10028991 | 3300026078 | Bacteria | 4603 |
| 757 | Ga0207702_10056555 | 3300026078 | Bacteria | 3331 |
| 758 | Ga0207641_10005810 | 3300026088 | Bacteria | 10470 |
| 759 | Ga0207641_10085777 | 3300026088 | Bacteria | 2744 |
| 760 | Ga0207641_10167384 | 3300026088 | Bacteria | 2003 |
| 761 | Ga0207641_10179572 | 3300026088 | Bacteria | 1938 |
| 762 | Ga0207641_10545589 | 3300026088 | Bacteria | 1130 |
| 763 | Ga0207648_10004730 | 3300026089 | Bacteria | 13904 |
| 764 | Ga0207648_10039268 | 3300026089 | Bacteria | 4163 |
| 765 | Ga0207648_10049631 | 3300026089 | Bacteria | 3672 |
| 766 | Ga0207676_10008134 | 3300026095 | Bacteria | 7455 |
| 767 | Ga0207676_10100203 | 3300026095 | Bacteria | 2399 |
| 768 | Ga0207676_10139552 | 3300026095 | Bacteria | 2073 |
| 769 | Ga0207676_10151364 | 3300026095 | Bacteria | 1998 |
| 770 | Ga0207676_10331087 | 3300026095 | Bacteria | 1401 |
| 771 | Ga0207674_10003323 | 3300026116 | Bacteria | 19775 |
| 772 | Ga0207674_10005364 | 3300026116 | Bacteria | 15249 |
| 773 | Ga0207674_10100292 | 3300026116 | Bacteria | 2877 |
| 774 | Ga0207674_10488334 | 3300026116 | Bacteria | 1190 |
| 775 | Ga0207675_100000815 | 3300026118 | Bacteria | 31016 |
| 776 | Ga0207675_100053907 | 3300026118 | Bacteria | 3752 |
| 777 | Ga0207675_100291146 | 3300026118 | Bacteria | 1588 |
| 778 | Ga0207675_100442262 | 3300026118 | Bacteria | 1287 |
| 779 | Ga0207675_100476579 | 3300026118 | Bacteria | 1240 |
| 780 | Ga0207683_10000001 | 3300026121 | Bacteria | 352047 |
| 781 | Ga0207683_10027788 | 3300026121 | Bacteria | 4889 |
| 782 | Ga0207683_10081084 | 3300026121 | Bacteria | 2879 |
| 783 | Ga0207683_10132061 | 3300026121 | Bacteria | 2246 |
| 784 | Ga0207683_10138555 | 3300026121 | Bacteria | 2191 |
| 785 | Ga0207698_10051342 | 3300026142 | Bacteria | 3152 |
| 786 | Ga0207698_10144287 | 3300026142 | Bacteria | 2056 |
| 787 | Ga0207698_10192321 | 3300026142 | Bacteria | 1819 |
| 788 | Ga0209967_1000489 | 3300027364 | Bacteria | 5203 |
| 789 | Ga0209981_1000830 | 3300027378 | Bacteria | 3900 |
| 790 | Ga0209995_1003461 | 3300027471 | Bacteria | 2515 |
| 791 | Ga0209999_1003822 | 3300027543 | Bacteria | 2705 |
| 792 | Ga0210002_1033724 | 3300027617 | Bacteria | 857 |
| 793 | Ga0209983_1030948 | 3300027665 | Bacteria | 1141 |
| 794 | Ga0209588_1021817 | 3300027671 | Bacteria | 2013 |
| 795 | Ga0209966_1000743 | 3300027695 | Bacteria | 6783 |
| 796 | Ga0209998_10001042 | 3300027717 | Bacteria | 6950 |
| 797 | Ga0209998_10002206 | 3300027717 | Bacteria | 4515 |
| 798 | Ga0209813_10082809 | 3300027866 | Bacteria | 1064 |
| 799 | Ga0209974_10065047 | 3300027876 | Bacteria | 1238 |
| 800 | Ga0207428_10000172 | 3300027907 | Bacteria | 90200 |
| 801 | Ga0207428_10000255 | 3300027907 | Bacteria | 72962 |
| 802 | Ga0207428_10003313 | 3300027907 | Bacteria | 15665 |
| 803 | Ga0207428_10013736 | 3300027907 | Bacteria | 7059 |
| 804 | Ga0207428_10016308 | 3300027907 | Bacteria | 6392 |
| 805 | Ga0207428_10058144 | 3300027907 | Bacteria | 3069 |
| 806 | Ga0207428_10138752 | 3300027907 | Bacteria | 1857 |
| 807 | Ga0207428_10178586 | 3300027907 | Bacteria | 1605 |
| 808 | Ga0265357_1002134 | 3300028023 | Bacteria | 1577 |
| 809 | Ga0268266_10020037 | 3300028379 | Bacteria | 5701 |
| 810 | Ga0268266_10175367 | 3300028379 | Bacteria | 1948 |
| 811 | Ga0268265_10009461 | 3300028380 | Bacteria | 6580 |
| 812 | Ga0268265_10029653 | 3300028380 | Bacteria | 3930 |
| 813 | Ga0268264_10001153 | 3300028381 | Bacteria | 25764 |
| 814 | Ga0268264_10006938 | 3300028381 | Bacteria | 9501 |
| 815 | Ga0268264_10330445 | 3300028381 | Bacteria | 1444 |
| 816 | Ga0268264_10350221 | 3300028381 | Bacteria | 1405 |
| 817 | Ga0268264_10353932 | 3300028381 | Bacteria | 1399 |
| 818 | Ga0268264_10366967 | 3300028381 | Bacteria | 1375 |
| 819 | Ga0265334_10075822 | 3300028573 | Bacteria | 1246 |
| 820 | Ga0265338_10038131 | 3300028800 | Bacteria | 4558 |
| 821 | Ga0265338_10038132 | 3300028800 | Bacteria | 4558 |
| 822 | Ga0265760_10069529 | 3300031090 | Bacteria | 1078 |
| 823 | Ga0265332_10085378 | 3300031238 | Bacteria | 1338 |
| 824 | Ga0265325_10000320 | 3300031241 | Bacteria | 33866 |
| 825 | Ga0265325_10000901 | 3300031241 | Bacteria | 21471 |
| 826 | Ga0265325_10001624 | 3300031241 | Bacteria | 15665 |
| 827 | Ga0265325_10013945 | 3300031241 | Bacteria | 4559 |
| 828 | Ga0265325_10018886 | 3300031241 | Bacteria | 3819 |
| 829 | Ga0265325_10022061 | 3300031241 | Bacteria | 3490 |
| 830 | Ga0265325_10105494 | 3300031241 | Bacteria | 1375 |
| 831 | Ga0265340_10053019 | 3300031247 | Bacteria | 1960 |
| 832 | Ga0265340_10099607 | 3300031247 | Bacteria | 1351 |
| 833 | Ga0265340_10216465 | 3300031247 | Bacteria | 859 |
| 834 | Ga0265339_10000091 | 3300031249 | Bacteria | 75937 |
| 835 | Ga0265339_10000387 | 3300031249 | Bacteria | 34871 |
| 836 | Ga0265339_10082085 | 3300031249 | Bacteria | 1702 |
| 837 | Ga0265316_10222699 | 3300031344 | Bacteria | 1391 |
| 838 | Ga0265316_10345461 | 3300031344 | Bacteria | 1078 |
| 839 | Ga0307513_10169054 | 3300031456 | Bacteria | 2066 |
| 840 | Ga0265313_10000850 | 3300031595 | Bacteria | 30762 |
| 841 | Ga0265313_10001068 | 3300031595 | Bacteria | 26548 |
| 842 | Ga0265313_10004004 | 3300031595 | Bacteria | 11532 |
| 843 | Ga0265313_10006723 | 3300031595 | Bacteria | 8045 |
| 844 | Ga0265313_10127706 | 3300031595 | Bacteria | 1104 |
| 845 | Ga0265313_10174770 | 3300031595 | Bacteria | 905 |
| 846 | Ga0265314_10007897 | 3300031711 | Bacteria | 9182 |
| 847 | Ga0265314_10024428 | 3300031711 | Bacteria | 4582 |
| 848 | Ga0265342_10000196 | 3300031712 | Bacteria | 67364 |
| 849 | Ga0265342_10024497 | 3300031712 | Bacteria | 3809 |
| 850 | Ga0265342_10051287 | 3300031712 | Bacteria | 2462 |
| 851 | Ga0307413_10105998 | 3300031824 | Bacteria | 1870 |
| 852 | Ga0307406_10733410 | 3300031901 | Bacteria | 828 |
| 853 | Ga0307411_10044801 | 3300032005 | Bacteria | 2841 |
| 854 | Ga0373930_0000014 | 3300034816 | Bacteria | 17170 |
| 855 | Ga0373948_0000493 | 3300034817 | Bacteria | 4922 |
| 856 | Ga0373948_0000950 | 3300034817 | Bacteria | 3883 |
| 857 | Ga0373950_0000145 | 3300034818 | Bacteria | 11351 |
| 858 | Ga0373950_0007552 | 3300034818 | Bacteria | 1691 |
| 859 | Ga0373958_0000064 | 3300034819 | Bacteria | 10619 |
| 860 | Ga0373958_0012499 | 3300034819 | Bacteria | 1453 |
| 861 | Ga0373958_0015415 | 3300034819 | Bacteria | 1350 |
| 862 | Ga0373958_0017715 | 3300034819 | Bacteria | 1284 |
| 863 | Ga0373959_0005735 | 3300034820 | Bacteria | 2041 |
| 864 | Ga0373959_0053195 | 3300034820 | Bacteria | 879 |
| 865 | Ga0373938_0001531 | 3300034957 | Bacteria | 3712 |
| 866 | Ga0373938_0014379 | 3300034957 | Bacteria | 1518 |
| 867 | Ga0373938_0037550 | 3300034957 | Bacteria | 1064 |
| 868 | Ga0373938_0049817 | 3300034957 | Bacteria | 954 |
| 869 | Ga0373926_0017053 | 3300035083 | Bacteria | 2489 |
| 870 | Ga0373926_0049141 | 3300035083 | Bacteria | 1518 |
| 871 | Ga0373926_0084674 | 3300035083 | Bacteria | 1175 |
| 872 | Ga0373928_0001389 | 3300035084 | Bacteria | 4719 |
| 873 | Ga0373928_0007010 | 3300035084 | Bacteria | 2172 |
| 874 | Ga0373929_0000101 | 3300035085 | Bacteria | 14304 |
| 875 | Ga0373929_0002108 | 3300035085 | Bacteria | 3695 |
| 876 | Ga0373929_0053362 | 3300035085 | Bacteria | 929 |
| 877 | Ga0373934_0010944 | 3300035086 | Bacteria | 3411 |
| 878 | Ga0373940_0003765 | 3300035088 | Bacteria | 3134 |
| 879 | Ga0373940_0041509 | 3300035088 | Bacteria | 1265 |
| 880 | Ga0373940_0076050 | 3300035088 | Bacteria | 985 |
| 881 | Ga0373944_0007357 | 3300035089 | Bacteria | 2948 |
| 882 | Ga0373944_0011177 | 3300035089 | Bacteria | 2456 |
| 883 | Ga0373944_0013599 | 3300035089 | Bacteria | 2261 |
| 884 | Ga0373944_0035961 | 3300035089 | Bacteria | 1511 |
| 885 | Ga0373944_0045478 | 3300035089 | Bacteria | 1370 |
| 886 | Ga0373944_0120512 | 3300035089 | Bacteria | 903 |
| 887 | Ga0373949_0000293 | 3300035090 | Bacteria | 18099 |
| 888 | Ga0373949_0000952 | 3300035090 | Bacteria | 8980 |
| 889 | Ga0373951_0000154 | 3300035091 | Bacteria | 25002 |
| 890 | Ga0373951_0014795 | 3300035091 | Bacteria | 1755 |
| 891 | Ga0373952_0000030 | 3300035092 | Bacteria | 16323 |
| 892 | Ga0373952_0000920 | 3300035092 | Bacteria | 5345 |
| 893 | Ga0373952_0023481 | 3300035092 | Bacteria | 1318 |
| 894 | Ga0373952_0050550 | 3300035092 | Bacteria | 990 |
| 895 | Ga0373923_0010802 | 3300035111 | Bacteria | 3333 |
| 896 | Ga0373932_0001243 | 3300035112 | Bacteria | 7237 |
| 897 | Ga0373932_0049425 | 3300035112 | Bacteria | 1243 |
| 898 | Ga0373936_0009974 | 3300035113 | Bacteria | 3585 |
| 899 | Ga0373936_0017372 | 3300035113 | Bacteria | 2769 |
| 900 | Ga0373936_0019684 | 3300035113 | Bacteria | 2616 |
| 901 | Ga0373936_0029855 | 3300035113 | Bacteria | 2148 |
| 902 | Ga0373936_0204465 | 3300035113 | Bacteria | 872 |
| 903 | Ga0373939_0000791 | 3300035114 | Bacteria | 7801 |
| 904 | Ga0373939_0003691 | 3300035114 | Bacteria | 3605 |
| 905 | Ga0373939_0004617 | 3300035114 | Bacteria | 3262 |
| 906 | Ga0373939_0021740 | 3300035114 | Bacteria | 1760 |
| 907 | Ga0373939_0024887 | 3300035114 | Bacteria | 1672 |
| 908 | Ga0373941_0000050 | 3300035115 | Bacteria | 17747 |
| 909 | Ga0373941_0085807 | 3300035115 | Bacteria | 1071 |
| 910 | Ga0373945_0001214 | 3300035116 | Bacteria | 7848 |
| 911 | Ga0373945_0005087 | 3300035116 | Bacteria | 4193 |
| 912 | Ga0373945_0010311 | 3300035116 | Bacteria | 3075 |
| 913 | Ga0373945_0010949 | 3300035116 | Bacteria | 2992 |
| 914 | Ga0373945_0023434 | 3300035116 | Bacteria | 2132 |
| 915 | Ga0373945_0030077 | 3300035116 | Bacteria | 1912 |
| 916 | Ga0373953_0001444 | 3300035117 | Bacteria | 6890 |
| 917 | Ga0373953_0013693 | 3300035117 | Bacteria | 2901 |
| 918 | Ga0373954_0001943 | 3300035118 | Bacteria | 8567 |
| 919 | Ga0373954_0008746 | 3300035118 | Bacteria | 4451 |
| 920 | Ga0373954_0021614 | 3300035118 | Bacteria | 2914 |
| 921 | Ga0373954_0023220 | 3300035118 | Bacteria | 2818 |
| 922 | Ga0373954_0025068 | 3300035118 | Bacteria | 2724 |
| 923 | Ga0373954_0137932 | 3300035118 | Bacteria | 1189 |
| 924 | Ga0373956_0024897 | 3300035119 | Bacteria | 2583 |
| 925 | Ga0373956_0044007 | 3300035119 | Bacteria | 1989 |
| 926 | Ga0373957_0003309 | 3300035120 | Bacteria | 4749 |
| 927 | Ga0373957_0005066 | 3300035120 | Bacteria | 4066 |
| 928 | Ga0373957_0024044 | 3300035120 | Bacteria | 2184 |
| 929 | Ga0373960_0003068 | 3300035121 | Bacteria | 3771 |
| 930 | Ga0373960_0028479 | 3300035121 | Bacteria | 1542 |
| 931 | Ga0373943_0000132 | 3300035170 | Bacteria | 28317 |
| 932 | Ga0373943_0001792 | 3300035170 | Bacteria | 9710 |
| 933 | Ga0373943_0006259 | 3300035170 | Bacteria | 5347 |
| 934 | Ga0373943_0010229 | 3300035170 | Bacteria | 4207 |
| 935 | Ga0373943_0014659 | 3300035170 | Bacteria | 3553 |
| 936 | Ga0373943_0115598 | 3300035170 | Bacteria | 1420 |
| 937 | Ga0373946_0000496 | 3300035171 | Bacteria | 13068 |
| 938 | Ga0373946_0000760 | 3300035171 | Bacteria | 10975 |
| 939 | Ga0373946_0001192 | 3300035171 | Bacteria | 9005 |
| 940 | Ga0373946_0005660 | 3300035171 | Bacteria | 4514 |
| 941 | Ga0373946_0007440 | 3300035171 | Bacteria | 4005 |
| 942 | Ga0373946_0111178 | 3300035171 | Bacteria | 1240 |
| 943 | Ga0373946_0159408 | 3300035171 | Bacteria | 1058 |
| 944 | Ga0373955_0000779 | 3300035172 | Bacteria | 13651 |
| 945 | Ga0373955_0005131 | 3300035172 | Bacteria | 5853 |
| 946 | Ga0373955_0057467 | 3300035172 | Bacteria | 2137 |
| 947 | Ga0373955_0067556 | 3300035172 | Bacteria | 1990 |
| 948 | Ga0373955_0084642 | 3300035172 | Bacteria | 1798 |
| 949 | Ga0373955_0127120 | 3300035172 | Bacteria | 1486 |
| 950 | Ga0373955_0146766 | 3300035172 | Bacteria | 1386 |
| 951 | Ga0373955_0270947 | 3300035172 | Bacteria | 1020 |
| 952 | Ga0373942_0000073 | 3300035207 | Bacteria | 21344 |
| 953 | Ga0373942_0025665 | 3300035207 | Bacteria | 1520 |
| 954 | Ga0373942_0026622 | 3300035207 | Bacteria | 1498 |
| 955 | Ga0373942_0061063 | 3300035207 | Bacteria | 1081 |
| 956 | Ga0373942_0103677 | 3300035207 | Bacteria | 872 |
| 957 | Ga0373961_0000480 | 3300035241 | Bacteria | 15603 |
| 958 | Ga0373961_0009096 | 3300035241 | Bacteria | 2425 |
| 959 | Ga0373961_0081398 | 3300035241 | Bacteria | 1019 |
| 960 | Ga0373962_0001214 | 3300035242 | Bacteria | 6025 |
| 961 | Ga0373962_0001920 | 3300035242 | Bacteria | 4950 |
| 962 | Ga0373962_0011212 | 3300035242 | Bacteria | 2244 |
| 963 | Ga0373962_0023763 | 3300035242 | Bacteria | 1634 |
| 964 | Ga0373962_0033854 | 3300035242 | Bacteria | 1412 |
| 965 | Ga0373924_0039884 | 3300035410 | Bacteria | 1920 |
| 966 | Ga0373924_0118510 | 3300035410 | Bacteria | 1147 |
| 967 | Ga0373931_0000537 | 3300035691 | Bacteria | 15543 |
| 968 | Ga0373931_0004302 | 3300035691 | Bacteria | 6489 |
| 969 | Ga0373931_0006018 | 3300035691 | Bacteria | 5644 |
| 970 | Ga0373931_0010273 | 3300035691 | Bacteria | 4498 |
| 971 | Ga0373931_0023545 | 3300035691 | Bacteria | 3111 |
| 972 | Ga0373931_0036666 | 3300035691 | Bacteria | 2557 |
| 973 | Ga0373931_0108251 | 3300035691 | Bacteria | 1573 |
| 974 | Ga0373931_0119575 | 3300035691 | Bacteria | 1504 |
| 975 | Ga0373931_0129610 | 3300035691 | Bacteria | 1450 |
| 976 | Ga0373935_0000053 | 3300035692 | Bacteria | 46838 |
| 977 | Ga0373935_0001261 | 3300035692 | Bacteria | 13962 |
| 978 | Ga0373935_0003568 | 3300035692 | Bacteria | 9069 |
| 979 | Ga0373935_0006902 | 3300035692 | Bacteria | 6778 |
| 980 | Ga0373935_0021565 | 3300035692 | Bacteria | 3945 |
| 981 | Ga0373935_0046856 | 3300035692 | Bacteria | 2732 |
| 982 | Ga0373935_0069841 | 3300035692 | Bacteria | 2263 |
| 983 | Ga0373935_0130097 | 3300035692 | Bacteria | 1690 |
| 984 | Ga0373935_0187924 | 3300035692 | Bacteria | 1421 |
| 985 | Ga0373935_0574631 | 3300035692 | Bacteria | 823 |
| 986 | Ga0373927_0011111 | 3300035695 | Bacteria | 5997 |
| 987 | Ga0373927_0035423 | 3300035695 | Bacteria | 3245 |
| 988 | Ga0373927_0095761 | 3300035695 | Bacteria | 1929 |
| 989 | Ga0373927_0116233 | 3300035695 | Bacteria | 1744 |
| 990 | Ga0373927_0120334 | 3300035695 | Bacteria | 1713 |
| 991 | Ga0373933_0001426 | 3300035724 | Bacteria | 14019 |
| 992 | Ga0373933_0002786 | 3300035724 | Bacteria | 9757 |
| 993 | Ga0373933_0021557 | 3300035724 | Bacteria | 3661 |
| 994 | Ga0373933_0022272 | 3300035724 | Bacteria | 3606 |
| 995 | Ga0373933_0051395 | 3300035724 | Bacteria | 2463 |
| 996 | Ga0373947_0000239 | 3300035725 | Bacteria | 30999 |
| 997 | Ga0373947_0000259 | 3300035725 | Bacteria | 29909 |
| 998 | Ga0373947_0001656 | 3300035725 | Bacteria | 13631 |
| 999 | Ga0373947_0008738 | 3300035725 | Bacteria | 5824 |
| 1000 | Ga0373947_0009288 | 3300035725 | Bacteria | 5649 |
| 1001 | Ga0373947_0013217 | 3300035725 | Bacteria | 4732 |
| 1002 | Ga0373947_0054577 | 3300035725 | Bacteria | 2411 |
| 1003 | Ga0373947_0065243 | 3300035725 | Bacteria | 2220 |
| 1004 | Ga0373947_0080997 | 3300035725 | Bacteria | 2009 |
| 1005 | Ga0373947_0169381 | 3300035725 | Bacteria | 1416 |
| 1006 | Ga0373937_0000030 | 3300036401 | Bacteria | 122176 |
| 1007 | Ga0373937_0000907 | 3300036401 | Bacteria | 25212 |
| 1008 | Ga0373937_0001504 | 3300036401 | Bacteria | 19577 |
| 1009 | Ga0373937_0003255 | 3300036401 | Bacteria | 13620 |
| 1010 | Ga0373937_0029085 | 3300036401 | Bacteria | 5003 |
| 1011 | Ga0373937_0036814 | 3300036401 | Bacteria | 4458 |
| 1012 | Ga0373937_0355286 | 3300036401 | Bacteria | 1388 |
| 1013 | Ga0373925_0000002 | 3300037068 | Bacteria | 368879 |
| 1014 | Ga0373925_0000706 | 3300037068 | Bacteria | 31254 |
| 1015 | Ga0373925_0019842 | 3300037068 | Bacteria | 4890 |
| 1016 | Ga0373925_0024207 | 3300037068 | Bacteria | 4432 |
| 1017 | Ga0373925_0036229 | 3300037068 | Bacteria | 3641 |
| 1018 | Ga0373925_0038812 | 3300037068 | Bacteria | 3522 |
| 1019 | Ga0373925_0057058 | 3300037068 | Bacteria | 2925 |
| 1020 | Ga0373925_0073022 | 3300037068 | Bacteria | 2596 |
| 1021 | Ga0373925_0178500 | 3300037068 | Bacteria | 1679 |
| 1022 | Ga0373925_0193557 | 3300037068 | Bacteria | 1614 |
| 1023 | Ga0373925_0644593 | 3300037068 | Bacteria | 873 |
| 1024 | Ga0395899_0052594 | 3300037312 | Bacteria | 3018 |
| 1025 | Ga0395900_0009186 | 3300037418 | Bacteria | 10132 |
| 1026 | Ga0395900_0022366 | 3300037418 | Bacteria | 6466 |
| 1027 | Ga0395900_0108898 | 3300037418 | Bacteria | 2846 |
| 1028 | Ga0395898_0003941 | 3300037466 | Bacteria | 16375 |
| 1029 | Ga0395898_0024197 | 3300037466 | Bacteria | 6126 |
| 1030 | Ga0395898_0310833 | 3300037466 | Bacteria | 1503 |
| 1031 | Ga0395901_0014006 | 3300038443 | Bacteria | 8161 |
| 1032 | Ga0395901_0075175 | 3300038443 | Bacteria | 3524 |
| 1033 | Ga0395901_0161489 | 3300038443 | Bacteria | 2353 |
| 1034 | Ga0395901_0321676 | 3300038443 | Bacteria | 1600 |
| 1035 | Ga0242420_033121 | 3300038996 | Bacteria | 965 |
| 1036 | Ga0436365_0109845 | 3300039437 | Bacteria | 1319 |
| 1037 | Ga0436365_0497354 | 3300039437 | Bacteria | 8033 |
| 1038 | Ga0436365_1614912 | 3300039437 | Bacteria | 4311 |
| 1039 | Ga0436363_0961840 | 3300039450 | Bacteria | 808 |
| 1040 | Ga0439453_0002489 | 3300041408 | Bacteria | 2549 |
| 1041 | Ga0439461_0003514 | 3300041410 | Bacteria | 2581 |
| 1042 | Ga0451835_0493760 | 3300041492 | Bacteria | 1024 |
| 1043 | Ga0439441_022166 | 3300042001 | Bacteria | 1178 |
| 1044 | Ga0439443_000477 | 3300042003 | Bacteria | 3560 |
| 1045 | Ga0439462_0023808 | 3300042015 | Bacteria | 1606 |
| 1046 | Ga0439446_0001019 | 3300042156 | Bacteria | 6142 |
| 1047 | Ga0439446_0035914 | 3300042156 | Bacteria | 1447 |
| 1048 | Ga0439434_0002451 | 3300042435 | Bacteria | 5395 |
| 1049 | Ga0439435_0000002 | 3300042436 | Bacteria | 34816 |
| 1050 | Ga0439435_0000646 | 3300042436 | Bacteria | 5729 |
| 1051 | Ga0439435_0028486 | 3300042436 | Bacteria | 1502 |
| 1052 | Ga0439464_0034111 | 3300042439 | Bacteria | 1434 |
| 1053 | Ga0451577_0147580 | 3300042876 | Bacteria | 2115 |
| 1054 | Ga0466966_0016428 | 3300044684 | Bacteria | 4891 |
| 1055 | Ga0466966_0135867 | 3300044684 | Bacteria | 1504 |
| 1056 | Ga0466963_0013664 | 3300044694 | Bacteria | 4992 |
| 1057 | Ga0466963_0044109 | 3300044694 | Bacteria | 2935 |
| 1058 | Ga0466963_0190873 | 3300044694 | Bacteria | 1431 |
| 1059 | Ga0466963_0431546 | 3300044694 | Bacteria | 929 |
| 1060 | Ga0453684_0283538 | 3300044712 | Bacteria | 1888 |
| 1061 | Ga0453684_0669787 | 3300044712 | Bacteria | 1130 |
| 1062 | Ga0466971_0008622 | 3300044719 | Bacteria | 4448 |
| 1063 | Ga0466971_0156124 | 3300044719 | Bacteria | 1067 |
| 1064 | Ga0466957_0034003 | 3300044842 | Bacteria | 3058 |
| 1065 | Ga0466957_0121630 | 3300044842 | Bacteria | 1664 |
| 1066 | Ga0466957_0373921 | 3300044842 | Bacteria | 971 |
| 1067 | Ga0466959_0168004 | 3300045049 | Bacteria | 1539 |
| 1068 | Ga0451576_0017130 | 3300045051 | Bacteria | 7970 |
| 1069 | Ga0451576_0117936 | 3300045051 | Bacteria | 2763 |
| 1070 | Ga0466958_0171884 | 3300045836 | Bacteria | 1372 |
| 1071 | Ga0466958_0304967 | 3300045836 | Bacteria | 1022 |
| 1072 | Ga0466967_0000135 | 3300045976 | Bacteria | 28276 |
| 1073 | Ga0466967_0006741 | 3300045976 | Bacteria | 8174 |
| 1074 | Ga0466967_0416209 | 3300045976 | Bacteria | 1309 |
| 1075 | Ga0495617_038698 | 3300046452 | Bacteria | 1595 |
| 1076 | Ga0495592_0000046 | 3300046454 | Bacteria | 117345 |
| 1077 | Ga0495592_0001393 | 3300046454 | Bacteria | 16741 |
| 1078 | Ga0495592_0002484 | 3300046454 | Bacteria | 13030 |
| 1079 | Ga0495592_0071960 | 3300046454 | Bacteria | 2516 |
| 1080 | Ga0495592_0078729 | 3300046454 | Bacteria | 2387 |
| 1081 | Ga0495603_0001804 | 3300046455 | Bacteria | 12638 |
| 1082 | Ga0495603_0002249 | 3300046455 | Bacteria | 11338 |
| 1083 | Ga0495603_0008354 | 3300046455 | Bacteria | 6257 |
| 1084 | Ga0495603_0014184 | 3300046455 | Bacteria | 4821 |
| 1085 | Ga0495603_0090177 | 3300046455 | Bacteria | 1793 |
| 1086 | Ga0495603_0155645 | 3300046455 | Bacteria | 1326 |
| 1087 | Ga0495629_0000594 | 3300046459 | Bacteria | 29414 |
| 1088 | Ga0495629_0001140 | 3300046459 | Bacteria | 20980 |
| 1089 | Ga0495629_0002311 | 3300046459 | Bacteria | 14684 |
| 1090 | Ga0495629_0019080 | 3300046459 | Bacteria | 4903 |
| 1091 | Ga0495629_0088951 | 3300046459 | Bacteria | 2154 |
| 1092 | Ga0495629_0233255 | 3300046459 | Bacteria | 1268 |
| 1093 | Ga0495638_0003988 | 3300046460 | Bacteria | 11355 |
| 1094 | Ga0495638_0039767 | 3300046460 | Bacteria | 2984 |
| 1095 | Ga0495638_0244708 | 3300046460 | Bacteria | 991 |
| 1096 | Ga0495638_0300939 | 3300046460 | Bacteria | 864 |
| 1097 | Ga0495641_0007754 | 3300046461 | Bacteria | 6650 |
| 1098 | Ga0495641_0011331 | 3300046461 | Bacteria | 5090 |
| 1099 | Ga0495641_0017820 | 3300046461 | Bacteria | 3686 |
| 1100 | Ga0495651_0000822 | 3300046462 | Bacteria | 24113 |
| 1101 | Ga0495651_0004816 | 3300046462 | Bacteria | 10326 |
| 1102 | Ga0495651_0047233 | 3300046462 | Bacteria | 3330 |
| 1103 | Ga0495653_0000006 | 3300046463 | Bacteria | 363285 |
| 1104 | Ga0495653_0004798 | 3300046463 | Bacteria | 10964 |
| 1105 | Ga0495653_0024139 | 3300046463 | Bacteria | 4904 |
| 1106 | Ga0495653_0037925 | 3300046463 | Bacteria | 3784 |
| 1107 | Ga0495653_0290993 | 3300046463 | Bacteria | 1068 |
| 1108 | Ga0495580_0017640 | 3300046472 | Bacteria | 5332 |
| 1109 | Ga0495580_0034551 | 3300046472 | Bacteria | 3640 |
| 1110 | Ga0495580_0057444 | 3300046472 | Bacteria | 2738 |
| 1111 | Ga0495580_0074214 | 3300046472 | Bacteria | 2374 |
| 1112 | Ga0495582_0000379 | 3300046473 | Bacteria | 24152 |
| 1113 | Ga0495582_0010594 | 3300046473 | Bacteria | 5072 |
| 1114 | Ga0495582_0028169 | 3300046473 | Bacteria | 3083 |
| 1115 | Ga0495582_0161747 | 3300046473 | Bacteria | 1273 |
| 1116 | Ga0495639_0004321 | 3300046475 | Bacteria | 6094 |
| 1117 | Ga0495639_0038991 | 3300046475 | Bacteria | 2135 |
| 1118 | Ga0495639_0046773 | 3300046475 | Bacteria | 1959 |
| 1119 | Ga0495639_0067099 | 3300046475 | Bacteria | 1652 |
| 1120 | Ga0495662_0000084 | 3300046476 | Bacteria | 33781 |
| 1121 | Ga0495662_0002481 | 3300046476 | Bacteria | 9294 |
| 1122 | Ga0495662_0027194 | 3300046476 | Bacteria | 2763 |
| 1123 | Ga0495662_0051846 | 3300046476 | Bacteria | 1980 |
| 1124 | Ga0495662_0237944 | 3300046476 | Bacteria | 897 |
| 1125 | Ga0495664_0000002 | 3300046477 | Bacteria | 625183 |
| 1126 | Ga0495664_0000112 | 3300046477 | Bacteria | 40522 |
| 1127 | Ga0495664_0007745 | 3300046477 | Bacteria | 5977 |
| 1128 | Ga0495664_0043029 | 3300046477 | Bacteria | 2676 |
| 1129 | Ga0495664_0050575 | 3300046477 | Bacteria | 2467 |
| 1130 | Ga0495584_0033756 | 3300046491 | Bacteria | 2590 |
| 1131 | Ga0495584_0048021 | 3300046491 | Bacteria | 2153 |
| 1132 | Ga0495585_0001932 | 3300046492 | Bacteria | 15492 |
| 1133 | Ga0495585_0196692 | 3300046492 | Bacteria | 1029 |
| 1134 | Ga0495594_0002726 | 3300046499 | Bacteria | 9162 |
| 1135 | Ga0495594_0009110 | 3300046499 | Bacteria | 5124 |
| 1136 | Ga0495594_0011284 | 3300046499 | Bacteria | 4642 |
| 1137 | Ga0495594_0247839 | 3300046499 | Bacteria | 1015 |
| 1138 | Ga0495607_0095599 | 3300046501 | Bacteria | 1601 |
| 1139 | Ga0495608_0000006 | 3300046511 | Bacteria | 324334 |
| 1140 | Ga0495608_0012927 | 3300046511 | Bacteria | 5794 |
| 1141 | Ga0495608_0017846 | 3300046511 | Bacteria | 4905 |
| 1142 | Ga0495608_0082397 | 3300046511 | Bacteria | 2089 |
| 1143 | Ga0495618_0000034 | 3300046514 | Bacteria | 104335 |
| 1144 | Ga0495618_0001016 | 3300046514 | Bacteria | 19217 |
| 1145 | Ga0495618_0001547 | 3300046514 | Bacteria | 15443 |
| 1146 | Ga0495618_0156557 | 3300046514 | Bacteria | 1454 |
| 1147 | Ga0495620_0073308 | 3300046515 | Bacteria | 1396 |
| 1148 | Ga0495628_0000002 | 3300046516 | Bacteria | 589399 |
| 1149 | Ga0495628_0003624 | 3300046516 | Bacteria | 13800 |
| 1150 | Ga0495628_0027943 | 3300046516 | Bacteria | 4586 |
| 1151 | Ga0495628_0032270 | 3300046516 | Bacteria | 4229 |
| 1152 | Ga0495628_0101756 | 3300046516 | Bacteria | 2217 |
| 1153 | Ga0495630_0000662 | 3300046517 | Bacteria | 24856 |
| 1154 | Ga0495630_0005622 | 3300046517 | Bacteria | 8855 |
| 1155 | Ga0495630_0015890 | 3300046517 | Bacteria | 5501 |
| 1156 | Ga0495630_0027968 | 3300046517 | Bacteria | 4189 |
| 1157 | Ga0495630_0042264 | 3300046517 | Bacteria | 3404 |
| 1158 | Ga0495637_0020521 | 3300046520 | Bacteria | 3041 |
| 1159 | Ga0495643_0130553 | 3300046522 | Bacteria | 1262 |
| 1160 | Ga0495644_0003085 | 3300046523 | Bacteria | 6594 |
| 1161 | Ga0495666_0001508 | 3300046526 | Bacteria | 11395 |
| 1162 | Ga0495666_0012392 | 3300046526 | Bacteria | 4250 |
| 1163 | Ga0495666_0034119 | 3300046526 | Bacteria | 2483 |
| 1164 | Ga0495666_0045397 | 3300046526 | Bacteria | 2120 |
| 1165 | Ga0495652_0000004 | 3300046529 | Bacteria | 588877 |
| 1166 | Ga0495652_0013904 | 3300046529 | Bacteria | 7238 |
| 1167 | Ga0495652_0019057 | 3300046529 | Bacteria | 6112 |
| 1168 | Ga0495652_0078363 | 3300046529 | Bacteria | 2736 |
| 1169 | Ga0495665_0003909 | 3300046531 | Bacteria | 8063 |
| 1170 | Ga0495665_0014689 | 3300046531 | Bacteria | 4221 |
| 1171 | Ga0495665_0084846 | 3300046531 | Bacteria | 1664 |
| 1172 | Ga0495665_0115799 | 3300046531 | Bacteria | 1404 |
| 1173 | Ga0495665_0123334 | 3300046531 | Bacteria | 1357 |
| 1174 | Ga0495665_0123478 | 3300046531 | Bacteria | 1356 |
| 1175 | Ga0495640_0000007 | 3300046533 | Bacteria | 265481 |
| 1176 | Ga0495640_0006199 | 3300046533 | Bacteria | 9472 |
| 1177 | Ga0495640_0008881 | 3300046533 | Bacteria | 7849 |
| 1178 | Ga0495640_0010455 | 3300046533 | Bacteria | 7168 |
| 1179 | Ga0495640_0050524 | 3300046533 | Bacteria | 2864 |
| 1180 | Ga0495640_0113463 | 3300046533 | Bacteria | 1768 |
| 1181 | Ga0495586_0032879 | 3300046535 | Bacteria | 2782 |
| 1182 | Ga0495586_0097810 | 3300046535 | Bacteria | 1626 |
| 1183 | Ga0495586_0177186 | 3300046535 | Bacteria | 1205 |
| 1184 | Ga0495587_0000031 | 3300046536 | Bacteria | 126721 |
| 1185 | Ga0495587_0002979 | 3300046536 | Bacteria | 11321 |
| 1186 | Ga0495587_0016339 | 3300046536 | Bacteria | 4618 |
| 1187 | Ga0495587_0179519 | 3300046536 | Bacteria | 1201 |
| 1188 | Ga0495598_0004396 | 3300046537 | Bacteria | 3048 |
| 1189 | Ga0495598_0050085 | 3300046537 | Bacteria | 1254 |
| 1190 | Ga0495609_0065459 | 3300046538 | Bacteria | 1602 |
| 1191 | Ga0495609_0132914 | 3300046538 | Bacteria | 1065 |
| 1192 | Ga0495645_0000003 | 3300046543 | Bacteria | 570133 |
| 1193 | Ga0495645_0005275 | 3300046543 | Bacteria | 8852 |
| 1194 | Ga0495645_0010875 | 3300046543 | Bacteria | 6391 |
| 1195 | Ga0495645_0011025 | 3300046543 | Bacteria | 6352 |
| 1196 | Ga0495645_0125919 | 3300046543 | Bacteria | 1800 |
| 1197 | Ga0495645_0128951 | 3300046543 | Bacteria | 1775 |
| 1198 | Ga0495622_0013050 | 3300046557 | Bacteria | 3855 |
| 1199 | Ga0495622_0049494 | 3300046557 | Bacteria | 1951 |
| 1200 | Ga0495633_0071043 | 3300046558 | Bacteria | 1624 |
| 1201 | Ga0495667_0000002 | 3300046559 | Bacteria | 437535 |
| 1202 | Ga0495667_0000202 | 3300046559 | Bacteria | 40046 |
| 1203 | Ga0495667_0000365 | 3300046559 | Bacteria | 28797 |
| 1204 | Ga0495667_0111739 | 3300046559 | Bacteria | 1765 |
| 1205 | Ga0495667_0188265 | 3300046559 | Bacteria | 1323 |
| 1206 | Ga0495667_0273622 | 3300046559 | Bacteria | 1073 |
| 1207 | Ga0495656_0000360 | 3300046615 | Bacteria | 15300 |
| 1208 | Ga0495634_0000533 | 3300046642 | Bacteria | 37336 |
| 1209 | Ga0495634_0003620 | 3300046642 | Bacteria | 12342 |
| 1210 | Ga0495634_0008544 | 3300046642 | Bacteria | 7612 |
| 1211 | Ga0495634_0021460 | 3300046642 | Bacteria | 4564 |
| 1212 | Ga0495611_0157480 | 3300046648 | Bacteria | 1061 |
| 1213 | Ga0495635_0000022 | 3300046663 | Bacteria | 160907 |
| 1214 | Ga0495635_0000981 | 3300046663 | Bacteria | 18808 |
| 1215 | Ga0495635_0004867 | 3300046663 | Bacteria | 9345 |
| 1216 | Ga0495635_0013894 | 3300046663 | Bacteria | 5633 |
| 1217 | Ga0495635_0081639 | 3300046663 | Bacteria | 2212 |
| 1218 | Ga0495659_0098745 | 3300046664 | Bacteria | 1129 |
| 1219 | Ga0495659_0117966 | 3300046664 | Bacteria | 1042 |
| 1220 | Ga0495661_0010683 | 3300046665 | Bacteria | 6254 |
| 1221 | Ga0495588_0019668 | 3300046674 | Bacteria | 3310 |
| 1222 | Ga0495588_0075208 | 3300046674 | Bacteria | 1759 |
| 1223 | Ga0495588_0090074 | 3300046674 | Bacteria | 1606 |
| 1224 | Ga0495588_0092431 | 3300046674 | Bacteria | 1585 |
| 1225 | Ga0495657_0000276 | 3300046675 | Bacteria | 46295 |
| 1226 | Ga0495657_0031463 | 3300046675 | Bacteria | 3709 |
| 1227 | Ga0495657_0045253 | 3300046675 | Bacteria | 2988 |
| 1228 | Ga0495599_0000001 | 3300046678 | Bacteria | 537563 |
| 1229 | Ga0495599_0002835 | 3300046678 | Bacteria | 10095 |
| 1230 | Ga0495599_0046540 | 3300046678 | Bacteria | 2720 |
| 1231 | Ga0495623_0000094 | 3300046679 | Bacteria | 53328 |
| 1232 | Ga0495623_0001448 | 3300046679 | Bacteria | 16089 |
| 1233 | Ga0495623_0204206 | 3300046679 | Bacteria | 1134 |
| 1234 | Ga0495646_0000007 | 3300046680 | Bacteria | 236764 |
| 1235 | Ga0495646_0002316 | 3300046680 | Bacteria | 11659 |
| 1236 | Ga0495646_0061367 | 3300046680 | Bacteria | 2239 |
| 1237 | Ga0495647_0000122 | 3300046681 | Bacteria | 19930 |
| 1238 | Ga0495647_0000393 | 3300046681 | Bacteria | 12484 |
| 1239 | Ga0495647_0001922 | 3300046681 | Bacteria | 6479 |
| 1240 | Ga0495647_0052367 | 3300046681 | Bacteria | 1589 |
| 1241 | Ga0495658_0000210 | 3300046683 | Bacteria | 33648 |
| 1242 | Ga0495658_0005298 | 3300046683 | Bacteria | 6345 |
| 1243 | Ga0495658_0009937 | 3300046683 | Bacteria | 4747 |
| 1244 | Ga0495658_0014265 | 3300046683 | Bacteria | 4057 |
| 1245 | Ga0495658_0026729 | 3300046683 | Bacteria | 3096 |
| 1246 | Ga0495658_0041879 | 3300046683 | Bacteria | 2554 |
| 1247 | Ga0495658_0148403 | 3300046683 | Bacteria | 1439 |
| 1248 | Ga0495658_0295200 | 3300046683 | Bacteria | 1024 |
| 1249 | Ga0495669_0028471 | 3300046684 | Bacteria | 2448 |
| 1250 | Ga0495669_0040626 | 3300046684 | Bacteria | 2064 |
| 1251 | Ga0495613_0018397 | 3300046689 | Bacteria | 5211 |
| 1252 | Ga0495613_0056650 | 3300046689 | Bacteria | 2878 |
| 1253 | Ga0495613_0083862 | 3300046689 | Bacteria | 2314 |
| 1254 | Ga0495613_0182607 | 3300046689 | Bacteria | 1485 |
| 1255 | Ga0495613_0288357 | 3300046689 | Bacteria | 1138 |
| 1256 | Ga0495624_0000222 | 3300046690 | Bacteria | 44293 |
| 1257 | Ga0495624_0001294 | 3300046690 | Bacteria | 19719 |
| 1258 | Ga0495624_0020416 | 3300046690 | Bacteria | 4410 |
| 1259 | Ga0495624_0034304 | 3300046690 | Bacteria | 3283 |
| 1260 | Ga0495624_0063300 | 3300046690 | Bacteria | 2312 |
| 1261 | Ga0495624_0091603 | 3300046690 | Bacteria | 1875 |
| 1262 | Ga0495624_0096687 | 3300046690 | Bacteria | 1819 |
| 1263 | Ga0495624_0184177 | 3300046690 | Bacteria | 1272 |
| 1264 | Ga0495670_0001624 | 3300046691 | Bacteria | 11000 |
| 1265 | Ga0495600_0000033 | 3300046809 | Bacteria | 83590 |
| 1266 | Ga0495600_0000506 | 3300046809 | Bacteria | 20198 |
| 1267 | Ga0495600_0002658 | 3300046809 | Bacteria | 10329 |
| 1268 | Ga0495600_0030323 | 3300046809 | Bacteria | 3503 |
| 1269 | Ga0495581_0005193 | 3300047315 | Bacteria | 7534 |
| 1270 | Ga0495581_0005649 | 3300047315 | Bacteria | 7252 |
| 1271 | Ga0495581_0020808 | 3300047315 | Bacteria | 3806 |
| 1272 | Ga0495581_0205382 | 3300047315 | Bacteria | 1152 |
| 1273 | Ga0495604_0000005 | 3300047317 | Bacteria | 424516 |
| 1274 | Ga0495604_0001089 | 3300047317 | Bacteria | 22540 |
| 1275 | Ga0495604_0002751 | 3300047317 | Bacteria | 14105 |
| 1276 | Ga0495604_0007025 | 3300047317 | Bacteria | 8925 |
| 1277 | Ga0495604_0082269 | 3300047317 | Bacteria | 2408 |
| 1278 | Ga0495674_0000003 | 3300047319 | Bacteria | 562126 |
| 1279 | Ga0495674_0001490 | 3300047319 | Bacteria | 22945 |
| 1280 | Ga0495674_0001513 | 3300047319 | Bacteria | 22779 |
| 1281 | Ga0495674_0014630 | 3300047319 | Bacteria | 7343 |
| 1282 | Ga0495674_0406574 | 3300047319 | Bacteria | 1098 |
| 1283 | Ga0495672_0127450 | 3300047320 | Bacteria | 1344 |
| 1284 | Ga0495672_0211159 | 3300047320 | Bacteria | 964 |
| 1285 | Ga0495676_0000289 | 3300047321 | Bacteria | 40718 |
| 1286 | Ga0495676_0021676 | 3300047321 | Bacteria | 5605 |
| 1287 | Ga0495676_0079695 | 3300047321 | Bacteria | 2489 |
| 1288 | Ga0495676_0096501 | 3300047321 | Bacteria | 2197 |
| 1289 | Ga0495676_0130099 | 3300047321 | Bacteria | 1818 |
| 1290 | Ga0495676_0171305 | 3300047321 | Bacteria | 1528 |
| 1291 | Ga0495680_0000091 | 3300047322 | Bacteria | 81622 |
| 1292 | Ga0495680_0001414 | 3300047322 | Bacteria | 25878 |
| 1293 | Ga0495680_0012301 | 3300047322 | Bacteria | 7541 |
| 1294 | Ga0495680_0018026 | 3300047322 | Bacteria | 6007 |
| 1295 | Ga0495680_0037109 | 3300047322 | Bacteria | 3906 |
| 1296 | Ga0495680_0072323 | 3300047322 | Bacteria | 2623 |
| 1297 | Ga0495675_0000064 | 3300047444 | Bacteria | 74132 |
| 1298 | Ga0495675_0063292 | 3300047444 | Bacteria | 2341 |
| 1299 | Ga0495679_046890 | 3300047446 | Bacteria | 1313 |
| 1300 | Ga0495684_0000035 | 3300047471 | Bacteria | 107768 |
| 1301 | Ga0495684_0000075 | 3300047471 | Bacteria | 67922 |
| 1302 | Ga0495684_0000264 | 3300047471 | Bacteria | 41677 |
| 1303 | Ga0495684_0001309 | 3300047471 | Bacteria | 20014 |
| 1304 | Ga0495684_0041943 | 3300047471 | Bacteria | 3506 |
| 1305 | Ga0495684_0073421 | 3300047471 | Bacteria | 2599 |
| 1306 | Ga0495684_0128149 | 3300047471 | Bacteria | 1908 |
| 1307 | Ga0495684_0383201 | 3300047471 | Bacteria | 991 |
| 1308 | Ga0495686_0172416 | 3300047472 | Bacteria | 1258 |
| 1309 | Ga0495593_0000228 | 3300047673 | Bacteria | 30037 |
| 1310 | Ga0495593_0001106 | 3300047673 | Bacteria | 15737 |
| 1311 | Ga0495593_0014059 | 3300047673 | Bacteria | 4556 |
| 1312 | Ga0495593_0020031 | 3300047673 | Bacteria | 3746 |
| 1313 | Ga0495602_0000029 | 3300048088 | Bacteria | 142344 |
| 1314 | Ga0495602_0002033 | 3300048088 | Bacteria | 20344 |
| 1315 | Ga0495602_0018847 | 3300048088 | Bacteria | 6872 |
| 1316 | Ga0495602_0460889 | 3300048088 | Bacteria | 895 |
| 1317 | Ga0495614_0017130 | 3300048089 | Bacteria | 3149 |
| 1318 | Ga0495614_0024948 | 3300048089 | Bacteria | 2580 |
| 1319 | Ga0495614_0118009 | 3300048089 | Bacteria | 1168 |
| 1320 | Ga0496100_0000404 | 3300048903 | Bacteria | 20908 |
| 1321 | Ga0496100_0000823 | 3300048903 | Bacteria | 14892 |
| 1322 | Ga0496100_0006720 | 3300048903 | Bacteria | 6298 |
| 1323 | Ga0496100_0017884 | 3300048903 | Bacteria | 4194 |
| 1324 | Ga0496100_0032334 | 3300048903 | Bacteria | 3262 |
| 1325 | Ga0496100_0265535 | 3300048903 | Bacteria | 1274 |
| 1326 | Ga0496100_0305060 | 3300048903 | Bacteria | 1192 |
| 1327 | Ga0496100_0322698 | 3300048903 | Bacteria | 1160 |
| 1328 | Ga0496101_0000423 | 3300048904 | Bacteria | 27228 |
| 1329 | Ga0496101_0013330 | 3300048904 | Bacteria | 5504 |
| 1330 | Ga0496101_0051874 | 3300048904 | Bacteria | 2956 |
| 1331 | Ga0496101_0090963 | 3300048904 | Bacteria | 2270 |
| 1332 | Ga0496102_0003323 | 3300048905 | Bacteria | 13636 |
| 1333 | Ga0496102_0017907 | 3300048905 | Bacteria | 6213 |
| 1334 | Ga0496102_0050819 | 3300048905 | Bacteria | 3775 |
| 1335 | Ga0496102_0137970 | 3300048905 | Bacteria | 2285 |
| 1336 | Ga0496102_0216909 | 3300048905 | Bacteria | 1803 |
| 1337 | Ga0496102_0362586 | 3300048905 | Bacteria | 1364 |
| 1338 | Ga0496102_0443883 | 3300048905 | Bacteria | 1217 |
| 1339 | Ga0496102_0726698 | 3300048905 | Bacteria | 916 |
| 1340 | Ga0496103_0000967 | 3300048906 | Bacteria | 20341 |
| 1341 | Ga0496103_0009318 | 3300048906 | Bacteria | 5817 |
| 1342 | Ga0496103_0023575 | 3300048906 | Bacteria | 3712 |
| 1343 | Ga0496103_0085283 | 3300048906 | Bacteria | 1990 |
| 1344 | Ga0496104_0000711 | 3300048907 | Bacteria | 28620 |
| 1345 | Ga0496104_0000925 | 3300048907 | Bacteria | 25187 |
| 1346 | Ga0496104_0005217 | 3300048907 | Bacteria | 11362 |
| 1347 | Ga0496104_0005466 | 3300048907 | Bacteria | 11129 |
| 1348 | Ga0496104_0014835 | 3300048907 | Bacteria | 7042 |
| 1349 | Ga0496104_0018532 | 3300048907 | Bacteria | 6351 |
| 1350 | Ga0496104_0018853 | 3300048907 | Bacteria | 6302 |
| 1351 | Ga0496104_0036022 | 3300048907 | Bacteria | 4622 |
| 1352 | Ga0496104_0037286 | 3300048907 | Bacteria | 4546 |
| 1353 | Ga0496104_0101035 | 3300048907 | Bacteria | 2761 |
| 1354 | Ga0496104_0144331 | 3300048907 | Bacteria | 2286 |
| 1355 | Ga0496104_0166636 | 3300048907 | Bacteria | 2113 |
| 1356 | Ga0496104_0181717 | 3300048907 | Bacteria | 2014 |
| 1357 | Ga0496104_0307758 | 3300048907 | Bacteria | 1497 |
| 1358 | Ga0496104_0319118 | 3300048907 | Bacteria | 1466 |
| 1359 | Ga0496105_0004562 | 3300048908 | Bacteria | 10431 |
| 1360 | Ga0496105_0010049 | 3300048908 | Bacteria | 7427 |
| 1361 | Ga0496105_0025218 | 3300048908 | Bacteria | 4837 |
| 1362 | Ga0496105_0055857 | 3300048908 | Bacteria | 3260 |
| 1363 | Ga0496105_0079464 | 3300048908 | Bacteria | 2708 |
| 1364 | Ga0496105_0081682 | 3300048908 | Bacteria | 2669 |
| 1365 | Ga0496105_0110294 | 3300048908 | Bacteria | 2271 |
| 1366 | Ga0496105_0172070 | 3300048908 | Bacteria | 1775 |
| 1367 | Ga0496105_0197097 | 3300048908 | Bacteria | 1645 |
| 1368 | Ga0496105_0213306 | 3300048908 | Bacteria | 1573 |
| 1369 | Ga0496105_0536570 | 3300048908 | Bacteria | 915 |
| 1370 | Ga0496106_0002446 | 3300048909 | Bacteria | 13839 |
| 1371 | Ga0496106_0003669 | 3300048909 | Bacteria | 11448 |
| 1372 | Ga0496106_0005520 | 3300048909 | Bacteria | 9359 |
| 1373 | Ga0496106_0009344 | 3300048909 | Bacteria | 7247 |
| 1374 | Ga0496106_0015174 | 3300048909 | Bacteria | 5701 |
| 1375 | Ga0496106_0017560 | 3300048909 | Bacteria | 5294 |
| 1376 | Ga0496106_0046079 | 3300048909 | Bacteria | 3277 |
| 1377 | Ga0496106_0138098 | 3300048909 | Bacteria | 1916 |
| 1378 | Ga0496106_0204770 | 3300048909 | Bacteria | 1571 |
| 1379 | Ga0496106_0278662 | 3300048909 | Bacteria | 1339 |
| 1380 | Ga0496106_0346450 | 3300048909 | Bacteria | 1193 |
| 1381 | Ga0496107_0000500 | 3300048910 | Bacteria | 21655 |
| 1382 | Ga0496107_0021517 | 3300048910 | Bacteria | 4558 |
| 1383 | Ga0496107_0036271 | 3300048910 | Bacteria | 3536 |
| 1384 | Ga0496107_0046339 | 3300048910 | Bacteria | 3129 |
| 1385 | Ga0496107_0130304 | 3300048910 | Bacteria | 1856 |
| 1386 | Ga0496107_0194999 | 3300048910 | Bacteria | 1505 |
| 1387 | Ga0496107_0222895 | 3300048910 | Bacteria | 1403 |
| 1388 | Ga0496107_0265173 | 3300048910 | Bacteria | 1278 |
| 1389 | Ga0496108_0032769 | 3300048911 | Bacteria | 4315 |
| 1390 | Ga0496108_0039555 | 3300048911 | Bacteria | 3930 |
| 1391 | Ga0496108_0048346 | 3300048911 | Bacteria | 3556 |
| 1392 | Ga0496108_0086431 | 3300048911 | Bacteria | 2662 |
| 1393 | Ga0496108_0137032 | 3300048911 | Bacteria | 2107 |
| 1394 | Ga0496108_0227952 | 3300048911 | Bacteria | 1619 |
| 1395 | Ga0496109_0000340 | 3300048912 | Bacteria | 43565 |
| 1396 | Ga0496109_0000359 | 3300048912 | Bacteria | 42297 |
| 1397 | Ga0496109_0000976 | 3300048912 | Bacteria | 23658 |
| 1398 | Ga0496109_0005940 | 3300048912 | Bacteria | 10246 |
| 1399 | Ga0496109_0015600 | 3300048912 | Bacteria | 6625 |
| 1400 | Ga0496109_0017045 | 3300048912 | Bacteria | 6358 |
| 1401 | Ga0496109_0060588 | 3300048912 | Bacteria | 3458 |
| 1402 | Ga0496109_0142769 | 3300048912 | Bacteria | 2239 |
| 1403 | Ga0496109_0191932 | 3300048912 | Bacteria | 1920 |
| 1404 | Ga0496109_0367970 | 3300048912 | Bacteria | 1358 |
| 1405 | Ga0496109_0411173 | 3300048912 | Bacteria | 1278 |
| 1406 | Ga0496110_0002357 | 3300048913 | Bacteria | 14148 |
| 1407 | Ga0496110_0003362 | 3300048913 | Bacteria | 12213 |
| 1408 | Ga0496110_0014914 | 3300048913 | Bacteria | 6458 |
| 1409 | Ga0496110_0020674 | 3300048913 | Bacteria | 5559 |
| 1410 | Ga0496110_0022973 | 3300048913 | Bacteria | 5301 |
| 1411 | Ga0496110_0027384 | 3300048913 | Bacteria | 4886 |
| 1412 | Ga0496110_0034978 | 3300048913 | Bacteria | 4355 |
| 1413 | Ga0496110_0054089 | 3300048913 | Bacteria | 3531 |
| 1414 | Ga0496110_0061174 | 3300048913 | Bacteria | 3323 |
| 1415 | Ga0496110_0122134 | 3300048913 | Bacteria | 2347 |
| 1416 | Ga0496110_0269120 | 3300048913 | Bacteria | 1551 |
| 1417 | Ga0496110_0444018 | 3300048913 | Bacteria | 1182 |
| 1418 | Ga0496111_0013977 | 3300048914 | Bacteria | 5475 |
| 1419 | Ga0496111_0021239 | 3300048914 | Bacteria | 4530 |
| 1420 | Ga0496111_0023917 | 3300048914 | Bacteria | 4294 |
| 1421 | Ga0496111_0030852 | 3300048914 | Bacteria | 3814 |
| 1422 | Ga0496111_0040590 | 3300048914 | Bacteria | 3338 |
| 1423 | Ga0496111_0069085 | 3300048914 | Bacteria | 2569 |
| 1424 | Ga0496111_0156658 | 3300048914 | Bacteria | 1690 |
| 1425 | Ga0496111_0171207 | 3300048914 | Bacteria | 1613 |
| 1426 | Ga0496112_0021049 | 3300048915 | Bacteria | 6194 |
| 1427 | Ga0496112_0044120 | 3300048915 | Bacteria | 4367 |
| 1428 | Ga0496112_0051703 | 3300048915 | Bacteria | 4030 |
| 1429 | Ga0496112_0061635 | 3300048915 | Bacteria | 3698 |
| 1430 | Ga0496112_0078758 | 3300048915 | Bacteria | 3259 |
| 1431 | Ga0496112_0302782 | 3300048915 | Bacteria | 1544 |
| 1432 | Ga0496113_0001950 | 3300048916 | Bacteria | 11812 |
| 1433 | Ga0496113_0002665 | 3300048916 | Bacteria | 10463 |
| 1434 | Ga0496113_0008785 | 3300048916 | Bacteria | 6598 |
| 1435 | Ga0496113_0008826 | 3300048916 | Bacteria | 6585 |
| 1436 | Ga0496113_0129705 | 3300048916 | Bacteria | 1977 |
| 1437 | Ga0496113_0199278 | 3300048916 | Bacteria | 1591 |
| 1438 | Ga0496113_0348048 | 3300048916 | Bacteria | 1188 |
| 1439 | Ga0496114_0046871 | 3300048917 | Bacteria | 3592 |
| 1440 | Ga0496114_0111990 | 3300048917 | Bacteria | 2339 |
| 1441 | Ga0496114_0137536 | 3300048917 | Bacteria | 2113 |
| 1442 | Ga0496114_0242600 | 3300048917 | Bacteria | 1585 |
| 1443 | Ga0496114_0284430 | 3300048917 | Bacteria | 1458 |
| 1444 | Ga0496114_0380195 | 3300048917 | Bacteria | 1250 |
| 1445 | Ga0496114_0428142 | 3300048917 | Bacteria | 1172 |
| 1446 | Ga0496115_0009549 | 3300048918 | Bacteria | 7206 |
| 1447 | Ga0496115_0019987 | 3300048918 | Bacteria | 5160 |
| 1448 | Ga0496115_0073699 | 3300048918 | Bacteria | 2771 |
| 1449 | Ga0496115_0080355 | 3300048918 | Bacteria | 2654 |
| 1450 | Ga0496115_0088771 | 3300048918 | Bacteria | 2525 |
| 1451 | Ga0496115_0096761 | 3300048918 | Bacteria | 2417 |
| 1452 | Ga0496115_0101996 | 3300048918 | Bacteria | 2353 |
| 1453 | Ga0496115_0127875 | 3300048918 | Bacteria | 2093 |
| 1454 | Ga0496115_0173197 | 3300048918 | Bacteria | 1784 |
| 1455 | Ga0496115_0263324 | 3300048918 | Bacteria | 1417 |
| 1456 | Ga0496115_0271117 | 3300048918 | Bacteria | 1394 |
| 1457 | Ga0496115_0333853 | 3300048918 | Bacteria | 1238 |
| 1458 | Ga0496115_0366312 | 3300048918 | Bacteria | 1173 |
| 1459 | Ga0501031_0055503 | 3300049568 | Bacteria | 2581 |
| 1460 | Ga0501031_0079391 | 3300049568 | Bacteria | 2138 |
| 1461 | Ga0501032_0148159 | 3300049569 | Bacteria | 1544 |
| 1462 | Ga0501033_0044445 | 3300049570 | Bacteria | 3307 |
| 1463 | Ga0501033_0075440 | 3300049570 | Bacteria | 2474 |
| 1464 | Ga0501033_0215081 | 3300049570 | Bacteria | 1370 |
| 1465 | Ga0501034_0001160 | 3300049571 | Bacteria | 36511 |
| 1466 | Ga0501034_0006692 | 3300049571 | Bacteria | 12361 |
| 1467 | Ga0501034_0029366 | 3300049571 | Bacteria | 5588 |
| 1468 | Ga0501034_0198853 | 3300049571 | Bacteria | 1963 |
| 1469 | Ga0501036_0018021 | 3300049572 | Bacteria | 5912 |
| 1470 | Ga0501036_0043532 | 3300049572 | Bacteria | 3802 |
| 1471 | Ga0501036_0090209 | 3300049572 | Bacteria | 2589 |
| 1472 | Ga0501036_0282535 | 3300049572 | Bacteria | 1389 |
| 1473 | Ga0501036_0309725 | 3300049572 | Bacteria | 1320 |
| 1474 | Ga0501036_0350203 | 3300049572 | Bacteria | 1233 |
| 1475 | Ga0501037_0026526 | 3300049573 | Bacteria | 4282 |
| 1476 | Ga0501037_0071272 | 3300049573 | Bacteria | 2528 |
| 1477 | Ga0501037_0220440 | 3300049573 | Bacteria | 1335 |
| 1478 | Ga0501038_0000775 | 3300049574 | Bacteria | 28264 |
| 1479 | Ga0501038_0076041 | 3300049574 | Bacteria | 2837 |
| 1480 | Ga0501038_0173956 | 3300049574 | Bacteria | 1741 |
| 1481 | Ga0501038_0255938 | 3300049574 | Bacteria | 1385 |
| 1482 | Ga0501038_0598462 | 3300049574 | Bacteria | 834 |
| 1483 | Ga0501039_0099388 | 3300049575 | Bacteria | 2270 |
| 1484 | Ga0501039_0232807 | 3300049575 | Bacteria | 1448 |
| 1485 | Ga0501040_0009567 | 3300049576 | Bacteria | 6324 |
| 1486 | Ga0501040_0012594 | 3300049576 | Bacteria | 5545 |
| 1487 | Ga0501040_0018457 | 3300049576 | Bacteria | 4631 |
| 1488 | Ga0501040_0318735 | 3300049576 | Bacteria | 1112 |
| 1489 | Ga0501040_0390174 | 3300049576 | Bacteria | 999 |
| 1490 | Ga0501040_0452266 | 3300049576 | Bacteria | 924 |
| 1491 | Ga0501041_0017024 | 3300049577 | Bacteria | 4325 |
| 1492 | Ga0501041_0027793 | 3300049577 | Bacteria | 3410 |
| 1493 | Ga0501041_0107756 | 3300049577 | Bacteria | 1728 |
| 1494 | Ga0501041_0125194 | 3300049577 | Bacteria | 1599 |
| 1495 | Ga0501041_0213223 | 3300049577 | Bacteria | 1211 |
| 1496 | Ga0501042_0059716 | 3300049578 | Bacteria | 2723 |
| 1497 | Ga0501042_0196918 | 3300049578 | Bacteria | 1453 |
| 1498 | Ga0501042_0202099 | 3300049578 | Bacteria | 1433 |
| 1499 | Ga0501042_0228284 | 3300049578 | Bacteria | 1343 |
| 1500 | Ga0501042_0281813 | 3300049578 | Bacteria | 1200 |
| 1501 | Ga0501043_0050356 | 3300049579 | Bacteria | 3274 |
| 1502 | Ga0501043_0087879 | 3300049579 | Bacteria | 2442 |
| 1503 | Ga0501043_0193664 | 3300049579 | Bacteria | 1580 |
| 1504 | Ga0501046_0039215 | 3300049580 | Bacteria | 3795 |
| 1505 | Ga0501046_0043437 | 3300049580 | Bacteria | 3578 |
| 1506 | Ga0501046_0044144 | 3300049580 | Bacteria | 3545 |
| 1507 | Ga0501046_0216539 | 3300049580 | Bacteria | 1420 |
| 1508 | Ga0501046_0252265 | 3300049580 | Bacteria | 1298 |
| 1509 | Ga0501046_0324833 | 3300049580 | Bacteria | 1121 |
| 1510 | Ga0501047_0006347 | 3300049581 | Bacteria | 11116 |
| 1511 | Ga0501047_0009067 | 3300049581 | Bacteria | 9395 |
| 1512 | Ga0501047_0018859 | 3300049581 | Bacteria | 6617 |
| 1513 | Ga0501047_0612500 | 3300049581 | Bacteria | 910 |
| 1514 | Ga0501048_0016432 | 3300049582 | Bacteria | 5454 |
| 1515 | Ga0501048_0105395 | 3300049582 | Bacteria | 1990 |
| 1516 | Ga0501048_0195551 | 3300049582 | Bacteria | 1434 |
| 1517 | Ga0501048_0371157 | 3300049582 | Bacteria | 1021 |
| 1518 | Ga0501048_0405454 | 3300049582 | Bacteria | 975 |
| 1519 | Ga0501067_0044703 | 3300049583 | Bacteria | 2460 |
| 1520 | Ga0501067_0117104 | 3300049583 | Bacteria | 1482 |
| 1521 | Ga0501067_0202144 | 3300049583 | Bacteria | 1107 |
| 1522 | Ga0501068_0070612 | 3300049584 | Bacteria | 2130 |
| 1523 | Ga0501068_0264327 | 3300049584 | Bacteria | 1098 |
| 1524 | Ga0501069_0046105 | 3300049585 | Bacteria | 2417 |
| 1525 | Ga0501070_0003185 | 3300049586 | Bacteria | 14271 |
| 1526 | Ga0501070_0004846 | 3300049586 | Bacteria | 11495 |
| 1527 | Ga0501070_0027193 | 3300049586 | Bacteria | 4799 |
| 1528 | Ga0501070_0056684 | 3300049586 | Bacteria | 3248 |
| 1529 | Ga0501070_0097024 | 3300049586 | Bacteria | 2438 |
| 1530 | Ga0501070_0113855 | 3300049586 | Bacteria | 2235 |
| 1531 | Ga0501070_0172111 | 3300049586 | Bacteria | 1783 |
| 1532 | Ga0501070_0471341 | 3300049586 | Bacteria | 1011 |
| 1533 | Ga0501070_0580399 | 3300049586 | Bacteria | 895 |
| 1534 | Ga0501071_0050634 | 3300049587 | Bacteria | 2992 |
| 1535 | Ga0501071_0095714 | 3300049587 | Bacteria | 2185 |
| 1536 | Ga0501071_0216273 | 3300049587 | Bacteria | 1442 |
| 1537 | Ga0501071_0424840 | 3300049587 | Bacteria | 1016 |
| 1538 | Ga0501072_0030502 | 3300049588 | Bacteria | 4218 |
| 1539 | Ga0501072_0067915 | 3300049588 | Bacteria | 2813 |
| 1540 | Ga0501072_0071741 | 3300049588 | Bacteria | 2737 |
| 1541 | Ga0501072_0099576 | 3300049588 | Bacteria | 2311 |
| 1542 | Ga0501072_0106645 | 3300049588 | Bacteria | 2228 |
| 1543 | Ga0501072_0356005 | 3300049588 | Bacteria | 1162 |
| 1544 | Ga0501072_0420071 | 3300049588 | Bacteria | 1060 |
| 1545 | Ga0501073_0029987 | 3300049589 | Bacteria | 3885 |
| 1546 | Ga0501073_0057334 | 3300049589 | Bacteria | 2723 |
| 1547 | Ga0501073_0192902 | 3300049589 | Bacteria | 1410 |
| 1548 | Ga0501073_0261578 | 3300049589 | Bacteria | 1194 |
| 1549 | Ga0501073_0281551 | 3300049589 | Bacteria | 1147 |
| 1550 | Ga0501073_0546123 | 3300049589 | Bacteria | 801 |
| 1551 | Ga0501074_0060566 | 3300049590 | Bacteria | 2727 |
| 1552 | Ga0501074_0073296 | 3300049590 | Bacteria | 2460 |
| 1553 | Ga0501074_0180182 | 3300049590 | Bacteria | 1507 |
| 1554 | Ga0501074_0575730 | 3300049590 | Bacteria | 797 |
| 1555 | Ga0501075_0004734 | 3300049591 | Bacteria | 9250 |
| 1556 | Ga0501075_0005155 | 3300049591 | Bacteria | 8937 |
| 1557 | Ga0501075_0098564 | 3300049591 | Bacteria | 2219 |
| 1558 | Ga0501075_0124053 | 3300049591 | Bacteria | 1966 |
| 1559 | Ga0501075_0125334 | 3300049591 | Bacteria | 1955 |
| 1560 | Ga0501075_0161886 | 3300049591 | Bacteria | 1707 |
| 1561 | Ga0501076_0001405 | 3300049592 | Bacteria | 16125 |
| 1562 | Ga0501076_0216486 | 3300049592 | Bacteria | 1566 |
| 1563 | Ga0501076_0420225 | 3300049592 | Bacteria | 1100 |
| 1564 | Ga0501077_0007341 | 3300049593 | Bacteria | 6798 |
| 1565 | Ga0501077_0034622 | 3300049593 | Bacteria | 3214 |
| 1566 | Ga0501077_0105319 | 3300049593 | Bacteria | 1788 |
| 1567 | Ga0501077_0183791 | 3300049593 | Bacteria | 1328 |
| 1568 | Ga0501077_0282036 | 3300049593 | Bacteria | 1058 |
| 1569 | Ga0501077_0378527 | 3300049593 | Bacteria | 904 |
| 1570 | Ga0501079_0003233 | 3300049741 | Bacteria | 11932 |
| 1571 | Ga0501079_0040616 | 3300049741 | Bacteria | 3589 |
| 1572 | Ga0501079_0118163 | 3300049741 | Bacteria | 2061 |
| 1573 | Ga0501079_0173252 | 3300049741 | Bacteria | 1682 |
| 1574 | Ga0501079_0498850 | 3300049741 | Bacteria | 957 |
| 1575 | Ga0501080_0021206 | 3300049742 | Bacteria | 6013 |
| 1576 | Ga0501080_0028713 | 3300049742 | Bacteria | 5178 |
| 1577 | Ga0501080_0064534 | 3300049742 | Bacteria | 3405 |
| 1578 | Ga0501080_0083911 | 3300049742 | Bacteria | 2960 |
| 1579 | Ga0501080_0096741 | 3300049742 | Bacteria | 2741 |
| 1580 | Ga0501080_0140519 | 3300049742 | Bacteria | 2233 |
| 1581 | Ga0501080_0259554 | 3300049742 | Bacteria | 1583 |
| 1582 | Ga0501080_0260592 | 3300049742 | Bacteria | 1580 |
| 1583 | Ga0501080_0284670 | 3300049742 | Bacteria | 1502 |
| 1584 | Ga0501080_0504713 | 3300049742 | Bacteria | 1081 |
| 1585 | Ga0501081_0001767 | 3300049743 | Bacteria | 13415 |
| 1586 | Ga0501081_0010499 | 3300049743 | Bacteria | 6045 |
| 1587 | Ga0501081_0010888 | 3300049743 | Bacteria | 5945 |
| 1588 | Ga0501081_0038168 | 3300049743 | Bacteria | 3280 |
| 1589 | Ga0501081_0055859 | 3300049743 | Bacteria | 2728 |
| 1590 | Ga0501081_0400901 | 3300049743 | Bacteria | 1015 |
| 1591 | Ga0501083_0057931 | 3300049744 | Bacteria | 2593 |
| 1592 | Ga0501083_0104465 | 3300049744 | Bacteria | 1866 |
| 1593 | Ga0501083_0240612 | 3300049744 | Bacteria | 1178 |
| 1594 | Ga0501035_0000127 | 3300049822 | Bacteria | 92397 |
| 1595 | Ga0501035_0005073 | 3300049822 | Bacteria | 12482 |
| 1596 | Ga0501035_0022579 | 3300049822 | Bacteria | 5779 |
| 1597 | Ga0501035_0025523 | 3300049822 | Bacteria | 5416 |
| 1598 | Ga0501035_0068477 | 3300049822 | Bacteria | 3147 |
| 1599 | Ga0501035_0294443 | 3300049822 | Bacteria | 1369 |
| 1600 | Ga0501044_0001312 | 3300049823 | Bacteria | 29308 |
| 1601 | Ga0501044_0008177 | 3300049823 | Bacteria | 11483 |
| 1602 | Ga0501044_0023098 | 3300049823 | Bacteria | 6621 |
| 1603 | Ga0501044_0030205 | 3300049823 | Bacteria | 5712 |
| 1604 | Ga0501044_0088157 | 3300049823 | Bacteria | 3133 |
| 1605 | Ga0501044_0117406 | 3300049823 | Bacteria | 2664 |
| 1606 | Ga0501044_0147701 | 3300049823 | Bacteria | 2335 |
| 1607 | Ga0501044_0163053 | 3300049823 | Bacteria | 2204 |
| 1608 | Ga0501044_0281404 | 3300049823 | Bacteria | 1597 |
| 1609 | Ga0501044_0309288 | 3300049823 | Bacteria | 1507 |
| 1610 | Ga0501045_0018155 | 3300049824 | Bacteria | 4999 |
| 1611 | Ga0501045_0026472 | 3300049824 | Bacteria | 4172 |
| 1612 | Ga0501045_0089530 | 3300049824 | Bacteria | 2273 |
| 1613 | nmdc:mga03683_4783_c1 | 3300050489 | Bacteria | 4521 |
| 1614 | nmdc:mga00v17_196983_c1 | 3300050491 | Bacteria | 1302 |
| 1615 | nmdc:mga00v17_4490_c1 | 3300050491 | Bacteria | 7264 |
| 1616 | nmdc:mga0yw44_114460_c1 | 3300050492 | Bacteria | 1274 |
| 1617 | nmdc:mga0yw44_23841_c1 | 3300050492 | Bacteria | 3453 |
| 1618 | nmdc:mga0yw44_89401_c1 | 3300050492 | Bacteria | 1943 |
| 1619 | nmdc:mga0k408_2408_c1 | 3300050493 | Bacteria | 9952 |
| 1620 | nmdc:mga06z11_124102_c1 | 3300050494 | Bacteria | 1443 |
| 1621 | nmdc:mga06z11_137595_c1 | 3300050494 | Bacteria | 1377 |
| 1622 | nmdc:mga06z11_23201_c1 | 3300050494 | Bacteria | 2911 |
| 1623 | nmdc:mga06z11_343661_c1 | 3300050494 | Bacteria | 892 |
| 1624 | nmdc:mga06z11_70741_c1 | 3300050494 | Bacteria | 1845 |
| 1625 | nmdc:mga04h51_83923_c1 | 3300050495 | Bacteria | 1135 |
| 1626 | nmdc:mga05p37_108365_c1 | 3300050507 | Bacteria | 3417 |
| 1627 | nmdc:mga05p37_148901_c1 | 3300050507 | Bacteria | 2865 |
| 1628 | nmdc:mga05p37_1808_c2 | 3300050507 | Bacteria | 13333 |
| 1629 | nmdc:mga05p37_450398_c1 | 3300050507 | Bacteria | 1490 |
| 1630 | nmdc:mga05p37_45950_c1 | 3300050507 | Bacteria | 5370 |
| 1631 | nmdc:mga05p37_508_c2 | 3300050507 | Bacteria | 7955 |
| 1632 | nmdc:mga05p37_75031_c1 | 3300050507 | Bacteria | 4163 |
| 1633 | nmdc:mga05p37_90850_c1 | 3300050507 | Bacteria | 3763 |
| 1634 | nmdc:mga09592_141748_c1 | 3300050508 | Bacteria | 2072 |
| 1635 | nmdc:mga09592_30039_c1 | 3300050508 | Bacteria | 4523 |
| 1636 | nmdc:mga09592_469785_c1 | 3300050508 | Bacteria | 1084 |
| 1637 | nmdc:mga09592_5057_c1 | 3300050508 | Bacteria | 10702 |
| 1638 | nmdc:mga09592_92656_c1 | 3300050508 | Bacteria | 2583 |
| 1639 | nmdc:mga0qj67_115940_c1 | 3300050509 | Bacteria | 2165 |
| 1640 | nmdc:mga0qj67_119224_c1 | 3300050509 | Bacteria | 2134 |
| 1641 | nmdc:mga0qj67_130809_c1 | 3300050509 | Bacteria | 2033 |
| 1642 | nmdc:mga0qj67_15510_c1 | 3300050509 | Bacteria | 5769 |
| 1643 | nmdc:mga0qj67_169352_c1 | 3300050509 | Bacteria | 1773 |
| 1644 | nmdc:mga0qj67_52_c1 | 3300050509 | Bacteria | 84067 |
| 1645 | nmdc:mga0qj67_72452_c1 | 3300050509 | Bacteria | 2751 |
| 1646 | nmdc:mga06r32_105218_c1 | 3300050510 | Bacteria | 2772 |
| 1647 | nmdc:mga06r32_146979_c1 | 3300050510 | Bacteria | 2334 |
| 1648 | nmdc:mga06r32_1960_c1 | 3300050510 | Bacteria | 18367 |
| 1649 | nmdc:mga06r32_230180_c1 | 3300050510 | Bacteria | 1841 |
| 1650 | nmdc:mga06r32_236166_c1 | 3300050510 | Bacteria | 1816 |
| 1651 | nmdc:mga06r32_33897_c1 | 3300050510 | Bacteria | 4812 |
| 1652 | nmdc:mga06r32_3441_c1 | 3300050510 | Bacteria | 14162 |
| 1653 | nmdc:mga06r32_34449_c1 | 3300050510 | Bacteria | 4774 |
| 1654 | nmdc:mga06r32_489666_c1 | 3300050510 | Bacteria | 1207 |
| 1655 | nmdc:mga06r32_53801_c1 | 3300050510 | Bacteria | 3858 |
| 1656 | nmdc:mga08y16_14675_c1 | 3300050511 | Bacteria | 8238 |
| 1657 | nmdc:mga08y16_2332_c1 | 3300050511 | Bacteria | 19466 |
| 1658 | nmdc:mga08y16_283486_c1 | 3300050511 | Bacteria | 1708 |
| 1659 | nmdc:mga08y16_290441_c1 | 3300050511 | Bacteria | 1686 |
| 1660 | nmdc:mga08y16_30278_c1 | 3300050511 | Bacteria | 5698 |
| 1661 | nmdc:mga08y16_3146_c1 | 3300050511 | Bacteria | 17090 |
| 1662 | nmdc:mga08y16_3939_c1 | 3300050511 | Bacteria | 15466 |
| 1663 | nmdc:mga08y16_63381_c1 | 3300050511 | Bacteria | 3860 |
| 1664 | nmdc:mga08y16_75718_c1 | 3300050511 | Bacteria | 3508 |
| 1665 | nmdc:mga08y16_8982_c1 | 3300050511 | Bacteria | 10497 |
| 1666 | nmdc:mga08y16_9215_c1 | 3300050511 | Bacteria | 10357 |
| 1667 | nmdc:mga0n895_145_c1 | 3300050512 | Bacteria | 43408 |
| 1668 | nmdc:mga0n895_159698_c1 | 3300050512 | Bacteria | 2285 |
| 1669 | nmdc:mga0n895_193711_c1 | 3300050512 | Bacteria | 2064 |
| 1670 | nmdc:mga0n895_336958_c1 | 3300050512 | Bacteria | 1528 |
| 1671 | nmdc:mga0n895_37534_c1 | 3300050512 | Bacteria | 4688 |
| 1672 | nmdc:mga0n895_414424_c1 | 3300050512 | Bacteria | 1362 |
| 1673 | nmdc:mga0n895_4696_c1 | 3300050512 | Bacteria | 11271 |
| 1674 | nmdc:mga0n895_475845_c1 | 3300050512 | Bacteria | 1260 |
| 1675 | nmdc:mga0n895_620401_c1 | 3300050512 | Bacteria | 1082 |
| 1676 | nmdc:mga0n895_69426_c1 | 3300050512 | Bacteria | 3491 |
| 1677 | nmdc:mga0n895_697_c1 | 3300050512 | Bacteria | 23592 |
| 1678 | nmdc:mga0n895_79449_c1 | 3300050512 | Bacteria | 3267 |
| 1679 | nmdc:mga0rr50_115821_c1 | 3300050513 | Bacteria | 2127 |
| 1680 | nmdc:mga0rr50_161239_c1 | 3300050513 | Bacteria | 1820 |
| 1681 | nmdc:mga0rr50_1966_c1 | 3300050513 | Bacteria | 11411 |
| 1682 | nmdc:mga0rr50_25674_c1 | 3300050513 | Bacteria | 4099 |
| 1683 | nmdc:mga0rr50_2684_c1 | 3300050513 | Bacteria | 10078 |
| 1684 | nmdc:mga0rr50_26927_c1 | 3300050513 | Bacteria | 4020 |
| 1685 | nmdc:mga0rr50_42859_c1 | 3300050513 | Bacteria | 3308 |
| 1686 | nmdc:mga0rr50_48815_c1 | 3300050513 | Bacteria | 3131 |
| 1687 | nmdc:mga0rr50_59705_c1 | 3300050513 | Bacteria | 2865 |
| 1688 | nmdc:mga0rr50_617932_c1 | 3300050513 | Bacteria | 924 |
| 1689 | nmdc:mga08x19_1133_c1 | 3300050514 | Bacteria | 16621 |
| 1690 | nmdc:mga08x19_116183_c1 | 3300050514 | Bacteria | 1789 |
| 1691 | nmdc:mga08x19_24255_c1 | 3300050514 | Bacteria | 3768 |
| 1692 | nmdc:mga08x19_274819_c1 | 3300050514 | Bacteria | 1166 |
| 1693 | nmdc:mga08x19_291574_c1 | 3300050514 | Bacteria | 1132 |
| 1694 | nmdc:mga08x19_33203_c1 | 3300050514 | Bacteria | 3256 |
| 1695 | nmdc:mga08x19_33421_c1 | 3300050514 | Bacteria | 3246 |
| 1696 | nmdc:mga08x19_386216_c1 | 3300050514 | Bacteria | 981 |
| 1697 | nmdc:mga08x19_3872_c1 | 3300050514 | Bacteria | 8905 |
| 1698 | nmdc:mga0a205_127802_c1 | 3300050515 | Bacteria | 1639 |
| 1699 | nmdc:mga0a205_17080_c2 | 3300050515 | Bacteria | 3784 |
| 1700 | nmdc:mga0a205_18201_c1 | 3300050515 | Bacteria | 6599 |
| 1701 | nmdc:mga0a205_1921_c1 | 3300050515 | Bacteria | 18059 |
| 1702 | nmdc:mga0a205_2724_c1 | 3300050515 | Bacteria | 15622 |
| 1703 | nmdc:mga0a205_297338_c1 | 3300050515 | Bacteria | 1488 |
| 1704 | nmdc:mga0a205_435226_c1 | 3300050515 | Bacteria | 1173 |
| 1705 | nmdc:mga0a205_44400_c1 | 3300050515 | Bacteria | 4284 |
| 1706 | Ga0495601_0000008 | 3300053077 | Bacteria | 362152 |
| 1707 | Ga0495601_0001042 | 3300053077 | Bacteria | 15154 |
| 1708 | Ga0495601_0001925 | 3300053077 | Bacteria | 11619 |
| 1709 | Ga0495601_0004619 | 3300053077 | Bacteria | 7965 |
| 1710 | Ga0495601_0029283 | 3300053077 | Bacteria | 3414 |
| 1711 | Ga0495601_0044685 | 3300053077 | Bacteria | 2784 |
| 1712 | Ga0495601_0094550 | 3300053077 | Bacteria | 1926 |
| 1713 | Ga0495601_0096670 | 3300053077 | Bacteria | 1905 |
| 1714 | Ga0495601_0113370 | 3300053077 | Bacteria | 1757 |
| 1715 | Ga0495601_0460018 | 3300053077 | Bacteria | 822 |
| 1716 | Ga0495612_0000026 | 3300053078 | Bacteria | 111627 |
| 1717 | Ga0495612_0000308 | 3300053078 | Bacteria | 19880 |
| 1718 | Ga0495612_0000858 | 3300053078 | Bacteria | 12361 |
| 1719 | Ga0495612_0012643 | 3300053078 | Bacteria | 3403 |
| 1720 | Ga0495612_0032977 | 3300053078 | Bacteria | 2094 |
| 1721 | Ga0495612_0140718 | 3300053078 | Bacteria | 1046 |
| 1722 | Ga0495595_0000024 | 3300053084 | Bacteria | 108008 |
| 1723 | Ga0495595_0000879 | 3300053084 | Bacteria | 11535 |
| 1724 | Ga0495595_0006336 | 3300053084 | Bacteria | 4819 |
| 1725 | Ga0495595_0010002 | 3300053084 | Bacteria | 3933 |
| 1726 | Ga0495595_0011017 | 3300053084 | Bacteria | 3773 |
| 1727 | Ga0495595_0014880 | 3300053084 | Bacteria | 3308 |
| 1728 | Ga0495595_0031159 | 3300053084 | Bacteria | 2395 |
| 1729 | Ga0495619_0000002 | 3300053085 | Bacteria | 530226 |
| 1730 | Ga0495619_0000229 | 3300053085 | Bacteria | 40785 |
| 1731 | Ga0495619_0001598 | 3300053085 | Bacteria | 14888 |
| 1732 | Ga0495619_0002881 | 3300053085 | Bacteria | 11182 |
| 1733 | Ga0495619_0005795 | 3300053085 | Bacteria | 7828 |
| 1734 | Ga0495619_0013992 | 3300053085 | Bacteria | 5062 |
| 1735 | Ga0495619_0018217 | 3300053085 | Bacteria | 4453 |
| 1736 | Ga0500643_009516 | 3300053087 | Bacteria | 3706 |
| 1737 | Ga0500651_0022942 | 3300053093 | Bacteria | 3904 |
| 1738 | Ga0500651_0180041 | 3300053093 | Bacteria | 1256 |
| 1739 | Ga0500566_0094479 | 3300053094 | Bacteria | 1648 |
| 1740 | Ga0500641_0020457 | 3300053096 | Bacteria | 2513 |
| 1741 | Ga0500562_056036 | 3300053108 | Bacteria | 1057 |
| 1742 | Ga0500562_057978 | 3300053108 | Bacteria | 1039 |
| 1743 | Ga0500595_000010 | 3300053119 | Bacteria | 275806 |
| 1744 | Ga0500595_014685 | 3300053119 | Bacteria | 2964 |
| 1745 | Ga0500595_048037 | 3300053119 | Bacteria | 1334 |
| 1746 | Ga0500616_0000001 | 3300053153 | Bacteria | 1986011 |
| 1747 | Ga0500616_0061428 | 3300053153 | Bacteria | 1945 |
| 1748 | Ga0500616_0062798 | 3300053153 | Bacteria | 1917 |
| 1749 | Ga0500616_0065607 | 3300053153 | Bacteria | 1866 |
| 1750 | Ga0500645_000015 | 3300053730 | Bacteria | 150140 |
| 1751 | Ga0501084_0057017 | 3300054114 | Bacteria | 3269 |
| 1752 | Ga0501084_0068704 | 3300054114 | Bacteria | 2966 |
| 1753 | Ga0501084_0077346 | 3300054114 | Bacteria | 2790 |
| 1754 | Ga0501084_0147838 | 3300054114 | Bacteria | 1979 |
| 1755 | Ga0501084_0150596 | 3300054114 | Bacteria | 1961 |
| 1756 | Ga0501084_0370135 | 3300054114 | Bacteria | 1211 |
| 1757 | Ga0501084_0450370 | 3300054114 | Bacteria | 1088 |
| 1758 | Ga0590071_011869 | 3300059421 | Bacteria | 2040 |
| 1759 | Ga0590075_021489 | 3300059424 | Bacteria | 1611 |
| 1760 | Ga0590077_005770 | 3300059426 | Bacteria | 2536 |
| 1761 | Ga0501082_0000013 | 3300060353 | Bacteria | 119623 |
| 1762 | Ga0501082_0013431 | 3300060353 | Bacteria | 7039 |
| 1763 | Ga0501082_0015413 | 3300060353 | Bacteria | 6579 |
| 1764 | Ga0501082_0052731 | 3300060353 | Bacteria | 3506 |
| 1765 | Ga0501082_0060268 | 3300060353 | Bacteria | 3268 |
| 1766 | Ga0501082_0112665 | 3300060353 | Bacteria | 2355 |
| 1767 | Ga0501082_0398927 | 3300060353 | Bacteria | 1200 |
| 1768 | Ga0530510_0000596 | 3300061734 | Bacteria | 23255 |
| 1769 | Ga0530510_0092868 | 3300061734 | Bacteria | 2203 |
| 1770 | Ga0530510_0111429 | 3300061734 | Bacteria | 2004 |
| 1771 | Ga0530510_0220076 | 3300061734 | Bacteria | 1411 |
| 1772 | Ga0530510_0419855 | 3300061734 | Bacteria | 1009 |
| 1773 | Ga0157374_10130183 | |||
| 1774 | 2214772980 | |||
| 1775 | ARcpr5oldR_c000026 | |||
| 1776 | ARSoilYngRDRAFT_c00029 | |||
| 1777 | ARcpr5yngRDRAFT_c000044 | |||
| 1778 | ARSoilOldRDRAFT_c000037 | |||
| 1779 | ARCol0oldRDRAFT_c01671 | |||
| 1780 | ARCol0yngRDRAFT_1000020 | |||
| 1781 | JGI24746J21847_1005093 | |||
| 1782 | JGI24747J21853_1006822 | |||
| 1783 | JGI24740J21852_10036806 | |||
| 1784 | JGI24739J22299_10004550 | |||
| 1785 | JGI24739J22299_10008850 | |||
| 1786 | JGI24737J22298_10001930 | |||
| 1787 | JGI24743J22301_10003452 | |||
| 1788 | JGI24750J21931_1000586 | |||
| 1789 | JGI24745J21846_1000864 | |||
| 1790 | JGI24749J21850_1001223 | |||
| 1791 | JGI24744J21845_10000745 | |||
| 1792 | JGI24035J26624_1001145 | |||
| 1793 | JGI24742J22300_10000139 | |||
| 1794 | JGI24751J29686_10015704 | |||
| 1795 | JGI25406J46586_10009736 | |||
| 1796 | JGI25153J46596_10002462 | |||
| 1797 | JGI25405J52794_10004616 | |||
| 1798 | Ga0065716_1001673 | |||
| 1799 | Ga0065712_10071735 | |||
| 1800 | Ga0065712_10077193 | |||
| 1801 | Ga0065715_10038352 | |||
| 1802 | Ga0065715_10092917 | |||
| 1803 | Ga0065715_10113387 | |||
| 1804 | Ga0070658_10021114 | |||
| 1805 | Ga0070658_10048153 | |||
| 1806 | Ga0070658_10191350 | |||
| 1807 | Ga0070676_10001078 | |||
| 1808 | Ga0070676_10079340 | |||
| 1809 | Ga0070676_10107334 | |||
| 1810 | Ga0070676_10188872 | |||
| 1811 | Ga0070683_100007390 | |||
| 1812 | Ga0070683_100138777 | |||
| 1813 | Ga0070683_100228105 | |||
| 1814 | Ga0070683_100400610 | |||
| 1815 | Ga0070690_100076879 | |||
| 1816 | Ga0070690_100104406 | |||
| 1817 | Ga0070690_100193295 | |||
| 1818 | Ga0070690_100303803 | |||
| 1819 | Ga0070670_100037546 | |||
| 1820 | Ga0070670_100215578 | |||
| 1821 | Ga0068869_100051408 | |||
| 1822 | Ga0068869_100176034 | |||
| 1823 | Ga0068869_100193995 | |||
| 1824 | Ga0070666_10162832 | |||
| 1825 | Ga0070680_100004715 | |||
| 1826 | Ga0070680_100021923 | |||
| 1827 | Ga0070680_100026870 | |||
| 1828 | Ga0070680_100094650 | |||
| 1829 | Ga0070682_100001091 | |||
| 1830 | Ga0070682_100048274 | |||
| 1831 | Ga0070682_100108168 | |||
| 1832 | Ga0068868_100037790 | |||
| 1833 | Ga0068868_100305139 | |||
| 1834 | Ga0070660_100001398 | |||
| 1835 | Ga0070660_100058854 | |||
| 1836 | Ga0070660_100189907 | |||
| 1837 | Ga0070660_100219760 | |||
| 1838 | Ga0070660_100244998 | |||
| 1839 | Ga0070660_100249932 | |||
| 1840 | Ga0070660_100409626 | |||
| 1841 | Ga0070660_100418893 | |||
| 1842 | Ga0070689_100008504 | |||
| 1843 | Ga0070689_100017677 | |||
| 1844 | Ga0070689_100063151 | |||
| 1845 | Ga0070689_100086925 | |||
| 1846 | Ga0070689_100138970 | |||
| 1847 | Ga0070689_100316812 | |||
| 1848 | Ga0070689_100488322 | |||
| 1849 | Ga0070691_10000769 | |||
| 1850 | Ga0070691_10205457 | |||
| 1851 | Ga0070687_100177502 | |||
| 1852 | Ga0070687_100206503 | |||
| 1853 | Ga0070687_100209803 | |||
| 1854 | Ga0070661_100001076 | |||
| 1855 | Ga0070661_100061169 | |||
| 1856 | Ga0070661_100061862 | |||
| 1857 | Ga0070661_100187879 | |||
| 1858 | Ga0070692_10015532 | |||
| 1859 | Ga0070692_10210532 | |||
| 1860 | Ga0070668_100012317 | |||
| 1861 | Ga0070668_100330193 | |||
| 1862 | Ga0070668_100415475 | |||
| 1863 | Ga0070669_100005888 | |||
| 1864 | Ga0070669_100045834 | |||
| 1865 | Ga0070669_100129722 | |||
| 1866 | Ga0070669_100141434 | |||
| 1867 | Ga0070669_100161681 | |||
| 1868 | Ga0070675_100000727 | |||
| 1869 | Ga0070675_100189878 | |||
| 1870 | Ga0070671_100000438 | |||
| 1871 | Ga0070671_100017456 | |||
| 1872 | Ga0070671_100018195 | |||
| 1873 | Ga0070671_100146871 | |||
| 1874 | Ga0070674_100001976 | |||
| 1875 | Ga0070674_100023669 | |||
| 1876 | Ga0070674_100076955 | |||
| 1877 | Ga0070673_100001186 | |||
| 1878 | Ga0070673_100064845 | |||
| 1879 | Ga0070673_100086664 | |||
| 1880 | Ga0070673_100231226 | |||
| 1881 | Ga0070688_100022325 | |||
| 1882 | Ga0070688_100064296 | |||
| 1883 | Ga0070688_100082189 | |||
| 1884 | Ga0070688_100116948 | |||
| 1885 | Ga0070688_100170191 | |||
| 1886 | Ga0070659_100005874 | |||
| 1887 | Ga0070659_100058285 | |||
| 1888 | Ga0070659_100159515 | |||
| 1889 | Ga0070667_100005963 | |||
| 1890 | Ga0070667_100150888 | |||
| 1891 | Ga0070667_100329662 | |||
| 1892 | Ga0070703_10002528 | |||
| 1893 | Ga0070703_10014584 | |||
| 1894 | Ga0070703_10027328 | |||
| 1895 | Ga0070709_10015469 | |||
| 1896 | Ga0070709_10089303 | |||
| 1897 | Ga0070709_10199392 | |||
| 1898 | Ga0070709_10223114 | |||
| 1899 | Ga0070714_100085977 | |||
| 1900 | Ga0070714_100111046 | |||
| 1901 | Ga0070714_100258646 | |||
| 1902 | Ga0070714_100623688 | |||
| 1903 | Ga0070713_100005553 | |||
| 1904 | Ga0070713_100015791 | |||
| 1905 | Ga0070713_100028859 | |||
| 1906 | Ga0070713_100108048 | |||
| 1907 | Ga0070713_100296394 | |||
| 1908 | Ga0070710_10010566 | |||
| 1909 | Ga0070710_10082207 | |||
| 1910 | Ga0070701_10000339 | |||
| 1911 | Ga0070701_10238564 | |||
| 1912 | Ga0070711_100027442 | |||
| 1913 | Ga0070711_100073831 | |||
| 1914 | Ga0070711_100090812 | |||
| 1915 | Ga0070711_100146211 | |||
| 1916 | Ga0070711_100163297 | |||
| 1917 | Ga0070711_100384579 | |||
| 1918 | Ga0070705_100000010 | |||
| 1919 | Ga0070705_100005352 | |||
| 1920 | Ga0070700_100000783 | |||
| 1921 | Ga0070700_100076044 | |||
| 1922 | Ga0070700_100203189 | |||
| 1923 | Ga0070700_100337910 | |||
| 1924 | Ga0070700_100417352 | |||
| 1925 | Ga0070694_100006633 | |||
| 1926 | Ga0070694_100155140 | |||
| 1927 | Ga0070694_100183756 | |||
| 1928 | Ga0070708_100179279 | |||
| 1929 | Ga0070708_100249728 | |||
| 1930 | Ga0070663_100017471 | |||
| 1931 | Ga0070663_100025858 | |||
| 1932 | Ga0070663_100028384 | |||
| 1933 | Ga0070663_100033005 | |||
| 1934 | Ga0070678_100011564 | |||
| 1935 | Ga0070678_100054346 | |||
| 1936 | Ga0070678_100160180 | |||
| 1937 | Ga0070678_100401004 | |||
| 1938 | Ga0070662_100017941 | |||
| 1939 | Ga0070662_100093667 | |||
| 1940 | Ga0070662_100103866 | |||
| 1941 | Ga0070662_100176643 | |||
| 1942 | Ga0070662_100253104 | |||
| 1943 | Ga0070681_10013836 | |||
| 1944 | Ga0070681_10051242 | |||
| 1945 | Ga0070681_10070525 | |||
| 1946 | Ga0070681_10089994 | |||
| 1947 | Ga0070681_10133426 | |||
| 1948 | Ga0070681_10457310 | |||
| 1949 | Ga0070681_10502254 | |||
| 1950 | Ga0068867_100047346 | |||
| 1951 | Ga0068867_100277257 | |||
| 1952 | Ga0068867_100504535 | |||
| 1953 | Ga0068867_100552296 | |||
| 1954 | Ga0070685_10005962 | |||
| 1955 | Ga0070685_10022940 | |||
| 1956 | Ga0070685_10023443 | |||
| 1957 | Ga0070685_10164789 | |||
| 1958 | Ga0070707_100232584 | |||
| 1959 | Ga0070699_100001314 | |||
| 1960 | Ga0070699_100010423 | |||
| 1961 | Ga0070699_100318041 | |||
| 1962 | Ga0070679_100021002 | |||
| 1963 | Ga0070679_100034318 | |||
| 1964 | Ga0070679_100056408 | |||
| 1965 | Ga0070679_100127315 | |||
| 1966 | Ga0070679_100212152 | |||
| 1967 | Ga0070679_100222677 | |||
| 1968 | Ga0070679_100348569 | |||
| 1969 | Ga0070679_100457082 | |||
| 1970 | Ga0070684_100142264 | |||
| 1971 | Ga0070684_100326179 | |||
| 1972 | Ga0070684_100345226 | |||
| 1973 | Ga0070697_100039300 | |||
| 1974 | Ga0070697_100236973 | |||
| 1975 | Ga0068853_100004375 | |||
| 1976 | Ga0070672_100011149 | |||
| 1977 | Ga0070672_100022463 | |||
| 1978 | Ga0070686_100006762 | |||
| 1979 | Ga0070686_100262531 | |||
| 1980 | Ga0070695_100001719 | |||
| 1981 | Ga0070695_100030227 | |||
| 1982 | Ga0070696_100002812 | |||
| 1983 | Ga0070696_100029222 | |||
| 1984 | Ga0070696_100045814 | |||
| 1985 | Ga0070696_100246747 | |||
| 1986 | Ga0070693_100000577 | |||
| 1987 | Ga0070693_100010134 | |||
| 1988 | Ga0070693_100023786 | |||
| 1989 | Ga0070693_100131349 | |||
| 1990 | Ga0070665_100076321 | |||
| 1991 | Ga0070665_100199540 | |||
| 1992 | Ga0070665_100231865 | |||
| 1993 | Ga0070704_100013846 | |||
| 1994 | Ga0070704_100028556 | |||
| 1995 | Ga0070704_100126371 | |||
| 1996 | Ga0068855_100014148 | |||
| 1997 | Ga0068855_100031300 | |||
| 1998 | Ga0068855_100409055 | |||
| 1999 | Ga0068855_100462066 | |||
| 2000 | Ga0070664_100002073 | |||
| 2001 | Ga0070664_100070153 | |||
| 2002 | Ga0070664_100076795 | |||
| 2003 | Ga0070664_100145042 | |||
| 2004 | Ga0070664_100167671 | |||
| 2005 | Ga0070664_100175888 | |||
| 2006 | Ga0070664_100268699 | |||
| 2007 | Ga0070664_100341265 | |||
| 2008 | Ga0070664_100374759 | |||
| 2009 | Ga0068857_100008536 | |||
| 2010 | Ga0068857_100011549 | |||
| 2011 | Ga0068857_100622489 | |||
| 2012 | Ga0068854_100001074 | |||
| 2013 | Ga0068854_100074407 | |||
| 2014 | Ga0068854_100581300 | |||
| 2015 | Ga0068856_100026335 | |||
| 2016 | Ga0068856_100039625 | |||
| 2017 | Ga0068856_100475444 | |||
| 2018 | Ga0068856_100485250 | |||
| 2019 | Ga0068856_100554185 | |||
| 2020 | Ga0070702_100005245 | |||
| 2021 | Ga0070702_100023173 | |||
| 2022 | Ga0070702_100184462 | |||
| 2023 | Ga0070702_100258096 | |||
| 2024 | Ga0070702_100269451 | |||
| 2025 | Ga0068852_100001086 | |||
| 2026 | Ga0068852_100054483 | |||
| 2027 | Ga0068852_100284846 | |||
| 2028 | Ga0068852_100436738 | |||
| 2029 | Ga0068859_100023234 | |||
| 2030 | Ga0068859_100087792 | |||
| 2031 | Ga0068859_100104533 | |||
| 2032 | Ga0068859_100108837 | |||
| 2033 | Ga0068859_100161472 | |||
| 2034 | Ga0068859_100242104 | |||
| 2035 | Ga0068859_100825794 | |||
| 2036 | Ga0068864_100021486 | |||
| 2037 | Ga0068864_100025772 | |||
| 2038 | Ga0068864_100053465 | |||
| 2039 | Ga0068864_100070454 | |||
| 2040 | Ga0068864_100197788 | |||
| 2041 | Ga0068866_10000403 | |||
| 2042 | Ga0068866_10083848 | |||
| 2043 | Ga0068866_10089937 | |||
| 2044 | Ga0068866_10152188 | |||
| 2045 | Ga0068861_100001047 | |||
| 2046 | Ga0068861_100112392 | |||
| 2047 | Ga0068870_10000860 | |||
| 2048 | Ga0068870_10087983 | |||
| 2049 | Ga0068863_100003728 | |||
| 2050 | Ga0068863_100184737 | |||
| 2051 | Ga0068863_100248601 | |||
| 2052 | Ga0068858_100032605 | |||
| 2053 | Ga0068858_100051742 | |||
| 2054 | Ga0068858_100098651 | |||
| 2055 | Ga0068858_100201782 | |||
| 2056 | Ga0068858_100391148 | |||
| 2057 | Ga0068858_100398192 | |||
| 2058 | Ga0068860_100013440 | |||
| 2059 | Ga0068860_100023327 | |||
| 2060 | Ga0068860_100223447 | |||
| 2061 | Ga0068862_100003043 | |||
| 2062 | Ga0068862_100024080 | |||
| 2063 | Ga0068862_100216773 | |||
| 2064 | Ga0068862_100223767 | |||
| 2065 | Ga0068862_100242962 | |||
| 2066 | Ga0081455_10000012 | |||
| 2067 | Ga0081455_10003284 | |||
| 2068 | Ga0081455_10007017 | |||
| 2069 | Ga0081455_10007967 | |||
| 2070 | Ga0081455_10016936 | |||
| 2071 | Ga0081455_10054157 | |||
| 2072 | Ga0081455_10186527 | |||
| 2073 | Ga0081538_10017736 | |||
| 2074 | Ga0081538_10018338 | |||
| 2075 | Ga0081538_10068602 | |||
| 2076 | Ga0081540_1000185 | |||
| 2077 | Ga0081540_1002413 | |||
| 2078 | Ga0081540_1005241 | |||
| 2079 | Ga0081540_1011112 | |||
| 2080 | Ga0081539_10008542 | |||
| 2081 | Ga0070717_10007114 | |||
| 2082 | Ga0070717_10010759 | |||
| 2083 | Ga0070717_10635447 | |||
| 2084 | Ga0075365_10040270 | |||
| 2085 | Ga0075365_10054308 | |||
| 2086 | Ga0075365_10118964 | |||
| 2087 | Ga0075365_10133288 | |||
| 2088 | Ga0075365_10256126 | |||
| 2089 | Ga0075368_10034063 | |||
| 2090 | Ga0075368_10125050 | |||
| 2091 | Ga0075363_100033082 | |||
| 2092 | Ga0075364_10008816 | |||
| 2093 | Ga0075364_10057317 | |||
| 2094 | Ga0075432_10001490 | |||
| 2095 | Ga0075432_10043086 | |||
| 2096 | Ga0070715_10015144 | |||
| 2097 | Ga0070716_100047381 | |||
| 2098 | Ga0070712_100001328 | |||
| 2099 | Ga0070712_100025089 | |||
| 2100 | Ga0070712_100227496 | |||
| 2101 | Ga0070712_100449611 | |||
| 2102 | Ga0075362_10014874 | |||
| 2103 | Ga0075362_10171211 | |||
| 2104 | Ga0075367_10039470 | |||
| 2105 | Ga0075367_10124156 | |||
| 2106 | Ga0075367_10186253 | |||
| 2107 | Ga0075367_10408182 | |||
| 2108 | Ga0075369_10016633 | |||
| 2109 | Ga0075427_10001112 | |||
| 2110 | Ga0075366_10001687 | |||
| 2111 | Ga0097621_100000421 | |||
| 2112 | Ga0097621_100008029 | |||
| 2113 | Ga0075370_10163989 | |||
| 2114 | Ga0068871_100000515 | |||
| 2115 | Ga0068871_100012948 | |||
| 2116 | Ga0075428_100007282 | |||
| 2117 | Ga0075428_100013216 | |||
| 2118 | Ga0075428_100068287 | |||
| 2119 | Ga0075428_100069359 | |||
| 2120 | Ga0075428_100099013 | |||
| 2121 | Ga0075428_100124513 | |||
| 2122 | Ga0075428_100124758 | |||
| 2123 | Ga0075428_100245919 | |||
| 2124 | Ga0075428_100598426 | |||
| 2125 | Ga0075430_100000223 | |||
| 2126 | Ga0075430_100021979 | |||
| 2127 | Ga0075430_100028858 | |||
| 2128 | Ga0075430_100285844 | |||
| 2129 | Ga0075431_100001810 | |||
| 2130 | Ga0075431_100002413 | |||
| 2131 | Ga0075431_100072177 | |||
| 2132 | Ga0075431_100143787 | |||
| 2133 | Ga0075431_100505165 | |||
| 2134 | Ga0075433_10002034 | |||
| 2135 | Ga0075433_10006137 | |||
| 2136 | Ga0075433_10008633 | |||
| 2137 | Ga0075433_10036232 | |||
| 2138 | Ga0075433_10062911 | |||
| 2139 | Ga0075433_10270158 | |||
| 2140 | Ga0075434_100000007 | |||
| 2141 | Ga0075434_100000693 | |||
| 2142 | Ga0075434_100001159 | |||
| 2143 | Ga0075434_100005025 | |||
| 2144 | Ga0075434_100020496 | |||
| 2145 | Ga0075434_100038594 | |||
| 2146 | Ga0075434_100082088 | |||
| 2147 | Ga0075434_100096480 | |||
| 2148 | Ga0075434_100152317 | |||
| 2149 | Ga0075434_100577216 | |||
| 2150 | Ga0075429_100004783 | |||
| 2151 | Ga0075429_100006663 | |||
| 2152 | Ga0075429_100021886 | |||
| 2153 | Ga0075429_100026387 | |||
| 2154 | Ga0075429_100119201 | |||
| 2155 | Ga0075429_100271459 | |||
| 2156 | Ga0075429_100353876 | |||
| 2157 | Ga0068865_100002115 | |||
| 2158 | Ga0075436_100002192 | |||
| 2159 | Ga0075436_100014836 | |||
| 2160 | Ga0075436_100037473 | |||
| 2161 | Ga0075436_100052910 | |||
| 2162 | Ga0075436_100116949 | |||
| 2163 | Ga0075436_100155144 | |||
| 2164 | Ga0097620_100023234 | |||
| 2165 | Ga0097620_100087787 | |||
| 2166 | Ga0097620_100104537 | |||
| 2167 | Ga0097620_100108838 | |||
| 2168 | Ga0097620_100161476 | |||
| 2169 | Ga0097620_100242115 | |||
| 2170 | Ga0097620_100825766 | |||
| 2171 | Ga0075435_100000432 | |||
| 2172 | Ga0075435_100025823 | |||
| 2173 | Ga0075435_100039209 | |||
| 2174 | Ga0075435_100049630 | |||
| 2175 | Ga0075435_100149194 | |||
| 2176 | Ga0075435_100698182 | |||
| 2177 | Ga0099794_10018222 | |||
| 2178 | Ga0105251_10040087 | |||
| 2179 | Ga0105240_10037315 | |||
| 2180 | Ga0105240_10146994 | |||
| 2181 | Ga0111539_10004448 | |||
| 2182 | Ga0111539_10005607 | |||
| 2183 | Ga0111539_10013539 | |||
| 2184 | Ga0111539_10017591 | |||
| 2185 | Ga0111539_10019998 | |||
| 2186 | Ga0111539_10022696 | |||
| 2187 | Ga0111539_10108411 | |||
| 2188 | Ga0111539_10146086 | |||
| 2189 | Ga0111539_10197563 | |||
| 2190 | Ga0111539_10358184 | |||
| 2191 | Ga0111539_10409294 | |||
| 2192 | Ga0111539_10642777 | |||
| 2193 | Ga0111539_11070617 | |||
| 2194 | Ga0105245_10069147 | |||
| 2195 | Ga0105245_10183449 | |||
| 2196 | Ga0105245_10536001 | |||
| 2197 | Ga0105247_10011296 | |||
| 2198 | Ga0105247_10012837 | |||
| 2199 | Ga0105247_10135646 | |||
| 2200 | Ga0114129_10000742 | |||
| 2201 | Ga0114129_10008001 | |||
| 2202 | Ga0114129_10059035 | |||
| 2203 | Ga0114129_10065278 | |||
| 2204 | Ga0114129_10072693 | |||
| 2205 | Ga0114129_10097190 | |||
| 2206 | Ga0114129_10105879 | |||
| 2207 | Ga0114129_10148174 | |||
| 2208 | Ga0114129_10240682 | |||
| 2209 | Ga0114129_10260479 | |||
| 2210 | Ga0105243_10002574 | |||
| 2211 | Ga0105243_10011951 | |||
| 2212 | Ga0105243_10209355 | |||
| 2213 | Ga0105243_10319277 | |||
| 2214 | Ga0105243_10774371 | |||
| 2215 | Ga0105241_10110703 | |||
| 2216 | Ga0105241_10111008 | |||
| 2217 | Ga0105241_10235651 | |||
| 2218 | Ga0105242_10056433 | |||
| 2219 | Ga0105242_10282850 | |||
| 2220 | Ga0105248_10000821 | |||
| 2221 | Ga0105248_10076409 | |||
| 2222 | Ga0105248_10084997 | |||
| 2223 | Ga0105248_10121013 | |||
| 2224 | Ga0105248_10196174 | |||
| 2225 | Ga0105248_10204882 | |||
| 2226 | Ga0105248_10451642 | |||
| 2227 | Ga0105237_10128596 | |||
| 2228 | Ga0105237_10262560 | |||
| 2229 | Ga0105238_10009936 | |||
| 2230 | Ga0105238_10011216 | |||
| 2231 | Ga0105238_10535685 | |||
| 2232 | Ga0105238_10732457 | |||
| 2233 | Ga0105249_10015879 | |||
| 2234 | Ga0105249_10017602 | |||
| 2235 | Ga0105249_10084737 | |||
| 2236 | Ga0105249_10319768 | |||
| 2237 | Ga0099796_10005153 | |||
| 2238 | Ga0105239_10004537 | |||
| 2239 | Ga0105239_10196874 | |||
| 2240 | Ga0105239_10405567 | |||
| 2241 | Ga0105239_10698425 | |||
| 2242 | Ga0105246_10001092 | |||
| 2243 | Ga0105246_10097849 | |||
| 2244 | Ga0105246_10147153 | |||
| 2245 | Ga0157335_1001913 | |||
| 2246 | Ga0157345_1001831 | |||
| 2247 | Ga0157316_1006538 | |||
| 2248 | Ga0157338_1014273 | |||
| 2249 | Ga0157373_10188691 | |||
| 2250 | Ga0157373_10239296 | |||
| 2251 | Ga0157373_10448647 | |||
| 2252 | Ga0157371_10007315 | |||
| 2253 | Ga0157371_10248820 | |||
| 2254 | Ga0157370_10158470 | |||
| 2255 | Ga0157370_10180697 | |||
| 2256 | Ga0157369_10312214 | |||
| 2257 | Ga0157369_10870663 | |||
| 2258 | Ga0157374_10002049 | |||
| 2259 | Ga0157374_10032857 | |||
| 2260 | Ga0157374_10527076 | |||
| 2261 | Ga0157378_10007541 | |||
| 2262 | Ga0157378_10213406 | |||
| 2263 | Ga0157378_10229704 | |||
| 2264 | Ga0157378_10312686 | |||
| 2265 | Ga0157378_10325547 | |||
| 2266 | Ga0157378_10573049 | |||
| 2267 | Ga0163162_10005029 | |||
| 2268 | Ga0163162_10077208 | |||
| 2269 | Ga0163162_10077995 | |||
| 2270 | Ga0163162_10218623 | |||
| 2271 | Ga0157372_10012748 | |||
| 2272 | Ga0157372_10343424 | |||
| 2273 | Ga0157372_11036284 | |||
| 2274 | Ga0157375_10005227 | |||
| 2275 | Ga0157375_10019784 | |||
| 2276 | Ga0157375_10180264 | |||
| 2277 | Ga0157375_10191934 | |||
| 2278 | Ga0157375_10207198 | |||
| 2279 | Ga0157375_10538422 | |||
| 2280 | Ga0163163_10005574 | |||
| 2281 | Ga0163163_10084887 | |||
| 2282 | Ga0157380_10001279 | |||
| 2283 | Ga0157380_10167974 | |||
| 2284 | Ga0157380_10726026 | |||
| 2285 | Ga0157377_10000312 | |||
| 2286 | Ga0157377_10284684 | |||
| 2287 | Ga0157379_10001989 | |||
| 2288 | Ga0157379_10029559 | |||
| 2289 | Ga0157379_10063884 | |||
| 2290 | Ga0157379_10387290 | |||
| 2291 | Ga0157376_10001372 | |||
| 2292 | Ga0157376_10019925 | |||
| 2293 | Ga0157376_10054749 | |||
| 2294 | Ga0157376_10440512 | |||
| 2295 | Ga0163161_10003480 | |||
| 2296 | Ga0213872_10111987 | |||
| 2297 | Ga0224572_1013150 | |||
| 2298 | Ga0228598_1016476 | |||
| 2299 | Ga0207666_1000038 | |||
| 2300 | Ga0207666_1000670 | |||
| 2301 | Ga0209758_1000079 | |||
| 2302 | Ga0207697_10000373 | |||
| 2303 | Ga0207656_10080070 | |||
| 2304 | Ga0207653_10000559 | |||
| 2305 | Ga0207653_10005254 | |||
| 2306 | Ga0207653_10009753 | |||
| 2307 | Ga0207682_10000071 | |||
| 2308 | Ga0207692_10010499 | |||
| 2309 | Ga0207692_10051167 | |||
| 2310 | Ga0207692_10076273 | |||
| 2311 | Ga0207692_10080845 | |||
| 2312 | Ga0207642_10004072 | |||
| 2313 | Ga0207710_10007122 | |||
| 2314 | Ga0207710_10018719 | |||
| 2315 | Ga0207710_10125777 | |||
| 2316 | Ga0207688_10000237 | |||
| 2317 | Ga0207688_10002075 | |||
| 2318 | Ga0207688_10062115 | |||
| 2319 | Ga0207680_10016997 | |||
| 2320 | Ga0207680_10037949 | |||
| 2321 | Ga0207647_10009005 | |||
| 2322 | Ga0207647_10064700 | |||
| 2323 | Ga0207647_10080366 | |||
| 2324 | Ga0207685_10043200 | |||
| 2325 | Ga0207699_10073451 | |||
| 2326 | Ga0207699_10126789 | |||
| 2327 | Ga0207645_10000779 | |||
| 2328 | Ga0207645_10027896 | |||
| 2329 | Ga0207645_10036138 | |||
| 2330 | Ga0207645_10093669 | |||
| 2331 | Ga0207643_10000276 | |||
| 2332 | Ga0207643_10002314 | |||
| 2333 | Ga0207643_10032530 | |||
| 2334 | Ga0207705_10077767 | |||
| 2335 | Ga0207705_10103433 | |||
| 2336 | Ga0207705_10223975 | |||
| 2337 | Ga0207684_10119069 | |||
| 2338 | Ga0207654_10014702 | |||
| 2339 | Ga0207654_10093334 | |||
| 2340 | Ga0207654_10361226 | |||
| 2341 | Ga0207707_10000454 | |||
| 2342 | Ga0207707_10069691 | |||
| 2343 | Ga0207707_10070862 | |||
| 2344 | Ga0207707_10080459 | |||
| 2345 | Ga0207707_10207864 | |||
| 2346 | Ga0207707_10236855 | |||
| 2347 | Ga0207707_10361291 | |||
| 2348 | Ga0207695_10213968 | |||
| 2349 | Ga0207671_10016484 | |||
| 2350 | Ga0207671_10037376 | |||
| 2351 | Ga0207671_10211283 | |||
| 2352 | Ga0207693_10005073 | |||
| 2353 | Ga0207693_10007312 | |||
| 2354 | Ga0207693_10010113 | |||
| 2355 | Ga0207693_10010718 | |||
| 2356 | Ga0207693_10021275 | |||
| 2357 | Ga0207693_10031132 | |||
| 2358 | Ga0207693_10073450 | |||
| 2359 | Ga0207693_10097721 | |||
| 2360 | Ga0207663_10072881 | |||
| 2361 | Ga0207663_10118857 | |||
| 2362 | Ga0207663_10141582 | |||
| 2363 | Ga0207663_10166343 | |||
| 2364 | Ga0207663_10183783 | |||
| 2365 | Ga0207663_10247050 | |||
| 2366 | Ga0207660_10000087 | |||
| 2367 | Ga0207660_10018065 | |||
| 2368 | Ga0207660_10035293 | |||
| 2369 | Ga0207660_10065427 | |||
| 2370 | Ga0207660_10107168 | |||
| 2371 | Ga0207660_10398957 | |||
| 2372 | Ga0207662_10000659 | |||
| 2373 | Ga0207662_10009020 | |||
| 2374 | Ga0207662_10022432 | |||
| 2375 | Ga0207662_10108986 | |||
| 2376 | Ga0207662_10244695 | |||
| 2377 | Ga0207657_10003101 | |||
| 2378 | Ga0207657_10005173 | |||
| 2379 | Ga0207657_10035321 | |||
| 2380 | Ga0207657_10090738 | |||
| 2381 | Ga0207657_10189285 | |||
| 2382 | Ga0207657_10440634 | |||
| 2383 | Ga0207649_10000662 | |||
| 2384 | Ga0207649_10039165 | |||
| 2385 | Ga0207652_10001908 | |||
| 2386 | Ga0207652_10008147 | |||
| 2387 | Ga0207652_10023549 | |||
| 2388 | Ga0207652_10111416 | |||
| 2389 | Ga0207652_10133337 | |||
| 2390 | Ga0207652_10257875 | |||
| 2391 | Ga0207652_10323990 | |||
| 2392 | Ga0207652_10385849 | |||
| 2393 | Ga0207652_10576436 | |||
| 2394 | Ga0207681_10001262 | |||
| 2395 | Ga0207681_10151297 | |||
| 2396 | Ga0207681_10253399 | |||
| 2397 | Ga0207694_10017984 | |||
| 2398 | Ga0207694_10044775 | |||
| 2399 | Ga0207694_10182297 | |||
| 2400 | Ga0207694_10435899 | |||
| 2401 | Ga0207650_10005107 | |||
| 2402 | Ga0207650_10015020 | |||
| 2403 | Ga0207650_10097382 | |||
| 2404 | Ga0207650_10178535 | |||
| 2405 | Ga0207659_10000143 | |||
| 2406 | Ga0207659_10026549 | |||
| 2407 | Ga0207659_10145896 | |||
| 2408 | Ga0207687_10000865 | |||
| 2409 | Ga0207687_10030379 | |||
| 2410 | Ga0207687_10052245 | |||
| 2411 | Ga0207687_10122905 | |||
| 2412 | Ga0207687_10246166 | |||
| 2413 | Ga0207700_10000323 | |||
| 2414 | Ga0207700_10276966 | |||
| 2415 | Ga0207700_10293094 | |||
| 2416 | Ga0207664_10075293 | |||
| 2417 | Ga0207664_10092332 | |||
| 2418 | Ga0207664_10104335 | |||
| 2419 | Ga0207664_10337725 | |||
| 2420 | Ga0207664_10388968 | |||
| 2421 | Ga0207664_10403389 | |||
| 2422 | Ga0207644_10000532 | |||
| 2423 | Ga0207644_10042290 | |||
| 2424 | Ga0207644_10243525 | |||
| 2425 | Ga0207644_10378619 | |||
| 2426 | Ga0207690_10000409 | |||
| 2427 | Ga0207690_10127841 | |||
| 2428 | Ga0207690_10269905 | |||
| 2429 | Ga0207706_10001338 | |||
| 2430 | Ga0207706_10006705 | |||
| 2431 | Ga0207706_10058641 | |||
| 2432 | Ga0207706_10138699 | |||
| 2433 | Ga0207706_10300810 | |||
| 2434 | Ga0207686_10000500 | |||
| 2435 | Ga0207686_10042200 | |||
| 2436 | Ga0207686_10097295 | |||
| 2437 | Ga0207686_10141181 | |||
| 2438 | Ga0207686_10322567 | |||
| 2439 | Ga0207709_10001266 | |||
| 2440 | Ga0207709_10037338 | |||
| 2441 | Ga0207709_10062539 | |||
| 2442 | Ga0207709_10131293 | |||
| 2443 | Ga0207670_10007354 | |||
| 2444 | Ga0207670_10016040 | |||
| 2445 | Ga0207670_10207631 | |||
| 2446 | Ga0207670_10229327 | |||
| 2447 | Ga0207670_10249011 | |||
| 2448 | Ga0207669_10001125 | |||
| 2449 | Ga0207669_10015259 | |||
| 2450 | Ga0207669_10397944 | |||
| 2451 | Ga0207669_10539886 | |||
| 2452 | Ga0207704_10000613 | |||
| 2453 | Ga0207704_10075416 | |||
| 2454 | Ga0207704_10266244 | |||
| 2455 | Ga0207665_10001192 | |||
| 2456 | Ga0207665_10003934 | |||
| 2457 | Ga0207665_10052253 | |||
| 2458 | Ga0207665_10133806 | |||
| 2459 | Ga0207665_10327524 | |||
| 2460 | Ga0207691_10002493 | |||
| 2461 | Ga0207691_10003339 | |||
| 2462 | Ga0207691_10024434 | |||
| 2463 | Ga0207691_10130622 | |||
| 2464 | Ga0207691_10193211 | |||
| 2465 | Ga0207711_10003987 | |||
| 2466 | Ga0207711_10029326 | |||
| 2467 | Ga0207711_10032877 | |||
| 2468 | Ga0207711_10041693 | |||
| 2469 | Ga0207711_10050370 | |||
| 2470 | Ga0207711_10162221 | |||
| 2471 | Ga0207711_10469127 | |||
| 2472 | Ga0207689_10000440 | |||
| 2473 | Ga0207689_10021598 | |||
| 2474 | Ga0207689_10064489 | |||
| 2475 | Ga0207689_10065413 | |||
| 2476 | Ga0207689_10248080 | |||
| 2477 | Ga0207689_10445733 | |||
| 2478 | Ga0207661_10059018 | |||
| 2479 | Ga0207661_10061762 | |||
| 2480 | Ga0207661_10320955 | |||
| 2481 | Ga0207679_10000131 | |||
| 2482 | Ga0207679_10016049 | |||
| 2483 | Ga0207679_10203794 | |||
| 2484 | Ga0207667_10088810 | |||
| 2485 | Ga0207667_10092846 | |||
| 2486 | Ga0207667_10724036 | |||
| 2487 | Ga0207651_10000335 | |||
| 2488 | Ga0207651_10298458 | |||
| 2489 | Ga0207712_10002448 | |||
| 2490 | Ga0207712_10004065 | |||
| 2491 | Ga0207712_10030909 | |||
| 2492 | Ga0207712_10048380 | |||
| 2493 | Ga0207712_10305140 | |||
| 2494 | Ga0207712_10395616 | |||
| 2495 | Ga0207668_10000065 | |||
| 2496 | Ga0207668_10100099 | |||
| 2497 | Ga0207640_10000339 | |||
| 2498 | Ga0207640_10031052 | |||
| 2499 | Ga0207640_10086417 | |||
| 2500 | Ga0207658_10004428 | |||
| 2501 | Ga0207658_10034444 | |||
| 2502 | Ga0207677_10003580 | |||
| 2503 | Ga0207677_10458159 | |||
| 2504 | Ga0207703_10001885 | |||
| 2505 | Ga0207703_10056702 | |||
| 2506 | Ga0207703_10124556 | |||
| 2507 | Ga0207703_10141154 | |||
| 2508 | Ga0207703_10413126 | |||
| 2509 | Ga0207703_10423763 | |||
| 2510 | Ga0207639_10041384 | |||
| 2511 | Ga0207639_10209690 | |||
| 2512 | Ga0207639_10436969 | |||
| 2513 | Ga0207678_10000944 | |||
| 2514 | Ga0207678_10006342 | |||
| 2515 | Ga0207678_10019284 | |||
| 2516 | Ga0207678_10036592 | |||
| 2517 | Ga0207678_10056937 | |||
| 2518 | Ga0207678_10058587 | |||
| 2519 | Ga0207678_10086398 | |||
| 2520 | Ga0207678_10160477 | |||
| 2521 | Ga0207708_10002019 | |||
| 2522 | Ga0207708_10002166 | |||
| 2523 | Ga0207708_10041728 | |||
| 2524 | Ga0207708_10067796 | |||
| 2525 | Ga0207708_10206842 | |||
| 2526 | Ga0207708_10237196 | |||
| 2527 | Ga0207708_10419328 | |||
| 2528 | Ga0207702_10028991 | |||
| 2529 | Ga0207702_10056555 | |||
| 2530 | Ga0207641_10005810 | |||
| 2531 | Ga0207641_10085777 | |||
| 2532 | Ga0207641_10167384 | |||
| 2533 | Ga0207641_10179572 | |||
| 2534 | Ga0207641_10545589 | |||
| 2535 | Ga0207648_10004730 | |||
| 2536 | Ga0207648_10039268 | |||
| 2537 | Ga0207648_10049631 | |||
| 2538 | Ga0207676_10008134 | |||
| 2539 | Ga0207676_10100203 | |||
| 2540 | Ga0207676_10139552 | |||
| 2541 | Ga0207676_10151364 | |||
| 2542 | Ga0207676_10331087 | |||
| 2543 | Ga0207674_10003323 | |||
| 2544 | Ga0207674_10005364 | |||
| 2545 | Ga0207674_10100292 | |||
| 2546 | Ga0207674_10488334 | |||
| 2547 | Ga0207675_100000815 | |||
| 2548 | Ga0207675_100053907 | |||
| 2549 | Ga0207675_100291146 | |||
| 2550 | Ga0207675_100442262 | |||
| 2551 | Ga0207675_100476579 | |||
| 2552 | Ga0207683_10000001 | |||
| 2553 | Ga0207683_10027788 | |||
| 2554 | Ga0207683_10081084 | |||
| 2555 | Ga0207683_10132061 | |||
| 2556 | Ga0207683_10138555 | |||
| 2557 | Ga0207698_10051342 | |||
| 2558 | Ga0207698_10144287 | |||
| 2559 | Ga0207698_10192321 | |||
| 2560 | Ga0209967_1000489 | |||
| 2561 | Ga0209981_1000830 | |||
| 2562 | Ga0209995_1003461 | |||
| 2563 | Ga0209999_1003822 | |||
| 2564 | Ga0210002_1033724 | |||
| 2565 | Ga0209983_1030948 | |||
| 2566 | Ga0209588_1021817 | |||
| 2567 | Ga0209966_1000743 | |||
| 2568 | Ga0209998_10001042 | |||
| 2569 | Ga0209998_10002206 | |||
| 2570 | Ga0209813_10082809 | |||
| 2571 | Ga0209974_10065047 | |||
| 2572 | Ga0207428_10000172 | |||
| 2573 | Ga0207428_10000255 | |||
| 2574 | Ga0207428_10003313 | |||
| 2575 | Ga0207428_10013736 | |||
| 2576 | Ga0207428_10016308 | |||
| 2577 | Ga0207428_10058144 | |||
| 2578 | Ga0207428_10138752 | |||
| 2579 | Ga0207428_10178586 | |||
| 2580 | Ga0265357_1002134 | |||
| 2581 | Ga0268266_10020037 | |||
| 2582 | Ga0268266_10175367 | |||
| 2583 | Ga0268265_10009461 | |||
| 2584 | Ga0268265_10029653 | |||
| 2585 | Ga0268264_10001153 | |||
| 2586 | Ga0268264_10006938 | |||
| 2587 | Ga0268264_10330445 | |||
| 2588 | Ga0268264_10350221 | |||
| 2589 | Ga0268264_10353932 | |||
| 2590 | Ga0268264_10366967 | |||
| 2591 | Ga0265334_10075822 | |||
| 2592 | Ga0265338_10038131 | |||
| 2593 | Ga0265338_10038132 | |||
| 2594 | Ga0265760_10069529 | |||
| 2595 | Ga0265332_10085378 | |||
| 2596 | Ga0265325_10000320 | |||
| 2597 | Ga0265325_10000901 | |||
| 2598 | Ga0265325_10001624 | |||
| 2599 | Ga0265325_10013945 | |||
| 2600 | Ga0265325_10018886 | |||
| 2601 | Ga0265325_10022061 | |||
| 2602 | Ga0265325_10105494 | |||
| 2603 | Ga0265340_10053019 | |||
| 2604 | Ga0265340_10099607 | |||
| 2605 | Ga0265340_10216465 | |||
| 2606 | Ga0265339_10000091 | |||
| 2607 | Ga0265339_10000387 | |||
| 2608 | Ga0265339_10082085 | |||
| 2609 | Ga0265316_10222699 | |||
| 2610 | Ga0265316_10345461 | |||
| 2611 | Ga0307513_10169054 | |||
| 2612 | Ga0265313_10000850 | |||
| 2613 | Ga0265313_10001068 | |||
| 2614 | Ga0265313_10004004 | |||
| 2615 | Ga0265313_10006723 | |||
| 2616 | Ga0265313_10127706 | |||
| 2617 | Ga0265313_10174770 | |||
| 2618 | Ga0265314_10007897 | |||
| 2619 | Ga0265314_10024428 | |||
| 2620 | Ga0265342_10000196 | |||
| 2621 | Ga0265342_10024497 | |||
| 2622 | Ga0265342_10051287 | |||
| 2623 | Ga0307413_10105998 | |||
| 2624 | Ga0307406_10733410 | |||
| 2625 | Ga0307411_10044801 | |||
| 2626 | Ga0373930_0000014 | |||
| 2627 | Ga0373948_0000493 | |||
| 2628 | Ga0373948_0000950 | |||
| 2629 | Ga0373950_0000145 | |||
| 2630 | Ga0373950_0007552 | |||
| 2631 | Ga0373958_0000064 | |||
| 2632 | Ga0373958_0012499 | |||
| 2633 | Ga0373958_0015415 | |||
| 2634 | Ga0373958_0017715 | |||
| 2635 | Ga0373959_0005735 | |||
| 2636 | Ga0373959_0053195 | |||
| 2637 | Ga0373938_0001531 | |||
| 2638 | Ga0373938_0014379 | |||
| 2639 | Ga0373938_0037550 | |||
| 2640 | Ga0373938_0049817 | |||
| 2641 | Ga0373926_0017053 | |||
| 2642 | Ga0373926_0049141 | |||
| 2643 | Ga0373926_0084674 | |||
| 2644 | Ga0373928_0001389 | |||
| 2645 | Ga0373928_0007010 | |||
| 2646 | Ga0373929_0000101 | |||
| 2647 | Ga0373929_0002108 | |||
| 2648 | Ga0373929_0053362 | |||
| 2649 | Ga0373934_0010944 | |||
| 2650 | Ga0373940_0003765 | |||
| 2651 | Ga0373940_0041509 | |||
| 2652 | Ga0373940_0076050 | |||
| 2653 | Ga0373944_0007357 | |||
| 2654 | Ga0373944_0011177 | |||
| 2655 | Ga0373944_0013599 | |||
| 2656 | Ga0373944_0035961 | |||
| 2657 | Ga0373944_0045478 | |||
| 2658 | Ga0373944_0120512 | |||
| 2659 | Ga0373949_0000293 | |||
| 2660 | Ga0373949_0000952 | |||
| 2661 | Ga0373951_0000154 | |||
| 2662 | Ga0373951_0014795 | |||
| 2663 | Ga0373952_0000030 | |||
| 2664 | Ga0373952_0000920 | |||
| 2665 | Ga0373952_0023481 | |||
| 2666 | Ga0373952_0050550 | |||
| 2667 | Ga0373923_0010802 | |||
| 2668 | Ga0373932_0001243 | |||
| 2669 | Ga0373932_0049425 | |||
| 2670 | Ga0373936_0009974 | |||
| 2671 | Ga0373936_0017372 | |||
| 2672 | Ga0373936_0019684 | |||
| 2673 | Ga0373936_0029855 | |||
| 2674 | Ga0373936_0204465 | |||
| 2675 | Ga0373939_0000791 | |||
| 2676 | Ga0373939_0003691 | |||
| 2677 | Ga0373939_0004617 | |||
| 2678 | Ga0373939_0021740 | |||
| 2679 | Ga0373939_0024887 | |||
| 2680 | Ga0373941_0000050 | |||
| 2681 | Ga0373941_0085807 | |||
| 2682 | Ga0373945_0001214 | |||
| 2683 | Ga0373945_0005087 | |||
| 2684 | Ga0373945_0010311 | |||
| 2685 | Ga0373945_0010949 | |||
| 2686 | Ga0373945_0023434 | |||
| 2687 | Ga0373945_0030077 | |||
| 2688 | Ga0373953_0001444 | |||
| 2689 | Ga0373953_0013693 | |||
| 2690 | Ga0373954_0001943 | |||
| 2691 | Ga0373954_0008746 | |||
| 2692 | Ga0373954_0021614 | |||
| 2693 | Ga0373954_0023220 | |||
| 2694 | Ga0373954_0025068 | |||
| 2695 | Ga0373954_0137932 | |||
| 2696 | Ga0373956_0024897 | |||
| 2697 | Ga0373956_0044007 | |||
| 2698 | Ga0373957_0003309 | |||
| 2699 | Ga0373957_0005066 | |||
| 2700 | Ga0373957_0024044 | |||
| 2701 | Ga0373960_0003068 | |||
| 2702 | Ga0373960_0028479 | |||
| 2703 | Ga0373943_0000132 | |||
| 2704 | Ga0373943_0001792 | |||
| 2705 | Ga0373943_0006259 | |||
| 2706 | Ga0373943_0010229 | |||
| 2707 | Ga0373943_0014659 | |||
| 2708 | Ga0373943_0115598 | |||
| 2709 | Ga0373946_0000496 | |||
| 2710 | Ga0373946_0000760 | |||
| 2711 | Ga0373946_0001192 | |||
| 2712 | Ga0373946_0005660 | |||
| 2713 | Ga0373946_0007440 | |||
| 2714 | Ga0373946_0111178 | |||
| 2715 | Ga0373946_0159408 | |||
| 2716 | Ga0373955_0000779 | |||
| 2717 | Ga0373955_0005131 | |||
| 2718 | Ga0373955_0057467 | |||
| 2719 | Ga0373955_0067556 | |||
| 2720 | Ga0373955_0084642 | |||
| 2721 | Ga0373955_0127120 | |||
| 2722 | Ga0373955_0146766 | |||
| 2723 | Ga0373955_0270947 | |||
| 2724 | Ga0373942_0000073 | |||
| 2725 | Ga0373942_0025665 | |||
| 2726 | Ga0373942_0026622 | |||
| 2727 | Ga0373942_0061063 | |||
| 2728 | Ga0373942_0103677 | |||
| 2729 | Ga0373961_0000480 | |||
| 2730 | Ga0373961_0009096 | |||
| 2731 | Ga0373961_0081398 | |||
| 2732 | Ga0373962_0001214 | |||
| 2733 | Ga0373962_0001920 | |||
| 2734 | Ga0373962_0011212 | |||
| 2735 | Ga0373962_0023763 | |||
| 2736 | Ga0373962_0033854 | |||
| 2737 | Ga0373924_0039884 | |||
| 2738 | Ga0373924_0118510 | |||
| 2739 | Ga0373931_0000537 | |||
| 2740 | Ga0373931_0004302 | |||
| 2741 | Ga0373931_0006018 | |||
| 2742 | Ga0373931_0010273 | |||
| 2743 | Ga0373931_0023545 | |||
| 2744 | Ga0373931_0036666 | |||
| 2745 | Ga0373931_0108251 | |||
| 2746 | Ga0373931_0119575 | |||
| 2747 | Ga0373931_0129610 | |||
| 2748 | Ga0373935_0000053 | |||
| 2749 | Ga0373935_0001261 | |||
| 2750 | Ga0373935_0003568 | |||
| 2751 | Ga0373935_0006902 | |||
| 2752 | Ga0373935_0021565 | |||
| 2753 | Ga0373935_0046856 | |||
| 2754 | Ga0373935_0069841 | |||
| 2755 | Ga0373935_0130097 | |||
| 2756 | Ga0373935_0187924 | |||
| 2757 | Ga0373935_0574631 | |||
| 2758 | Ga0373927_0011111 | |||
| 2759 | Ga0373927_0035423 | |||
| 2760 | Ga0373927_0095761 | |||
| 2761 | Ga0373927_0116233 | |||
| 2762 | Ga0373927_0120334 | |||
| 2763 | Ga0373933_0001426 | |||
| 2764 | Ga0373933_0002786 | |||
| 2765 | Ga0373933_0021557 | |||
| 2766 | Ga0373933_0022272 | |||
| 2767 | Ga0373933_0051395 | |||
| 2768 | Ga0373947_0000239 | |||
| 2769 | Ga0373947_0000259 | |||
| 2770 | Ga0373947_0001656 | |||
| 2771 | Ga0373947_0008738 | |||
| 2772 | Ga0373947_0009288 | |||
| 2773 | Ga0373947_0013217 | |||
| 2774 | Ga0373947_0054577 | |||
| 2775 | Ga0373947_0065243 | |||
| 2776 | Ga0373947_0080997 | |||
| 2777 | Ga0373947_0169381 | |||
| 2778 | Ga0373937_0000030 | |||
| 2779 | Ga0373937_0000907 | |||
| 2780 | Ga0373937_0001504 | |||
| 2781 | Ga0373937_0003255 | |||
| 2782 | Ga0373937_0029085 | |||
| 2783 | Ga0373937_0036814 | |||
| 2784 | Ga0373937_0355286 | |||
| 2785 | Ga0373925_0000002 | |||
| 2786 | Ga0373925_0000706 | |||
| 2787 | Ga0373925_0019842 | |||
| 2788 | Ga0373925_0024207 | |||
| 2789 | Ga0373925_0036229 | |||
| 2790 | Ga0373925_0038812 | |||
| 2791 | Ga0373925_0057058 | |||
| 2792 | Ga0373925_0073022 | |||
| 2793 | Ga0373925_0178500 | |||
| 2794 | Ga0373925_0193557 | |||
| 2795 | Ga0373925_0644593 | |||
| 2796 | Ga0395899_0052594 | |||
| 2797 | Ga0395900_0009186 | |||
| 2798 | Ga0395900_0022366 | |||
| 2799 | Ga0395900_0108898 | |||
| 2800 | Ga0395898_0003941 | |||
| 2801 | Ga0395898_0024197 | |||
| 2802 | Ga0395898_0310833 | |||
| 2803 | Ga0395901_0014006 | |||
| 2804 | Ga0395901_0075175 | |||
| 2805 | Ga0395901_0161489 | |||
| 2806 | Ga0395901_0321676 | |||
| 2807 | Ga0242420_033121 | |||
| 2808 | Ga0436365_0109845 | |||
| 2809 | Ga0436365_0497354 | |||
| 2810 | Ga0436365_1614912 | |||
| 2811 | Ga0436363_0961840 | |||
| 2812 | Ga0439453_0002489 | |||
| 2813 | Ga0439461_0003514 | |||
| 2814 | Ga0451835_0493760 | |||
| 2815 | Ga0439441_022166 | |||
| 2816 | Ga0439443_000477 | |||
| 2817 | Ga0439462_0023808 | |||
| 2818 | Ga0439446_0001019 | |||
| 2819 | Ga0439446_0035914 | |||
| 2820 | Ga0439434_0002451 | |||
| 2821 | Ga0439435_0000002 | |||
| 2822 | Ga0439435_0000646 | |||
| 2823 | Ga0439435_0028486 | |||
| 2824 | Ga0439464_0034111 | |||
| 2825 | Ga0451577_0147580 | |||
| 2826 | Ga0466966_0016428 | |||
| 2827 | Ga0466966_0135867 | |||
| 2828 | Ga0466963_0013664 | |||
| 2829 | Ga0466963_0044109 | |||
| 2830 | Ga0466963_0190873 | |||
| 2831 | Ga0466963_0431546 | |||
| 2832 | Ga0453684_0283538 | |||
| 2833 | Ga0453684_0669787 | |||
| 2834 | Ga0466971_0008622 | |||
| 2835 | Ga0466971_0156124 | |||
| 2836 | Ga0466957_0034003 | |||
| 2837 | Ga0466957_0121630 | |||
| 2838 | Ga0466957_0373921 | |||
| 2839 | Ga0466959_0168004 | |||
| 2840 | Ga0451576_0017130 | |||
| 2841 | Ga0451576_0117936 | |||
| 2842 | Ga0466958_0171884 | |||
| 2843 | Ga0466958_0304967 | |||
| 2844 | Ga0466967_0000135 | |||
| 2845 | Ga0466967_0006741 | |||
| 2846 | Ga0466967_0416209 | |||
| 2847 | Ga0495617_038698 | |||
| 2848 | Ga0495592_0000046 | |||
| 2849 | Ga0495592_0001393 | |||
| 2850 | Ga0495592_0002484 | |||
| 2851 | Ga0495592_0071960 | |||
| 2852 | Ga0495592_0078729 | |||
| 2853 | Ga0495603_0001804 | |||
| 2854 | Ga0495603_0002249 | |||
| 2855 | Ga0495603_0008354 | |||
| 2856 | Ga0495603_0014184 | |||
| 2857 | Ga0495603_0090177 | |||
| 2858 | Ga0495603_0155645 | |||
| 2859 | Ga0495629_0000594 | |||
| 2860 | Ga0495629_0001140 | |||
| 2861 | Ga0495629_0002311 | |||
| 2862 | Ga0495629_0019080 | |||
| 2863 | Ga0495629_0088951 | |||
| 2864 | Ga0495629_0233255 | |||
| 2865 | Ga0495638_0003988 | |||
| 2866 | Ga0495638_0039767 | |||
| 2867 | Ga0495638_0244708 | |||
| 2868 | Ga0495638_0300939 | |||
| 2869 | Ga0495641_0007754 | |||
| 2870 | Ga0495641_0011331 | |||
| 2871 | Ga0495641_0017820 | |||
| 2872 | Ga0495651_0000822 | |||
| 2873 | Ga0495651_0004816 | |||
| 2874 | Ga0495651_0047233 | |||
| 2875 | Ga0495653_0000006 | |||
| 2876 | Ga0495653_0004798 | |||
| 2877 | Ga0495653_0024139 | |||
| 2878 | Ga0495653_0037925 | |||
| 2879 | Ga0495653_0290993 | |||
| 2880 | Ga0495580_0017640 | |||
| 2881 | Ga0495580_0034551 | |||
| 2882 | Ga0495580_0057444 | |||
| 2883 | Ga0495580_0074214 | |||
| 2884 | Ga0495582_0000379 | |||
| 2885 | Ga0495582_0010594 | |||
| 2886 | Ga0495582_0028169 | |||
| 2887 | Ga0495582_0161747 | |||
| 2888 | Ga0495639_0004321 | |||
| 2889 | Ga0495639_0038991 | |||
| 2890 | Ga0495639_0046773 | |||
| 2891 | Ga0495639_0067099 | |||
| 2892 | Ga0495662_0000084 | |||
| 2893 | Ga0495662_0002481 | |||
| 2894 | Ga0495662_0027194 | |||
| 2895 | Ga0495662_0051846 | |||
| 2896 | Ga0495662_0237944 | |||
| 2897 | Ga0495664_0000002 | |||
| 2898 | Ga0495664_0000112 | |||
| 2899 | Ga0495664_0007745 | |||
| 2900 | Ga0495664_0043029 | |||
| 2901 | Ga0495664_0050575 | |||
| 2902 | Ga0495584_0033756 | |||
| 2903 | Ga0495584_0048021 | |||
| 2904 | Ga0495585_0001932 | |||
| 2905 | Ga0495585_0196692 | |||
| 2906 | Ga0495594_0002726 | |||
| 2907 | Ga0495594_0009110 | |||
| 2908 | Ga0495594_0011284 | |||
| 2909 | Ga0495594_0247839 | |||
| 2910 | Ga0495607_0095599 | |||
| 2911 | Ga0495608_0000006 | |||
| 2912 | Ga0495608_0012927 | |||
| 2913 | Ga0495608_0017846 | |||
| 2914 | Ga0495608_0082397 | |||
| 2915 | Ga0495618_0000034 | |||
| 2916 | Ga0495618_0001016 | |||
| 2917 | Ga0495618_0001547 | |||
| 2918 | Ga0495618_0156557 | |||
| 2919 | Ga0495620_0073308 | |||
| 2920 | Ga0495628_0000002 | |||
| 2921 | Ga0495628_0003624 | |||
| 2922 | Ga0495628_0027943 | |||
| 2923 | Ga0495628_0032270 | |||
| 2924 | Ga0495628_0101756 | |||
| 2925 | Ga0495630_0000662 | |||
| 2926 | Ga0495630_0005622 | |||
| 2927 | Ga0495630_0015890 | |||
| 2928 | Ga0495630_0027968 | |||
| 2929 | Ga0495630_0042264 | |||
| 2930 | Ga0495637_0020521 | |||
| 2931 | Ga0495643_0130553 | |||
| 2932 | Ga0495644_0003085 | |||
| 2933 | Ga0495666_0001508 | |||
| 2934 | Ga0495666_0012392 | |||
| 2935 | Ga0495666_0034119 | |||
| 2936 | Ga0495666_0045397 | |||
| 2937 | Ga0495652_0000004 | |||
| 2938 | Ga0495652_0013904 | |||
| 2939 | Ga0495652_0019057 | |||
| 2940 | Ga0495652_0078363 | |||
| 2941 | Ga0495665_0003909 | |||
| 2942 | Ga0495665_0014689 | |||
| 2943 | Ga0495665_0084846 | |||
| 2944 | Ga0495665_0115799 | |||
| 2945 | Ga0495665_0123334 | |||
| 2946 | Ga0495665_0123478 | |||
| 2947 | Ga0495640_0000007 | |||
| 2948 | Ga0495640_0006199 | |||
| 2949 | Ga0495640_0008881 | |||
| 2950 | Ga0495640_0010455 | |||
| 2951 | Ga0495640_0050524 | |||
| 2952 | Ga0495640_0113463 | |||
| 2953 | Ga0495586_0032879 | |||
| 2954 | Ga0495586_0097810 | |||
| 2955 | Ga0495586_0177186 | |||
| 2956 | Ga0495587_0000031 | |||
| 2957 | Ga0495587_0002979 | |||
| 2958 | Ga0495587_0016339 | |||
| 2959 | Ga0495587_0179519 | |||
| 2960 | Ga0495598_0004396 | |||
| 2961 | Ga0495598_0050085 | |||
| 2962 | Ga0495609_0065459 | |||
| 2963 | Ga0495609_0132914 | |||
| 2964 | Ga0495645_0000003 | |||
| 2965 | Ga0495645_0005275 | |||
| 2966 | Ga0495645_0010875 | |||
| 2967 | Ga0495645_0011025 | |||
| 2968 | Ga0495645_0125919 | |||
| 2969 | Ga0495645_0128951 | |||
| 2970 | Ga0495622_0013050 | |||
| 2971 | Ga0495622_0049494 | |||
| 2972 | Ga0495633_0071043 | |||
| 2973 | Ga0495667_0000002 | |||
| 2974 | Ga0495667_0000202 | |||
| 2975 | Ga0495667_0000365 | |||
| 2976 | Ga0495667_0111739 | |||
| 2977 | Ga0495667_0188265 | |||
| 2978 | Ga0495667_0273622 | |||
| 2979 | Ga0495656_0000360 | |||
| 2980 | Ga0495634_0000533 | |||
| 2981 | Ga0495634_0003620 | |||
| 2982 | Ga0495634_0008544 | |||
| 2983 | Ga0495634_0021460 | |||
| 2984 | Ga0495611_0157480 | |||
| 2985 | Ga0495635_0000022 | |||
| 2986 | Ga0495635_0000981 | |||
| 2987 | Ga0495635_0004867 | |||
| 2988 | Ga0495635_0013894 | |||
| 2989 | Ga0495635_0081639 | |||
| 2990 | Ga0495659_0098745 | |||
| 2991 | Ga0495659_0117966 | |||
| 2992 | Ga0495661_0010683 | |||
| 2993 | Ga0495588_0019668 | |||
| 2994 | Ga0495588_0075208 | |||
| 2995 | Ga0495588_0090074 | |||
| 2996 | Ga0495588_0092431 | |||
| 2997 | Ga0495657_0000276 | |||
| 2998 | Ga0495657_0031463 | |||
| 2999 | Ga0495657_0045253 | |||
| 3000 | Ga0495599_0000001 | |||
| 3001 | Ga0495599_0002835 | |||
| 3002 | Ga0495599_0046540 | |||
| 3003 | Ga0495623_0000094 | |||
| 3004 | Ga0495623_0001448 | |||
| 3005 | Ga0495623_0204206 | |||
| 3006 | Ga0495646_0000007 | |||
| 3007 | Ga0495646_0002316 | |||
| 3008 | Ga0495646_0061367 | |||
| 3009 | Ga0495647_0000122 | |||
| 3010 | Ga0495647_0000393 | |||
| 3011 | Ga0495647_0001922 | |||
| 3012 | Ga0495647_0052367 | |||
| 3013 | Ga0495658_0000210 | |||
| 3014 | Ga0495658_0005298 | |||
| 3015 | Ga0495658_0009937 | |||
| 3016 | Ga0495658_0014265 | |||
| 3017 | Ga0495658_0026729 | |||
| 3018 | Ga0495658_0041879 | |||
| 3019 | Ga0495658_0148403 | |||
| 3020 | Ga0495658_0295200 | |||
| 3021 | Ga0495669_0028471 | |||
| 3022 | Ga0495669_0040626 | |||
| 3023 | Ga0495613_0018397 | |||
| 3024 | Ga0495613_0056650 | |||
| 3025 | Ga0495613_0083862 | |||
| 3026 | Ga0495613_0182607 | |||
| 3027 | Ga0495613_0288357 | |||
| 3028 | Ga0495624_0000222 | |||
| 3029 | Ga0495624_0001294 | |||
| 3030 | Ga0495624_0020416 | |||
| 3031 | Ga0495624_0034304 | |||
| 3032 | Ga0495624_0063300 | |||
| 3033 | Ga0495624_0091603 | |||
| 3034 | Ga0495624_0096687 | |||
| 3035 | Ga0495624_0184177 | |||
| 3036 | Ga0495670_0001624 | |||
| 3037 | Ga0495600_0000033 | |||
| 3038 | Ga0495600_0000506 | |||
| 3039 | Ga0495600_0002658 | |||
| 3040 | Ga0495600_0030323 | |||
| 3041 | Ga0495581_0005193 | |||
| 3042 | Ga0495581_0005649 | |||
| 3043 | Ga0495581_0020808 | |||
| 3044 | Ga0495581_0205382 | |||
| 3045 | Ga0495604_0000005 | |||
| 3046 | Ga0495604_0001089 | |||
| 3047 | Ga0495604_0002751 | |||
| 3048 | Ga0495604_0007025 | |||
| 3049 | Ga0495604_0082269 | |||
| 3050 | Ga0495674_0000003 | |||
| 3051 | Ga0495674_0001490 | |||
| 3052 | Ga0495674_0001513 | |||
| 3053 | Ga0495674_0014630 | |||
| 3054 | Ga0495674_0406574 | |||
| 3055 | Ga0495672_0127450 | |||
| 3056 | Ga0495672_0211159 | |||
| 3057 | Ga0495676_0000289 | |||
| 3058 | Ga0495676_0021676 | |||
| 3059 | Ga0495676_0079695 | |||
| 3060 | Ga0495676_0096501 | |||
| 3061 | Ga0495676_0130099 | |||
| 3062 | Ga0495676_0171305 | |||
| 3063 | Ga0495680_0000091 | |||
| 3064 | Ga0495680_0001414 | |||
| 3065 | Ga0495680_0012301 | |||
| 3066 | Ga0495680_0018026 | |||
| 3067 | Ga0495680_0037109 | |||
| 3068 | Ga0495680_0072323 | |||
| 3069 | Ga0495675_0000064 | |||
| 3070 | Ga0495675_0063292 | |||
| 3071 | Ga0495679_046890 | |||
| 3072 | Ga0495684_0000035 | |||
| 3073 | Ga0495684_0000075 | |||
| 3074 | Ga0495684_0000264 | |||
| 3075 | Ga0495684_0001309 | |||
| 3076 | Ga0495684_0041943 | |||
| 3077 | Ga0495684_0073421 | |||
| 3078 | Ga0495684_0128149 | |||
| 3079 | Ga0495684_0383201 | |||
| 3080 | Ga0495686_0172416 | |||
| 3081 | Ga0495593_0000228 | |||
| 3082 | Ga0495593_0001106 | |||
| 3083 | Ga0495593_0014059 | |||
| 3084 | Ga0495593_0020031 | |||
| 3085 | Ga0495602_0000029 | |||
| 3086 | Ga0495602_0002033 | |||
| 3087 | Ga0495602_0018847 | |||
| 3088 | Ga0495602_0460889 | |||
| 3089 | Ga0495614_0017130 | |||
| 3090 | Ga0495614_0024948 | |||
| 3091 | Ga0495614_0118009 | |||
| 3092 | Ga0496100_0000404 | |||
| 3093 | Ga0496100_0000823 | |||
| 3094 | Ga0496100_0006720 | |||
| 3095 | Ga0496100_0017884 | |||
| 3096 | Ga0496100_0032334 | |||
| 3097 | Ga0496100_0265535 | |||
| 3098 | Ga0496100_0305060 | |||
| 3099 | Ga0496100_0322698 | |||
| 3100 | Ga0496101_0000423 | |||
| 3101 | Ga0496101_0013330 | |||
| 3102 | Ga0496101_0051874 | |||
| 3103 | Ga0496101_0090963 | |||
| 3104 | Ga0496102_0003323 | |||
| 3105 | Ga0496102_0017907 | |||
| 3106 | Ga0496102_0050819 | |||
| 3107 | Ga0496102_0137970 | |||
| 3108 | Ga0496102_0216909 | |||
| 3109 | Ga0496102_0362586 | |||
| 3110 | Ga0496102_0443883 | |||
| 3111 | Ga0496102_0726698 | |||
| 3112 | Ga0496103_0000967 | |||
| 3113 | Ga0496103_0009318 | |||
| 3114 | Ga0496103_0023575 | |||
| 3115 | Ga0496103_0085283 | |||
| 3116 | Ga0496104_0000711 | |||
| 3117 | Ga0496104_0000925 | |||
| 3118 | Ga0496104_0005217 | |||
| 3119 | Ga0496104_0005466 | |||
| 3120 | Ga0496104_0014835 | |||
| 3121 | Ga0496104_0018532 | |||
| 3122 | Ga0496104_0018853 | |||
| 3123 | Ga0496104_0036022 | |||
| 3124 | Ga0496104_0037286 | |||
| 3125 | Ga0496104_0101035 | |||
| 3126 | Ga0496104_0144331 | |||
| 3127 | Ga0496104_0166636 | |||
| 3128 | Ga0496104_0181717 | |||
| 3129 | Ga0496104_0307758 | |||
| 3130 | Ga0496104_0319118 | |||
| 3131 | Ga0496105_0004562 | |||
| 3132 | Ga0496105_0010049 | |||
| 3133 | Ga0496105_0025218 | |||
| 3134 | Ga0496105_0055857 | |||
| 3135 | Ga0496105_0079464 | |||
| 3136 | Ga0496105_0081682 | |||
| 3137 | Ga0496105_0110294 | |||
| 3138 | Ga0496105_0172070 | |||
| 3139 | Ga0496105_0197097 | |||
| 3140 | Ga0496105_0213306 | |||
| 3141 | Ga0496105_0536570 | |||
| 3142 | Ga0496106_0002446 | |||
| 3143 | Ga0496106_0003669 | |||
| 3144 | Ga0496106_0005520 | |||
| 3145 | Ga0496106_0009344 | |||
| 3146 | Ga0496106_0015174 | |||
| 3147 | Ga0496106_0017560 | |||
| 3148 | Ga0496106_0046079 | |||
| 3149 | Ga0496106_0138098 | |||
| 3150 | Ga0496106_0204770 | |||
| 3151 | Ga0496106_0278662 | |||
| 3152 | Ga0496106_0346450 | |||
| 3153 | Ga0496107_0000500 | |||
| 3154 | Ga0496107_0021517 | |||
| 3155 | Ga0496107_0036271 | |||
| 3156 | Ga0496107_0046339 | |||
| 3157 | Ga0496107_0130304 | |||
| 3158 | Ga0496107_0194999 | |||
| 3159 | Ga0496107_0222895 | |||
| 3160 | Ga0496107_0265173 | |||
| 3161 | Ga0496108_0032769 | |||
| 3162 | Ga0496108_0039555 | |||
| 3163 | Ga0496108_0048346 | |||
| 3164 | Ga0496108_0086431 | |||
| 3165 | Ga0496108_0137032 | |||
| 3166 | Ga0496108_0227952 | |||
| 3167 | Ga0496109_0000340 | |||
| 3168 | Ga0496109_0000359 | |||
| 3169 | Ga0496109_0000976 | |||
| 3170 | Ga0496109_0005940 | |||
| 3171 | Ga0496109_0015600 | |||
| 3172 | Ga0496109_0017045 | |||
| 3173 | Ga0496109_0060588 | |||
| 3174 | Ga0496109_0142769 | |||
| 3175 | Ga0496109_0191932 | |||
| 3176 | Ga0496109_0367970 | |||
| 3177 | Ga0496109_0411173 | |||
| 3178 | Ga0496110_0002357 | |||
| 3179 | Ga0496110_0003362 | |||
| 3180 | Ga0496110_0014914 | |||
| 3181 | Ga0496110_0020674 | |||
| 3182 | Ga0496110_0022973 | |||
| 3183 | Ga0496110_0027384 | |||
| 3184 | Ga0496110_0034978 | |||
| 3185 | Ga0496110_0054089 | |||
| 3186 | Ga0496110_0061174 | |||
| 3187 | Ga0496110_0122134 | |||
| 3188 | Ga0496110_0269120 | |||
| 3189 | Ga0496110_0444018 | |||
| 3190 | Ga0496111_0013977 | |||
| 3191 | Ga0496111_0021239 | |||
| 3192 | Ga0496111_0023917 | |||
| 3193 | Ga0496111_0030852 | |||
| 3194 | Ga0496111_0040590 | |||
| 3195 | Ga0496111_0069085 | |||
| 3196 | Ga0496111_0156658 | |||
| 3197 | Ga0496111_0171207 | |||
| 3198 | Ga0496112_0021049 | |||
| 3199 | Ga0496112_0044120 | |||
| 3200 | Ga0496112_0051703 | |||
| 3201 | Ga0496112_0061635 | |||
| 3202 | Ga0496112_0078758 | |||
| 3203 | Ga0496112_0302782 | |||
| 3204 | Ga0496113_0001950 | |||
| 3205 | Ga0496113_0002665 | |||
| 3206 | Ga0496113_0008785 | |||
| 3207 | Ga0496113_0008826 | |||
| 3208 | Ga0496113_0129705 | |||
| 3209 | Ga0496113_0199278 | |||
| 3210 | Ga0496113_0348048 | |||
| 3211 | Ga0496114_0046871 | |||
| 3212 | Ga0496114_0111990 | |||
| 3213 | Ga0496114_0137536 | |||
| 3214 | Ga0496114_0242600 | |||
| 3215 | Ga0496114_0284430 | |||
| 3216 | Ga0496114_0380195 | |||
| 3217 | Ga0496114_0428142 | |||
| 3218 | Ga0496115_0009549 | |||
| 3219 | Ga0496115_0019987 | |||
| 3220 | Ga0496115_0073699 | |||
| 3221 | Ga0496115_0080355 | |||
| 3222 | Ga0496115_0088771 | |||
| 3223 | Ga0496115_0096761 | |||
| 3224 | Ga0496115_0101996 | |||
| 3225 | Ga0496115_0127875 | |||
| 3226 | Ga0496115_0173197 | |||
| 3227 | Ga0496115_0263324 | |||
| 3228 | Ga0496115_0271117 | |||
| 3229 | Ga0496115_0333853 | |||
| 3230 | Ga0496115_0366312 | |||
| 3231 | Ga0501031_0055503 | |||
| 3232 | Ga0501031_0079391 | |||
| 3233 | Ga0501032_0148159 | |||
| 3234 | Ga0501033_0044445 | |||
| 3235 | Ga0501033_0075440 | |||
| 3236 | Ga0501033_0215081 | |||
| 3237 | Ga0501034_0001160 | |||
| 3238 | Ga0501034_0006692 | |||
| 3239 | Ga0501034_0029366 | |||
| 3240 | Ga0501034_0198853 | |||
| 3241 | Ga0501036_0018021 | |||
| 3242 | Ga0501036_0043532 | |||
| 3243 | Ga0501036_0090209 | |||
| 3244 | Ga0501036_0282535 | |||
| 3245 | Ga0501036_0309725 | |||
| 3246 | Ga0501036_0350203 | |||
| 3247 | Ga0501037_0026526 | |||
| 3248 | Ga0501037_0071272 | |||
| 3249 | Ga0501037_0220440 | |||
| 3250 | Ga0501038_0000775 | |||
| 3251 | Ga0501038_0076041 | |||
| 3252 | Ga0501038_0173956 | |||
| 3253 | Ga0501038_0255938 | |||
| 3254 | Ga0501038_0598462 | |||
| 3255 | Ga0501039_0099388 | |||
| 3256 | Ga0501039_0232807 | |||
| 3257 | Ga0501040_0009567 | |||
| 3258 | Ga0501040_0012594 | |||
| 3259 | Ga0501040_0018457 | |||
| 3260 | Ga0501040_0318735 | |||
| 3261 | Ga0501040_0390174 | |||
| 3262 | Ga0501040_0452266 | |||
| 3263 | Ga0501041_0017024 | |||
| 3264 | Ga0501041_0027793 | |||
| 3265 | Ga0501041_0107756 | |||
| 3266 | Ga0501041_0125194 | |||
| 3267 | Ga0501041_0213223 | |||
| 3268 | Ga0501042_0059716 | |||
| 3269 | Ga0501042_0196918 | |||
| 3270 | Ga0501042_0202099 | |||
| 3271 | Ga0501042_0228284 | |||
| 3272 | Ga0501042_0281813 | |||
| 3273 | Ga0501043_0050356 | |||
| 3274 | Ga0501043_0087879 | |||
| 3275 | Ga0501043_0193664 | |||
| 3276 | Ga0501046_0039215 | |||
| 3277 | Ga0501046_0043437 | |||
| 3278 | Ga0501046_0044144 | |||
| 3279 | Ga0501046_0216539 | |||
| 3280 | Ga0501046_0252265 | |||
| 3281 | Ga0501046_0324833 | |||
| 3282 | Ga0501047_0006347 | |||
| 3283 | Ga0501047_0009067 | |||
| 3284 | Ga0501047_0018859 | |||
| 3285 | Ga0501047_0612500 | |||
| 3286 | Ga0501048_0016432 | |||
| 3287 | Ga0501048_0105395 | |||
| 3288 | Ga0501048_0195551 | |||
| 3289 | Ga0501048_0371157 | |||
| 3290 | Ga0501048_0405454 | |||
| 3291 | Ga0501067_0044703 | |||
| 3292 | Ga0501067_0117104 | |||
| 3293 | Ga0501067_0202144 | |||
| 3294 | Ga0501068_0070612 | |||
| 3295 | Ga0501068_0264327 | |||
| 3296 | Ga0501069_0046105 | |||
| 3297 | Ga0501070_0003185 | |||
| 3298 | Ga0501070_0004846 | |||
| 3299 | Ga0501070_0027193 | |||
| 3300 | Ga0501070_0056684 | |||
| 3301 | Ga0501070_0097024 | |||
| 3302 | Ga0501070_0113855 | |||
| 3303 | Ga0501070_0172111 | |||
| 3304 | Ga0501070_0471341 | |||
| 3305 | Ga0501070_0580399 | |||
| 3306 | Ga0501071_0050634 | |||
| 3307 | Ga0501071_0095714 | |||
| 3308 | Ga0501071_0216273 | |||
| 3309 | Ga0501071_0424840 | |||
| 3310 | Ga0501072_0030502 | |||
| 3311 | Ga0501072_0067915 | |||
| 3312 | Ga0501072_0071741 | |||
| 3313 | Ga0501072_0099576 | |||
| 3314 | Ga0501072_0106645 | |||
| 3315 | Ga0501072_0356005 | |||
| 3316 | Ga0501072_0420071 | |||
| 3317 | Ga0501073_0029987 | |||
| 3318 | Ga0501073_0057334 | |||
| 3319 | Ga0501073_0192902 | |||
| 3320 | Ga0501073_0261578 | |||
| 3321 | Ga0501073_0281551 | |||
| 3322 | Ga0501073_0546123 | |||
| 3323 | Ga0501074_0060566 | |||
| 3324 | Ga0501074_0073296 | |||
| 3325 | Ga0501074_0180182 | |||
| 3326 | Ga0501074_0575730 | |||
| 3327 | Ga0501075_0004734 | |||
| 3328 | Ga0501075_0005155 | |||
| 3329 | Ga0501075_0098564 | |||
| 3330 | Ga0501075_0124053 | |||
| 3331 | Ga0501075_0125334 | |||
| 3332 | Ga0501075_0161886 | |||
| 3333 | Ga0501076_0001405 | |||
| 3334 | Ga0501076_0216486 | |||
| 3335 | Ga0501076_0420225 | |||
| 3336 | Ga0501077_0007341 | |||
| 3337 | Ga0501077_0034622 | |||
| 3338 | Ga0501077_0105319 | |||
| 3339 | Ga0501077_0183791 | |||
| 3340 | Ga0501077_0282036 | |||
| 3341 | Ga0501077_0378527 | |||
| 3342 | Ga0501079_0003233 | |||
| 3343 | Ga0501079_0040616 | |||
| 3344 | Ga0501079_0118163 | |||
| 3345 | Ga0501079_0173252 | |||
| 3346 | Ga0501079_0498850 | |||
| 3347 | Ga0501080_0021206 | |||
| 3348 | Ga0501080_0028713 | |||
| 3349 | Ga0501080_0064534 | |||
| 3350 | Ga0501080_0083911 | |||
| 3351 | Ga0501080_0096741 | |||
| 3352 | Ga0501080_0140519 | |||
| 3353 | Ga0501080_0259554 | |||
| 3354 | Ga0501080_0260592 | |||
| 3355 | Ga0501080_0284670 | |||
| 3356 | Ga0501080_0504713 | |||
| 3357 | Ga0501081_0001767 | |||
| 3358 | Ga0501081_0010499 | |||
| 3359 | Ga0501081_0010888 | |||
| 3360 | Ga0501081_0038168 | |||
| 3361 | Ga0501081_0055859 | |||
| 3362 | Ga0501081_0400901 | |||
| 3363 | Ga0501083_0057931 | |||
| 3364 | Ga0501083_0104465 | |||
| 3365 | Ga0501083_0240612 | |||
| 3366 | Ga0501035_0000127 | |||
| 3367 | Ga0501035_0005073 | |||
| 3368 | Ga0501035_0022579 | |||
| 3369 | Ga0501035_0025523 | |||
| 3370 | Ga0501035_0068477 | |||
| 3371 | Ga0501035_0294443 | |||
| 3372 | Ga0501044_0001312 | |||
| 3373 | Ga0501044_0008177 | |||
| 3374 | Ga0501044_0023098 | |||
| 3375 | Ga0501044_0030205 | |||
| 3376 | Ga0501044_0088157 | |||
| 3377 | Ga0501044_0117406 | |||
| 3378 | Ga0501044_0147701 | |||
| 3379 | Ga0501044_0163053 | |||
| 3380 | Ga0501044_0281404 | |||
| 3381 | Ga0501044_0309288 | |||
| 3382 | Ga0501045_0018155 | |||
| 3383 | Ga0501045_0026472 | |||
| 3384 | Ga0501045_0089530 | |||
| 3385 | nmdc:mga03683_4783_c1 | |||
| 3386 | nmdc:mga00v17_196983_c1 | |||
| 3387 | nmdc:mga00v17_4490_c1 | |||
| 3388 | nmdc:mga0yw44_114460_c1 | |||
| 3389 | nmdc:mga0yw44_23841_c1 | |||
| 3390 | nmdc:mga0yw44_89401_c1 | |||
| 3391 | nmdc:mga0k408_2408_c1 | |||
| 3392 | nmdc:mga06z11_124102_c1 | |||
| 3393 | nmdc:mga06z11_137595_c1 | |||
| 3394 | nmdc:mga06z11_23201_c1 | |||
| 3395 | nmdc:mga06z11_343661_c1 | |||
| 3396 | nmdc:mga06z11_70741_c1 | |||
| 3397 | nmdc:mga04h51_83923_c1 | |||
| 3398 | nmdc:mga05p37_108365_c1 | |||
| 3399 | nmdc:mga05p37_148901_c1 | |||
| 3400 | nmdc:mga05p37_1808_c2 | |||
| 3401 | nmdc:mga05p37_450398_c1 | |||
| 3402 | nmdc:mga05p37_45950_c1 | |||
| 3403 | nmdc:mga05p37_508_c2 | |||
| 3404 | nmdc:mga05p37_75031_c1 | |||
| 3405 | nmdc:mga05p37_90850_c1 | |||
| 3406 | nmdc:mga09592_141748_c1 | |||
| 3407 | nmdc:mga09592_30039_c1 | |||
| 3408 | nmdc:mga09592_469785_c1 | |||
| 3409 | nmdc:mga09592_5057_c1 | |||
| 3410 | nmdc:mga09592_92656_c1 | |||
| 3411 | nmdc:mga0qj67_115940_c1 | |||
| 3412 | nmdc:mga0qj67_119224_c1 | |||
| 3413 | nmdc:mga0qj67_130809_c1 | |||
| 3414 | nmdc:mga0qj67_15510_c1 | |||
| 3415 | nmdc:mga0qj67_169352_c1 | |||
| 3416 | nmdc:mga0qj67_52_c1 | |||
| 3417 | nmdc:mga0qj67_72452_c1 | |||
| 3418 | nmdc:mga06r32_105218_c1 | |||
| 3419 | nmdc:mga06r32_146979_c1 | |||
| 3420 | nmdc:mga06r32_1960_c1 | |||
| 3421 | nmdc:mga06r32_230180_c1 | |||
| 3422 | nmdc:mga06r32_236166_c1 | |||
| 3423 | nmdc:mga06r32_33897_c1 | |||
| 3424 | nmdc:mga06r32_3441_c1 | |||
| 3425 | nmdc:mga06r32_34449_c1 | |||
| 3426 | nmdc:mga06r32_489666_c1 | |||
| 3427 | nmdc:mga06r32_53801_c1 | |||
| 3428 | nmdc:mga08y16_14675_c1 | |||
| 3429 | nmdc:mga08y16_2332_c1 | |||
| 3430 | nmdc:mga08y16_283486_c1 | |||
| 3431 | nmdc:mga08y16_290441_c1 | |||
| 3432 | nmdc:mga08y16_30278_c1 | |||
| 3433 | nmdc:mga08y16_3146_c1 | |||
| 3434 | nmdc:mga08y16_3939_c1 | |||
| 3435 | nmdc:mga08y16_63381_c1 | |||
| 3436 | nmdc:mga08y16_75718_c1 | |||
| 3437 | nmdc:mga08y16_8982_c1 | |||
| 3438 | nmdc:mga08y16_9215_c1 | |||
| 3439 | nmdc:mga0n895_145_c1 | |||
| 3440 | nmdc:mga0n895_159698_c1 | |||
| 3441 | nmdc:mga0n895_193711_c1 | |||
| 3442 | nmdc:mga0n895_336958_c1 | |||
| 3443 | nmdc:mga0n895_37534_c1 | |||
| 3444 | nmdc:mga0n895_414424_c1 | |||
| 3445 | nmdc:mga0n895_4696_c1 | |||
| 3446 | nmdc:mga0n895_475845_c1 | |||
| 3447 | nmdc:mga0n895_620401_c1 | |||
| 3448 | nmdc:mga0n895_69426_c1 | |||
| 3449 | nmdc:mga0n895_697_c1 | |||
| 3450 | nmdc:mga0n895_79449_c1 | |||
| 3451 | nmdc:mga0rr50_115821_c1 | |||
| 3452 | nmdc:mga0rr50_161239_c1 | |||
| 3453 | nmdc:mga0rr50_1966_c1 | |||
| 3454 | nmdc:mga0rr50_25674_c1 | |||
| 3455 | nmdc:mga0rr50_2684_c1 | |||
| 3456 | nmdc:mga0rr50_26927_c1 | |||
| 3457 | nmdc:mga0rr50_42859_c1 | |||
| 3458 | nmdc:mga0rr50_48815_c1 | |||
| 3459 | nmdc:mga0rr50_59705_c1 | |||
| 3460 | nmdc:mga0rr50_617932_c1 | |||
| 3461 | nmdc:mga08x19_1133_c1 | |||
| 3462 | nmdc:mga08x19_116183_c1 | |||
| 3463 | nmdc:mga08x19_24255_c1 | |||
| 3464 | nmdc:mga08x19_274819_c1 | |||
| 3465 | nmdc:mga08x19_291574_c1 | |||
| 3466 | nmdc:mga08x19_33203_c1 | |||
| 3467 | nmdc:mga08x19_33421_c1 | |||
| 3468 | nmdc:mga08x19_386216_c1 | |||
| 3469 | nmdc:mga08x19_3872_c1 | |||
| 3470 | nmdc:mga0a205_127802_c1 | |||
| 3471 | nmdc:mga0a205_17080_c2 | |||
| 3472 | nmdc:mga0a205_18201_c1 | |||
| 3473 | nmdc:mga0a205_1921_c1 | |||
| 3474 | nmdc:mga0a205_2724_c1 | |||
| 3475 | nmdc:mga0a205_297338_c1 | |||
| 3476 | nmdc:mga0a205_435226_c1 | |||
| 3477 | nmdc:mga0a205_44400_c1 | |||
| 3478 | Ga0495601_0000008 | |||
| 3479 | Ga0495601_0001042 | |||
| 3480 | Ga0495601_0001925 | |||
| 3481 | Ga0495601_0004619 | |||
| 3482 | Ga0495601_0029283 | |||
| 3483 | Ga0495601_0044685 | |||
| 3484 | Ga0495601_0094550 | |||
| 3485 | Ga0495601_0096670 | |||
| 3486 | Ga0495601_0113370 | |||
| 3487 | Ga0495601_0460018 | |||
| 3488 | Ga0495612_0000026 | |||
| 3489 | Ga0495612_0000308 | |||
| 3490 | Ga0495612_0000858 | |||
| 3491 | Ga0495612_0012643 | |||
| 3492 | Ga0495612_0032977 | |||
| 3493 | Ga0495612_0140718 | |||
| 3494 | Ga0495595_0000024 | |||
| 3495 | Ga0495595_0000879 | |||
| 3496 | Ga0495595_0006336 | |||
| 3497 | Ga0495595_0010002 | |||
| 3498 | Ga0495595_0011017 | |||
| 3499 | Ga0495595_0014880 | |||
| 3500 | Ga0495595_0031159 | |||
| 3501 | Ga0495619_0000002 | |||
| 3502 | Ga0495619_0000229 | |||
| 3503 | Ga0495619_0001598 | |||
| 3504 | Ga0495619_0002881 | |||
| 3505 | Ga0495619_0005795 | |||
| 3506 | Ga0495619_0013992 | |||
| 3507 | Ga0495619_0018217 | |||
| 3508 | Ga0500643_009516 | |||
| 3509 | Ga0500651_0022942 | |||
| 3510 | Ga0500651_0180041 | |||
| 3511 | Ga0500566_0094479 | |||
| 3512 | Ga0500641_0020457 | |||
| 3513 | Ga0500562_056036 | |||
| 3514 | Ga0500562_057978 | |||
| 3515 | Ga0500595_000010 | |||
| 3516 | Ga0500595_014685 | |||
| 3517 | Ga0500595_048037 | |||
| 3518 | Ga0500616_0000001 | |||
| 3519 | Ga0500616_0061428 | |||
| 3520 | Ga0500616_0062798 | |||
| 3521 | Ga0500616_0065607 | |||
| 3522 | Ga0500645_000015 | |||
| 3523 | Ga0501084_0057017 | |||
| 3524 | Ga0501084_0068704 | |||
| 3525 | Ga0501084_0077346 | |||
| 3526 | Ga0501084_0147838 | |||
| 3527 | Ga0501084_0150596 | |||
| 3528 | Ga0501084_0370135 | |||
| 3529 | Ga0501084_0450370 | |||
| 3530 | Ga0590071_011869 | |||
| 3531 | Ga0590075_021489 | |||
| 3532 | Ga0590077_005770 | |||
| 3533 | Ga0501082_0000013 | |||
| 3534 | Ga0501082_0013431 | |||
| 3535 | Ga0501082_0015413 | |||
| 3536 | Ga0501082_0052731 | |||
| 3537 | Ga0501082_0060268 | |||
| 3538 | Ga0501082_0112665 | |||
| 3539 | Ga0501082_0398927 | |||
| 3540 | Ga0530510_0000596 | |||
| 3541 | Ga0530510_0092868 | |||
| 3542 | Ga0530510_0111429 | |||
| 3543 | Ga0530510_0220076 | |||
| 3544 | Ga0530510_0419855 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2awo-assembly2.cif.gz_C | crystal structure of the adp-mg-bound e. coli malk (crystallized with adp-mg) | 0.9309 | 3 | 221 |
| 2awo-assembly2.cif.gz_D | crystal structure of the adp-mg-bound e. coli malk (crystallized with adp-mg) | 0.9295 | 3 | 221 |
| 7x0q-assembly1.cif.gz_A | crystal structure of atpase clo1313_2554 from clostridium thermocellum | 0.9238 | 4 | 221 |
| 1v43-assembly1.cif.gz_A | crystal structure of atpase subunit of abc sugar transporter | 0.9234 | 1 | 221 |
| 7caf-assembly1.cif.gz_C | mycobacterium smegmatis lpqy-sugabc complex in the pre-translocation state | 0.922 | 3 | 223 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q57855_15_256_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9606 | 4 | 243 | 3.40.50.300 |
| af_Q57855_15_256_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9452 | 4 | 243 | 3.40.50.300 |
| 2awoD01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9288 | 3 | 220 | 3.40.50.300 |
| 2awoD01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9164 | 3 | 220 | 3.40.50.300 |
| af_P77795_1_218_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9137 | 1 | 221 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1J5HAE4-F1-model_v4 | Sugar ABC transporter ATP-binding protein | 0.9478 | 1 | 221 |
GO:0005524
GO:0008643 GO:0016887 GO:0055052 GO:0140359 |
| AF-A0A537ZXY3-F1-model_v4 | ABC transporter ATP-binding protein | 0.9448 | 4 | 221 |
GO:0005524
GO:0016887 GO:0022857 GO:0043190 |
| AF-A0A6G2KRN3-F1-model_v4 | deleted | 0.9443 | 1 | 247 |
|
| AF-A0A382ZAC4-F1-model_v4 | ABC transporter domain-containing protein | 0.9438 | 2 | 208 |
GO:0005524
GO:0005886 GO:0015408 GO:0016887 |
| AF-A0A7Z0MMF1-F1-model_v4 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 0.9436 | 1 | 221 |
GO:0001407
GO:0005524 GO:0008643 GO:0015794 GO:0016887 GO:0055052 GO:0140359 |