F495656

General Info

Members Datasets Scaffolds Average Seq Length
1773 592 3546 214

Family's Representative Sequence

Representative Sequence 3300050509|nmdc:mga0qj67_276001_c1|nmdc:mga0qj67_276001_c1_204_956
Length 232
Sequence LPRCKASVRIGRTTDIGIGDLLLVYEYTAQMSSHLFDIAHMLAGGLVLLSLALLYQDRMFGLLNVFALHAVXXXXSVAWQGHIQGAPHLYITALIALLLKAVIETVVGIGPTMLAGLALVALSMVVMLKATATADPLAREDLAFALSVVLLGLLMMVTRRNAVSQVVGFMSLENGMILAATGAKGMPLVVEISVAFSVLVAFIVIGVFLFRIRERFDTVDVAALDAFRGERR

Samples

Sample ID Description Type Environment
1 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
7 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
8 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
9 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
10 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
11 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
12 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
13 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
14 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
15 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
16 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
17 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
18 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
19 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
20 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
21 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
22 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
23 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
24 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
25 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
26 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
27 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
28 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
29 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
30 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
31 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
32 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
33 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
34 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
35 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
36 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
37 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
38 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
39 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
40 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
41 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
42 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
43 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
44 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
45 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
46 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
47 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
48 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
49 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
50 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
51 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
52 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
53 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
54 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
55 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
56 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
57 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
58 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
59 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
60 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
61 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
62 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
63 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
64 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
65 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
66 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
67 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
68 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
69 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
70 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
71 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
72 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
73 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
74 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
75 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
76 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
77 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
78 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
79 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
80 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
81 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
82 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
83 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
84 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
85 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
86 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
87 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
88 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
89 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
90 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
91 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
92 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
93 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
94 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
95 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
96 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
97 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
98 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
99 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
100 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
101 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
102 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
103 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
104 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
105 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
106 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
107 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
108 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
109 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
110 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
111 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
112 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
113 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
114 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
115 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
116 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
117 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
118 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
119 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
120 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
121 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
122 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
123 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
124 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
125 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
126 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
127 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
128 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
129 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
130 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
131 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
132 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
133 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
134 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
135 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
136 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
137 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
138 3300009984 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG Metagenome Rhizosphere
139 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
140 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
141 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
142 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
143 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
144 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
145 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
146 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
147 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
148 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
149 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
150 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
151 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
152 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
153 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
154 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
155 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
156 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
157 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
158 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
159 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
160 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
161 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
162 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
163 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
164 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
165 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
166 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
167 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
168 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
169 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
170 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
237 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
238 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
239 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
242 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
246 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
247 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
248 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
249 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
250 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
251 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
252 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
253 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
254 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
255 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
256 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
257 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
258 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
259 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
260 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
261 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
262 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
263 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
264 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
265 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
266 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
267 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
268 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
269 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
270 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
271 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
272 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
273 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
274 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
275 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
276 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
277 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
278 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
279 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
280 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
281 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
282 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
283 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
284 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
285 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
286 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
287 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
288 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
289 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
290 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
291 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
292 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
293 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
294 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
295 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
296 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
297 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
298 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
299 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
300 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
301 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
302 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
303 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
304 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
305 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
306 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
307 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
308 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
309 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
310 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
311 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
312 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
313 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
314 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
315 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
316 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
317 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
318 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
319 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
320 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
321 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
322 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
323 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
324 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
325 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
326 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
327 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
328 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
329 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
330 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
331 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
332 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
333 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
334 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
335 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
336 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
337 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
338 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
339 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
340 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
341 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
342 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
343 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
344 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
345 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
346 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
347 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
348 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
349 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
350 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
351 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
352 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
353 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
354 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
355 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
356 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
357 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
358 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
359 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
360 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
361 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
362 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
363 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
364 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
365 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
366 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
367 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
368 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
369 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
370 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
371 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
372 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
373 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
374 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
375 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
376 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
377 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
378 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
379 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
380 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
381 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
382 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
383 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
384 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
385 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
386 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
387 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
388 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
389 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
390 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
391 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
392 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
393 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
394 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
395 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
396 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
397 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
398 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
399 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
400 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
401 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
402 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
403 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
404 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
405 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
406 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
407 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
408 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
409 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
410 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
411 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
412 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
413 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
414 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
415 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
416 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
417 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
418 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
419 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
420 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
421 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
422 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
423 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
424 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
425 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
426 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
427 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
428 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
429 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
430 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
431 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
432 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
433 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
434 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
435 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
436 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
437 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
438 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
439 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
440 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
441 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
442 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
443 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
444 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
445 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
446 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
447 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
448 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
449 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
450 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
451 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
452 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
453 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
454 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
455 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
456 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
457 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
458 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
459 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
460 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
461 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
462 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
463 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
464 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
465 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
466 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
467 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
468 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
469 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
470 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
471 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
472 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
473 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
474 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
475 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
476 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
477 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
478 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
479 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
480 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
481 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
482 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
483 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
484 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
485 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
486 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
487 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
488 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
489 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
490 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
491 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
492 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
493 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
494 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
495 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
496 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
497 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
498 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
499 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
500 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
501 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
502 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
503 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
504 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
505 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
506 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
507 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
508 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
509 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
510 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
511 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
512 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
513 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
514 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
515 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
516 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
517 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
518 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
519 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
520 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
521 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
522 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
523 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
524 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
525 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
526 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
527 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
528 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
529 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
530 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
531 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
532 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
533 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
534 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
535 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
536 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
537 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
538 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
539 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
540 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
541 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
542 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
543 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
544 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
545 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
546 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
547 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
548 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
549 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
550 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
551 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
552 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
553 2791355199
554 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
555 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
556 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
557 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
558 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
559 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
560 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
561 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
562 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
563 2906610324
564 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
565 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
566 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
567 2922425934
568 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
569 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
570 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
571 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
572 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
573 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
574 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
575 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
576 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
577 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
578 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
579 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
580 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
581 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
582 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
583 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
584 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
585 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
586 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
587 8002060224 Methylocystis sp. Sn-Cys Isolate Unclassified
588 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
589 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
590 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
591 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
592 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.18
Metatranscriptomes 0.06
Isolates 2.77

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.58
Nodule 2.54
Rhizoplane 9.08
Rhizosphere 78.34
Stem 0
Stem Tuber 0
Unclassified 0.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0qj67_276001_c1 3300050509 Bacteria 1363
2 JGI24746J21847_1002224 3300001977 Bacteria 3102
3 JGI24737J22298_10046026 3300001990 Bacteria 1332
4 JGI24743J22301_10035741 3300001991 Bacteria 988
5 JGI24735J21928_10041249 3300002067 Bacteria 1345
6 JGI24750J21931_1001355 3300002070 Bacteria 3076
7 JGI24745J21846_1000775 3300002073 Bacteria 2925
8 JGI24748J21848_1003115 3300002074 Bacteria 1891
9 JGI24749J21850_1002812 3300002076 Bacteria 2437
10 JGI24744J21845_10000934 3300002077 Bacteria 5556
11 JGI24034J26672_10011810 3300002239 Bacteria 1311
12 JGI24742J22300_10000424 3300002244 Bacteria 6224
13 JGI24742J22300_10003626 3300002244 Bacteria 2506
14 JGI25156J39149_1000198 3300002705 Bacteria 42079
15 JGI25154J39366_1000209 3300002738 Bacteria 41899
16 JGI25157J39369_1000240 3300002741 Bacteria 42079
17 JGI25159J45721_1007087 3300002987 Bacteria 3263
18 JGI25406J46586_10004053 3300003203 Bacteria 6850
19 JGI25165J46597_1011687 3300003214 Bacteria 1248
20 JGI25153J46596_10000946 3300003215 Bacteria 17627
21 rootH1_10253643 3300003323 Bacteria 1076
22 JGI25160J50197_1024073 3300003354 Bacteria 1736
23 JGI25405J52794_10011223 3300003911 Bacteria 1714
24 Ga0055543_1014759 3300004625 Bacteria 1516
25 Ga0065165_1000785 3300005262 Bacteria 42533
26 Ga0065165_1016570 3300005262 Bacteria 2752
27 Ga0065707_10091172 3300005295 Bacteria 3993
28 Ga0065707_10199625 3300005295 Bacteria 1317
29 Ga0070658_10067069 3300005327 Bacteria 2932
30 Ga0070658_10131651 3300005327 Bacteria 2085
31 Ga0070676_10013244 3300005328 Bacteria 4517
32 Ga0070676_10025116 3300005328 Bacteria 3365
33 Ga0070676_10031955 3300005328 Bacteria 3013
34 Ga0070676_10489589 3300005328 Bacteria 871
35 Ga0070683_100529961 3300005329 Bacteria 1126
36 Ga0070690_100010416 3300005330 Bacteria 5411
37 Ga0070670_100009831 3300005331 Bacteria 8172
38 Ga0070670_100080110 3300005331 Bacteria 2807
39 Ga0070670_100113554 3300005331 Bacteria 2335
40 Ga0070670_100222332 3300005331 Bacteria 1643
41 Ga0068869_100005796 3300005334 Bacteria 7797
42 Ga0068869_100033165 3300005334 Bacteria 3644
43 Ga0070666_10008356 3300005335 Bacteria 6424
44 Ga0070666_10431938 3300005335 Bacteria 950
45 Ga0070680_100070310 3300005336 Bacteria 2875
46 Ga0070680_100117171 3300005336 Bacteria 2221
47 Ga0070682_100008701 3300005337 Bacteria 5725
48 Ga0070682_100009990 3300005337 Bacteria 5375
49 Ga0070682_100498948 3300005337 Bacteria 943
50 Ga0068868_100006107 3300005338 Bacteria 8510
51 Ga0068868_100040882 3300005338 Bacteria 3611
52 Ga0070660_100000939 3300005339 Bacteria 19455
53 Ga0070660_100025758 3300005339 Bacteria 4374
54 Ga0070660_100255115 3300005339 Bacteria 1431
55 Ga0070689_100018460 3300005340 Bacteria 5139
56 Ga0070689_100020568 3300005340 Bacteria 4899
57 Ga0070689_100022682 3300005340 Bacteria 4690
58 Ga0070689_100160791 3300005340 Bacteria 1815
59 Ga0070691_10010464 3300005341 Bacteria 4233
60 Ga0070691_10142950 3300005341 Bacteria 1221
61 Ga0070687_100008830 3300005343 Bacteria 4285
62 Ga0070687_100028601 3300005343 Bacteria 2706
63 Ga0070661_100027242 3300005344 Bacteria 4113
64 Ga0070661_100307306 3300005344 Bacteria 1236
65 Ga0070661_100889811 3300005344 Bacteria 734
66 Ga0070692_10071462 3300005345 Bacteria 1850
67 Ga0070692_10096682 3300005345 Bacteria 1613
68 Ga0070668_100010470 3300005347 Bacteria 6893
69 Ga0070668_100011094 3300005347 Bacteria 6708
70 Ga0070668_100021106 3300005347 Bacteria 4923
71 Ga0070668_100162264 3300005347 Bacteria 1814
72 Ga0070669_100014612 3300005353 Bacteria 5589
73 Ga0070669_100022662 3300005353 Bacteria 4491
74 Ga0070669_100054921 3300005353 Bacteria 2918
75 Ga0070669_100115944 3300005353 Bacteria 2038
76 Ga0070669_100214713 3300005353 Bacteria 1519
77 Ga0070669_100357841 3300005353 Bacteria 1186
78 Ga0070675_100007433 3300005354 Bacteria 8461
79 Ga0070675_100010507 3300005354 Bacteria 7231
80 Ga0070671_100001845 3300005355 Bacteria 16138
81 Ga0070671_100049276 3300005355 Bacteria 3504
82 Ga0070671_100072337 3300005355 Bacteria 2879
83 Ga0070671_100341681 3300005355 Bacteria 1277
84 Ga0070674_100009356 3300005356 Bacteria 5867
85 Ga0070674_100109690 3300005356 Bacteria 2024
86 Ga0070673_100006459 3300005364 Bacteria 7622
87 Ga0070673_100007902 3300005364 Bacteria 7051
88 Ga0070673_100012955 3300005364 Bacteria 5747
89 Ga0070688_100056856 3300005365 Bacteria 2457
90 Ga0070688_100212681 3300005365 Bacteria 1358
91 Ga0070659_100004243 3300005366 Bacteria 10232
92 Ga0070659_100020505 3300005366 Bacteria 5023
93 Ga0070659_100052526 3300005366 Bacteria 3206
94 Ga0070659_100173866 3300005366 Bacteria 1766
95 Ga0070659_100442758 3300005366 Bacteria 1101
96 Ga0070667_100089323 3300005367 Bacteria 2647
97 Ga0070667_100628389 3300005367 Bacteria 991
98 Ga0070667_100731439 3300005367 Bacteria 917
99 Ga0070709_10311234 3300005434 Bacteria 1153
100 Ga0070709_10382254 3300005434 Bacteria 1047
101 Ga0070714_100020133 3300005435 Bacteria 5445
102 Ga0070714_100083496 3300005435 Bacteria 2785
103 Ga0070714_100342879 3300005435 Bacteria 1402
104 Ga0070714_100401132 3300005435 Bacteria 1296
105 Ga0070714_100407643 3300005435 Bacteria 1286
106 Ga0070713_100006457 3300005436 Bacteria 8130
107 Ga0070713_100012781 3300005436 Bacteria 6171
108 Ga0070713_100082029 3300005436 Bacteria 2753
109 Ga0070713_100130847 3300005436 Bacteria 2213
110 Ga0070713_100186406 3300005436 Bacteria 1867
111 Ga0070713_100242797 3300005436 Bacteria 1641
112 Ga0070713_100577855 3300005436 Bacteria 1066
113 Ga0070713_100801842 3300005436 Bacteria 903
114 Ga0070710_10001738 3300005437 Bacteria 10292
115 Ga0070710_10145602 3300005437 Bacteria 1457
116 Ga0070710_10392002 3300005437 Bacteria 929
117 Ga0070701_10007943 3300005438 Bacteria 4564
118 Ga0070711_100004017 3300005439 Bacteria 8649
119 Ga0070711_100028343 3300005439 Bacteria 3685
120 Ga0070711_100068473 3300005439 Bacteria 2494
121 Ga0070711_100225585 3300005439 Bacteria 1459
122 Ga0070705_100060768 3300005440 Bacteria 2243
123 Ga0070705_100452288 3300005440 Bacteria 964
124 Ga0070700_100023233 3300005441 Bacteria 3625
125 Ga0070700_100164743 3300005441 Bacteria 1530
126 Ga0070694_100039271 3300005444 Bacteria 3150
127 Ga0070694_100091305 3300005444 Bacteria 2137
128 Ga0070694_100101966 3300005444 Bacteria 2031
129 Ga0070663_100009487 3300005455 Bacteria 6029
130 Ga0070663_100026948 3300005455 Bacteria 3898
131 Ga0070663_100603274 3300005455 Bacteria 923
132 Ga0070663_100726812 3300005455 Bacteria 846
133 Ga0070678_100085452 3300005456 Bacteria 2404
134 Ga0070662_100012811 3300005457 Bacteria 5569
135 Ga0070662_100016757 3300005457 Bacteria 4925
136 Ga0070662_100045051 3300005457 Bacteria 3163
137 Ga0070662_100108225 3300005457 Bacteria 2114
138 Ga0070662_100123661 3300005457 Bacteria 1986
139 Ga0070662_100415041 3300005457 Bacteria 1113
140 Ga0070662_100576393 3300005457 Bacteria 945
141 Ga0070681_10020204 3300005458 Bacteria 6676
142 Ga0070681_10027203 3300005458 Bacteria 5751
143 Ga0070681_10047854 3300005458 Bacteria 4274
144 Ga0070681_10206617 3300005458 Bacteria 1881
145 Ga0068867_100024994 3300005459 Bacteria 4284
146 Ga0068867_100081404 3300005459 Bacteria 2441
147 Ga0068867_100122647 3300005459 Bacteria 2010
148 Ga0068867_100272156 3300005459 Bacteria 1385
149 Ga0070685_10012638 3300005466 Bacteria 4439
150 Ga0070685_10164001 3300005466 Bacteria 1419
151 Ga0070707_100252048 3300005468 Bacteria 1718
152 Ga0070707_100657677 3300005468 Bacteria 1010
153 Ga0070699_100406998 3300005518 Bacteria 1231
154 Ga0070679_100010140 3300005530 Bacteria 8932
155 Ga0070679_100011107 3300005530 Bacteria 8571
156 Ga0070684_100030922 3300005535 Bacteria 4553
157 Ga0070684_100081673 3300005535 Bacteria 2860
158 Ga0068853_100005277 3300005539 Bacteria 10116
159 Ga0068853_100010108 3300005539 Bacteria 7625
160 Ga0068853_100071078 3300005539 Bacteria 3030
161 Ga0068853_100097710 3300005539 Bacteria 2593
162 Ga0068853_100595339 3300005539 Bacteria 1050
163 Ga0070672_100003221 3300005543 Bacteria 10563
164 Ga0070672_100242747 3300005543 Bacteria 1515
165 Ga0070672_100341286 3300005543 Bacteria 1276
166 Ga0070686_100273192 3300005544 Bacteria 1243
167 Ga0070686_100509861 3300005544 Bacteria 935
168 Ga0070695_100000088 3300005545 Bacteria 38984
169 Ga0070695_100008380 3300005545 Bacteria 6135
170 Ga0070695_100126206 3300005545 Bacteria 1757
171 Ga0070695_100258945 3300005545 Bacteria 1270
172 Ga0070695_100317945 3300005545 Bacteria 1156
173 Ga0070696_100018761 3300005546 Bacteria 4680
174 Ga0070696_100047274 3300005546 Bacteria 2985
175 Ga0070696_100120101 3300005546 Bacteria 1902
176 Ga0070665_100021137 3300005548 Bacteria 6542
177 Ga0070665_100041633 3300005548 Bacteria 4618
178 Ga0070665_100062066 3300005548 Bacteria 3747
179 Ga0070665_100088181 3300005548 Bacteria 3108
180 Ga0070665_100981455 3300005548 Bacteria 857
181 Ga0070704_100005398 3300005549 Bacteria 7444
182 Ga0070704_100019709 3300005549 Bacteria 4339
183 Ga0070704_100043795 3300005549 Bacteria 3105
184 Ga0068855_100036765 3300005563 Bacteria 5826
185 Ga0068855_100068463 3300005563 Bacteria 4133
186 Ga0068855_101024888 3300005563 Bacteria 866
187 Ga0070664_100035563 3300005564 Bacteria 4182
188 Ga0070664_100104031 3300005564 Bacteria 2472
189 Ga0070664_100129446 3300005564 Bacteria 2216
190 Ga0070664_100363142 3300005564 Bacteria 1319
191 Ga0070664_100556568 3300005564 Bacteria 1061
192 Ga0068857_100004707 3300005577 Bacteria 11566
193 Ga0068857_100099316 3300005577 Bacteria 2611
194 Ga0068854_100013937 3300005578 Bacteria 5288
195 Ga0068856_100090862 3300005614 Bacteria 3038
196 Ga0068856_100274594 3300005614 Bacteria 1702
197 Ga0068856_100316935 3300005614 Bacteria 1577
198 Ga0068856_100377500 3300005614 Bacteria 1437
199 Ga0068856_100513005 3300005614 Bacteria 1220
200 Ga0070702_100002160 3300005615 Bacteria 8361
201 Ga0070702_100058756 3300005615 Bacteria 2229
202 Ga0070702_100090997 3300005615 Bacteria 1850
203 Ga0070702_100551387 3300005615 Bacteria 856
204 Ga0068852_100009156 3300005616 Bacteria 7334
205 Ga0068852_100029216 3300005616 Bacteria 4525
206 Ga0068852_100335326 3300005616 Bacteria 1472
207 Ga0068859_100047469 3300005617 Bacteria 4314
208 Ga0068859_100093559 3300005617 Bacteria 3057
209 Ga0068859_100312167 3300005617 Bacteria 1666
210 Ga0068859_100557151 3300005617 Bacteria 1241
211 Ga0068864_100004704 3300005618 Bacteria 11195
212 Ga0068864_100009782 3300005618 Bacteria 7905
213 Ga0068864_100080001 3300005618 Bacteria 2863
214 Ga0068864_100201456 3300005618 Bacteria 1829
215 Ga0068866_10004095 3300005718 Bacteria 5982
216 Ga0068866_10197501 3300005718 Bacteria 1200
217 Ga0068861_100017474 3300005719 Bacteria 5094
218 Ga0068861_100057206 3300005719 Bacteria 2978
219 Ga0068861_100295122 3300005719 Bacteria 1401
220 Ga0068861_100475583 3300005719 Bacteria 1125
221 Ga0068851_10009739 3300005834 Bacteria 4476
222 Ga0068870_10004328 3300005840 Bacteria 6109
223 Ga0068870_10005082 3300005840 Bacteria 5719
224 Ga0068863_100005050 3300005841 Bacteria 13012
225 Ga0068863_100014875 3300005841 Bacteria 7475
226 Ga0068863_100044944 3300005841 Bacteria 4192
227 Ga0068863_100512502 3300005841 Bacteria 1182
228 Ga0068858_100008255 3300005842 Bacteria 10009
229 Ga0068858_100041195 3300005842 Bacteria 4283
230 Ga0068860_100007113 3300005843 Bacteria 11195
231 Ga0068860_100046816 3300005843 Bacteria 4123
232 Ga0068862_100007625 3300005844 Bacteria 8962
233 Ga0068862_100086826 3300005844 Bacteria 2720
234 Ga0068862_100394166 3300005844 Bacteria 1294
235 Ga0081455_10004617 3300005937 Bacteria 15376
236 Ga0081455_10005751 3300005937 Bacteria 13521
237 Ga0081455_10235690 3300005937 Bacteria 1348
238 Ga0081455_10299808 3300005937 Bacteria 1154
239 Ga0081538_10020707 3300005981 Bacteria 4829
240 Ga0081540_1001688 3300005983 Bacteria 18755
241 Ga0081540_1002923 3300005983 Bacteria 13756
242 Ga0081540_1009895 3300005983 Bacteria 6508
243 Ga0081539_10003785 3300005985 Bacteria 17869
244 Ga0081539_10019455 3300005985 Bacteria 4646
245 Ga0081539_10021469 3300005985 Bacteria 4312
246 Ga0081539_10072437 3300005985 Bacteria 1841
247 Ga0081539_10095390 3300005985 Bacteria 1528
248 Ga0070717_10003779 3300006028 Bacteria 10878
249 Ga0070717_10015928 3300006028 Bacteria 5819
250 Ga0070717_10048243 3300006028 Bacteria 3492
251 Ga0070717_10139812 3300006028 Bacteria 2088
252 Ga0070717_10441941 3300006028 Bacteria 1171
253 Ga0075365_10026618 3300006038 Bacteria 3673
254 Ga0075365_10140400 3300006038 Bacteria 1677
255 Ga0075365_10163298 3300006038 Bacteria 1553
256 Ga0075365_10273891 3300006038 Bacteria 1187
257 Ga0075365_10496570 3300006038 Bacteria 862
258 Ga0075364_10002553 3300006051 Bacteria 10200
259 Ga0075432_10076047 3300006058 Bacteria 1212
260 Ga0070716_100010739 3300006173 Bacteria 4601
261 Ga0070716_100053462 3300006173 Bacteria 2303
262 Ga0070716_100184782 3300006173 Bacteria 1372
263 Ga0070716_100359132 3300006173 Bacteria 1034
264 Ga0070712_100003573 3300006175 Bacteria 9577
265 Ga0070712_100016638 3300006175 Bacteria 4751
266 Ga0070712_100122234 3300006175 Bacteria 1960
267 Ga0070712_100139359 3300006175 Bacteria 1849
268 Ga0070712_100365042 3300006175 Bacteria 1185
269 Ga0070712_100407066 3300006175 Bacteria 1125
270 Ga0075362_10241676 3300006177 Bacteria 887
271 Ga0075367_10003976 3300006178 Bacteria 7138
272 Ga0075369_10064360 3300006186 Bacteria 1605
273 Ga0097621_100004513 3300006237 Bacteria 9706
274 Ga0097621_100467307 3300006237 Bacteria 1139
275 Ga0075370_10057493 3300006353 Bacteria 2211
276 Ga0075370_10211328 3300006353 Bacteria 1146
277 Ga0068871_100012856 3300006358 Bacteria 6197
278 Ga0068871_100256293 3300006358 Bacteria 1525
279 Ga0068871_100640353 3300006358 Bacteria 970
280 Ga0075428_100121815 3300006844 Bacteria 2840
281 Ga0075428_100128951 3300006844 Bacteria 2752
282 Ga0075428_100146476 3300006844 Bacteria 2566
283 Ga0075428_100379353 3300006844 Bacteria 1516
284 Ga0075428_100427259 3300006844 Bacteria 1419
285 Ga0075428_100614108 3300006844 Bacteria 1161
286 Ga0075428_100907265 3300006844 Bacteria 934
287 Ga0075430_100047302 3300006846 Bacteria 3632
288 Ga0075430_100066972 3300006846 Bacteria 3015
289 Ga0075430_100348701 3300006846 Bacteria 1223
290 Ga0075431_100061704 3300006847 Bacteria 3868
291 Ga0075431_100205538 3300006847 Bacteria 2013
292 Ga0075431_100517639 3300006847 Bacteria 1183
293 Ga0075433_10196719 3300006852 Bacteria 1793
294 Ga0075434_100118279 3300006871 Bacteria 2664
295 Ga0075434_100131513 3300006871 Bacteria 2522
296 Ga0075434_100211466 3300006871 Bacteria 1959
297 Ga0075434_100229670 3300006871 Bacteria 1875
298 Ga0075434_100445691 3300006871 Bacteria 1316
299 Ga0075429_100296701 3300006880 Bacteria 1415
300 Ga0075429_100347525 3300006880 Bacteria 1298
301 Ga0068865_100008478 3300006881 Bacteria 6355
302 Ga0068865_100054808 3300006881 Bacteria 2772
303 Ga0075436_100008678 3300006914 Bacteria 6946
304 Ga0075436_100088469 3300006914 Bacteria 2152
305 Ga0075436_100104645 3300006914 Bacteria 1973
306 Ga0075436_100434978 3300006914 Bacteria 954
307 Ga0097620_100047472 3300006931 Bacteria 4314
308 Ga0097620_100093559 3300006931 Bacteria 3057
309 Ga0097620_100312184 3300006931 Bacteria 1666
310 Ga0097620_100557091 3300006931 Bacteria 1241
311 Ga0099824_1009169 3300006942 Bacteria 12291
312 Ga0099822_1012158 3300006943 Bacteria 10347
313 Ga0075435_100008690 3300007076 Bacteria 7305
314 Ga0075435_100709120 3300007076 Bacteria 875
315 Ga0099794_10008987 3300007265 Bacteria 4171
316 Ga0099794_10040959 3300007265 Bacteria 2204
317 Ga0099794_10074240 3300007265 Bacteria 1670
318 Ga0099795_10000441 3300007788 Bacteria 7618
319 Ga0099795_10024476 3300007788 Bacteria 2014
320 Ga0099795_10066158 3300007788 Bacteria 1353
321 Ga0099795_10094123 3300007788 Bacteria 1166
322 Ga0105251_10088082 3300009011 Bacteria 1428
323 Ga0105244_10081325 3300009036 Bacteria 1603
324 Ga0105240_10048174 3300009093 Bacteria 5388
325 Ga0105240_10063893 3300009093 Bacteria 4576
326 Ga0105240_10099376 3300009093 Bacteria 3542
327 Ga0105240_11046430 3300009093 Bacteria 871
328 Ga0111539_10087869 3300009094 Bacteria 3652
329 Ga0111539_10097294 3300009094 Bacteria 3457
330 Ga0111539_10122649 3300009094 Bacteria 3046
331 Ga0111539_10170022 3300009094 Bacteria 2547
332 Ga0105245_10006657 3300009098 Bacteria 10142
333 Ga0105245_10011565 3300009098 Bacteria 7688
334 Ga0105245_10042174 3300009098 Bacteria 4071
335 Ga0105247_10003741 3300009101 Bacteria 9868
336 Ga0105247_10020804 3300009101 Bacteria 3946
337 Ga0105247_10035674 3300009101 Bacteria 3032
338 Ga0105247_10038462 3300009101 Bacteria 2921
339 Ga0105247_10049424 3300009101 Bacteria 2586
340 Ga0105247_10074650 3300009101 Bacteria 2127
341 Ga0114129_10059852 3300009147 Bacteria 5325
342 Ga0114129_10203045 3300009147 Bacteria 2683
343 Ga0114129_10422172 3300009147 Bacteria 1754
344 Ga0114129_10723256 3300009147 Bacteria 1277
345 Ga0105243_10070118 3300009148 Bacteria 2829
346 Ga0105243_10282345 3300009148 Bacteria 1496
347 Ga0105241_10008231 3300009174 Bacteria 7678
348 Ga0105241_10034255 3300009174 Bacteria 3814
349 Ga0105242_10029002 3300009176 Bacteria 4410
350 Ga0105242_10295399 3300009176 Bacteria 1477
351 Ga0105248_10059261 3300009177 Bacteria 4300
352 Ga0105248_10138902 3300009177 Bacteria 2741
353 Ga0105248_10369308 3300009177 Bacteria 1615
354 Ga0105248_10393057 3300009177 Bacteria 1561
355 Ga0105248_10615759 3300009177 Bacteria 1225
356 Ga0105248_10629628 3300009177 Bacteria 1210
357 Ga0105237_10002982 3300009545 Bacteria 20460
358 Ga0105237_10053877 3300009545 Bacteria 4033
359 Ga0105237_10055541 3300009545 Bacteria 3965
360 Ga0105237_10131772 3300009545 Bacteria 2494
361 Ga0105238_10005756 3300009551 Bacteria 12263
362 Ga0105238_10029879 3300009551 Bacteria 5549
363 Ga0105238_10064315 3300009551 Bacteria 3668
364 Ga0105238_10091379 3300009551 Bacteria 3031
365 Ga0105238_10117557 3300009551 Bacteria 2639
366 Ga0105238_10639322 3300009551 Bacteria 1073
367 Ga0105249_10026496 3300009553 Bacteria 5224
368 Ga0105249_10057738 3300009553 Bacteria 3556
369 Ga0105249_10092266 3300009553 Bacteria 2835
370 Ga0105249_10133579 3300009553 Bacteria 2372
371 Ga0105029_107684 3300009984 Bacteria 785
372 Ga0099796_10001698 3300010159 Bacteria 4566
373 Ga0099796_10001865 3300010159 Bacteria 4439
374 Ga0099796_10007090 3300010159 Bacteria 2912
375 Ga0099796_10048575 3300010159 Bacteria 1464
376 Ga0099796_10052230 3300010159 Bacteria 1423
377 Ga0105239_10016807 3300010375 Bacteria 8088
378 Ga0105239_10035074 3300010375 Bacteria 5509
379 Ga0105239_10090414 3300010375 Bacteria 3377
380 Ga0105239_10169861 3300010375 Bacteria 2438
381 Ga0105239_10299879 3300010375 Bacteria 1810
382 Ga0105246_10020411 3300011119 Bacteria 4249
383 Ga0105246_10065320 3300011119 Bacteria 2544
384 Ga0105246_10136614 3300011119 Bacteria 1838
385 Ga0105246_10749675 3300011119 Bacteria 861
386 Ga0157371_10498812 3300013102 Bacteria 899
387 Ga0157370_10035007 3300013104 Bacteria 4886
388 Ga0157370_10114027 3300013104 Bacteria 2525
389 Ga0157370_10508487 3300013104 Bacteria 1106
390 Ga0157370_10770111 3300013104 Bacteria 876
391 Ga0157369_10001818 3300013105 Bacteria 25829
392 Ga0157369_10008070 3300013105 Bacteria 12073
393 Ga0157369_10101657 3300013105 Bacteria 3063
394 Ga0157374_10010373 3300013296 Bacteria 8014
395 Ga0157374_10034810 3300013296 Bacteria 4603
396 Ga0157378_10129148 3300013297 Bacteria 2337
397 Ga0157378_10142012 3300013297 Bacteria 2230
398 Ga0157378_10738696 3300013297 Bacteria 1006
399 Ga0163162_10087541 3300013306 Bacteria 3193
400 Ga0163162_10243031 3300013306 Bacteria 1931
401 Ga0163162_10373032 3300013306 Bacteria 1560
402 Ga0163162_10381981 3300013306 Bacteria 1542
403 Ga0163162_11075866 3300013306 Bacteria 911
404 Ga0157372_10004050 3300013307 Bacteria 15705
405 Ga0157372_10160662 3300013307 Bacteria 2597
406 Ga0157372_10438263 3300013307 Bacteria 1523
407 Ga0157372_10538770 3300013307 Bacteria 1361
408 Ga0157375_10015123 3300013308 Bacteria 6902
409 Ga0157375_10090637 3300013308 Bacteria 3116
410 Ga0157375_10407215 3300013308 Bacteria 1526
411 Ga0157375_10418534 3300013308 Unclassified 1506
412 Ga0157375_11042996 3300013308 Bacteria 956
413 Ga0163163_10010748 3300014325 Bacteria 8256
414 Ga0163163_10049335 3300014325 Bacteria 4142
415 Ga0163163_10138553 3300014325 Bacteria 2475
416 Ga0163163_10236146 3300014325 Bacteria 1877
417 Ga0163163_10417182 3300014325 Bacteria 1401
418 Ga0157380_10025703 3300014326 Bacteria 4468
419 Ga0157380_10048738 3300014326 Bacteria 3338
420 Ga0157380_10081638 3300014326 Bacteria 2645
421 Ga0157377_10007621 3300014745 Bacteria 5238
422 Ga0157377_10493536 3300014745 Bacteria 854
423 Ga0157379_10027562 3300014968 Bacteria 5058
424 Ga0157379_10238949 3300014968 Bacteria 1648
425 Ga0157376_10074712 3300014969 Bacteria 2890
426 Ga0157376_10182891 3300014969 Bacteria 1917
427 Ga0157376_10381575 3300014969 Bacteria 1358
428 Ga0163161_10015441 3300017792 Bacteria 5324
429 Ga0163161_10373676 3300017792 Bacteria 1138
430 Ga0213873_10012361 3300021358 Bacteria 1850
431 Ga0213872_10048695 3300021361 Bacteria 1926
432 Ga0213872_10056759 3300021361 Bacteria 1774
433 Ga0213874_10016816 3300021377 Bacteria 1954
434 Ga0213876_10003691 3300021384 Bacteria 8687
435 Ga0213876_10127457 3300021384 Bacteria 1352
436 Ga0213871_10002516 3300021441 Bacteria 3378
437 Ga0213871_10018478 3300021441 Bacteria 1706
438 Ga0224572_1041130 3300024225 Bacteria 870
439 Ga0209435_100091 3300025206 Bacteria 41951
440 Ga0209646_1000295 3300025246 Bacteria 41951
441 Ga0209026_1000366 3300025250 Bacteria 41951
442 Ga0209759_1000513 3300025256 Bacteria 41951
443 Ga0209233_1002293 3300025261 Bacteria 7134
444 Ga0209233_1008990 3300025261 Bacteria 3057
445 Ga0209130_1000389 3300025284 Bacteria 48487
446 Ga0209758_1004239 3300025297 Bacteria 12134
447 Ga0207426_1000361 3300025302 Bacteria 81889
448 Ga0207426_1025172 3300025302 Bacteria 2008
449 Ga0207697_10008248 3300025315 Bacteria 4573
450 Ga0207656_10013388 3300025321 Bacteria 3135
451 Ga0207656_10020494 3300025321 Bacteria 2629
452 Ga0207682_10013567 3300025893 Bacteria 3174
453 Ga0207692_10000880 3300025898 Bacteria 10851
454 Ga0207642_10187404 3300025899 Bacteria 1132
455 Ga0207710_10002838 3300025900 Bacteria 7895
456 Ga0207710_10019649 3300025900 Bacteria 2882
457 Ga0207710_10082431 3300025900 Bacteria 1494
458 Ga0207688_10001906 3300025901 Bacteria 11175
459 Ga0207688_10002332 3300025901 Bacteria 10203
460 Ga0207688_10048591 3300025901 Bacteria 2370
461 Ga0207680_10079461 3300025903 Bacteria 2057
462 Ga0207680_10377148 3300025903 Bacteria 999
463 Ga0207647_10004250 3300025904 Bacteria 10615
464 Ga0207647_10088873 3300025904 Bacteria 1844
465 Ga0207647_10094052 3300025904 Bacteria 1786
466 Ga0207685_10074761 3300025905 Bacteria 1384
467 Ga0207685_10201347 3300025905 Bacteria 935
468 Ga0207699_10002228 3300025906 Bacteria 9146
469 Ga0207699_10082613 3300025906 Bacteria 1996
470 Ga0207699_10111388 3300025906 Bacteria 1755
471 Ga0207699_10428640 3300025906 Bacteria 946
472 Ga0207645_10010970 3300025907 Bacteria 6200
473 Ga0207645_10026220 3300025907 Bacteria 3767
474 Ga0207645_10034046 3300025907 Bacteria 3273
475 Ga0207645_10038240 3300025907 Bacteria 3077
476 Ga0207643_10002034 3300025908 Bacteria 11165
477 Ga0207643_10014811 3300025908 Bacteria 4241
478 Ga0207705_10161483 3300025909 Bacteria 1684
479 Ga0207684_10083513 3300025910 Bacteria 2720
480 Ga0207684_10111421 3300025910 Bacteria 2343
481 Ga0207684_10742172 3300025910 Bacteria 832
482 Ga0207654_10002780 3300025911 Bacteria 8888
483 Ga0207654_10078431 3300025911 Bacteria 1982
484 Ga0207707_10010663 3300025912 Bacteria 7984
485 Ga0207707_10017265 3300025912 Bacteria 6289
486 Ga0207707_10053530 3300025912 Bacteria 3513
487 Ga0207707_10807096 3300025912 Bacteria 781
488 Ga0207695_10254758 3300025913 Bacteria 1654
489 Ga0207671_10007430 3300025914 Bacteria 9508
490 Ga0207671_10150972 3300025914 Bacteria 1795
491 Ga0207671_10170500 3300025914 Bacteria 1690
492 Ga0207671_10174915 3300025914 Bacteria 1668
493 Ga0207671_10589229 3300025914 Bacteria 886
494 Ga0207693_10006271 3300025915 Bacteria 9862
495 Ga0207693_10017660 3300025915 Bacteria 5688
496 Ga0207693_10020813 3300025915 Bacteria 5216
497 Ga0207693_10122957 3300025915 Bacteria 2038
498 Ga0207693_10334496 3300025915 Bacteria 1185
499 Ga0207693_10454112 3300025915 Bacteria 1001
500 Ga0207693_10498647 3300025915 Bacteria 950
501 Ga0207663_10002278 3300025916 Bacteria 9186
502 Ga0207663_10050857 3300025916 Bacteria 2577
503 Ga0207663_10096389 3300025916 Bacteria 1976
504 Ga0207663_10164948 3300025916 Bacteria 1568
505 Ga0207663_10282365 3300025916 Bacteria 1234
506 Ga0207663_10633890 3300025916 Bacteria 842
507 Ga0207660_10005920 3300025917 Bacteria 7941
508 Ga0207660_10055147 3300025917 Bacteria 2839
509 Ga0207660_10072531 3300025917 Bacteria 2508
510 Ga0207660_10089440 3300025917 Bacteria 2279
511 Ga0207660_10268682 3300025917 Bacteria 1351
512 Ga0207660_10362776 3300025917 Bacteria 1162
513 Ga0207662_10004685 3300025918 Bacteria 7219
514 Ga0207662_10006282 3300025918 Bacteria 6401
515 Ga0207657_10002785 3300025919 Bacteria 18801
516 Ga0207657_10038506 3300025919 Bacteria 4256
517 Ga0207657_10150596 3300025919 Bacteria 1895
518 Ga0207649_10000031 3300025920 Bacteria 146217
519 Ga0207649_10000033 3300025920 Bacteria 139416
520 Ga0207649_10137525 3300025920 Bacteria 1667
521 Ga0207649_10417491 3300025920 Bacteria 1007
522 Ga0207652_10007295 3300025921 Bacteria 8904
523 Ga0207652_10034133 3300025921 Bacteria 4287
524 Ga0207652_10067755 3300025921 Bacteria 3096
525 Ga0207652_10400632 3300025921 Bacteria 1238
526 Ga0207652_10615235 3300025921 Bacteria 973
527 Ga0207681_10109735 3300025923 Bacteria 2005
528 Ga0207681_10117307 3300025923 Bacteria 1946
529 Ga0207694_10004400 3300025924 Bacteria 11004
530 Ga0207694_10076254 3300025924 Bacteria 2626
531 Ga0207694_10463499 3300025924 Bacteria 1059
532 Ga0207650_10002738 3300025925 Bacteria 12166
533 Ga0207650_10027115 3300025925 Bacteria 4097
534 Ga0207650_10063064 3300025925 Bacteria 2770
535 Ga0207650_10131050 3300025925 Bacteria 1962
536 Ga0207659_10010009 3300025926 Bacteria 5940
537 Ga0207659_10015533 3300025926 Bacteria 4936
538 Ga0207687_10005847 3300025927 Bacteria 8137
539 Ga0207687_10010555 3300025927 Bacteria 6036
540 Ga0207687_10111636 3300025927 Bacteria 2030
541 Ga0207687_10142963 3300025927 Bacteria 1817
542 Ga0207700_10006859 3300025928 Bacteria 6924
543 Ga0207700_10046006 3300025928 Bacteria 3224
544 Ga0207700_10048646 3300025928 Bacteria 3150
545 Ga0207700_10086525 3300025928 Bacteria 2463
546 Ga0207700_10132540 3300025928 Bacteria 2037
547 Ga0207700_10140670 3300025928 Bacteria 1983
548 Ga0207700_10306789 3300025928 Bacteria 1372
549 Ga0207700_10316065 3300025928 Bacteria 1352
550 Ga0207700_10481406 3300025928 Bacteria 1097
551 Ga0207700_10764645 3300025928 Bacteria 863
552 Ga0207700_10898641 3300025928 Bacteria 793
553 Ga0207664_10032247 3300025929 Bacteria 4014
554 Ga0207664_10072622 3300025929 Bacteria 2774
555 Ga0207664_10353106 3300025929 Bacteria 1302
556 Ga0207644_10010237 3300025931 Bacteria 6181
557 Ga0207644_10010951 3300025931 Bacteria 5991
558 Ga0207644_10012480 3300025931 Bacteria 5645
559 Ga0207690_10002494 3300025932 Bacteria 11127
560 Ga0207690_10069545 3300025932 Bacteria 2422
561 Ga0207690_10073108 3300025932 Bacteria 2370
562 Ga0207690_10225112 3300025932 Bacteria 1437
563 Ga0207690_10316053 3300025932 Bacteria 1226
564 Ga0207706_10001779 3300025933 Bacteria 21159
565 Ga0207706_10003134 3300025933 Bacteria 15886
566 Ga0207706_10024619 3300025933 Bacteria 5395
567 Ga0207706_10081024 3300025933 Bacteria 2853
568 Ga0207706_10256945 3300025933 Bacteria 1525
569 Ga0207706_10294259 3300025933 Bacteria 1415
570 Ga0207706_10351132 3300025933 Bacteria 1282
571 Ga0207686_10044106 3300025934 Bacteria 2736
572 Ga0207709_10016786 3300025935 Bacteria 4078
573 Ga0207709_10115209 3300025935 Bacteria 1805
574 Ga0207709_10352062 3300025935 Bacteria 1112
575 Ga0207670_10021392 3300025936 Bacteria 3990
576 Ga0207670_10029969 3300025936 Bacteria 3472
577 Ga0207670_10290942 3300025936 Bacteria 1276
578 Ga0207669_10005756 3300025937 Bacteria 5595
579 Ga0207669_10520971 3300025937 Bacteria 954
580 Ga0207704_10010329 3300025938 Bacteria 4549
581 Ga0207665_10015878 3300025939 Bacteria 4942
582 Ga0207665_10083685 3300025939 Bacteria 2201
583 Ga0207665_10144852 3300025939 Bacteria 1697
584 Ga0207665_10382972 3300025939 Bacteria 1068
585 Ga0207691_10006507 3300025940 Bacteria 11273
586 Ga0207691_10007515 3300025940 Bacteria 10489
587 Ga0207691_10253496 3300025940 Bacteria 1518
588 Ga0207691_10317525 3300025940 Bacteria 1336
589 Ga0207691_10426154 3300025940 Bacteria 1130
590 Ga0207711_10010088 3300025941 Bacteria 7851
591 Ga0207711_10118037 3300025941 Bacteria 2367
592 Ga0207711_10182716 3300025941 Bacteria 1908
593 Ga0207711_10381207 3300025941 Bacteria 1308
594 Ga0207689_10001370 3300025942 Bacteria 23353
595 Ga0207689_10008563 3300025942 Bacteria 8915
596 Ga0207661_10012149 3300025944 Bacteria 6252
597 Ga0207661_10035468 3300025944 Bacteria 3887
598 Ga0207679_10176707 3300025945 Bacteria 1763
599 Ga0207679_10280389 3300025945 Bacteria 1429
600 Ga0207679_10583956 3300025945 Bacteria 1005
601 Ga0207679_10797351 3300025945 Bacteria 861
602 Ga0207679_10839664 3300025945 Bacteria 839
603 Ga0207667_10010887 3300025949 Bacteria 10605
604 Ga0207667_10182003 3300025949 Bacteria 2158
605 Ga0207667_10929025 3300025949 Bacteria 860
606 Ga0207651_10006050 3300025960 Bacteria 6284
607 Ga0207651_10049466 3300025960 Bacteria 2848
608 Ga0207651_10175172 3300025960 Bacteria 1696
609 Ga0207712_10055094 3300025961 Bacteria 2796
610 Ga0207712_10082319 3300025961 Bacteria 2346
611 Ga0207712_10257091 3300025961 Bacteria 1415
612 Ga0207712_10488089 3300025961 Bacteria 1051
613 Ga0207668_10029634 3300025972 Bacteria 3588
614 Ga0207668_10066722 3300025972 Bacteria 2551
615 Ga0207668_10130771 3300025972 Bacteria 1916
616 Ga0207668_10315769 3300025972 Bacteria 1295
617 Ga0207668_10437286 3300025972 Bacteria 1113
618 Ga0207640_10028881 3300025981 Bacteria 3397
619 Ga0207640_10137437 3300025981 Bacteria 1776
620 Ga0207640_10517461 3300025981 Bacteria 997
621 Ga0207658_10271554 3300025986 Bacteria 1450
622 Ga0207677_10007022 3300026023 Bacteria 6195
623 Ga0207677_10859754 3300026023 Bacteria 815
624 Ga0207703_10005527 3300026035 Bacteria 10149
625 Ga0207703_10087571 3300026035 Bacteria 2611
626 Ga0207703_10178690 3300026035 Bacteria 1872
627 Ga0207703_10301275 3300026035 Bacteria 1462
628 Ga0207639_10018693 3300026041 Bacteria 4928
629 Ga0207639_10179605 3300026041 Bacteria 1799
630 Ga0207639_10434586 3300026041 Bacteria 1189
631 Ga0207639_10574955 3300026041 Bacteria 1037
632 Ga0207678_10004671 3300026067 Bacteria 12299
633 Ga0207678_10006952 3300026067 Bacteria 10045
634 Ga0207678_10025982 3300026067 Bacteria 5109
635 Ga0207678_10027109 3300026067 Bacteria 4996
636 Ga0207678_10856244 3300026067 Bacteria 803
637 Ga0207708_10001428 3300026075 Bacteria 17910
638 Ga0207708_10007178 3300026075 Bacteria 8235
639 Ga0207708_10029917 3300026075 Bacteria 4129
640 Ga0207702_10088425 3300026078 Bacteria 2706
641 Ga0207702_10270409 3300026078 Bacteria 1603
642 Ga0207702_10405922 3300026078 Bacteria 1315
643 Ga0207702_10735139 3300026078 Bacteria 974
644 Ga0207702_10748554 3300026078 Bacteria 965
645 Ga0207641_10017293 3300026088 Bacteria 5902
646 Ga0207641_10025809 3300026088 Bacteria 4846
647 Ga0207641_10256148 3300026088 Bacteria 1636
648 Ga0207648_10004473 3300026089 Bacteria 14342
649 Ga0207648_10010764 3300026089 Bacteria 8642
650 Ga0207648_10139092 3300026089 Bacteria 2140
651 Ga0207648_10309360 3300026089 Bacteria 1418
652 Ga0207648_10431927 3300026089 Bacteria 1197
653 Ga0207676_10010604 3300026095 Bacteria 6568
654 Ga0207676_10010854 3300026095 Bacteria 6497
655 Ga0207676_10067232 3300026095 Bacteria 2862
656 Ga0207674_10015065 3300026116 Bacteria 8514
657 Ga0207674_10051516 3300026116 Bacteria 4201
658 Ga0207674_10081726 3300026116 Bacteria 3233
659 Ga0207674_10174528 3300026116 Bacteria 2102
660 Ga0207674_10308462 3300026116 Bacteria 1532
661 Ga0207675_100001777 3300026118 Bacteria 21552
662 Ga0207675_100003458 3300026118 Bacteria 15440
663 Ga0207675_100213360 3300026118 Bacteria 1858
664 Ga0207675_100348625 3300026118 Bacteria 1451
665 Ga0207675_100756441 3300026118 Bacteria 983
666 Ga0207683_10003755 3300026121 Bacteria 13166
667 Ga0207683_10010729 3300026121 Bacteria 7811
668 Ga0207683_10023225 3300026121 Bacteria 5331
669 Ga0207683_10048576 3300026121 Bacteria 3715
670 Ga0207683_10315499 3300026121 Bacteria 1431
671 Ga0207698_10005989 3300026142 Bacteria 7558
672 Ga0207698_10153205 3300026142 Bacteria 2004
673 Ga0207698_10257106 3300026142 Bacteria 1602
674 Ga0207698_10666931 3300026142 Bacteria 1032
675 Ga0209589_1000006 3300027357 Bacteria 436292
676 Ga0209489_100007 3300027361 Bacteria 436292
677 Ga0209700_100008 3300027363 Bacteria 436292
678 Ga0209179_1005350 3300027512 Bacteria 2003
679 Ga0209179_1014263 3300027512 Bacteria 1456
680 Ga0209588_1001156 3300027671 Bacteria 6803
681 Ga0209588_1046820 3300027671 Bacteria 1399
682 Ga0207428_10094389 3300027907 Bacteria 2319
683 Ga0207428_10391742 3300027907 Bacteria 1018
684 Ga0268266_10002524 3300028379 Bacteria 19477
685 Ga0268266_10002721 3300028379 Bacteria 18537
686 Ga0268266_10005528 3300028379 Bacteria 11762
687 Ga0268266_10008468 3300028379 Bacteria 9143
688 Ga0268266_10010821 3300028379 Bacteria 7948
689 Ga0268266_10181864 3300028379 Bacteria 1915
690 Ga0268266_10267273 3300028379 Bacteria 1587
691 Ga0268265_10007472 3300028380 Bacteria 7379
692 Ga0268265_10123881 3300028380 Bacteria 2135
693 Ga0268265_10164209 3300028380 Bacteria 1890
694 Ga0268265_10881527 3300028380 Bacteria 877
695 Ga0268264_10000174 3300028381 Bacteria 137254
696 Ga0268264_10031810 3300028381 Bacteria 4327
697 Ga0268264_10055736 3300028381 Bacteria 3303
698 Ga0268264_10645447 3300028381 Bacteria 1047
699 Ga0265338_10069616 3300028800 Bacteria 3021
700 Ga0265338_10087780 3300028800 Bacteria 2583
701 Ga0265324_10006333 3300029957 Bacteria 4957
702 Ga0265330_10006018 3300031235 Bacteria 6007
703 Ga0265330_10168617 3300031235 Bacteria 928
704 Ga0265332_10039386 3300031238 Bacteria 2047
705 Ga0265328_10000006 3300031239 Bacteria 227698
706 Ga0265328_10000450 3300031239 Bacteria 19127
707 Ga0265328_10009243 3300031239 Bacteria 4022
708 Ga0265328_10021734 3300031239 Bacteria 2446
709 Ga0265328_10051919 3300031239 Bacteria 1505
710 Ga0265328_10082408 3300031239 Bacteria 1186
711 Ga0265320_10002095 3300031240 Bacteria 14042
712 Ga0265325_10008854 3300031241 Bacteria 5913
713 Ga0265325_10013263 3300031241 Bacteria 4697
714 Ga0265325_10024250 3300031241 Bacteria 3302
715 Ga0265325_10026580 3300031241 Bacteria 3133
716 Ga0265325_10115409 3300031241 Bacteria 1300
717 Ga0265340_10003647 3300031247 Bacteria 8655
718 Ga0265340_10006812 3300031247 Bacteria 6253
719 Ga0265340_10033125 3300031247 Bacteria 2575
720 Ga0265340_10123680 3300031247 Bacteria 1189
721 Ga0265339_10000137 3300031249 Bacteria 60322
722 Ga0265339_10009370 3300031249 Bacteria 6159
723 Ga0265339_10030160 3300031249 Bacteria 3072
724 Ga0265339_10041964 3300031249 Bacteria 2535
725 Ga0265331_10000141 3300031250 Bacteria 94896
726 Ga0265331_10000145 3300031250 Bacteria 92545
727 Ga0265331_10000673 3300031250 Bacteria 29339
728 Ga0265331_10000882 3300031250 Bacteria 24333
729 Ga0265331_10019993 3300031250 Bacteria 3446
730 Ga0265331_10099921 3300031250 Bacteria 1336
731 Ga0265331_10133630 3300031250 Bacteria 1131
732 Ga0265327_10000033 3300031251 Bacteria 317182
733 Ga0265327_10000070 3300031251 Bacteria 217350
734 Ga0265327_10000703 3300031251 Bacteria 53052
735 Ga0265327_10008302 3300031251 Bacteria 7769
736 Ga0265327_10099810 3300031251 Bacteria 1402
737 Ga0265316_10000091 3300031344 Bacteria 96882
738 Ga0265316_10041888 3300031344 Bacteria 3661
739 Ga0265316_10068276 3300031344 Bacteria 2747
740 Ga0265316_10070886 3300031344 Bacteria 2687
741 Ga0265316_10398203 3300031344 Bacteria 992
742 Ga0265316_10414470 3300031344 Bacteria 969
743 Ga0265316_10621841 3300031344 Bacteria 765
744 Ga0307509_10006398 3300031507 Bacteria 15864
745 Ga0307509_10046824 3300031507 Bacteria 4653
746 Ga0307509_10050219 3300031507 Bacteria 4467
747 Ga0307509_10283105 3300031507 Bacteria 1418
748 Ga0265313_10000269 3300031595 Bacteria 56767
749 Ga0265313_10000782 3300031595 Bacteria 32152
750 Ga0265313_10001300 3300031595 Bacteria 23590
751 Ga0265313_10080712 3300031595 Bacteria 1478
752 Ga0265313_10148342 3300031595 Bacteria 1004
753 Ga0307508_10000105 3300031616 Bacteria 99107
754 Ga0307508_10063281 3300031616 Bacteria 3264
755 Ga0307508_10094506 3300031616 Bacteria 2580
756 Ga0265314_10001057 3300031711 Bacteria 32018
757 Ga0265314_10002651 3300031711 Bacteria 17962
758 Ga0265314_10002789 3300031711 Bacteria 17445
759 Ga0265314_10006484 3300031711 Bacteria 10350
760 Ga0265314_10042742 3300031711 Bacteria 3228
761 Ga0265314_10061525 3300031711 Bacteria 2556
762 Ga0265314_10095947 3300031711 Bacteria 1919
763 Ga0265314_10176091 3300031711 Bacteria 1286
764 Ga0265342_10008664 3300031712 Bacteria 7262
765 Ga0265342_10019274 3300031712 Bacteria 4400
766 Ga0265342_10033550 3300031712 Bacteria 3155
767 Ga0265342_10041441 3300031712 Bacteria 2788
768 Ga0265342_10299282 3300031712 Bacteria 848
769 Ga0316576_10389413 3300031727 Bacteria 1034
770 Ga0316578_10005177 3300031728 Bacteria 6289
771 Ga0307516_10000657 3300031730 Bacteria 46760
772 Ga0307516_10025929 3300031730 Bacteria 5960
773 Ga0307516_10046721 3300031730 Bacteria 4270
774 Ga0307516_10121468 3300031730 Bacteria 2402
775 Ga0307518_10422147 3300031838 Bacteria 731
776 Ga0307406_10380002 3300031901 Bacteria 1113
777 Ga0307416_100285090 3300032002 Bacteria 1631
778 Ga0307415_100046127 3300032126 Bacteria 2926
779 Ga0316583_10000233 3300032133 Bacteria 15084
780 Ga0307507_10101126 3300033179 Bacteria 2412
781 Ga0307510_10027931 3300033180 Bacteria 6453
782 Ga0307510_10028847 3300033180 Bacteria 6330
783 Ga0307510_10032970 3300033180 Bacteria 5828
784 Ga0315911_1000003 3300033442 Bacteria 502217
785 Ga0316215_1003294 3300033544 Bacteria 1535
786 Ga0373959_0122038 3300034820 Bacteria 638
787 Ga0373938_0014387 3300034957 Bacteria 1518
788 Ga0373926_0107403 3300035083 Bacteria 1047
789 Ga0373928_0010982 3300035084 Bacteria 1786
790 Ga0373934_0022581 3300035086 Bacteria 2428
791 Ga0373934_0095934 3300035086 Bacteria 1198
792 Ga0373940_0158077 3300035088 Bacteria 726
793 Ga0373944_0019687 3300035089 Bacteria 1938
794 Ga0373944_0033857 3300035089 Bacteria 1550
795 Ga0373944_0129889 3300035089 Bacteria 875
796 Ga0373949_0042525 3300035090 Bacteria 1122
797 Ga0373923_0012312 3300035111 Bacteria 3159
798 Ga0373923_0155147 3300035111 Bacteria 1042
799 Ga0373936_0000885 3300035113 Bacteria 10703
800 Ga0373936_0003367 3300035113 Bacteria 5990
801 Ga0373936_0095937 3300035113 Bacteria 1247
802 Ga0373939_0113964 3300035114 Bacteria 945
803 Ga0373945_0007786 3300035116 Bacteria 3476
804 Ga0373945_0014890 3300035116 Bacteria 2611
805 Ga0373945_0016878 3300035116 Bacteria 2468
806 Ga0373945_0105297 3300035116 Bacteria 1108
807 Ga0373953_0004630 3300035117 Bacteria 4398
808 Ga0373953_0004698 3300035117 Bacteria 4375
809 Ga0373953_0036551 3300035117 Bacteria 1935
810 Ga0373953_0176723 3300035117 Bacteria 920
811 Ga0373954_0000950 3300035118 Bacteria 11319
812 Ga0373954_0009404 3300035118 Bacteria 4297
813 Ga0373954_0023202 3300035118 Bacteria 2819
814 Ga0373954_0034271 3300035118 Bacteria 2351
815 Ga0373954_0042781 3300035118 Bacteria 2112
816 Ga0373954_0214303 3300035118 Bacteria 947
817 Ga0373956_0066659 3300035119 Bacteria 1638
818 Ga0373956_0115695 3300035119 Bacteria 1250
819 Ga0373956_0134170 3300035119 Bacteria 1160
820 Ga0373957_0011342 3300035120 Bacteria 2973
821 Ga0373957_0014124 3300035120 Bacteria 2724
822 Ga0373957_0085738 3300035120 Bacteria 1247
823 Ga0373943_0014141 3300035170 Bacteria 3609
824 Ga0373943_0047480 3300035170 Bacteria 2099
825 Ga0373943_0057788 3300035170 Bacteria 1929
826 Ga0373943_0102654 3300035170 Bacteria 1498
827 Ga0373943_0128823 3300035170 Bacteria 1352
828 Ga0373943_0201324 3300035170 Bacteria 1102
829 Ga0373943_0252177 3300035170 Bacteria 991
830 Ga0373943_0268221 3300035170 Bacteria 962
831 Ga0373946_0001576 3300035171 Bacteria 7942
832 Ga0373946_0006921 3300035171 Bacteria 4129
833 Ga0373946_0039314 3300035171 Bacteria 1931
834 Ga0373946_0202706 3300035171 Bacteria 951
835 Ga0373955_0000742 3300035172 Bacteria 14009
836 Ga0373955_0000886 3300035172 Bacteria 12852
837 Ga0373955_0047053 3300035172 Bacteria 2334
838 Ga0373955_0072915 3300035172 Bacteria 1924
839 Ga0373955_0164645 3300035172 Bacteria 1310
840 Ga0373961_0006767 3300035241 Bacteria 2758
841 Ga0316574_0293439 3300035398 Bacteria 1035
842 Ga0373924_0004542 3300035410 Bacteria 4850
843 Ga0373924_0010961 3300035410 Bacteria 3356
844 Ga0373924_0018781 3300035410 Bacteria 2670
845 Ga0373931_0008548 3300035691 Bacteria 4859
846 Ga0373931_0033811 3300035691 Bacteria 2651
847 Ga0373931_0036799 3300035691 Bacteria 2553
848 Ga0373931_0255773 3300035691 Bacteria 1067
849 Ga0373931_0272597 3300035691 Bacteria 1036
850 Ga0373935_0000096 3300035692 Bacteria 39013
851 Ga0373935_0000478 3300035692 Bacteria 20767
852 Ga0373935_0030724 3300035692 Bacteria 3330
853 Ga0373935_0056406 3300035692 Bacteria 2504
854 Ga0373935_0085096 3300035692 Bacteria 2061
855 Ga0373935_0164907 3300035692 Bacteria 1512
856 Ga0373935_0343190 3300035692 Bacteria 1063
857 Ga0373935_0386684 3300035692 Bacteria 1003
858 Ga0373927_0001272 3300035695 Bacteria 19085
859 Ga0373927_0002293 3300035695 Bacteria 14012
860 Ga0373927_0008757 3300035695 Bacteria 6798
861 Ga0373927_0018308 3300035695 Bacteria 4603
862 Ga0373927_0074347 3300035695 Bacteria 2200
863 Ga0373927_0136821 3300035695 Bacteria 1601
864 Ga0373927_0138432 3300035695 Bacteria 1591
865 Ga0373927_0157523 3300035695 Bacteria 1487
866 Ga0373927_0255099 3300035695 Bacteria 1153
867 Ga0373933_0001294 3300035724 Bacteria 14734
868 Ga0373933_0003722 3300035724 Bacteria 8429
869 Ga0373933_0042183 3300035724 Bacteria 2696
870 Ga0373933_0268650 3300035724 Bacteria 1100
871 Ga0373947_0000081 3300035725 Bacteria 48660
872 Ga0373947_0000843 3300035725 Bacteria 18525
873 Ga0373947_0007899 3300035725 Bacteria 6138
874 Ga0373947_0061030 3300035725 Bacteria 2290
875 Ga0373947_0062604 3300035725 Bacteria 2264
876 Ga0373947_0089470 3300035725 Bacteria 1918
877 Ga0373947_0166631 3300035725 Bacteria 1428
878 Ga0373947_0405417 3300035725 Bacteria 920
879 Ga0373937_0000515 3300036401 Bacteria 34939
880 Ga0373937_0002933 3300036401 Bacteria 14270
881 Ga0373937_0005300 3300036401 Bacteria 11020
882 Ga0373937_0032217 3300036401 Bacteria 4754
883 Ga0373937_0043424 3300036401 Bacteria 4103
884 Ga0373937_0047034 3300036401 Bacteria 3947
885 Ga0373937_0067718 3300036401 Bacteria 3290
886 Ga0373937_0074952 3300036401 Bacteria 3123
887 Ga0373937_0148832 3300036401 Bacteria 2193
888 Ga0373937_0187739 3300036401 Bacteria 1941
889 Ga0373937_0423725 3300036401 Bacteria 1263
890 Ga0373937_0536984 3300036401 Bacteria 1111
891 Ga0373937_1094580 3300036401 Bacteria 745
892 Ga0372808_004176 3300036459 Bacteria 1825
893 Ga0316582_0524902 3300036647 Bacteria 816
894 Ga0316584_0006337 3300036712 Bacteria 8016
895 Ga0316584_0068926 3300036712 Bacteria 2652
896 Ga0316584_0141881 3300036712 Bacteria 1791
897 Ga0373925_0000011 3300037068 Bacteria 209840
898 Ga0373925_0001296 3300037068 Bacteria 21916
899 Ga0373925_0025284 3300037068 Bacteria 4337
900 Ga0373925_0079999 3300037068 Bacteria 2484
901 Ga0373925_0109099 3300037068 Bacteria 2136
902 Ga0373925_0112460 3300037068 Bacteria 2105
903 Ga0373925_0123453 3300037068 Bacteria 2012
904 Ga0373925_0138814 3300037068 Bacteria 1901
905 Ga0373925_0426242 3300037068 Bacteria 1084
906 Ga0373925_0644329 3300037068 Bacteria 873
907 Ga0395899_0101941 3300037312 Bacteria 2071
908 Ga0395900_0347141 3300037418 Bacteria 1458
909 Ga0395898_0022529 3300037466 Bacteria 6379
910 Ga0395898_0030141 3300037466 Bacteria 5431
911 Ga0395905_0001778 3300037471 Bacteria 25004
912 Ga0395905_0020451 3300037471 Bacteria 6271
913 Ga0436364_0489075 3300037853 Bacteria 2109
914 Ga0395901_0352855 3300038443 Bacteria 1518
915 Ga0395901_1153766 3300038443 Bacteria 743
916 Ga0436365_0081603 3300039437 Bacteria 4352
917 Ga0436365_0808140 3300039437 Bacteria 2653
918 Ga0436360_0050348 3300039438 Bacteria 4179
919 Ga0436360_0170277 3300039438 Bacteria 1118
920 Ga0436360_0320963 3300039438 Bacteria 1204
921 Ga0436360_1074814 3300039438 Bacteria 5161
922 Ga0436360_1356508 3300039438 Bacteria 1278
923 Ga0436361_0256757 3300039447 Bacteria 1736
924 Ga0436361_0369023 3300039447 Bacteria 6346
925 Ga0436361_0452542 3300039447 Bacteria 1827
926 Ga0436361_0539018 3300039447 Bacteria 2789
927 Ga0436361_0740814 3300039447 Bacteria 4372
928 Ga0436361_0825589 3300039447 Bacteria 1275
929 Ga0436361_1002425 3300039447 Bacteria 2703
930 Ga0436363_0202525 3300039450 Bacteria 5216
931 Ga0436363_0419001 3300039450 Bacteria 4507
932 Ga0436363_0510027 3300039450 Bacteria 861
933 Ga0436363_0772297 3300039450 Bacteria 1349
934 Ga0436363_0947874 3300039450 Bacteria 1015
935 Ga0436363_1300598 3300039450 Bacteria 1694
936 Ga0436362_0138375 3300039453 Bacteria 2240
937 Ga0436362_0756530 3300039453 Bacteria 3447
938 Ga0439453_0000337 3300041408 Bacteria 4926
939 Ga0451793_1820481 3300041452 Bacteria 1081
940 Ga0439442_039143 3300042002 Bacteria 994
941 Ga0439443_020201 3300042003 Bacteria 1044
942 Ga0439434_0137912 3300042435 Bacteria 803
943 Ga0439435_0003544 3300042436 Bacteria 3261
944 Ga0439435_0010286 3300042436 Bacteria 2216
945 Ga0451577_0341346 3300042876 Bacteria 1358
946 Ga0453683_0012709 3300044673 Bacteria 5512
947 Ga0466966_0047159 3300044684 Bacteria 2749
948 Ga0466963_0035869 3300044694 Bacteria 3231
949 Ga0466963_0255841 3300044694 Bacteria 1229
950 Ga0453684_0000006 3300044712 Bacteria 1364191
951 Ga0453684_0000031 3300044712 Bacteria 752632
952 Ga0453684_0032690 3300044712 Bacteria 7272
953 Ga0453684_0037507 3300044712 Bacteria 6651
954 Ga0453684_0054779 3300044712 Bacteria 5191
955 Ga0453684_0720980 3300044712 Bacteria 1082
956 Ga0466957_0014629 3300044842 Bacteria 4571
957 Ga0466959_0142724 3300045049 Bacteria 1691
958 Ga0451576_0000056 3300045051 Bacteria 303398
959 Ga0451576_0000919 3300045051 Bacteria 55733
960 Ga0451576_0024090 3300045051 Bacteria 6577
961 Ga0451576_0111401 3300045051 Bacteria 2848
962 Ga0466958_0196272 3300045836 Bacteria 1284
963 Ga0466967_0071219 3300045976 Bacteria 3112
964 Ga0495592_0000493 3300046454 Bacteria 28774
965 Ga0495592_0027393 3300046454 Bacteria 4321
966 Ga0495592_0058610 3300046454 Bacteria 2839
967 Ga0495592_0132347 3300046454 Bacteria 1743
968 Ga0495592_0145179 3300046454 Bacteria 1646
969 Ga0495592_0344353 3300046454 Bacteria 957
970 Ga0495603_0002952 3300046455 Bacteria 10061
971 Ga0495603_0004318 3300046455 Bacteria 8477
972 Ga0495603_0008319 3300046455 Bacteria 6271
973 Ga0495603_0018514 3300046455 Bacteria 4214
974 Ga0495603_0102521 3300046455 Bacteria 1670
975 Ga0495590_0044817 3300046457 Bacteria 1542
976 Ga0495590_0063082 3300046457 Bacteria 1297
977 Ga0495629_0002893 3300046459 Bacteria 13107
978 Ga0495629_0003465 3300046459 Bacteria 11932
979 Ga0495629_0032712 3300046459 Bacteria 3681
980 Ga0495629_0046403 3300046459 Bacteria 3048
981 Ga0495629_0074389 3300046459 Bacteria 2372
982 Ga0495629_0099874 3300046459 Bacteria 2025
983 Ga0495629_0193713 3300046459 Bacteria 1406
984 Ga0495629_0390467 3300046459 Bacteria 946
985 Ga0495638_0011130 3300046460 Bacteria 6214
986 Ga0495638_0151907 3300046460 Bacteria 1343
987 Ga0495641_0002491 3300046461 Bacteria 14496
988 Ga0495641_0217332 3300046461 Bacteria 857
989 Ga0495651_0000364 3300046462 Bacteria 34831
990 Ga0495651_0015118 3300046462 Bacteria 5965
991 Ga0495651_0018706 3300046462 Bacteria 5367
992 Ga0495651_0090272 3300046462 Bacteria 2298
993 Ga0495651_0098904 3300046462 Bacteria 2176
994 Ga0495651_0131710 3300046462 Bacteria 1824
995 Ga0495653_0000398 3300046463 Bacteria 34931
996 Ga0495653_0025322 3300046463 Bacteria 4771
997 Ga0495653_0032960 3300046463 Bacteria 4108
998 Ga0495653_0076978 3300046463 Bacteria 2478
999 Ga0495653_0130834 3300046463 Bacteria 1777
1000 Ga0495653_0155527 3300046463 Bacteria 1593
1001 Ga0495580_0000749 3300046472 Bacteria 27814
1002 Ga0495580_0006621 3300046472 Bacteria 9413
1003 Ga0495580_0072398 3300046472 Bacteria 2407
1004 Ga0495580_0120756 3300046472 Bacteria 1819
1005 Ga0495580_0519254 3300046472 Bacteria 794
1006 Ga0495582_0000038 3300046473 Bacteria 67536
1007 Ga0495582_0104553 3300046473 Bacteria 1587
1008 Ga0495605_0135223 3300046474 Bacteria 1109
1009 Ga0495605_0260953 3300046474 Bacteria 739
1010 Ga0495639_0000092 3300046475 Bacteria 43860
1011 Ga0495639_0014639 3300046475 Bacteria 3398
1012 Ga0495639_0020661 3300046475 Bacteria 2877
1013 Ga0495639_0158744 3300046475 Bacteria 1094
1014 Ga0495662_0002976 3300046476 Bacteria 8551
1015 Ga0495662_0008650 3300046476 Bacteria 5004
1016 Ga0495662_0040962 3300046476 Bacteria 2236
1017 Ga0495662_0340939 3300046476 Bacteria 737
1018 Ga0495664_0000019 3300046477 Bacteria 153012
1019 Ga0495664_0002736 3300046477 Bacteria 9481
1020 Ga0495664_0003467 3300046477 Bacteria 8586
1021 Ga0495664_0008379 3300046477 Bacteria 5767
1022 Ga0495664_0010424 3300046477 Bacteria 5215
1023 Ga0495664_0087932 3300046477 Bacteria 1867
1024 Ga0495664_0278017 3300046477 Bacteria 1012
1025 Ga0495584_0020845 3300046491 Bacteria 3328
1026 Ga0495584_0074952 3300046491 Bacteria 1701
1027 Ga0495585_0030191 3300046492 Bacteria 3083
1028 Ga0495585_0150291 3300046492 Bacteria 1215
1029 Ga0495594_0001994 3300046499 Bacteria 10639
1030 Ga0495594_0161170 3300046499 Bacteria 1275
1031 Ga0495594_0167624 3300046499 Bacteria 1249
1032 Ga0495594_0263434 3300046499 Bacteria 982
1033 Ga0495596_0131316 3300046500 Bacteria 972
1034 Ga0495606_0291294 3300046507 Bacteria 888
1035 Ga0495608_0000026 3300046511 Bacteria 156234
1036 Ga0495608_0040232 3300046511 Bacteria 3132
1037 Ga0495608_0090254 3300046511 Bacteria 1982
1038 Ga0495616_0037108 3300046513 Bacteria 2509
1039 Ga0495616_0193452 3300046513 Bacteria 898
1040 Ga0495618_0000015 3300046514 Bacteria 152478
1041 Ga0495618_0000705 3300046514 Bacteria 23292
1042 Ga0495618_0015933 3300046514 Bacteria 4589
1043 Ga0495618_0038274 3300046514 Bacteria 3013
1044 Ga0495618_0045102 3300046514 Bacteria 2781
1045 Ga0495618_0075820 3300046514 Bacteria 2142
1046 Ga0495620_0038186 3300046515 Bacteria 2133
1047 Ga0495620_0105029 3300046515 Bacteria 1123
1048 Ga0495628_0000006 3300046516 Bacteria 306606
1049 Ga0495628_0074103 3300046516 Bacteria 2652
1050 Ga0495628_0082302 3300046516 Bacteria 2500
1051 Ga0495630_0001838 3300046517 Bacteria 14813
1052 Ga0495630_0004473 3300046517 Bacteria 9800
1053 Ga0495630_0009360 3300046517 Bacteria 7042
1054 Ga0495630_0034189 3300046517 Bacteria 3794
1055 Ga0495630_0042211 3300046517 Bacteria 3407
1056 Ga0495630_0233841 3300046517 Bacteria 1404
1057 Ga0495631_0013380 3300046518 Bacteria 3983
1058 Ga0495631_0044415 3300046518 Bacteria 1958
1059 Ga0495632_0154205 3300046519 Bacteria 1061
1060 Ga0495643_0089309 3300046522 Bacteria 1592
1061 Ga0495644_0016167 3300046523 Bacteria 2858
1062 Ga0495644_0249174 3300046523 Bacteria 690
1063 Ga0495648_0015002 3300046524 Bacteria 5644
1064 Ga0495648_0143397 3300046524 Bacteria 1254
1065 Ga0495648_0152429 3300046524 Bacteria 1204
1066 Ga0495648_0188554 3300046524 Bacteria 1042
1067 Ga0495663_0014873 3300046525 Bacteria 2186
1068 Ga0495666_0006104 3300046526 Bacteria 6060
1069 Ga0495666_0007530 3300046526 Bacteria 5447
1070 Ga0495652_0000030 3300046529 Bacteria 152921
1071 Ga0495652_0019294 3300046529 Bacteria 6075
1072 Ga0495652_0032264 3300046529 Bacteria 4582
1073 Ga0495652_0035784 3300046529 Bacteria 4320
1074 Ga0495652_0252724 3300046529 Bacteria 1305
1075 Ga0495665_0000186 3300046531 Bacteria 31853
1076 Ga0495665_0017149 3300046531 Bacteria 3896
1077 Ga0495665_0036835 3300046531 Bacteria 2611
1078 Ga0495665_0090938 3300046531 Bacteria 1604
1079 Ga0495640_0000246 3300046533 Bacteria 35995
1080 Ga0495640_0001008 3300046533 Bacteria 21806
1081 Ga0495640_0002127 3300046533 Bacteria 15810
1082 Ga0495640_0037739 3300046533 Bacteria 3404
1083 Ga0495640_0060449 3300046533 Bacteria 2577
1084 Ga0495640_0233108 3300046533 Bacteria 1157
1085 Ga0495640_0303996 3300046533 Bacteria 990
1086 Ga0495586_0331955 3300046535 Bacteria 872
1087 Ga0495586_0384130 3300046535 Bacteria 808
1088 Ga0495587_0000021 3300046536 Bacteria 152895
1089 Ga0495587_0144911 3300046536 Bacteria 1354
1090 Ga0495587_0217249 3300046536 Bacteria 1079
1091 Ga0495587_0240169 3300046536 Bacteria 1020
1092 Ga0495598_0002784 3300046537 Bacteria 3636
1093 Ga0495598_0111028 3300046537 Bacteria 919
1094 Ga0495621_0018686 3300046539 Bacteria 2254
1095 Ga0495645_0000001 3300046543 Bacteria 657910
1096 Ga0495645_0019743 3300046543 Bacteria 4855
1097 Ga0495645_0023021 3300046543 Bacteria 4509
1098 Ga0495645_0034293 3300046543 Bacteria 3703
1099 Ga0495645_0156786 3300046543 Bacteria 1577
1100 Ga0495645_0474007 3300046543 Bacteria 786
1101 Ga0495622_0012358 3300046557 Bacteria 3952
1102 Ga0495622_0027174 3300046557 Bacteria 2670
1103 Ga0495622_0066724 3300046557 Bacteria 1663
1104 Ga0495667_0000027 3300046559 Bacteria 152535
1105 Ga0495667_0013545 3300046559 Bacteria 5516
1106 Ga0495667_0117742 3300046559 Bacteria 1716
1107 Ga0495667_0154015 3300046559 Bacteria 1479
1108 Ga0495667_0257268 3300046559 Bacteria 1111
1109 Ga0495656_0003198 3300046615 Bacteria 5518
1110 Ga0495656_0068974 3300046615 Bacteria 1565
1111 Ga0495668_0011373 3300046616 Bacteria 5334
1112 Ga0495668_0015058 3300046616 Bacteria 4524
1113 Ga0495668_0099735 3300046616 Bacteria 1589
1114 Ga0495634_0000008 3300046642 Bacteria 163983
1115 Ga0495634_0000706 3300046642 Bacteria 32394
1116 Ga0495634_0015350 3300046642 Bacteria 5505
1117 Ga0495634_0021107 3300046642 Bacteria 4610
1118 Ga0495634_0023535 3300046642 Bacteria 4327
1119 Ga0495611_0012542 3300046648 Bacteria 3603
1120 Ga0495625_0050870 3300046660 Bacteria 2971
1121 Ga0495625_0081568 3300046660 Bacteria 2251
1122 Ga0495625_0245777 3300046660 Bacteria 1163
1123 Ga0495635_0000028 3300046663 Bacteria 121669
1124 Ga0495635_0002553 3300046663 Bacteria 12464
1125 Ga0495635_0012050 3300046663 Bacteria 6061
1126 Ga0495635_0022409 3300046663 Bacteria 4398
1127 Ga0495635_0039315 3300046663 Bacteria 3272
1128 Ga0495635_0061392 3300046663 Bacteria 2582
1129 Ga0495635_0103202 3300046663 Bacteria 1949
1130 Ga0495635_0163069 3300046663 Bacteria 1517
1131 Ga0495659_0033429 3300046664 Bacteria 1805
1132 Ga0495661_0034000 3300046665 Bacteria 3211
1133 Ga0495588_0003404 3300046674 Bacteria 6912
1134 Ga0495588_0113239 3300046674 Bacteria 1429
1135 Ga0495588_0231807 3300046674 Bacteria 974
1136 Ga0495588_0246739 3300046674 Bacteria 942
1137 Ga0495657_0004008 3300046675 Bacteria 11813
1138 Ga0495657_0031662 3300046675 Bacteria 3695
1139 Ga0495657_0305561 3300046675 Bacteria 948
1140 Ga0495599_0000232 3300046678 Bacteria 34997
1141 Ga0495599_0044273 3300046678 Bacteria 2791
1142 Ga0495623_0000448 3300046679 Bacteria 27077
1143 Ga0495623_0098569 3300046679 Bacteria 1783
1144 Ga0495623_0128708 3300046679 Bacteria 1518
1145 Ga0495646_0000148 3300046680 Bacteria 35382
1146 Ga0495646_0032422 3300046680 Bacteria 3251
1147 Ga0495646_0122361 3300046680 Bacteria 1471
1148 Ga0495646_0161842 3300046680 Bacteria 1238
1149 Ga0495646_0377122 3300046680 Bacteria 740
1150 Ga0495647_0000203 3300046681 Bacteria 16019
1151 Ga0495647_0008947 3300046681 Bacteria 3377
1152 Ga0495647_0047420 3300046681 Bacteria 1658
1153 Ga0495647_0238845 3300046681 Bacteria 806
1154 Ga0495658_0001537 3300046683 Bacteria 12092
1155 Ga0495658_0015719 3300046683 Bacteria 3886
1156 Ga0495658_0016381 3300046683 Bacteria 3816
1157 Ga0495658_0056336 3300046683 Bacteria 2242
1158 Ga0495658_0065199 3300046683 Bacteria 2101
1159 Ga0495669_0009514 3300046684 Bacteria 4099
1160 Ga0495669_0282784 3300046684 Bacteria 798
1161 Ga0495613_0017873 3300046689 Bacteria 5286
1162 Ga0495613_0022543 3300046689 Bacteria 4690
1163 Ga0495613_0079448 3300046689 Bacteria 2385
1164 Ga0495613_0120984 3300046689 Bacteria 1880
1165 Ga0495613_0121448 3300046689 Bacteria 1876
1166 Ga0495613_0190890 3300046689 Bacteria 1448
1167 Ga0495613_0198031 3300046689 Bacteria 1417
1168 Ga0495613_0538409 3300046689 Bacteria 783
1169 Ga0495624_0001987 3300046690 Bacteria 15598
1170 Ga0495624_0018144 3300046690 Bacteria 4708
1171 Ga0495624_0029729 3300046690 Bacteria 3563
1172 Ga0495624_0044550 3300046690 Bacteria 2828
1173 Ga0495624_0063304 3300046690 Bacteria 2312
1174 Ga0495624_0327486 3300046690 Bacteria 922
1175 Ga0495670_0003950 3300046691 Bacteria 7281
1176 Ga0495670_0022339 3300046691 Bacteria 3124
1177 Ga0495670_0201466 3300046691 Bacteria 1054
1178 Ga0495670_0313003 3300046691 Bacteria 842
1179 Ga0495671_0067264 3300046692 Bacteria 1762
1180 Ga0495671_0186494 3300046692 Bacteria 1007
1181 Ga0495649_0127772 3300046694 Bacteria 1342
1182 Ga0495649_0284314 3300046694 Bacteria 845
1183 Ga0495589_0057399 3300046794 Bacteria 1915
1184 Ga0495589_0097600 3300046794 Bacteria 1423
1185 Ga0495600_0000195 3300046809 Bacteria 35017
1186 Ga0495600_0002506 3300046809 Bacteria 10545
1187 Ga0495600_0020494 3300046809 Bacteria 4228
1188 Ga0495600_0025066 3300046809 Bacteria 3843
1189 Ga0495600_0059898 3300046809 Bacteria 2486
1190 Ga0495600_0163254 3300046809 Bacteria 1439
1191 Ga0495660_0311530 3300046810 Bacteria 710
1192 Ga0495581_0000019 3300047315 Bacteria 57810
1193 Ga0495581_0013871 3300047315 Bacteria 4671
1194 Ga0495581_0088455 3300047315 Bacteria 1796
1195 Ga0495581_0157969 3300047315 Bacteria 1325
1196 Ga0495581_0175987 3300047315 Bacteria 1251
1197 Ga0495581_0183224 3300047315 Bacteria 1225
1198 Ga0495581_0263521 3300047315 Bacteria 1008
1199 Ga0495581_0319024 3300047315 Bacteria 908
1200 Ga0495604_0000002 3300047317 Bacteria 530904
1201 Ga0495604_0009212 3300047317 Bacteria 7815
1202 Ga0495604_0034714 3300047317 Bacteria 3989
1203 Ga0495604_0079171 3300047317 Bacteria 2465
1204 Ga0495604_0085241 3300047317 Bacteria 2358
1205 Ga0495604_0276700 3300047317 Bacteria 1135
1206 Ga0495636_0034181 3300047318 Bacteria 2091
1207 Ga0495674_0000004 3300047319 Bacteria 531855
1208 Ga0495674_0003455 3300047319 Bacteria 15353
1209 Ga0495674_0048516 3300047319 Bacteria 3757
1210 Ga0495674_0168307 3300047319 Bacteria 1830
1211 Ga0495674_0270718 3300047319 Bacteria 1393
1212 Ga0495674_0290211 3300047319 Bacteria 1338
1213 Ga0495672_0149882 3300047320 Bacteria 1210
1214 Ga0495672_0171915 3300047320 Bacteria 1104
1215 Ga0495676_0020934 3300047321 Bacteria 5726
1216 Ga0495676_0048740 3300047321 Bacteria 3412
1217 Ga0495676_0078890 3300047321 Bacteria 2505
1218 Ga0495676_0095015 3300047321 Bacteria 2219
1219 Ga0495676_0298644 3300047321 Bacteria 1087
1220 Ga0495680_0001465 3300047322 Bacteria 25478
1221 Ga0495680_0003584 3300047322 Bacteria 15203
1222 Ga0495680_0015898 3300047322 Bacteria 6478
1223 Ga0495680_0033269 3300047322 Bacteria 4175
1224 Ga0495680_0035652 3300047322 Bacteria 4005
1225 Ga0495680_0081665 3300047322 Bacteria 2440
1226 Ga0495680_0305013 3300047322 Bacteria 1117
1227 Ga0495683_0023073 3300047323 Bacteria 3199
1228 Ga0495675_0000351 3300047444 Bacteria 32308
1229 Ga0495675_0020965 3300047444 Bacteria 4160
1230 Ga0495675_0124763 3300047444 Bacteria 1602
1231 Ga0495675_0157773 3300047444 Bacteria 1398
1232 Ga0495677_0014595 3300047445 Bacteria 2858
1233 Ga0495677_0015227 3300047445 Bacteria 2795
1234 Ga0495677_0141474 3300047445 Bacteria 924
1235 Ga0495679_039674 3300047446 Bacteria 1467
1236 Ga0495685_124816 3300047447 Bacteria 844
1237 Ga0495673_0013698 3300047469 Bacteria 4246
1238 Ga0495673_0018331 3300047469 Bacteria 3531
1239 Ga0495673_0162883 3300047469 Bacteria 855
1240 Ga0495684_0000004 3300047471 Bacteria 307093
1241 Ga0495684_0002699 3300047471 Bacteria 14047
1242 Ga0495684_0006327 3300047471 Bacteria 9203
1243 Ga0495684_0011826 3300047471 Bacteria 6733
1244 Ga0495684_0026662 3300047471 Bacteria 4440
1245 Ga0495684_0148165 3300047471 Bacteria 1756
1246 Ga0495684_0251155 3300047471 Bacteria 1287
1247 Ga0495686_0074432 3300047472 Bacteria 2084
1248 Ga0495686_0140297 3300047472 Bacteria 1426
1249 Ga0495593_0000250 3300047673 Bacteria 29194
1250 Ga0495593_0007024 3300047673 Bacteria 6602
1251 Ga0495593_0031371 3300047673 Bacteria 2903
1252 Ga0495593_0039653 3300047673 Bacteria 2538
1253 Ga0495593_0083810 3300047673 Bacteria 1646
1254 Ga0495593_0188875 3300047673 Bacteria 1037
1255 Ga0495602_0000001 3300048088 Bacteria 510904
1256 Ga0495602_0015663 3300048088 Bacteria 7642
1257 Ga0495602_0039711 3300048088 Bacteria 4329
1258 Ga0495602_0488502 3300048088 Bacteria 863
1259 Ga0495614_0084919 3300048089 Bacteria 1374
1260 Ga0495626_0058422 3300048091 Bacteria 1762
1261 Ga0496100_0000842 3300048903 Bacteria 14711
1262 Ga0496100_0025238 3300048903 Bacteria 3633
1263 Ga0496100_0046119 3300048903 Bacteria 2800
1264 Ga0496100_0310976 3300048903 Bacteria 1181
1265 Ga0496100_0392737 3300048903 Bacteria 1055
1266 Ga0496100_0403206 3300048903 Bacteria 1042
1267 Ga0496100_0532549 3300048903 Bacteria 907
1268 Ga0496100_0584448 3300048903 Bacteria 866
1269 Ga0496100_0709386 3300048903 Bacteria 785
1270 Ga0496101_0001211 3300048904 Bacteria 15442
1271 Ga0496101_0010196 3300048904 Bacteria 6200
1272 Ga0496101_0032129 3300048904 Bacteria 3693
1273 Ga0496101_0037494 3300048904 Bacteria 3439
1274 Ga0496101_0051165 3300048904 Bacteria 2976
1275 Ga0496101_0060112 3300048904 Bacteria 2757
1276 Ga0496101_0183719 3300048904 Bacteria 1611
1277 Ga0496101_0201052 3300048904 Bacteria 1540
1278 Ga0496101_0233004 3300048904 Bacteria 1432
1279 Ga0496101_0542824 3300048904 Bacteria 919
1280 Ga0496102_0000617 3300048905 Bacteria 36855
1281 Ga0496102_0011697 3300048905 Bacteria 7572
1282 Ga0496102_0028987 3300048905 Bacteria 4948
1283 Ga0496102_0029422 3300048905 Bacteria 4915
1284 Ga0496102_0068983 3300048905 Bacteria 3245
1285 Ga0496102_0093582 3300048905 Bacteria 2784
1286 Ga0496102_0310052 3300048905 Bacteria 1487
1287 Ga0496102_0463740 3300048905 Bacteria 1188
1288 Ga0496103_0007489 3300048906 Bacteria 6505
1289 Ga0496103_0010791 3300048906 Bacteria 5406
1290 Ga0496103_0010836 3300048906 Bacteria 5396
1291 Ga0496103_0032320 3300048906 Bacteria 3193
1292 Ga0496103_0035956 3300048906 Bacteria 3032
1293 Ga0496103_0126230 3300048906 Bacteria 1632
1294 Ga0496104_0000538 3300048907 Bacteria 32550
1295 Ga0496104_0000602 3300048907 Bacteria 30848
1296 Ga0496104_0001834 3300048907 Bacteria 18376
1297 Ga0496104_0006005 3300048907 Bacteria 10645
1298 Ga0496104_0011586 3300048907 Bacteria 7903
1299 Ga0496104_0022907 3300048907 Bacteria 5739
1300 Ga0496104_0023409 3300048907 Bacteria 5679
1301 Ga0496104_0030685 3300048907 Bacteria 4996
1302 Ga0496104_0033068 3300048907 Bacteria 4814
1303 Ga0496104_0046946 3300048907 Bacteria 4069
1304 Ga0496104_0170737 3300048907 Bacteria 2085
1305 Ga0496104_0245800 3300048907 Bacteria 1702
1306 Ga0496104_0276427 3300048907 Bacteria 1592
1307 Ga0496105_0002373 3300048908 Bacteria 13644
1308 Ga0496105_0004135 3300048908 Bacteria 10885
1309 Ga0496105_0022659 3300048908 Bacteria 5088
1310 Ga0496105_0026177 3300048908 Bacteria 4755
1311 Ga0496105_0050267 3300048908 Bacteria 3443
1312 Ga0496105_0054388 3300048908 Bacteria 3305
1313 Ga0496105_0078540 3300048908 Bacteria 2725
1314 Ga0496105_0176113 3300048908 Bacteria 1752
1315 Ga0496105_0226816 3300048908 Bacteria 1519
1316 Ga0496105_0295102 3300048908 Bacteria 1304
1317 Ga0496105_0506829 3300048908 Bacteria 947
1318 Ga0496105_0549099 3300048908 Bacteria 902
1319 Ga0496105_0792354 3300048908 Bacteria 721
1320 Ga0496106_0000405 3300048909 Bacteria 30644
1321 Ga0496106_0013666 3300048909 Bacteria 5994
1322 Ga0496106_0026406 3300048909 Bacteria 4325
1323 Ga0496106_0036756 3300048909 Bacteria 3663
1324 Ga0496106_0070055 3300048909 Bacteria 2678
1325 Ga0496106_0092378 3300048909 Bacteria 2337
1326 Ga0496106_0347998 3300048909 Bacteria 1190
1327 Ga0496107_0001082 3300048910 Bacteria 16345
1328 Ga0496107_0001145 3300048910 Bacteria 16048
1329 Ga0496107_0030443 3300048910 Bacteria 3847
1330 Ga0496107_0046438 3300048910 Bacteria 3126
1331 Ga0496107_0154833 3300048910 Bacteria 1696
1332 Ga0496107_0170673 3300048910 Bacteria 1614
1333 Ga0496107_0271152 3300048910 Bacteria 1263
1334 Ga0496108_0001230 3300048911 Bacteria 20080
1335 Ga0496108_0003869 3300048911 Bacteria 12021
1336 Ga0496108_0012570 3300048911 Bacteria 6896
1337 Ga0496108_0014737 3300048911 Bacteria 6380
1338 Ga0496108_0021443 3300048911 Bacteria 5311
1339 Ga0496108_0029580 3300048911 Bacteria 4538
1340 Ga0496108_0034009 3300048911 Bacteria 4233
1341 Ga0496108_0183347 3300048911 Bacteria 1813
1342 Ga0496108_0238341 3300048911 Bacteria 1582
1343 Ga0496108_0378507 3300048911 Bacteria 1236
1344 Ga0496108_0572736 3300048911 Bacteria 984
1345 Ga0496109_0002911 3300048912 Bacteria 14299
1346 Ga0496109_0004441 3300048912 Bacteria 11714
1347 Ga0496109_0006129 3300048912 Bacteria 10104
1348 Ga0496109_0006276 3300048912 Bacteria 10002
1349 Ga0496109_0008231 3300048912 Bacteria 8852
1350 Ga0496109_0052215 3300048912 Bacteria 3725
1351 Ga0496109_0096114 3300048912 Bacteria 2744
1352 Ga0496109_0107547 3300048912 Bacteria 2591
1353 Ga0496109_0123808 3300048912 Bacteria 2410
1354 Ga0496109_0312075 3300048912 Bacteria 1484
1355 Ga0496109_0316444 3300048912 Bacteria 1473
1356 Ga0496109_0613669 3300048912 Bacteria 1024
1357 Ga0496109_0905120 3300048912 Bacteria 820
1358 Ga0496110_0000468 3300048913 Bacteria 27460
1359 Ga0496110_0017492 3300048913 Bacteria 5998
1360 Ga0496110_0019783 3300048913 Bacteria 5672
1361 Ga0496110_0032199 3300048913 Bacteria 4526
1362 Ga0496110_0035095 3300048913 Bacteria 4349
1363 Ga0496110_0075221 3300048913 Bacteria 3000
1364 Ga0496110_0093168 3300048913 Bacteria 2696
1365 Ga0496110_0102346 3300048913 Bacteria 2568
1366 Ga0496110_0131034 3300048913 Bacteria 2264
1367 Ga0496110_0151100 3300048913 Bacteria 2103
1368 Ga0496110_0177650 3300048913 Bacteria 1933
1369 Ga0496110_0217966 3300048913 Bacteria 1735
1370 Ga0496110_0257669 3300048913 Bacteria 1588
1371 Ga0496111_0001165 3300048914 Bacteria 14618
1372 Ga0496111_0001714 3300048914 Bacteria 12814
1373 Ga0496111_0004338 3300048914 Bacteria 8949
1374 Ga0496111_0036936 3300048914 Bacteria 3494
1375 Ga0496111_0086310 3300048914 Bacteria 2296
1376 Ga0496111_0117006 3300048914 Bacteria 1966
1377 Ga0496111_0243138 3300048914 Bacteria 1336
1378 Ga0496112_0000014 3300048915 Bacteria 210932
1379 Ga0496112_0000527 3300048915 Bacteria 26121
1380 Ga0496112_0003749 3300048915 Bacteria 12694
1381 Ga0496112_0011543 3300048915 Bacteria 8074
1382 Ga0496112_0012163 3300048915 Bacteria 7899
1383 Ga0496112_0038471 3300048915 Bacteria 4671
1384 Ga0496112_0070265 3300048915 Bacteria 3460
1385 Ga0496112_0089626 3300048915 Bacteria 3044
1386 Ga0496112_0092100 3300048915 Bacteria 3000
1387 Ga0496112_0113744 3300048915 Bacteria 2677
1388 Ga0496112_0189750 3300048915 Bacteria 2017
1389 Ga0496112_0279636 3300048915 Bacteria 1616
1390 Ga0496112_0473916 3300048915 Bacteria 1189
1391 Ga0496113_0001893 3300048916 Bacteria 11943
1392 Ga0496113_0003961 3300048916 Bacteria 8995
1393 Ga0496113_0010110 3300048916 Bacteria 6224
1394 Ga0496113_0037525 3300048916 Bacteria 3557
1395 Ga0496113_0055397 3300048916 Bacteria 2972
1396 Ga0496113_0164171 3300048916 Bacteria 1757
1397 Ga0496113_0192022 3300048916 Bacteria 1621
1398 Ga0496114_0084167 3300048917 Bacteria 2693
1399 Ga0496114_0097669 3300048917 Bacteria 2503
1400 Ga0496114_0104086 3300048917 Bacteria 2427
1401 Ga0496114_0125366 3300048917 Bacteria 2213
1402 Ga0496114_0150849 3300048917 Bacteria 2016
1403 Ga0496114_0252240 3300048917 Bacteria 1553
1404 Ga0496114_0311775 3300048917 Bacteria 1390
1405 Ga0496114_0673136 3300048917 Bacteria 909
1406 Ga0496115_0006200 3300048918 Bacteria 8746
1407 Ga0496115_0021274 3300048918 Bacteria 5009
1408 Ga0496115_0069948 3300048918 Bacteria 2844
1409 Ga0496115_0073218 3300048918 Bacteria 2780
1410 Ga0496115_0117378 3300048918 Bacteria 2189
1411 Ga0496115_0193467 3300048918 Bacteria 1680
1412 Ga0496115_0201937 3300048918 Bacteria 1642
1413 Ga0496115_0220417 3300048918 Bacteria 1565
1414 Ga0496115_0220700 3300048918 Bacteria 1564
1415 Ga0496115_0223030 3300048918 Bacteria 1556
1416 Ga0496115_0231694 3300048918 Bacteria 1523
1417 Ga0496115_0330050 3300048918 Bacteria 1246
1418 Ga0496115_0477846 3300048918 Bacteria 1004
1419 Ga0496115_0642331 3300048918 Bacteria 840
1420 Ga0496116_0069466 3300048919 Bacteria 2239
1421 Ga0496117_0001758 3300048920 Bacteria 29816
1422 Ga0496117_0076566 3300048920 Bacteria 2218
1423 Ga0496117_0100245 3300048920 Bacteria 1835
1424 Ga0496118_0017789 3300048921 Bacteria 6452
1425 Ga0496118_0081995 3300048921 Bacteria 2262
1426 Ga0496118_0111000 3300048921 Bacteria 1819
1427 Ga0496119_0018215 3300048922 Bacteria 5243
1428 Ga0496120_0006082 3300048923 Bacteria 9373
1429 Ga0496121_0000283 3300048924 Bacteria 105735
1430 Ga0496121_0023892 3300048924 Bacteria 5864
1431 Ga0496121_0054093 3300048924 Bacteria 3357
1432 Ga0496121_0057138 3300048924 Bacteria 3236
1433 Ga0496121_0060601 3300048924 Bacteria 3112
1434 Ga0496121_0097563 3300048924 Bacteria 2277
1435 Ga0496121_0128993 3300048924 Bacteria 1896
1436 Ga0496121_0190012 3300048924 Bacteria 1473
1437 Ga0496121_0218313 3300048924 Bacteria 1345
1438 Ga0496122_0077145 3300048925 Bacteria 2342
1439 Ga0496124_0065553 3300048927 Bacteria 3028
1440 Ga0496124_0076754 3300048927 Bacteria 2757
1441 Ga0496124_0114179 3300048927 Bacteria 2169
1442 Ga0496124_0130174 3300048927 Bacteria 2000
1443 Ga0496125_0019849 3300048928 Bacteria 6323
1444 Ga0496125_0030819 3300048928 Bacteria 4790
1445 Ga0496125_0043700 3300048928 Bacteria 3798
1446 Ga0496126_0129226 3300048929 Bacteria 2184
1447 Ga0496126_0145419 3300048929 Bacteria 2036
1448 Ga0496126_0170067 3300048929 Bacteria 1857
1449 Ga0495682_0087690 3300049460 Bacteria 1118
1450 Ga0501031_0026174 3300049568 Bacteria 3805
1451 Ga0501031_0499363 3300049568 Bacteria 785
1452 Ga0501032_0092511 3300049569 Bacteria 2006
1453 Ga0501032_0448186 3300049569 Bacteria 827
1454 Ga0501033_0046869 3300049570 Bacteria 3214
1455 Ga0501033_0120574 3300049570 Bacteria 1904
1456 Ga0501033_0551945 3300049570 Bacteria 793
1457 Ga0501034_0035866 3300049571 Bacteria 5028
1458 Ga0501034_0318667 3300049571 Bacteria 1488
1459 Ga0501036_0002481 3300049572 Bacteria 14464
1460 Ga0501036_0058938 3300049572 Bacteria 3253
1461 Ga0501036_0364868 3300049572 Bacteria 1206
1462 Ga0501037_0023005 3300049573 Bacteria 4609
1463 Ga0501037_0057904 3300049573 Bacteria 2828
1464 Ga0501038_0011597 3300049574 Bacteria 8041
1465 Ga0501038_0043917 3300049574 Bacteria 3885
1466 Ga0501038_0090782 3300049574 Bacteria 2560
1467 Ga0501038_0164254 3300049574 Bacteria 1802
1468 Ga0501039_0021356 3300049575 Bacteria 4967
1469 Ga0501039_0208491 3300049575 Bacteria 1537
1470 Ga0501040_0009859 3300049576 Bacteria 6238
1471 Ga0501040_0077664 3300049576 Bacteria 2297
1472 Ga0501040_0188368 3300049576 Bacteria 1464
1473 Ga0501040_0225898 3300049576 Bacteria 1332
1474 Ga0501041_0014421 3300049577 Bacteria 4693
1475 Ga0501041_0032605 3300049577 Bacteria 3148
1476 Ga0501041_0153040 3300049577 Bacteria 1440
1477 Ga0501042_0005234 3300049578 Bacteria 8334
1478 Ga0501042_0037155 3300049578 Bacteria 3456
1479 Ga0501042_0099205 3300049578 Bacteria 2094
1480 Ga0501042_0277750 3300049578 Bacteria 1210
1481 Ga0501042_0283153 3300049578 Bacteria 1197
1482 Ga0501042_0489477 3300049578 Bacteria 893
1483 Ga0501043_0013428 3300049579 Bacteria 6406
1484 Ga0501043_0080598 3300049579 Bacteria 2558
1485 Ga0501046_0014699 3300049580 Bacteria 6592
1486 Ga0501046_0019015 3300049580 Bacteria 5702
1487 Ga0501046_0025386 3300049580 Bacteria 4850
1488 Ga0501046_0216313 3300049580 Bacteria 1421
1489 Ga0501046_0255288 3300049580 Bacteria 1289
1490 Ga0501047_0089977 3300049581 Bacteria 2946
1491 Ga0501047_0096900 3300049581 Bacteria 2828
1492 Ga0501047_0343159 3300049581 Bacteria 1331
1493 Ga0501048_0006475 3300049582 Bacteria 8902
1494 Ga0501048_0094232 3300049582 Bacteria 2112
1495 Ga0501048_0228067 3300049582 Bacteria 1322
1496 Ga0501048_0719108 3300049582 Bacteria 717
1497 Ga0501067_0035095 3300049583 Bacteria 2784
1498 Ga0501068_0031554 3300049584 Bacteria 3147
1499 Ga0501068_0076309 3300049584 Bacteria 2051
1500 Ga0501069_0060890 3300049585 Bacteria 2108
1501 Ga0501069_0148389 3300049585 Bacteria 1347
1502 Ga0501070_0021833 3300049586 Bacteria 5364
1503 Ga0501070_0206954 3300049586 Bacteria 1611
1504 Ga0501070_0213456 3300049586 Bacteria 1583
1505 Ga0501070_0235098 3300049586 Bacteria 1501
1506 Ga0501070_0245273 3300049586 Bacteria 1466
1507 Ga0501070_0250744 3300049586 Bacteria 1448
1508 Ga0501071_0051680 3300049587 Bacteria 2963
1509 Ga0501071_0339764 3300049587 Bacteria 1142
1510 Ga0501071_0458531 3300049587 Bacteria 976
1511 Ga0501072_0001512 3300049588 Bacteria 17432
1512 Ga0501072_0013914 3300049588 Bacteria 6166
1513 Ga0501072_0042411 3300049588 Bacteria 3574
1514 Ga0501072_0065633 3300049588 Bacteria 2862
1515 Ga0501072_0095047 3300049588 Bacteria 2368
1516 Ga0501072_0160351 3300049588 Bacteria 1794
1517 Ga0501072_0716275 3300049588 Bacteria 786
1518 Ga0501073_0005592 3300049589 Bacteria 9404
1519 Ga0501073_0019034 3300049589 Bacteria 4962
1520 Ga0501073_0184961 3300049589 Bacteria 1442
1521 Ga0501073_0226023 3300049589 Bacteria 1293
1522 Ga0501073_0238326 3300049589 Bacteria 1256
1523 Ga0501073_0296907 3300049589 Bacteria 1115
1524 Ga0501074_0027303 3300049590 Bacteria 4139
1525 Ga0501074_0043753 3300049590 Bacteria 3241
1526 Ga0501074_0464979 3300049590 Bacteria 897
1527 Ga0501074_0724765 3300049590 Bacteria 701
1528 Ga0501075_0160035 3300049591 Bacteria 1717
1529 Ga0501075_0219008 3300049591 Bacteria 1452
1530 Ga0501075_0467879 3300049591 Bacteria 961
1531 Ga0501076_0026862 3300049592 Bacteria 4462
1532 Ga0501076_0101972 3300049592 Bacteria 2313
1533 Ga0501076_0114869 3300049592 Bacteria 2178
1534 Ga0501076_0178900 3300049592 Bacteria 1729
1535 Ga0501076_0197265 3300049592 Bacteria 1643
1536 Ga0501076_0309785 3300049592 Bacteria 1295
1537 Ga0501077_0003968 3300049593 Bacteria 8923
1538 Ga0501077_0008803 3300049593 Bacteria 6263
1539 Ga0501077_0021498 3300049593 Bacteria 4083
1540 Ga0501077_0097546 3300049593 Bacteria 1863
1541 Ga0501077_0209235 3300049593 Bacteria 1239
1542 Ga0501077_0335716 3300049593 Bacteria 964
1543 Ga0501077_0512926 3300049593 Bacteria 769
1544 Ga0501079_0001178 3300049741 Bacteria 18318
1545 Ga0501079_0046758 3300049741 Bacteria 3339
1546 Ga0501079_0049659 3300049741 Bacteria 3238
1547 Ga0501079_0081736 3300049741 Bacteria 2498
1548 Ga0501079_0161339 3300049741 Bacteria 1748
1549 Ga0501079_0615055 3300049741 Bacteria 855
1550 Ga0501079_0700644 3300049741 Bacteria 797
1551 Ga0501080_0007750 3300049742 Bacteria 9706
1552 Ga0501080_0100700 3300049742 Bacteria 2680
1553 Ga0501080_0138185 3300049742 Bacteria 2254
1554 Ga0501080_0184529 3300049742 Bacteria 1918
1555 Ga0501080_0241087 3300049742 Bacteria 1650
1556 Ga0501081_0013714 3300049743 Bacteria 5329
1557 Ga0501081_0057512 3300049743 Bacteria 2689
1558 Ga0501081_0081853 3300049743 Bacteria 2261
1559 Ga0501081_0118370 3300049743 Bacteria 1884
1560 Ga0501081_0139745 3300049743 Bacteria 1735
1561 Ga0501081_0459323 3300049743 Bacteria 947
1562 Ga0501083_0085981 3300049744 Bacteria 2080
1563 Ga0501083_0117991 3300049744 Bacteria 1741
1564 Ga0501083_0233603 3300049744 Bacteria 1197
1565 Ga0501035_0068660 3300049822 Bacteria 3142
1566 Ga0501035_0420111 3300049822 Bacteria 1110
1567 Ga0501035_0475011 3300049822 Bacteria 1032
1568 Ga0501035_0779311 3300049822 Bacteria 765
1569 Ga0501044_0074734 3300049823 Bacteria 3442
1570 Ga0501044_0137435 3300049823 Bacteria 2434
1571 Ga0501045_0020987 3300049824 Bacteria 4669
1572 Ga0501045_0024775 3300049824 Bacteria 4310
1573 Ga0501045_0039471 3300049824 Bacteria 3435
1574 Ga0501045_0041521 3300049824 Bacteria 3347
1575 Ga0501045_0278970 3300049824 Bacteria 1244
1576 Ga0501045_0531644 3300049824 Bacteria 873
1577 nmdc:mga03683_17787_c1 3300050489 Bacteria 2695
1578 nmdc:mga00v17_188659_c1 3300050491 Bacteria 1331
1579 nmdc:mga00v17_25224_c1 3300050491 Bacteria 3454
1580 nmdc:mga00v17_2904_c1 3300050491 Bacteria 8786
1581 nmdc:mga0yw44_119488_c1 3300050492 Bacteria 1696
1582 nmdc:mga0yw44_1963_c1 3300050492 Bacteria 8529
1583 nmdc:mga0yw44_6715_c1 3300050492 Bacteria 5591
1584 nmdc:mga0yw44_70010_c1 3300050492 Bacteria 2174
1585 nmdc:mga0yw44_77943_c1 3300050492 Bacteria 1722
1586 nmdc:mga06z11_26813_c1 3300050494 Bacteria 2747
1587 nmdc:mga06z11_442474_c1 3300050494 Bacteria 785
1588 nmdc:mga06z11_65144_c1 3300050494 Bacteria 1912
1589 nmdc:mga04h51_23443_c1 3300050495 Bacteria 1312
1590 nmdc:mga07m45_177619_c1 3300050496 Bacteria 1238
1591 nmdc:mga07m45_21851_c1 3300050496 Bacteria 3488
1592 nmdc:mga07m45_34845_c1 3300050496 Bacteria 2799
1593 nmdc:mga05p37_137815_c1 3300050507 Bacteria 2991
1594 nmdc:mga05p37_250969_c1 3300050507 Bacteria 2122
1595 nmdc:mga05p37_329373_c1 3300050507 Bacteria 1804
1596 nmdc:mga05p37_442270_c1 3300050507 Bacteria 1507
1597 nmdc:mga05p37_4993_c2 3300050507 Bacteria 6721
1598 nmdc:mga05p37_548803_c1 3300050507 Bacteria 1316
1599 nmdc:mga09592_280592_c1 3300050508 Bacteria 1445
1600 nmdc:mga09592_374686_c1 3300050508 Bacteria 1231
1601 nmdc:mga09592_78389_c1 3300050508 Bacteria 2811
1602 nmdc:mga0qj67_348644_c1 3300050509 Bacteria 1197
1603 nmdc:mga0qj67_602649_c1 3300050509 Bacteria 879
1604 nmdc:mga0qj67_786278_c1 3300050509 Bacteria 754
1605 nmdc:mga06r32_136705_c1 3300050510 Bacteria 2425
1606 nmdc:mga06r32_314861_c1 3300050510 Bacteria 1551
1607 nmdc:mga06r32_60002_c1 3300050510 Bacteria 3659
1608 nmdc:mga08y16_149896_c1 3300050511 Bacteria 2424
1609 nmdc:mga08y16_27944_c1 3300050511 Bacteria 5947
1610 nmdc:mga08y16_430061_c1 3300050511 Bacteria 1348
1611 nmdc:mga0n895_143248_c1 3300050512 Bacteria 2419
1612 nmdc:mga0n895_14768_c1 3300050512 Bacteria 7104
1613 nmdc:mga0n895_319480_c1 3300050512 Bacteria 1573
1614 nmdc:mga0n895_390435_c1 3300050512 Bacteria 1408
1615 nmdc:mga0n895_54579_c1 3300050512 Bacteria 3931
1616 nmdc:mga0n895_56599_c1 3300050512 Bacteria 3863
1617 nmdc:mga0n895_702211_c1 3300050512 Bacteria 1007
1618 nmdc:mga0rr50_2831_c1 3300050513 Bacteria 9866
1619 nmdc:mga0rr50_877259_c1 3300050513 Bacteria 765
1620 nmdc:mga08x19_24_c1 3300050514 Bacteria 245940
1621 nmdc:mga08x19_295126_c1 3300050514 Bacteria 1125
1622 nmdc:mga08x19_90102_c1 3300050514 Bacteria 2023
1623 nmdc:mga0a205_126593_c1 3300050515 Bacteria 2454
1624 nmdc:mga0a205_233224_c1 3300050515 Bacteria 1723
1625 nmdc:mga0a205_42460_c2 3300050515 Bacteria 3584
1626 nmdc:mga0sz30_49723_c1 3300050516 Bacteria 1777
1627 Ga0495601_0000023 3300053077 Bacteria 140141
1628 Ga0495601_0014297 3300053077 Bacteria 4782
1629 Ga0495601_0016474 3300053077 Bacteria 4479
1630 Ga0495601_0019932 3300053077 Bacteria 4093
1631 Ga0495601_0023594 3300053077 Bacteria 3781
1632 Ga0495601_0042008 3300053077 Bacteria 2867
1633 Ga0495612_0000005 3300053078 Bacteria 286943
1634 Ga0495655_0005113 3300053083 Bacteria 2296
1635 Ga0495655_0027352 3300053083 Bacteria 1352
1636 Ga0495595_0000013 3300053084 Bacteria 160811
1637 Ga0495595_0004754 3300053084 Bacteria 5466
1638 Ga0495595_0298962 3300053084 Bacteria 809
1639 Ga0495619_0000003 3300053085 Bacteria 515784
1640 Ga0495619_0014748 3300053085 Bacteria 4936
1641 Ga0495619_0028733 3300053085 Bacteria 3589
1642 Ga0495619_0036675 3300053085 Bacteria 3193
1643 Ga0495619_0045584 3300053085 Bacteria 2881
1644 Ga0495619_0137914 3300053085 Bacteria 1678
1645 Ga0495619_0212087 3300053085 Bacteria 1341
1646 Ga0495619_0246669 3300053085 Bacteria 1237
1647 Ga0500643_020103 3300053087 Bacteria 2189
1648 Ga0500643_029467 3300053087 Bacteria 1688
1649 Ga0500647_0033698 3300053091 Bacteria 2444
1650 Ga0500651_0184092 3300053093 Bacteria 1239
1651 Ga0500566_0000049 3300053094 Bacteria 57920
1652 Ga0500566_0019723 3300053094 Bacteria 3960
1653 Ga0500640_041496 3300053095 Bacteria 2021
1654 Ga0500641_0007196 3300053096 Bacteria 3967
1655 Ga0500648_062230 3300053097 Bacteria 2115
1656 Ga0500654_118940 3300053099 Bacteria 1048
1657 Ga0500554_044646 3300053102 Bacteria 1374
1658 Ga0500555_077202 3300053103 Bacteria 871
1659 Ga0500562_014378 3300053108 Bacteria 2027
1660 Ga0500572_000476 3300053111 Bacteria 13916
1661 Ga0500591_027619 3300053115 Bacteria 2748
1662 Ga0500593_032050 3300053117 Bacteria 2351
1663 Ga0500595_000586 3300053119 Bacteria 21747
1664 Ga0500595_001444 3300053119 Bacteria 12688
1665 Ga0500595_002570 3300053119 Bacteria 8869
1666 Ga0500595_013365 3300053119 Bacteria 3147
1667 Ga0500595_028285 3300053119 Bacteria 1912
1668 Ga0500608_030856 3300053122 Bacteria 2542
1669 Ga0500614_016596 3300053123 Bacteria 1654
1670 Ga0500621_100634 3300053126 Bacteria 1141
1671 Ga0500642_0185661 3300053130 Bacteria 971
1672 Ga0500658_0006809 3300053134 Bacteria 4228
1673 Ga0500658_0279235 3300053134 Bacteria 768
1674 Ga0500559_0000654 3300053136 Bacteria 23267
1675 Ga0500559_0016820 3300053136 Bacteria 3089
1676 Ga0500568_0066049 3300053139 Bacteria 1392
1677 Ga0500568_0093983 3300053139 Bacteria 1129
1678 Ga0500573_0016365 3300053140 Bacteria 4208
1679 Ga0500577_0013422 3300053142 Bacteria 2502
1680 Ga0500577_0079270 3300053142 Bacteria 1306
1681 Ga0500589_042895 3300053147 Bacteria 2108
1682 Ga0500590_065126 3300053148 Bacteria 1823
1683 Ga0500603_000031 3300053150 Bacteria 34081
1684 Ga0500603_000171 3300053150 Bacteria 16423
1685 Ga0500622_0263836 3300053156 Bacteria 750
1686 Ga0500627_0107617 3300053158 Bacteria 1254
1687 Ga0500630_000581 3300053159 Bacteria 16620
1688 Ga0500633_0110996 3300053160 Bacteria 1016
1689 Ga0500638_018261 3300053162 Bacteria 3270
1690 Ga0500639_000020 3300053163 Bacteria 102959
1691 Ga0500636_0049485 3300053177 Bacteria 2473
1692 Ga0500636_0058958 3300053177 Bacteria 2243
1693 Ga0500636_0070433 3300053177 Bacteria 2029
1694 Ga0500637_0005363 3300053178 Bacteria 6198
1695 Ga0500637_0007143 3300053178 Bacteria 5566
1696 Ga0500637_0016794 3300053178 Bacteria 3909
1697 Ga0500637_0189385 3300053178 Bacteria 1176
1698 Ga0500611_001811 3300053727 Bacteria 2440
1699 Ga0500611_021826 3300053727 Bacteria 1227
1700 Ga0500645_010565 3300053730 Bacteria 3048
1701 Ga0500609_021471 3300053731 Bacteria 881
1702 Ga0500552_024431 3300053733 Bacteria 888
1703 Ga0500596_003763 3300053735 Bacteria 2848
1704 Ga0500596_008547 3300053735 Bacteria 1628
1705 Ga0501084_0014440 3300054114 Bacteria 6545
1706 Ga0501084_0015558 3300054114 Bacteria 6309
1707 Ga0501084_0036665 3300054114 Bacteria 4096
1708 Ga0501084_0039306 3300054114 Bacteria 3957
1709 Ga0501084_0361418 3300054114 Bacteria 1227
1710 Ga0501082_0000040 3300060353 Bacteria 91596
1711 Ga0501082_0013015 3300060353 Bacteria 7151
1712 Ga0501082_0042865 3300060353 Bacteria 3900
1713 Ga0501082_0059229 3300060353 Bacteria 3300
1714 Ga0501082_0115603 3300060353 Bacteria 2323
1715 Ga0501082_0356681 3300060353 Bacteria 1275
1716 Ga0501082_0463768 3300060353 Bacteria 1107
1717 Ga0501082_0568314 3300060353 Bacteria 992
1718 Ga0501082_0948740 3300060353 Bacteria 752
1719 Ga0530510_0061859 3300061734 Bacteria 2710
1720 Ga0530510_0079726 3300061734 Bacteria 2381
1721 Ga0530510_0250688 3300061734 Bacteria 1319
1722 2513590484 2513237087 Bacteria 5817514
1723 2513649496 2513237095 Bacteria 8976980
1724 2513657248 2513237096 Bacteria 8722461
1725 2513857716 2513237137 Bacteria 9558895
1726 2513919256 2513237145 Bacteria 8979722
1727 2514589642 2513237351 Bacteria 6968952
1728 2517891047 2517572143 Bacteria 9484767
1729 2524465181 2524023210 Bacteria 9029266
1730 2671123712 2667528175 Bacteria 7532676
1731 2723843425 2721755755 Bacteria 8322773
1732 2728752686 2728368998 Bacteria 8720350
1733 2793066401 2791355197 Bacteria 8420563
1734 2793077851
1735 2818237966 2816332527 Bacteria 8933356
1736 2874611664 2874604998 Bacteria 7834745
1737 2876814232 2876808645 Bacteria 8824342
1738 2878743754 2878738818 Bacteria 7136951
1739 2879114909 2879110137 Bacteria 8907982
1740 2885387638 2885383462 Bacteria 9473874
1741 2885418282 2885409591 Bacteria 9235467
1742 2888381716 2888378607 Bacteria 9652610
1743 2903749279 2903748898 Bacteria 9972761
1744 2906616244
1745 2906628310 2906626472 Bacteria 8826946
1746 2906640334 2906635258 Bacteria 8601019
1747 2906667254 2906660503 Bacteria 8595048
1748 2922431762
1749 2924781567 2924776078 Bacteria 7492003
1750 2932796602 2932794094 Bacteria 7915132
1751 2932802616 2932801729 Bacteria 7987968
1752 2935680019 2935675223 Bacteria 9928132
1753 2935693901 2935684952 Bacteria 9590419
1754 2935700659 2935694250 Bacteria 9291695
1755 2935722023 2935713505 Bacteria 9608509
1756 2935731332 2935722832 Bacteria 9608746
1757 2935741032 2935732158 Bacteria 9706831
1758 2935750408 2935741537 Bacteria 9707219
1759 2935759663 2935750917 Bacteria 9590372
1760 2935768583 2935760218 Bacteria 9817913
1761 2935883573 2935883170 Bacteria 7964738
1762 2935967062 2935959822 Bacteria 7869783
1763 2940565568 2940556831 Bacteria 9590747
1764 2958146568 2958144490 Bacteria 6677056
1765 2968017563 2968016561 Bacteria 7022047
1766 2970472261 2970469710 Bacteria 6969209
1767 3005481580 3005474847 Bacteria 9259049
1768 8002060756 8002060224 Bacteria 4026565
1769 8006943174 8006933436 Bacteria 10410654
1770 8006982969 8006973647 Bacteria 10679141
1771 8016591194 8016583857 Bacteria 10421953
1772 8019575114 8019565922 Bacteria 9639779
1773 8019653219 8019648815 Bacteria 10014479
1774 nmdc:mga0qj67_276001_c1
1775 JGI24746J21847_1002224
1776 JGI24737J22298_10046026
1777 JGI24743J22301_10035741
1778 JGI24735J21928_10041249
1779 JGI24750J21931_1001355
1780 JGI24745J21846_1000775
1781 JGI24748J21848_1003115
1782 JGI24749J21850_1002812
1783 JGI24744J21845_10000934
1784 JGI24034J26672_10011810
1785 JGI24742J22300_10000424
1786 JGI24742J22300_10003626
1787 JGI25156J39149_1000198
1788 JGI25154J39366_1000209
1789 JGI25157J39369_1000240
1790 JGI25159J45721_1007087
1791 JGI25406J46586_10004053
1792 JGI25165J46597_1011687
1793 JGI25153J46596_10000946
1794 rootH1_10253643
1795 JGI25160J50197_1024073
1796 JGI25405J52794_10011223
1797 Ga0055543_1014759
1798 Ga0065165_1000785
1799 Ga0065165_1016570
1800 Ga0065707_10091172
1801 Ga0065707_10199625
1802 Ga0070658_10067069
1803 Ga0070658_10131651
1804 Ga0070676_10013244
1805 Ga0070676_10025116
1806 Ga0070676_10031955
1807 Ga0070676_10489589
1808 Ga0070683_100529961
1809 Ga0070690_100010416
1810 Ga0070670_100009831
1811 Ga0070670_100080110
1812 Ga0070670_100113554
1813 Ga0070670_100222332
1814 Ga0068869_100005796
1815 Ga0068869_100033165
1816 Ga0070666_10008356
1817 Ga0070666_10431938
1818 Ga0070680_100070310
1819 Ga0070680_100117171
1820 Ga0070682_100008701
1821 Ga0070682_100009990
1822 Ga0070682_100498948
1823 Ga0068868_100006107
1824 Ga0068868_100040882
1825 Ga0070660_100000939
1826 Ga0070660_100025758
1827 Ga0070660_100255115
1828 Ga0070689_100018460
1829 Ga0070689_100020568
1830 Ga0070689_100022682
1831 Ga0070689_100160791
1832 Ga0070691_10010464
1833 Ga0070691_10142950
1834 Ga0070687_100008830
1835 Ga0070687_100028601
1836 Ga0070661_100027242
1837 Ga0070661_100307306
1838 Ga0070661_100889811
1839 Ga0070692_10071462
1840 Ga0070692_10096682
1841 Ga0070668_100010470
1842 Ga0070668_100011094
1843 Ga0070668_100021106
1844 Ga0070668_100162264
1845 Ga0070669_100014612
1846 Ga0070669_100022662
1847 Ga0070669_100054921
1848 Ga0070669_100115944
1849 Ga0070669_100214713
1850 Ga0070669_100357841
1851 Ga0070675_100007433
1852 Ga0070675_100010507
1853 Ga0070671_100001845
1854 Ga0070671_100049276
1855 Ga0070671_100072337
1856 Ga0070671_100341681
1857 Ga0070674_100009356
1858 Ga0070674_100109690
1859 Ga0070673_100006459
1860 Ga0070673_100007902
1861 Ga0070673_100012955
1862 Ga0070688_100056856
1863 Ga0070688_100212681
1864 Ga0070659_100004243
1865 Ga0070659_100020505
1866 Ga0070659_100052526
1867 Ga0070659_100173866
1868 Ga0070659_100442758
1869 Ga0070667_100089323
1870 Ga0070667_100628389
1871 Ga0070667_100731439
1872 Ga0070709_10311234
1873 Ga0070709_10382254
1874 Ga0070714_100020133
1875 Ga0070714_100083496
1876 Ga0070714_100342879
1877 Ga0070714_100401132
1878 Ga0070714_100407643
1879 Ga0070713_100006457
1880 Ga0070713_100012781
1881 Ga0070713_100082029
1882 Ga0070713_100130847
1883 Ga0070713_100186406
1884 Ga0070713_100242797
1885 Ga0070713_100577855
1886 Ga0070713_100801842
1887 Ga0070710_10001738
1888 Ga0070710_10145602
1889 Ga0070710_10392002
1890 Ga0070701_10007943
1891 Ga0070711_100004017
1892 Ga0070711_100028343
1893 Ga0070711_100068473
1894 Ga0070711_100225585
1895 Ga0070705_100060768
1896 Ga0070705_100452288
1897 Ga0070700_100023233
1898 Ga0070700_100164743
1899 Ga0070694_100039271
1900 Ga0070694_100091305
1901 Ga0070694_100101966
1902 Ga0070663_100009487
1903 Ga0070663_100026948
1904 Ga0070663_100603274
1905 Ga0070663_100726812
1906 Ga0070678_100085452
1907 Ga0070662_100012811
1908 Ga0070662_100016757
1909 Ga0070662_100045051
1910 Ga0070662_100108225
1911 Ga0070662_100123661
1912 Ga0070662_100415041
1913 Ga0070662_100576393
1914 Ga0070681_10020204
1915 Ga0070681_10027203
1916 Ga0070681_10047854
1917 Ga0070681_10206617
1918 Ga0068867_100024994
1919 Ga0068867_100081404
1920 Ga0068867_100122647
1921 Ga0068867_100272156
1922 Ga0070685_10012638
1923 Ga0070685_10164001
1924 Ga0070707_100252048
1925 Ga0070707_100657677
1926 Ga0070699_100406998
1927 Ga0070679_100010140
1928 Ga0070679_100011107
1929 Ga0070684_100030922
1930 Ga0070684_100081673
1931 Ga0068853_100005277
1932 Ga0068853_100010108
1933 Ga0068853_100071078
1934 Ga0068853_100097710
1935 Ga0068853_100595339
1936 Ga0070672_100003221
1937 Ga0070672_100242747
1938 Ga0070672_100341286
1939 Ga0070686_100273192
1940 Ga0070686_100509861
1941 Ga0070695_100000088
1942 Ga0070695_100008380
1943 Ga0070695_100126206
1944 Ga0070695_100258945
1945 Ga0070695_100317945
1946 Ga0070696_100018761
1947 Ga0070696_100047274
1948 Ga0070696_100120101
1949 Ga0070665_100021137
1950 Ga0070665_100041633
1951 Ga0070665_100062066
1952 Ga0070665_100088181
1953 Ga0070665_100981455
1954 Ga0070704_100005398
1955 Ga0070704_100019709
1956 Ga0070704_100043795
1957 Ga0068855_100036765
1958 Ga0068855_100068463
1959 Ga0068855_101024888
1960 Ga0070664_100035563
1961 Ga0070664_100104031
1962 Ga0070664_100129446
1963 Ga0070664_100363142
1964 Ga0070664_100556568
1965 Ga0068857_100004707
1966 Ga0068857_100099316
1967 Ga0068854_100013937
1968 Ga0068856_100090862
1969 Ga0068856_100274594
1970 Ga0068856_100316935
1971 Ga0068856_100377500
1972 Ga0068856_100513005
1973 Ga0070702_100002160
1974 Ga0070702_100058756
1975 Ga0070702_100090997
1976 Ga0070702_100551387
1977 Ga0068852_100009156
1978 Ga0068852_100029216
1979 Ga0068852_100335326
1980 Ga0068859_100047469
1981 Ga0068859_100093559
1982 Ga0068859_100312167
1983 Ga0068859_100557151
1984 Ga0068864_100004704
1985 Ga0068864_100009782
1986 Ga0068864_100080001
1987 Ga0068864_100201456
1988 Ga0068866_10004095
1989 Ga0068866_10197501
1990 Ga0068861_100017474
1991 Ga0068861_100057206
1992 Ga0068861_100295122
1993 Ga0068861_100475583
1994 Ga0068851_10009739
1995 Ga0068870_10004328
1996 Ga0068870_10005082
1997 Ga0068863_100005050
1998 Ga0068863_100014875
1999 Ga0068863_100044944
2000 Ga0068863_100512502
2001 Ga0068858_100008255
2002 Ga0068858_100041195
2003 Ga0068860_100007113
2004 Ga0068860_100046816
2005 Ga0068862_100007625
2006 Ga0068862_100086826
2007 Ga0068862_100394166
2008 Ga0081455_10004617
2009 Ga0081455_10005751
2010 Ga0081455_10235690
2011 Ga0081455_10299808
2012 Ga0081538_10020707
2013 Ga0081540_1001688
2014 Ga0081540_1002923
2015 Ga0081540_1009895
2016 Ga0081539_10003785
2017 Ga0081539_10019455
2018 Ga0081539_10021469
2019 Ga0081539_10072437
2020 Ga0081539_10095390
2021 Ga0070717_10003779
2022 Ga0070717_10015928
2023 Ga0070717_10048243
2024 Ga0070717_10139812
2025 Ga0070717_10441941
2026 Ga0075365_10026618
2027 Ga0075365_10140400
2028 Ga0075365_10163298
2029 Ga0075365_10273891
2030 Ga0075365_10496570
2031 Ga0075364_10002553
2032 Ga0075432_10076047
2033 Ga0070716_100010739
2034 Ga0070716_100053462
2035 Ga0070716_100184782
2036 Ga0070716_100359132
2037 Ga0070712_100003573
2038 Ga0070712_100016638
2039 Ga0070712_100122234
2040 Ga0070712_100139359
2041 Ga0070712_100365042
2042 Ga0070712_100407066
2043 Ga0075362_10241676
2044 Ga0075367_10003976
2045 Ga0075369_10064360
2046 Ga0097621_100004513
2047 Ga0097621_100467307
2048 Ga0075370_10057493
2049 Ga0075370_10211328
2050 Ga0068871_100012856
2051 Ga0068871_100256293
2052 Ga0068871_100640353
2053 Ga0075428_100121815
2054 Ga0075428_100128951
2055 Ga0075428_100146476
2056 Ga0075428_100379353
2057 Ga0075428_100427259
2058 Ga0075428_100614108
2059 Ga0075428_100907265
2060 Ga0075430_100047302
2061 Ga0075430_100066972
2062 Ga0075430_100348701
2063 Ga0075431_100061704
2064 Ga0075431_100205538
2065 Ga0075431_100517639
2066 Ga0075433_10196719
2067 Ga0075434_100118279
2068 Ga0075434_100131513
2069 Ga0075434_100211466
2070 Ga0075434_100229670
2071 Ga0075434_100445691
2072 Ga0075429_100296701
2073 Ga0075429_100347525
2074 Ga0068865_100008478
2075 Ga0068865_100054808
2076 Ga0075436_100008678
2077 Ga0075436_100088469
2078 Ga0075436_100104645
2079 Ga0075436_100434978
2080 Ga0097620_100047472
2081 Ga0097620_100093559
2082 Ga0097620_100312184
2083 Ga0097620_100557091
2084 Ga0099824_1009169
2085 Ga0099822_1012158
2086 Ga0075435_100008690
2087 Ga0075435_100709120
2088 Ga0099794_10008987
2089 Ga0099794_10040959
2090 Ga0099794_10074240
2091 Ga0099795_10000441
2092 Ga0099795_10024476
2093 Ga0099795_10066158
2094 Ga0099795_10094123
2095 Ga0105251_10088082
2096 Ga0105244_10081325
2097 Ga0105240_10048174
2098 Ga0105240_10063893
2099 Ga0105240_10099376
2100 Ga0105240_11046430
2101 Ga0111539_10087869
2102 Ga0111539_10097294
2103 Ga0111539_10122649
2104 Ga0111539_10170022
2105 Ga0105245_10006657
2106 Ga0105245_10011565
2107 Ga0105245_10042174
2108 Ga0105247_10003741
2109 Ga0105247_10020804
2110 Ga0105247_10035674
2111 Ga0105247_10038462
2112 Ga0105247_10049424
2113 Ga0105247_10074650
2114 Ga0114129_10059852
2115 Ga0114129_10203045
2116 Ga0114129_10422172
2117 Ga0114129_10723256
2118 Ga0105243_10070118
2119 Ga0105243_10282345
2120 Ga0105241_10008231
2121 Ga0105241_10034255
2122 Ga0105242_10029002
2123 Ga0105242_10295399
2124 Ga0105248_10059261
2125 Ga0105248_10138902
2126 Ga0105248_10369308
2127 Ga0105248_10393057
2128 Ga0105248_10615759
2129 Ga0105248_10629628
2130 Ga0105237_10002982
2131 Ga0105237_10053877
2132 Ga0105237_10055541
2133 Ga0105237_10131772
2134 Ga0105238_10005756
2135 Ga0105238_10029879
2136 Ga0105238_10064315
2137 Ga0105238_10091379
2138 Ga0105238_10117557
2139 Ga0105238_10639322
2140 Ga0105249_10026496
2141 Ga0105249_10057738
2142 Ga0105249_10092266
2143 Ga0105249_10133579
2144 Ga0105029_107684
2145 Ga0099796_10001698
2146 Ga0099796_10001865
2147 Ga0099796_10007090
2148 Ga0099796_10048575
2149 Ga0099796_10052230
2150 Ga0105239_10016807
2151 Ga0105239_10035074
2152 Ga0105239_10090414
2153 Ga0105239_10169861
2154 Ga0105239_10299879
2155 Ga0105246_10020411
2156 Ga0105246_10065320
2157 Ga0105246_10136614
2158 Ga0105246_10749675
2159 Ga0157371_10498812
2160 Ga0157370_10035007
2161 Ga0157370_10114027
2162 Ga0157370_10508487
2163 Ga0157370_10770111
2164 Ga0157369_10001818
2165 Ga0157369_10008070
2166 Ga0157369_10101657
2167 Ga0157374_10010373
2168 Ga0157374_10034810
2169 Ga0157378_10129148
2170 Ga0157378_10142012
2171 Ga0157378_10738696
2172 Ga0163162_10087541
2173 Ga0163162_10243031
2174 Ga0163162_10373032
2175 Ga0163162_10381981
2176 Ga0163162_11075866
2177 Ga0157372_10004050
2178 Ga0157372_10160662
2179 Ga0157372_10438263
2180 Ga0157372_10538770
2181 Ga0157375_10015123
2182 Ga0157375_10090637
2183 Ga0157375_10407215
2184 Ga0157375_10418534
2185 Ga0157375_11042996
2186 Ga0163163_10010748
2187 Ga0163163_10049335
2188 Ga0163163_10138553
2189 Ga0163163_10236146
2190 Ga0163163_10417182
2191 Ga0157380_10025703
2192 Ga0157380_10048738
2193 Ga0157380_10081638
2194 Ga0157377_10007621
2195 Ga0157377_10493536
2196 Ga0157379_10027562
2197 Ga0157379_10238949
2198 Ga0157376_10074712
2199 Ga0157376_10182891
2200 Ga0157376_10381575
2201 Ga0163161_10015441
2202 Ga0163161_10373676
2203 Ga0213873_10012361
2204 Ga0213872_10048695
2205 Ga0213872_10056759
2206 Ga0213874_10016816
2207 Ga0213876_10003691
2208 Ga0213876_10127457
2209 Ga0213871_10002516
2210 Ga0213871_10018478
2211 Ga0224572_1041130
2212 Ga0209435_100091
2213 Ga0209646_1000295
2214 Ga0209026_1000366
2215 Ga0209759_1000513
2216 Ga0209233_1002293
2217 Ga0209233_1008990
2218 Ga0209130_1000389
2219 Ga0209758_1004239
2220 Ga0207426_1000361
2221 Ga0207426_1025172
2222 Ga0207697_10008248
2223 Ga0207656_10013388
2224 Ga0207656_10020494
2225 Ga0207682_10013567
2226 Ga0207692_10000880
2227 Ga0207642_10187404
2228 Ga0207710_10002838
2229 Ga0207710_10019649
2230 Ga0207710_10082431
2231 Ga0207688_10001906
2232 Ga0207688_10002332
2233 Ga0207688_10048591
2234 Ga0207680_10079461
2235 Ga0207680_10377148
2236 Ga0207647_10004250
2237 Ga0207647_10088873
2238 Ga0207647_10094052
2239 Ga0207685_10074761
2240 Ga0207685_10201347
2241 Ga0207699_10002228
2242 Ga0207699_10082613
2243 Ga0207699_10111388
2244 Ga0207699_10428640
2245 Ga0207645_10010970
2246 Ga0207645_10026220
2247 Ga0207645_10034046
2248 Ga0207645_10038240
2249 Ga0207643_10002034
2250 Ga0207643_10014811
2251 Ga0207705_10161483
2252 Ga0207684_10083513
2253 Ga0207684_10111421
2254 Ga0207684_10742172
2255 Ga0207654_10002780
2256 Ga0207654_10078431
2257 Ga0207707_10010663
2258 Ga0207707_10017265
2259 Ga0207707_10053530
2260 Ga0207707_10807096
2261 Ga0207695_10254758
2262 Ga0207671_10007430
2263 Ga0207671_10150972
2264 Ga0207671_10170500
2265 Ga0207671_10174915
2266 Ga0207671_10589229
2267 Ga0207693_10006271
2268 Ga0207693_10017660
2269 Ga0207693_10020813
2270 Ga0207693_10122957
2271 Ga0207693_10334496
2272 Ga0207693_10454112
2273 Ga0207693_10498647
2274 Ga0207663_10002278
2275 Ga0207663_10050857
2276 Ga0207663_10096389
2277 Ga0207663_10164948
2278 Ga0207663_10282365
2279 Ga0207663_10633890
2280 Ga0207660_10005920
2281 Ga0207660_10055147
2282 Ga0207660_10072531
2283 Ga0207660_10089440
2284 Ga0207660_10268682
2285 Ga0207660_10362776
2286 Ga0207662_10004685
2287 Ga0207662_10006282
2288 Ga0207657_10002785
2289 Ga0207657_10038506
2290 Ga0207657_10150596
2291 Ga0207649_10000031
2292 Ga0207649_10000033
2293 Ga0207649_10137525
2294 Ga0207649_10417491
2295 Ga0207652_10007295
2296 Ga0207652_10034133
2297 Ga0207652_10067755
2298 Ga0207652_10400632
2299 Ga0207652_10615235
2300 Ga0207681_10109735
2301 Ga0207681_10117307
2302 Ga0207694_10004400
2303 Ga0207694_10076254
2304 Ga0207694_10463499
2305 Ga0207650_10002738
2306 Ga0207650_10027115
2307 Ga0207650_10063064
2308 Ga0207650_10131050
2309 Ga0207659_10010009
2310 Ga0207659_10015533
2311 Ga0207687_10005847
2312 Ga0207687_10010555
2313 Ga0207687_10111636
2314 Ga0207687_10142963
2315 Ga0207700_10006859
2316 Ga0207700_10046006
2317 Ga0207700_10048646
2318 Ga0207700_10086525
2319 Ga0207700_10132540
2320 Ga0207700_10140670
2321 Ga0207700_10306789
2322 Ga0207700_10316065
2323 Ga0207700_10481406
2324 Ga0207700_10764645
2325 Ga0207700_10898641
2326 Ga0207664_10032247
2327 Ga0207664_10072622
2328 Ga0207664_10353106
2329 Ga0207644_10010237
2330 Ga0207644_10010951
2331 Ga0207644_10012480
2332 Ga0207690_10002494
2333 Ga0207690_10069545
2334 Ga0207690_10073108
2335 Ga0207690_10225112
2336 Ga0207690_10316053
2337 Ga0207706_10001779
2338 Ga0207706_10003134
2339 Ga0207706_10024619
2340 Ga0207706_10081024
2341 Ga0207706_10256945
2342 Ga0207706_10294259
2343 Ga0207706_10351132
2344 Ga0207686_10044106
2345 Ga0207709_10016786
2346 Ga0207709_10115209
2347 Ga0207709_10352062
2348 Ga0207670_10021392
2349 Ga0207670_10029969
2350 Ga0207670_10290942
2351 Ga0207669_10005756
2352 Ga0207669_10520971
2353 Ga0207704_10010329
2354 Ga0207665_10015878
2355 Ga0207665_10083685
2356 Ga0207665_10144852
2357 Ga0207665_10382972
2358 Ga0207691_10006507
2359 Ga0207691_10007515
2360 Ga0207691_10253496
2361 Ga0207691_10317525
2362 Ga0207691_10426154
2363 Ga0207711_10010088
2364 Ga0207711_10118037
2365 Ga0207711_10182716
2366 Ga0207711_10381207
2367 Ga0207689_10001370
2368 Ga0207689_10008563
2369 Ga0207661_10012149
2370 Ga0207661_10035468
2371 Ga0207679_10176707
2372 Ga0207679_10280389
2373 Ga0207679_10583956
2374 Ga0207679_10797351
2375 Ga0207679_10839664
2376 Ga0207667_10010887
2377 Ga0207667_10182003
2378 Ga0207667_10929025
2379 Ga0207651_10006050
2380 Ga0207651_10049466
2381 Ga0207651_10175172
2382 Ga0207712_10055094
2383 Ga0207712_10082319
2384 Ga0207712_10257091
2385 Ga0207712_10488089
2386 Ga0207668_10029634
2387 Ga0207668_10066722
2388 Ga0207668_10130771
2389 Ga0207668_10315769
2390 Ga0207668_10437286
2391 Ga0207640_10028881
2392 Ga0207640_10137437
2393 Ga0207640_10517461
2394 Ga0207658_10271554
2395 Ga0207677_10007022
2396 Ga0207677_10859754
2397 Ga0207703_10005527
2398 Ga0207703_10087571
2399 Ga0207703_10178690
2400 Ga0207703_10301275
2401 Ga0207639_10018693
2402 Ga0207639_10179605
2403 Ga0207639_10434586
2404 Ga0207639_10574955
2405 Ga0207678_10004671
2406 Ga0207678_10006952
2407 Ga0207678_10025982
2408 Ga0207678_10027109
2409 Ga0207678_10856244
2410 Ga0207708_10001428
2411 Ga0207708_10007178
2412 Ga0207708_10029917
2413 Ga0207702_10088425
2414 Ga0207702_10270409
2415 Ga0207702_10405922
2416 Ga0207702_10735139
2417 Ga0207702_10748554
2418 Ga0207641_10017293
2419 Ga0207641_10025809
2420 Ga0207641_10256148
2421 Ga0207648_10004473
2422 Ga0207648_10010764
2423 Ga0207648_10139092
2424 Ga0207648_10309360
2425 Ga0207648_10431927
2426 Ga0207676_10010604
2427 Ga0207676_10010854
2428 Ga0207676_10067232
2429 Ga0207674_10015065
2430 Ga0207674_10051516
2431 Ga0207674_10081726
2432 Ga0207674_10174528
2433 Ga0207674_10308462
2434 Ga0207675_100001777
2435 Ga0207675_100003458
2436 Ga0207675_100213360
2437 Ga0207675_100348625
2438 Ga0207675_100756441
2439 Ga0207683_10003755
2440 Ga0207683_10010729
2441 Ga0207683_10023225
2442 Ga0207683_10048576
2443 Ga0207683_10315499
2444 Ga0207698_10005989
2445 Ga0207698_10153205
2446 Ga0207698_10257106
2447 Ga0207698_10666931
2448 Ga0209589_1000006
2449 Ga0209489_100007
2450 Ga0209700_100008
2451 Ga0209179_1005350
2452 Ga0209179_1014263
2453 Ga0209588_1001156
2454 Ga0209588_1046820
2455 Ga0207428_10094389
2456 Ga0207428_10391742
2457 Ga0268266_10002524
2458 Ga0268266_10002721
2459 Ga0268266_10005528
2460 Ga0268266_10008468
2461 Ga0268266_10010821
2462 Ga0268266_10181864
2463 Ga0268266_10267273
2464 Ga0268265_10007472
2465 Ga0268265_10123881
2466 Ga0268265_10164209
2467 Ga0268265_10881527
2468 Ga0268264_10000174
2469 Ga0268264_10031810
2470 Ga0268264_10055736
2471 Ga0268264_10645447
2472 Ga0265338_10069616
2473 Ga0265338_10087780
2474 Ga0265324_10006333
2475 Ga0265330_10006018
2476 Ga0265330_10168617
2477 Ga0265332_10039386
2478 Ga0265328_10000006
2479 Ga0265328_10000450
2480 Ga0265328_10009243
2481 Ga0265328_10021734
2482 Ga0265328_10051919
2483 Ga0265328_10082408
2484 Ga0265320_10002095
2485 Ga0265325_10008854
2486 Ga0265325_10013263
2487 Ga0265325_10024250
2488 Ga0265325_10026580
2489 Ga0265325_10115409
2490 Ga0265340_10003647
2491 Ga0265340_10006812
2492 Ga0265340_10033125
2493 Ga0265340_10123680
2494 Ga0265339_10000137
2495 Ga0265339_10009370
2496 Ga0265339_10030160
2497 Ga0265339_10041964
2498 Ga0265331_10000141
2499 Ga0265331_10000145
2500 Ga0265331_10000673
2501 Ga0265331_10000882
2502 Ga0265331_10019993
2503 Ga0265331_10099921
2504 Ga0265331_10133630
2505 Ga0265327_10000033
2506 Ga0265327_10000070
2507 Ga0265327_10000703
2508 Ga0265327_10008302
2509 Ga0265327_10099810
2510 Ga0265316_10000091
2511 Ga0265316_10041888
2512 Ga0265316_10068276
2513 Ga0265316_10070886
2514 Ga0265316_10398203
2515 Ga0265316_10414470
2516 Ga0265316_10621841
2517 Ga0307509_10006398
2518 Ga0307509_10046824
2519 Ga0307509_10050219
2520 Ga0307509_10283105
2521 Ga0265313_10000269
2522 Ga0265313_10000782
2523 Ga0265313_10001300
2524 Ga0265313_10080712
2525 Ga0265313_10148342
2526 Ga0307508_10000105
2527 Ga0307508_10063281
2528 Ga0307508_10094506
2529 Ga0265314_10001057
2530 Ga0265314_10002651
2531 Ga0265314_10002789
2532 Ga0265314_10006484
2533 Ga0265314_10042742
2534 Ga0265314_10061525
2535 Ga0265314_10095947
2536 Ga0265314_10176091
2537 Ga0265342_10008664
2538 Ga0265342_10019274
2539 Ga0265342_10033550
2540 Ga0265342_10041441
2541 Ga0265342_10299282
2542 Ga0316576_10389413
2543 Ga0316578_10005177
2544 Ga0307516_10000657
2545 Ga0307516_10025929
2546 Ga0307516_10046721
2547 Ga0307516_10121468
2548 Ga0307518_10422147
2549 Ga0307406_10380002
2550 Ga0307416_100285090
2551 Ga0307415_100046127
2552 Ga0316583_10000233
2553 Ga0307507_10101126
2554 Ga0307510_10027931
2555 Ga0307510_10028847
2556 Ga0307510_10032970
2557 Ga0315911_1000003
2558 Ga0316215_1003294
2559 Ga0373959_0122038
2560 Ga0373938_0014387
2561 Ga0373926_0107403
2562 Ga0373928_0010982
2563 Ga0373934_0022581
2564 Ga0373934_0095934
2565 Ga0373940_0158077
2566 Ga0373944_0019687
2567 Ga0373944_0033857
2568 Ga0373944_0129889
2569 Ga0373949_0042525
2570 Ga0373923_0012312
2571 Ga0373923_0155147
2572 Ga0373936_0000885
2573 Ga0373936_0003367
2574 Ga0373936_0095937
2575 Ga0373939_0113964
2576 Ga0373945_0007786
2577 Ga0373945_0014890
2578 Ga0373945_0016878
2579 Ga0373945_0105297
2580 Ga0373953_0004630
2581 Ga0373953_0004698
2582 Ga0373953_0036551
2583 Ga0373953_0176723
2584 Ga0373954_0000950
2585 Ga0373954_0009404
2586 Ga0373954_0023202
2587 Ga0373954_0034271
2588 Ga0373954_0042781
2589 Ga0373954_0214303
2590 Ga0373956_0066659
2591 Ga0373956_0115695
2592 Ga0373956_0134170
2593 Ga0373957_0011342
2594 Ga0373957_0014124
2595 Ga0373957_0085738
2596 Ga0373943_0014141
2597 Ga0373943_0047480
2598 Ga0373943_0057788
2599 Ga0373943_0102654
2600 Ga0373943_0128823
2601 Ga0373943_0201324
2602 Ga0373943_0252177
2603 Ga0373943_0268221
2604 Ga0373946_0001576
2605 Ga0373946_0006921
2606 Ga0373946_0039314
2607 Ga0373946_0202706
2608 Ga0373955_0000742
2609 Ga0373955_0000886
2610 Ga0373955_0047053
2611 Ga0373955_0072915
2612 Ga0373955_0164645
2613 Ga0373961_0006767
2614 Ga0316574_0293439
2615 Ga0373924_0004542
2616 Ga0373924_0010961
2617 Ga0373924_0018781
2618 Ga0373931_0008548
2619 Ga0373931_0033811
2620 Ga0373931_0036799
2621 Ga0373931_0255773
2622 Ga0373931_0272597
2623 Ga0373935_0000096
2624 Ga0373935_0000478
2625 Ga0373935_0030724
2626 Ga0373935_0056406
2627 Ga0373935_0085096
2628 Ga0373935_0164907
2629 Ga0373935_0343190
2630 Ga0373935_0386684
2631 Ga0373927_0001272
2632 Ga0373927_0002293
2633 Ga0373927_0008757
2634 Ga0373927_0018308
2635 Ga0373927_0074347
2636 Ga0373927_0136821
2637 Ga0373927_0138432
2638 Ga0373927_0157523
2639 Ga0373927_0255099
2640 Ga0373933_0001294
2641 Ga0373933_0003722
2642 Ga0373933_0042183
2643 Ga0373933_0268650
2644 Ga0373947_0000081
2645 Ga0373947_0000843
2646 Ga0373947_0007899
2647 Ga0373947_0061030
2648 Ga0373947_0062604
2649 Ga0373947_0089470
2650 Ga0373947_0166631
2651 Ga0373947_0405417
2652 Ga0373937_0000515
2653 Ga0373937_0002933
2654 Ga0373937_0005300
2655 Ga0373937_0032217
2656 Ga0373937_0043424
2657 Ga0373937_0047034
2658 Ga0373937_0067718
2659 Ga0373937_0074952
2660 Ga0373937_0148832
2661 Ga0373937_0187739
2662 Ga0373937_0423725
2663 Ga0373937_0536984
2664 Ga0373937_1094580
2665 Ga0372808_004176
2666 Ga0316582_0524902
2667 Ga0316584_0006337
2668 Ga0316584_0068926
2669 Ga0316584_0141881
2670 Ga0373925_0000011
2671 Ga0373925_0001296
2672 Ga0373925_0025284
2673 Ga0373925_0079999
2674 Ga0373925_0109099
2675 Ga0373925_0112460
2676 Ga0373925_0123453
2677 Ga0373925_0138814
2678 Ga0373925_0426242
2679 Ga0373925_0644329
2680 Ga0395899_0101941
2681 Ga0395900_0347141
2682 Ga0395898_0022529
2683 Ga0395898_0030141
2684 Ga0395905_0001778
2685 Ga0395905_0020451
2686 Ga0436364_0489075
2687 Ga0395901_0352855
2688 Ga0395901_1153766
2689 Ga0436365_0081603
2690 Ga0436365_0808140
2691 Ga0436360_0050348
2692 Ga0436360_0170277
2693 Ga0436360_0320963
2694 Ga0436360_1074814
2695 Ga0436360_1356508
2696 Ga0436361_0256757
2697 Ga0436361_0369023
2698 Ga0436361_0452542
2699 Ga0436361_0539018
2700 Ga0436361_0740814
2701 Ga0436361_0825589
2702 Ga0436361_1002425
2703 Ga0436363_0202525
2704 Ga0436363_0419001
2705 Ga0436363_0510027
2706 Ga0436363_0772297
2707 Ga0436363_0947874
2708 Ga0436363_1300598
2709 Ga0436362_0138375
2710 Ga0436362_0756530
2711 Ga0439453_0000337
2712 Ga0451793_1820481
2713 Ga0439442_039143
2714 Ga0439443_020201
2715 Ga0439434_0137912
2716 Ga0439435_0003544
2717 Ga0439435_0010286
2718 Ga0451577_0341346
2719 Ga0453683_0012709
2720 Ga0466966_0047159
2721 Ga0466963_0035869
2722 Ga0466963_0255841
2723 Ga0453684_0000006
2724 Ga0453684_0000031
2725 Ga0453684_0032690
2726 Ga0453684_0037507
2727 Ga0453684_0054779
2728 Ga0453684_0720980
2729 Ga0466957_0014629
2730 Ga0466959_0142724
2731 Ga0451576_0000056
2732 Ga0451576_0000919
2733 Ga0451576_0024090
2734 Ga0451576_0111401
2735 Ga0466958_0196272
2736 Ga0466967_0071219
2737 Ga0495592_0000493
2738 Ga0495592_0027393
2739 Ga0495592_0058610
2740 Ga0495592_0132347
2741 Ga0495592_0145179
2742 Ga0495592_0344353
2743 Ga0495603_0002952
2744 Ga0495603_0004318
2745 Ga0495603_0008319
2746 Ga0495603_0018514
2747 Ga0495603_0102521
2748 Ga0495590_0044817
2749 Ga0495590_0063082
2750 Ga0495629_0002893
2751 Ga0495629_0003465
2752 Ga0495629_0032712
2753 Ga0495629_0046403
2754 Ga0495629_0074389
2755 Ga0495629_0099874
2756 Ga0495629_0193713
2757 Ga0495629_0390467
2758 Ga0495638_0011130
2759 Ga0495638_0151907
2760 Ga0495641_0002491
2761 Ga0495641_0217332
2762 Ga0495651_0000364
2763 Ga0495651_0015118
2764 Ga0495651_0018706
2765 Ga0495651_0090272
2766 Ga0495651_0098904
2767 Ga0495651_0131710
2768 Ga0495653_0000398
2769 Ga0495653_0025322
2770 Ga0495653_0032960
2771 Ga0495653_0076978
2772 Ga0495653_0130834
2773 Ga0495653_0155527
2774 Ga0495580_0000749
2775 Ga0495580_0006621
2776 Ga0495580_0072398
2777 Ga0495580_0120756
2778 Ga0495580_0519254
2779 Ga0495582_0000038
2780 Ga0495582_0104553
2781 Ga0495605_0135223
2782 Ga0495605_0260953
2783 Ga0495639_0000092
2784 Ga0495639_0014639
2785 Ga0495639_0020661
2786 Ga0495639_0158744
2787 Ga0495662_0002976
2788 Ga0495662_0008650
2789 Ga0495662_0040962
2790 Ga0495662_0340939
2791 Ga0495664_0000019
2792 Ga0495664_0002736
2793 Ga0495664_0003467
2794 Ga0495664_0008379
2795 Ga0495664_0010424
2796 Ga0495664_0087932
2797 Ga0495664_0278017
2798 Ga0495584_0020845
2799 Ga0495584_0074952
2800 Ga0495585_0030191
2801 Ga0495585_0150291
2802 Ga0495594_0001994
2803 Ga0495594_0161170
2804 Ga0495594_0167624
2805 Ga0495594_0263434
2806 Ga0495596_0131316
2807 Ga0495606_0291294
2808 Ga0495608_0000026
2809 Ga0495608_0040232
2810 Ga0495608_0090254
2811 Ga0495616_0037108
2812 Ga0495616_0193452
2813 Ga0495618_0000015
2814 Ga0495618_0000705
2815 Ga0495618_0015933
2816 Ga0495618_0038274
2817 Ga0495618_0045102
2818 Ga0495618_0075820
2819 Ga0495620_0038186
2820 Ga0495620_0105029
2821 Ga0495628_0000006
2822 Ga0495628_0074103
2823 Ga0495628_0082302
2824 Ga0495630_0001838
2825 Ga0495630_0004473
2826 Ga0495630_0009360
2827 Ga0495630_0034189
2828 Ga0495630_0042211
2829 Ga0495630_0233841
2830 Ga0495631_0013380
2831 Ga0495631_0044415
2832 Ga0495632_0154205
2833 Ga0495643_0089309
2834 Ga0495644_0016167
2835 Ga0495644_0249174
2836 Ga0495648_0015002
2837 Ga0495648_0143397
2838 Ga0495648_0152429
2839 Ga0495648_0188554
2840 Ga0495663_0014873
2841 Ga0495666_0006104
2842 Ga0495666_0007530
2843 Ga0495652_0000030
2844 Ga0495652_0019294
2845 Ga0495652_0032264
2846 Ga0495652_0035784
2847 Ga0495652_0252724
2848 Ga0495665_0000186
2849 Ga0495665_0017149
2850 Ga0495665_0036835
2851 Ga0495665_0090938
2852 Ga0495640_0000246
2853 Ga0495640_0001008
2854 Ga0495640_0002127
2855 Ga0495640_0037739
2856 Ga0495640_0060449
2857 Ga0495640_0233108
2858 Ga0495640_0303996
2859 Ga0495586_0331955
2860 Ga0495586_0384130
2861 Ga0495587_0000021
2862 Ga0495587_0144911
2863 Ga0495587_0217249
2864 Ga0495587_0240169
2865 Ga0495598_0002784
2866 Ga0495598_0111028
2867 Ga0495621_0018686
2868 Ga0495645_0000001
2869 Ga0495645_0019743
2870 Ga0495645_0023021
2871 Ga0495645_0034293
2872 Ga0495645_0156786
2873 Ga0495645_0474007
2874 Ga0495622_0012358
2875 Ga0495622_0027174
2876 Ga0495622_0066724
2877 Ga0495667_0000027
2878 Ga0495667_0013545
2879 Ga0495667_0117742
2880 Ga0495667_0154015
2881 Ga0495667_0257268
2882 Ga0495656_0003198
2883 Ga0495656_0068974
2884 Ga0495668_0011373
2885 Ga0495668_0015058
2886 Ga0495668_0099735
2887 Ga0495634_0000008
2888 Ga0495634_0000706
2889 Ga0495634_0015350
2890 Ga0495634_0021107
2891 Ga0495634_0023535
2892 Ga0495611_0012542
2893 Ga0495625_0050870
2894 Ga0495625_0081568
2895 Ga0495625_0245777
2896 Ga0495635_0000028
2897 Ga0495635_0002553
2898 Ga0495635_0012050
2899 Ga0495635_0022409
2900 Ga0495635_0039315
2901 Ga0495635_0061392
2902 Ga0495635_0103202
2903 Ga0495635_0163069
2904 Ga0495659_0033429
2905 Ga0495661_0034000
2906 Ga0495588_0003404
2907 Ga0495588_0113239
2908 Ga0495588_0231807
2909 Ga0495588_0246739
2910 Ga0495657_0004008
2911 Ga0495657_0031662
2912 Ga0495657_0305561
2913 Ga0495599_0000232
2914 Ga0495599_0044273
2915 Ga0495623_0000448
2916 Ga0495623_0098569
2917 Ga0495623_0128708
2918 Ga0495646_0000148
2919 Ga0495646_0032422
2920 Ga0495646_0122361
2921 Ga0495646_0161842
2922 Ga0495646_0377122
2923 Ga0495647_0000203
2924 Ga0495647_0008947
2925 Ga0495647_0047420
2926 Ga0495647_0238845
2927 Ga0495658_0001537
2928 Ga0495658_0015719
2929 Ga0495658_0016381
2930 Ga0495658_0056336
2931 Ga0495658_0065199
2932 Ga0495669_0009514
2933 Ga0495669_0282784
2934 Ga0495613_0017873
2935 Ga0495613_0022543
2936 Ga0495613_0079448
2937 Ga0495613_0120984
2938 Ga0495613_0121448
2939 Ga0495613_0190890
2940 Ga0495613_0198031
2941 Ga0495613_0538409
2942 Ga0495624_0001987
2943 Ga0495624_0018144
2944 Ga0495624_0029729
2945 Ga0495624_0044550
2946 Ga0495624_0063304
2947 Ga0495624_0327486
2948 Ga0495670_0003950
2949 Ga0495670_0022339
2950 Ga0495670_0201466
2951 Ga0495670_0313003
2952 Ga0495671_0067264
2953 Ga0495671_0186494
2954 Ga0495649_0127772
2955 Ga0495649_0284314
2956 Ga0495589_0057399
2957 Ga0495589_0097600
2958 Ga0495600_0000195
2959 Ga0495600_0002506
2960 Ga0495600_0020494
2961 Ga0495600_0025066
2962 Ga0495600_0059898
2963 Ga0495600_0163254
2964 Ga0495660_0311530
2965 Ga0495581_0000019
2966 Ga0495581_0013871
2967 Ga0495581_0088455
2968 Ga0495581_0157969
2969 Ga0495581_0175987
2970 Ga0495581_0183224
2971 Ga0495581_0263521
2972 Ga0495581_0319024
2973 Ga0495604_0000002
2974 Ga0495604_0009212
2975 Ga0495604_0034714
2976 Ga0495604_0079171
2977 Ga0495604_0085241
2978 Ga0495604_0276700
2979 Ga0495636_0034181
2980 Ga0495674_0000004
2981 Ga0495674_0003455
2982 Ga0495674_0048516
2983 Ga0495674_0168307
2984 Ga0495674_0270718
2985 Ga0495674_0290211
2986 Ga0495672_0149882
2987 Ga0495672_0171915
2988 Ga0495676_0020934
2989 Ga0495676_0048740
2990 Ga0495676_0078890
2991 Ga0495676_0095015
2992 Ga0495676_0298644
2993 Ga0495680_0001465
2994 Ga0495680_0003584
2995 Ga0495680_0015898
2996 Ga0495680_0033269
2997 Ga0495680_0035652
2998 Ga0495680_0081665
2999 Ga0495680_0305013
3000 Ga0495683_0023073
3001 Ga0495675_0000351
3002 Ga0495675_0020965
3003 Ga0495675_0124763
3004 Ga0495675_0157773
3005 Ga0495677_0014595
3006 Ga0495677_0015227
3007 Ga0495677_0141474
3008 Ga0495679_039674
3009 Ga0495685_124816
3010 Ga0495673_0013698
3011 Ga0495673_0018331
3012 Ga0495673_0162883
3013 Ga0495684_0000004
3014 Ga0495684_0002699
3015 Ga0495684_0006327
3016 Ga0495684_0011826
3017 Ga0495684_0026662
3018 Ga0495684_0148165
3019 Ga0495684_0251155
3020 Ga0495686_0074432
3021 Ga0495686_0140297
3022 Ga0495593_0000250
3023 Ga0495593_0007024
3024 Ga0495593_0031371
3025 Ga0495593_0039653
3026 Ga0495593_0083810
3027 Ga0495593_0188875
3028 Ga0495602_0000001
3029 Ga0495602_0015663
3030 Ga0495602_0039711
3031 Ga0495602_0488502
3032 Ga0495614_0084919
3033 Ga0495626_0058422
3034 Ga0496100_0000842
3035 Ga0496100_0025238
3036 Ga0496100_0046119
3037 Ga0496100_0310976
3038 Ga0496100_0392737
3039 Ga0496100_0403206
3040 Ga0496100_0532549
3041 Ga0496100_0584448
3042 Ga0496100_0709386
3043 Ga0496101_0001211
3044 Ga0496101_0010196
3045 Ga0496101_0032129
3046 Ga0496101_0037494
3047 Ga0496101_0051165
3048 Ga0496101_0060112
3049 Ga0496101_0183719
3050 Ga0496101_0201052
3051 Ga0496101_0233004
3052 Ga0496101_0542824
3053 Ga0496102_0000617
3054 Ga0496102_0011697
3055 Ga0496102_0028987
3056 Ga0496102_0029422
3057 Ga0496102_0068983
3058 Ga0496102_0093582
3059 Ga0496102_0310052
3060 Ga0496102_0463740
3061 Ga0496103_0007489
3062 Ga0496103_0010791
3063 Ga0496103_0010836
3064 Ga0496103_0032320
3065 Ga0496103_0035956
3066 Ga0496103_0126230
3067 Ga0496104_0000538
3068 Ga0496104_0000602
3069 Ga0496104_0001834
3070 Ga0496104_0006005
3071 Ga0496104_0011586
3072 Ga0496104_0022907
3073 Ga0496104_0023409
3074 Ga0496104_0030685
3075 Ga0496104_0033068
3076 Ga0496104_0046946
3077 Ga0496104_0170737
3078 Ga0496104_0245800
3079 Ga0496104_0276427
3080 Ga0496105_0002373
3081 Ga0496105_0004135
3082 Ga0496105_0022659
3083 Ga0496105_0026177
3084 Ga0496105_0050267
3085 Ga0496105_0054388
3086 Ga0496105_0078540
3087 Ga0496105_0176113
3088 Ga0496105_0226816
3089 Ga0496105_0295102
3090 Ga0496105_0506829
3091 Ga0496105_0549099
3092 Ga0496105_0792354
3093 Ga0496106_0000405
3094 Ga0496106_0013666
3095 Ga0496106_0026406
3096 Ga0496106_0036756
3097 Ga0496106_0070055
3098 Ga0496106_0092378
3099 Ga0496106_0347998
3100 Ga0496107_0001082
3101 Ga0496107_0001145
3102 Ga0496107_0030443
3103 Ga0496107_0046438
3104 Ga0496107_0154833
3105 Ga0496107_0170673
3106 Ga0496107_0271152
3107 Ga0496108_0001230
3108 Ga0496108_0003869
3109 Ga0496108_0012570
3110 Ga0496108_0014737
3111 Ga0496108_0021443
3112 Ga0496108_0029580
3113 Ga0496108_0034009
3114 Ga0496108_0183347
3115 Ga0496108_0238341
3116 Ga0496108_0378507
3117 Ga0496108_0572736
3118 Ga0496109_0002911
3119 Ga0496109_0004441
3120 Ga0496109_0006129
3121 Ga0496109_0006276
3122 Ga0496109_0008231
3123 Ga0496109_0052215
3124 Ga0496109_0096114
3125 Ga0496109_0107547
3126 Ga0496109_0123808
3127 Ga0496109_0312075
3128 Ga0496109_0316444
3129 Ga0496109_0613669
3130 Ga0496109_0905120
3131 Ga0496110_0000468
3132 Ga0496110_0017492
3133 Ga0496110_0019783
3134 Ga0496110_0032199
3135 Ga0496110_0035095
3136 Ga0496110_0075221
3137 Ga0496110_0093168
3138 Ga0496110_0102346
3139 Ga0496110_0131034
3140 Ga0496110_0151100
3141 Ga0496110_0177650
3142 Ga0496110_0217966
3143 Ga0496110_0257669
3144 Ga0496111_0001165
3145 Ga0496111_0001714
3146 Ga0496111_0004338
3147 Ga0496111_0036936
3148 Ga0496111_0086310
3149 Ga0496111_0117006
3150 Ga0496111_0243138
3151 Ga0496112_0000014
3152 Ga0496112_0000527
3153 Ga0496112_0003749
3154 Ga0496112_0011543
3155 Ga0496112_0012163
3156 Ga0496112_0038471
3157 Ga0496112_0070265
3158 Ga0496112_0089626
3159 Ga0496112_0092100
3160 Ga0496112_0113744
3161 Ga0496112_0189750
3162 Ga0496112_0279636
3163 Ga0496112_0473916
3164 Ga0496113_0001893
3165 Ga0496113_0003961
3166 Ga0496113_0010110
3167 Ga0496113_0037525
3168 Ga0496113_0055397
3169 Ga0496113_0164171
3170 Ga0496113_0192022
3171 Ga0496114_0084167
3172 Ga0496114_0097669
3173 Ga0496114_0104086
3174 Ga0496114_0125366
3175 Ga0496114_0150849
3176 Ga0496114_0252240
3177 Ga0496114_0311775
3178 Ga0496114_0673136
3179 Ga0496115_0006200
3180 Ga0496115_0021274
3181 Ga0496115_0069948
3182 Ga0496115_0073218
3183 Ga0496115_0117378
3184 Ga0496115_0193467
3185 Ga0496115_0201937
3186 Ga0496115_0220417
3187 Ga0496115_0220700
3188 Ga0496115_0223030
3189 Ga0496115_0231694
3190 Ga0496115_0330050
3191 Ga0496115_0477846
3192 Ga0496115_0642331
3193 Ga0496116_0069466
3194 Ga0496117_0001758
3195 Ga0496117_0076566
3196 Ga0496117_0100245
3197 Ga0496118_0017789
3198 Ga0496118_0081995
3199 Ga0496118_0111000
3200 Ga0496119_0018215
3201 Ga0496120_0006082
3202 Ga0496121_0000283
3203 Ga0496121_0023892
3204 Ga0496121_0054093
3205 Ga0496121_0057138
3206 Ga0496121_0060601
3207 Ga0496121_0097563
3208 Ga0496121_0128993
3209 Ga0496121_0190012
3210 Ga0496121_0218313
3211 Ga0496122_0077145
3212 Ga0496124_0065553
3213 Ga0496124_0076754
3214 Ga0496124_0114179
3215 Ga0496124_0130174
3216 Ga0496125_0019849
3217 Ga0496125_0030819
3218 Ga0496125_0043700
3219 Ga0496126_0129226
3220 Ga0496126_0145419
3221 Ga0496126_0170067
3222 Ga0495682_0087690
3223 Ga0501031_0026174
3224 Ga0501031_0499363
3225 Ga0501032_0092511
3226 Ga0501032_0448186
3227 Ga0501033_0046869
3228 Ga0501033_0120574
3229 Ga0501033_0551945
3230 Ga0501034_0035866
3231 Ga0501034_0318667
3232 Ga0501036_0002481
3233 Ga0501036_0058938
3234 Ga0501036_0364868
3235 Ga0501037_0023005
3236 Ga0501037_0057904
3237 Ga0501038_0011597
3238 Ga0501038_0043917
3239 Ga0501038_0090782
3240 Ga0501038_0164254
3241 Ga0501039_0021356
3242 Ga0501039_0208491
3243 Ga0501040_0009859
3244 Ga0501040_0077664
3245 Ga0501040_0188368
3246 Ga0501040_0225898
3247 Ga0501041_0014421
3248 Ga0501041_0032605
3249 Ga0501041_0153040
3250 Ga0501042_0005234
3251 Ga0501042_0037155
3252 Ga0501042_0099205
3253 Ga0501042_0277750
3254 Ga0501042_0283153
3255 Ga0501042_0489477
3256 Ga0501043_0013428
3257 Ga0501043_0080598
3258 Ga0501046_0014699
3259 Ga0501046_0019015
3260 Ga0501046_0025386
3261 Ga0501046_0216313
3262 Ga0501046_0255288
3263 Ga0501047_0089977
3264 Ga0501047_0096900
3265 Ga0501047_0343159
3266 Ga0501048_0006475
3267 Ga0501048_0094232
3268 Ga0501048_0228067
3269 Ga0501048_0719108
3270 Ga0501067_0035095
3271 Ga0501068_0031554
3272 Ga0501068_0076309
3273 Ga0501069_0060890
3274 Ga0501069_0148389
3275 Ga0501070_0021833
3276 Ga0501070_0206954
3277 Ga0501070_0213456
3278 Ga0501070_0235098
3279 Ga0501070_0245273
3280 Ga0501070_0250744
3281 Ga0501071_0051680
3282 Ga0501071_0339764
3283 Ga0501071_0458531
3284 Ga0501072_0001512
3285 Ga0501072_0013914
3286 Ga0501072_0042411
3287 Ga0501072_0065633
3288 Ga0501072_0095047
3289 Ga0501072_0160351
3290 Ga0501072_0716275
3291 Ga0501073_0005592
3292 Ga0501073_0019034
3293 Ga0501073_0184961
3294 Ga0501073_0226023
3295 Ga0501073_0238326
3296 Ga0501073_0296907
3297 Ga0501074_0027303
3298 Ga0501074_0043753
3299 Ga0501074_0464979
3300 Ga0501074_0724765
3301 Ga0501075_0160035
3302 Ga0501075_0219008
3303 Ga0501075_0467879
3304 Ga0501076_0026862
3305 Ga0501076_0101972
3306 Ga0501076_0114869
3307 Ga0501076_0178900
3308 Ga0501076_0197265
3309 Ga0501076_0309785
3310 Ga0501077_0003968
3311 Ga0501077_0008803
3312 Ga0501077_0021498
3313 Ga0501077_0097546
3314 Ga0501077_0209235
3315 Ga0501077_0335716
3316 Ga0501077_0512926
3317 Ga0501079_0001178
3318 Ga0501079_0046758
3319 Ga0501079_0049659
3320 Ga0501079_0081736
3321 Ga0501079_0161339
3322 Ga0501079_0615055
3323 Ga0501079_0700644
3324 Ga0501080_0007750
3325 Ga0501080_0100700
3326 Ga0501080_0138185
3327 Ga0501080_0184529
3328 Ga0501080_0241087
3329 Ga0501081_0013714
3330 Ga0501081_0057512
3331 Ga0501081_0081853
3332 Ga0501081_0118370
3333 Ga0501081_0139745
3334 Ga0501081_0459323
3335 Ga0501083_0085981
3336 Ga0501083_0117991
3337 Ga0501083_0233603
3338 Ga0501035_0068660
3339 Ga0501035_0420111
3340 Ga0501035_0475011
3341 Ga0501035_0779311
3342 Ga0501044_0074734
3343 Ga0501044_0137435
3344 Ga0501045_0020987
3345 Ga0501045_0024775
3346 Ga0501045_0039471
3347 Ga0501045_0041521
3348 Ga0501045_0278970
3349 Ga0501045_0531644
3350 nmdc:mga03683_17787_c1
3351 nmdc:mga00v17_188659_c1
3352 nmdc:mga00v17_25224_c1
3353 nmdc:mga00v17_2904_c1
3354 nmdc:mga0yw44_119488_c1
3355 nmdc:mga0yw44_1963_c1
3356 nmdc:mga0yw44_6715_c1
3357 nmdc:mga0yw44_70010_c1
3358 nmdc:mga0yw44_77943_c1
3359 nmdc:mga06z11_26813_c1
3360 nmdc:mga06z11_442474_c1
3361 nmdc:mga06z11_65144_c1
3362 nmdc:mga04h51_23443_c1
3363 nmdc:mga07m45_177619_c1
3364 nmdc:mga07m45_21851_c1
3365 nmdc:mga07m45_34845_c1
3366 nmdc:mga05p37_137815_c1
3367 nmdc:mga05p37_250969_c1
3368 nmdc:mga05p37_329373_c1
3369 nmdc:mga05p37_442270_c1
3370 nmdc:mga05p37_4993_c2
3371 nmdc:mga05p37_548803_c1
3372 nmdc:mga09592_280592_c1
3373 nmdc:mga09592_374686_c1
3374 nmdc:mga09592_78389_c1
3375 nmdc:mga0qj67_348644_c1
3376 nmdc:mga0qj67_602649_c1
3377 nmdc:mga0qj67_786278_c1
3378 nmdc:mga06r32_136705_c1
3379 nmdc:mga06r32_314861_c1
3380 nmdc:mga06r32_60002_c1
3381 nmdc:mga08y16_149896_c1
3382 nmdc:mga08y16_27944_c1
3383 nmdc:mga08y16_430061_c1
3384 nmdc:mga0n895_143248_c1
3385 nmdc:mga0n895_14768_c1
3386 nmdc:mga0n895_319480_c1
3387 nmdc:mga0n895_390435_c1
3388 nmdc:mga0n895_54579_c1
3389 nmdc:mga0n895_56599_c1
3390 nmdc:mga0n895_702211_c1
3391 nmdc:mga0rr50_2831_c1
3392 nmdc:mga0rr50_877259_c1
3393 nmdc:mga08x19_24_c1
3394 nmdc:mga08x19_295126_c1
3395 nmdc:mga08x19_90102_c1
3396 nmdc:mga0a205_126593_c1
3397 nmdc:mga0a205_233224_c1
3398 nmdc:mga0a205_42460_c2
3399 nmdc:mga0sz30_49723_c1
3400 Ga0495601_0000023
3401 Ga0495601_0014297
3402 Ga0495601_0016474
3403 Ga0495601_0019932
3404 Ga0495601_0023594
3405 Ga0495601_0042008
3406 Ga0495612_0000005
3407 Ga0495655_0005113
3408 Ga0495655_0027352
3409 Ga0495595_0000013
3410 Ga0495595_0004754
3411 Ga0495595_0298962
3412 Ga0495619_0000003
3413 Ga0495619_0014748
3414 Ga0495619_0028733
3415 Ga0495619_0036675
3416 Ga0495619_0045584
3417 Ga0495619_0137914
3418 Ga0495619_0212087
3419 Ga0495619_0246669
3420 Ga0500643_020103
3421 Ga0500643_029467
3422 Ga0500647_0033698
3423 Ga0500651_0184092
3424 Ga0500566_0000049
3425 Ga0500566_0019723
3426 Ga0500640_041496
3427 Ga0500641_0007196
3428 Ga0500648_062230
3429 Ga0500654_118940
3430 Ga0500554_044646
3431 Ga0500555_077202
3432 Ga0500562_014378
3433 Ga0500572_000476
3434 Ga0500591_027619
3435 Ga0500593_032050
3436 Ga0500595_000586
3437 Ga0500595_001444
3438 Ga0500595_002570
3439 Ga0500595_013365
3440 Ga0500595_028285
3441 Ga0500608_030856
3442 Ga0500614_016596
3443 Ga0500621_100634
3444 Ga0500642_0185661
3445 Ga0500658_0006809
3446 Ga0500658_0279235
3447 Ga0500559_0000654
3448 Ga0500559_0016820
3449 Ga0500568_0066049
3450 Ga0500568_0093983
3451 Ga0500573_0016365
3452 Ga0500577_0013422
3453 Ga0500577_0079270
3454 Ga0500589_042895
3455 Ga0500590_065126
3456 Ga0500603_000031
3457 Ga0500603_000171
3458 Ga0500622_0263836
3459 Ga0500627_0107617
3460 Ga0500630_000581
3461 Ga0500633_0110996
3462 Ga0500638_018261
3463 Ga0500639_000020
3464 Ga0500636_0049485
3465 Ga0500636_0058958
3466 Ga0500636_0070433
3467 Ga0500637_0005363
3468 Ga0500637_0007143
3469 Ga0500637_0016794
3470 Ga0500637_0189385
3471 Ga0500611_001811
3472 Ga0500611_021826
3473 Ga0500645_010565
3474 Ga0500609_021471
3475 Ga0500552_024431
3476 Ga0500596_003763
3477 Ga0500596_008547
3478 Ga0501084_0014440
3479 Ga0501084_0015558
3480 Ga0501084_0036665
3481 Ga0501084_0039306
3482 Ga0501084_0361418
3483 Ga0501082_0000040
3484 Ga0501082_0013015
3485 Ga0501082_0042865
3486 Ga0501082_0059229
3487 Ga0501082_0115603
3488 Ga0501082_0356681
3489 Ga0501082_0463768
3490 Ga0501082_0568314
3491 Ga0501082_0948740
3492 Ga0530510_0061859
3493 Ga0530510_0079726
3494 Ga0530510_0250688
3495 2513590484
3496 2513649496
3497 2513657248
3498 2513857716
3499 2513919256
3500 2514589642
3501 2517891047
3502 2524465181
3503 2671123712
3504 2723843425
3505 2728752686
3506 2793066401
3507 2793077851
3508 2818237966
3509 2874611664
3510 2876814232
3511 2878743754
3512 2879114909
3513 2885387638
3514 2885418282
3515 2888381716
3516 2903749279
3517 2906616244
3518 2906628310
3519 2906640334
3520 2906667254
3521 2922431762
3522 2924781567
3523 2932796602
3524 2932802616
3525 2935680019
3526 2935693901
3527 2935700659
3528 2935722023
3529 2935731332
3530 2935741032
3531 2935750408
3532 2935759663
3533 2935768583
3534 2935883573
3535 2935967062
3536 2940565568
3537 2958146568
3538 2968017563
3539 2970472261
3540 3005481580
3541 8002060756
3542 8006943174
3543 8006982969
3544 8016591194
3545 8019575114
3546 8019653219

MSA Aligner

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7f9o-assembly1.cif.gz_P psi-ndh supercomplex of barley 0.8117 114 191
7p64-assembly1.cif.gz_K complex i from e. coli, ddm/lmng-purified, under turnover at ph 6, open state 0.7925 110 191
7a24-assembly1.cif.gz_K assembly intermediate of the plant mitochondrial complex i 0.7511 114 189
6khi-assembly1.cif.gz_E supercomplex for cylic electron transport in cyanobacteria 0.7451 114 187
7nyu-assembly1.cif.gz_K respiratory complex i from escherichia coli - conformation 2 0.7156 114 208
ID Description Score Start End Superfamily
6humE00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.7419 114 184 1.10.287.3510
af_Q6R9N1_4_99_1.10.287.3510 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.672 116 190 1.10.287.3510
3rkoK00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.6595 114 190 1.10.287.3510
af_Q57879_1_79_1.10.287.3510 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.6478 11 76 1.10.287.3510
6nbqE00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.61 114 196 1.10.287.3510
ID Description Score Start End GO Terms
AF-A0A257T7U1-F1-model_v4 Formate hydrogenlyase 0.9229 6 145 GO:0005886
GO:0016829
AF-T1ARD1-F1-model_v4 Respiratory-chain NADH dehydrogenase, subunit 1 0.9149 5 157 GO:0005886
AF-A0A3A0CAQ0-F1-model_v4 Hydrogenase 0.9136 1 196 GO:0005886
AF-A0A7Y3LL32-F1-model_v4 Hydrogenase-4 component E 0.9132 1 208 GO:0005886
AF-A0A537SC42-F1-model_v4 Hydrogenase-4 component E 0.9123 1 136 GO:0005886

Map