F495656
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1773 | 592 | 3546 | 214 |
Family's Representative Sequence
| Representative Sequence | 3300050509|nmdc:mga0qj67_276001_c1|nmdc:mga0qj67_276001_c1_204_956 |
| Length | 232 |
| Sequence | LPRCKASVRIGRTTDIGIGDLLLVYEYTAQMSSHLFDIAHMLAGGLVLLSLALLYQDRMFGLLNVFALHAVXXXXSVAWQGHIQGAPHLYITALIALLLKAVIETVVGIGPTMLAGLALVALSMVVMLKATATADPLAREDLAFALSVVLLGLLMMVTRRNAVSQVVGFMSLENGMILAATGAKGMPLVVEISVAFSVLVAFIVIGVFLFRIRERFDTVDVAALDAFRGERR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 2 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 5 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 6 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 7 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 8 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 9 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 10 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 11 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 12 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 13 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 14 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 15 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 16 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 17 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 18 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 19 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 20 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 21 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 22 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 23 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 24 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 25 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 26 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 32 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 36 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 38 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 49 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 64 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 65 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 66 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 69 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 70 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 71 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 73 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 78 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 80 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 81 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 82 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 84 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 85 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 86 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 87 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 88 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 89 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 90 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 91 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 92 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 93 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 94 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 95 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 96 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 97 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 98 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 100 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 101 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 102 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 103 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 104 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 105 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 106 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 107 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 109 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 110 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 111 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 112 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 113 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 114 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 115 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 116 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 117 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 118 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 120 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 121 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 122 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 123 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 124 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009984 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG | Metagenome | Rhizosphere |
| 139 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 140 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 157 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 158 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 159 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 160 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 161 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 162 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 163 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 164 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 165 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 166 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 170 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 237 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 238 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 239 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 242 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 246 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 247 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 248 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 249 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 250 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 251 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 252 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 253 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 254 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 255 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 256 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 257 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 258 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 259 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 260 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 261 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 262 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 263 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 264 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 265 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 266 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 267 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 268 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 269 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 270 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 271 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 272 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 273 | 3300033544 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 | Metagenome | Unclassified |
| 274 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 275 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 276 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 277 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 278 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 279 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 280 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 281 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 282 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 283 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 284 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 285 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 286 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 287 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 288 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 289 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 290 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 291 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 292 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 293 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 294 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 295 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 296 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 297 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 298 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 299 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 300 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 301 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 302 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 303 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 304 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 305 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 306 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 307 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 308 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 309 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 310 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 311 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 312 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 313 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 314 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 315 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 316 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 317 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 318 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 319 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 320 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 321 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 322 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 323 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 324 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 325 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 326 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 327 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 328 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 329 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 330 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 331 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 332 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 333 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 419 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 420 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 421 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 422 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 423 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 424 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 425 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 426 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 427 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 428 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 429 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 430 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 431 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 432 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 433 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 434 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 435 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 436 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 437 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 438 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 439 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 440 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 441 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 442 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 443 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 444 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 446 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 447 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 448 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 449 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 450 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 451 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 452 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 453 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 454 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 455 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 456 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 457 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 458 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 459 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 460 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 461 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 462 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 463 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 464 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 465 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 466 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 467 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 468 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 469 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 470 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 471 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 472 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 473 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 474 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 475 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 476 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 477 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 478 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 479 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 480 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 481 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 482 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 483 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 484 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 485 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 486 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 487 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 488 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 489 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 490 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 491 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 492 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 493 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 494 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 495 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 496 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 497 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 498 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 499 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 500 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 501 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 502 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 503 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 504 | 3300053097 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere | Metagenome | Endosphere |
| 505 | 3300053099 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere | Metagenome | Endosphere |
| 506 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 507 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 508 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 509 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 510 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 511 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 512 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 513 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 514 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 515 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 516 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 517 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 518 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 519 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 520 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 521 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 522 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 523 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 524 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 525 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 526 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 527 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 528 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 529 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 530 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 531 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 532 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 533 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 534 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 535 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 536 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 537 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 538 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 539 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 540 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 541 | 2513237087 | Azorhizobium doebereinerae UFLA1-100 | Isolate | Nodule |
| 542 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 543 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 544 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 545 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 546 | 2513237351 | Mesorhizobium alhagi CCNWXJ12-2 | Isolate | Nodule |
| 547 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 548 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 549 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 550 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 551 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 552 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 553 | 2791355199 | |||
| 554 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 555 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 556 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 557 | 2878738818 | Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 | Isolate | Nodule |
| 558 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 559 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 560 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 561 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 562 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 563 | 2906610324 | |||
| 564 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 565 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 566 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 567 | 2922425934 | |||
| 568 | 2924776078 | Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 | Isolate | Nodule |
| 569 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 570 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 571 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 572 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 573 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 574 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 575 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 576 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 577 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 578 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 579 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 580 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 581 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 582 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 583 | 2958144490 | Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 | Isolate | Nodule |
| 584 | 2968016561 | Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 | Isolate | Nodule |
| 585 | 2970469710 | Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 | Isolate | Nodule |
| 586 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 587 | 8002060224 | Methylocystis sp. Sn-Cys | Isolate | Unclassified |
| 588 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 589 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 590 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 591 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 592 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.18 |
| Metatranscriptomes | 0.06 |
| Isolates | 2.77 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.58 |
| Nodule | 2.54 |
| Rhizoplane | 9.08 |
| Rhizosphere | 78.34 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.06 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | nmdc:mga0qj67_276001_c1 | 3300050509 | Bacteria | 1363 |
| 2 | JGI24746J21847_1002224 | 3300001977 | Bacteria | 3102 |
| 3 | JGI24737J22298_10046026 | 3300001990 | Bacteria | 1332 |
| 4 | JGI24743J22301_10035741 | 3300001991 | Bacteria | 988 |
| 5 | JGI24735J21928_10041249 | 3300002067 | Bacteria | 1345 |
| 6 | JGI24750J21931_1001355 | 3300002070 | Bacteria | 3076 |
| 7 | JGI24745J21846_1000775 | 3300002073 | Bacteria | 2925 |
| 8 | JGI24748J21848_1003115 | 3300002074 | Bacteria | 1891 |
| 9 | JGI24749J21850_1002812 | 3300002076 | Bacteria | 2437 |
| 10 | JGI24744J21845_10000934 | 3300002077 | Bacteria | 5556 |
| 11 | JGI24034J26672_10011810 | 3300002239 | Bacteria | 1311 |
| 12 | JGI24742J22300_10000424 | 3300002244 | Bacteria | 6224 |
| 13 | JGI24742J22300_10003626 | 3300002244 | Bacteria | 2506 |
| 14 | JGI25156J39149_1000198 | 3300002705 | Bacteria | 42079 |
| 15 | JGI25154J39366_1000209 | 3300002738 | Bacteria | 41899 |
| 16 | JGI25157J39369_1000240 | 3300002741 | Bacteria | 42079 |
| 17 | JGI25159J45721_1007087 | 3300002987 | Bacteria | 3263 |
| 18 | JGI25406J46586_10004053 | 3300003203 | Bacteria | 6850 |
| 19 | JGI25165J46597_1011687 | 3300003214 | Bacteria | 1248 |
| 20 | JGI25153J46596_10000946 | 3300003215 | Bacteria | 17627 |
| 21 | rootH1_10253643 | 3300003323 | Bacteria | 1076 |
| 22 | JGI25160J50197_1024073 | 3300003354 | Bacteria | 1736 |
| 23 | JGI25405J52794_10011223 | 3300003911 | Bacteria | 1714 |
| 24 | Ga0055543_1014759 | 3300004625 | Bacteria | 1516 |
| 25 | Ga0065165_1000785 | 3300005262 | Bacteria | 42533 |
| 26 | Ga0065165_1016570 | 3300005262 | Bacteria | 2752 |
| 27 | Ga0065707_10091172 | 3300005295 | Bacteria | 3993 |
| 28 | Ga0065707_10199625 | 3300005295 | Bacteria | 1317 |
| 29 | Ga0070658_10067069 | 3300005327 | Bacteria | 2932 |
| 30 | Ga0070658_10131651 | 3300005327 | Bacteria | 2085 |
| 31 | Ga0070676_10013244 | 3300005328 | Bacteria | 4517 |
| 32 | Ga0070676_10025116 | 3300005328 | Bacteria | 3365 |
| 33 | Ga0070676_10031955 | 3300005328 | Bacteria | 3013 |
| 34 | Ga0070676_10489589 | 3300005328 | Bacteria | 871 |
| 35 | Ga0070683_100529961 | 3300005329 | Bacteria | 1126 |
| 36 | Ga0070690_100010416 | 3300005330 | Bacteria | 5411 |
| 37 | Ga0070670_100009831 | 3300005331 | Bacteria | 8172 |
| 38 | Ga0070670_100080110 | 3300005331 | Bacteria | 2807 |
| 39 | Ga0070670_100113554 | 3300005331 | Bacteria | 2335 |
| 40 | Ga0070670_100222332 | 3300005331 | Bacteria | 1643 |
| 41 | Ga0068869_100005796 | 3300005334 | Bacteria | 7797 |
| 42 | Ga0068869_100033165 | 3300005334 | Bacteria | 3644 |
| 43 | Ga0070666_10008356 | 3300005335 | Bacteria | 6424 |
| 44 | Ga0070666_10431938 | 3300005335 | Bacteria | 950 |
| 45 | Ga0070680_100070310 | 3300005336 | Bacteria | 2875 |
| 46 | Ga0070680_100117171 | 3300005336 | Bacteria | 2221 |
| 47 | Ga0070682_100008701 | 3300005337 | Bacteria | 5725 |
| 48 | Ga0070682_100009990 | 3300005337 | Bacteria | 5375 |
| 49 | Ga0070682_100498948 | 3300005337 | Bacteria | 943 |
| 50 | Ga0068868_100006107 | 3300005338 | Bacteria | 8510 |
| 51 | Ga0068868_100040882 | 3300005338 | Bacteria | 3611 |
| 52 | Ga0070660_100000939 | 3300005339 | Bacteria | 19455 |
| 53 | Ga0070660_100025758 | 3300005339 | Bacteria | 4374 |
| 54 | Ga0070660_100255115 | 3300005339 | Bacteria | 1431 |
| 55 | Ga0070689_100018460 | 3300005340 | Bacteria | 5139 |
| 56 | Ga0070689_100020568 | 3300005340 | Bacteria | 4899 |
| 57 | Ga0070689_100022682 | 3300005340 | Bacteria | 4690 |
| 58 | Ga0070689_100160791 | 3300005340 | Bacteria | 1815 |
| 59 | Ga0070691_10010464 | 3300005341 | Bacteria | 4233 |
| 60 | Ga0070691_10142950 | 3300005341 | Bacteria | 1221 |
| 61 | Ga0070687_100008830 | 3300005343 | Bacteria | 4285 |
| 62 | Ga0070687_100028601 | 3300005343 | Bacteria | 2706 |
| 63 | Ga0070661_100027242 | 3300005344 | Bacteria | 4113 |
| 64 | Ga0070661_100307306 | 3300005344 | Bacteria | 1236 |
| 65 | Ga0070661_100889811 | 3300005344 | Bacteria | 734 |
| 66 | Ga0070692_10071462 | 3300005345 | Bacteria | 1850 |
| 67 | Ga0070692_10096682 | 3300005345 | Bacteria | 1613 |
| 68 | Ga0070668_100010470 | 3300005347 | Bacteria | 6893 |
| 69 | Ga0070668_100011094 | 3300005347 | Bacteria | 6708 |
| 70 | Ga0070668_100021106 | 3300005347 | Bacteria | 4923 |
| 71 | Ga0070668_100162264 | 3300005347 | Bacteria | 1814 |
| 72 | Ga0070669_100014612 | 3300005353 | Bacteria | 5589 |
| 73 | Ga0070669_100022662 | 3300005353 | Bacteria | 4491 |
| 74 | Ga0070669_100054921 | 3300005353 | Bacteria | 2918 |
| 75 | Ga0070669_100115944 | 3300005353 | Bacteria | 2038 |
| 76 | Ga0070669_100214713 | 3300005353 | Bacteria | 1519 |
| 77 | Ga0070669_100357841 | 3300005353 | Bacteria | 1186 |
| 78 | Ga0070675_100007433 | 3300005354 | Bacteria | 8461 |
| 79 | Ga0070675_100010507 | 3300005354 | Bacteria | 7231 |
| 80 | Ga0070671_100001845 | 3300005355 | Bacteria | 16138 |
| 81 | Ga0070671_100049276 | 3300005355 | Bacteria | 3504 |
| 82 | Ga0070671_100072337 | 3300005355 | Bacteria | 2879 |
| 83 | Ga0070671_100341681 | 3300005355 | Bacteria | 1277 |
| 84 | Ga0070674_100009356 | 3300005356 | Bacteria | 5867 |
| 85 | Ga0070674_100109690 | 3300005356 | Bacteria | 2024 |
| 86 | Ga0070673_100006459 | 3300005364 | Bacteria | 7622 |
| 87 | Ga0070673_100007902 | 3300005364 | Bacteria | 7051 |
| 88 | Ga0070673_100012955 | 3300005364 | Bacteria | 5747 |
| 89 | Ga0070688_100056856 | 3300005365 | Bacteria | 2457 |
| 90 | Ga0070688_100212681 | 3300005365 | Bacteria | 1358 |
| 91 | Ga0070659_100004243 | 3300005366 | Bacteria | 10232 |
| 92 | Ga0070659_100020505 | 3300005366 | Bacteria | 5023 |
| 93 | Ga0070659_100052526 | 3300005366 | Bacteria | 3206 |
| 94 | Ga0070659_100173866 | 3300005366 | Bacteria | 1766 |
| 95 | Ga0070659_100442758 | 3300005366 | Bacteria | 1101 |
| 96 | Ga0070667_100089323 | 3300005367 | Bacteria | 2647 |
| 97 | Ga0070667_100628389 | 3300005367 | Bacteria | 991 |
| 98 | Ga0070667_100731439 | 3300005367 | Bacteria | 917 |
| 99 | Ga0070709_10311234 | 3300005434 | Bacteria | 1153 |
| 100 | Ga0070709_10382254 | 3300005434 | Bacteria | 1047 |
| 101 | Ga0070714_100020133 | 3300005435 | Bacteria | 5445 |
| 102 | Ga0070714_100083496 | 3300005435 | Bacteria | 2785 |
| 103 | Ga0070714_100342879 | 3300005435 | Bacteria | 1402 |
| 104 | Ga0070714_100401132 | 3300005435 | Bacteria | 1296 |
| 105 | Ga0070714_100407643 | 3300005435 | Bacteria | 1286 |
| 106 | Ga0070713_100006457 | 3300005436 | Bacteria | 8130 |
| 107 | Ga0070713_100012781 | 3300005436 | Bacteria | 6171 |
| 108 | Ga0070713_100082029 | 3300005436 | Bacteria | 2753 |
| 109 | Ga0070713_100130847 | 3300005436 | Bacteria | 2213 |
| 110 | Ga0070713_100186406 | 3300005436 | Bacteria | 1867 |
| 111 | Ga0070713_100242797 | 3300005436 | Bacteria | 1641 |
| 112 | Ga0070713_100577855 | 3300005436 | Bacteria | 1066 |
| 113 | Ga0070713_100801842 | 3300005436 | Bacteria | 903 |
| 114 | Ga0070710_10001738 | 3300005437 | Bacteria | 10292 |
| 115 | Ga0070710_10145602 | 3300005437 | Bacteria | 1457 |
| 116 | Ga0070710_10392002 | 3300005437 | Bacteria | 929 |
| 117 | Ga0070701_10007943 | 3300005438 | Bacteria | 4564 |
| 118 | Ga0070711_100004017 | 3300005439 | Bacteria | 8649 |
| 119 | Ga0070711_100028343 | 3300005439 | Bacteria | 3685 |
| 120 | Ga0070711_100068473 | 3300005439 | Bacteria | 2494 |
| 121 | Ga0070711_100225585 | 3300005439 | Bacteria | 1459 |
| 122 | Ga0070705_100060768 | 3300005440 | Bacteria | 2243 |
| 123 | Ga0070705_100452288 | 3300005440 | Bacteria | 964 |
| 124 | Ga0070700_100023233 | 3300005441 | Bacteria | 3625 |
| 125 | Ga0070700_100164743 | 3300005441 | Bacteria | 1530 |
| 126 | Ga0070694_100039271 | 3300005444 | Bacteria | 3150 |
| 127 | Ga0070694_100091305 | 3300005444 | Bacteria | 2137 |
| 128 | Ga0070694_100101966 | 3300005444 | Bacteria | 2031 |
| 129 | Ga0070663_100009487 | 3300005455 | Bacteria | 6029 |
| 130 | Ga0070663_100026948 | 3300005455 | Bacteria | 3898 |
| 131 | Ga0070663_100603274 | 3300005455 | Bacteria | 923 |
| 132 | Ga0070663_100726812 | 3300005455 | Bacteria | 846 |
| 133 | Ga0070678_100085452 | 3300005456 | Bacteria | 2404 |
| 134 | Ga0070662_100012811 | 3300005457 | Bacteria | 5569 |
| 135 | Ga0070662_100016757 | 3300005457 | Bacteria | 4925 |
| 136 | Ga0070662_100045051 | 3300005457 | Bacteria | 3163 |
| 137 | Ga0070662_100108225 | 3300005457 | Bacteria | 2114 |
| 138 | Ga0070662_100123661 | 3300005457 | Bacteria | 1986 |
| 139 | Ga0070662_100415041 | 3300005457 | Bacteria | 1113 |
| 140 | Ga0070662_100576393 | 3300005457 | Bacteria | 945 |
| 141 | Ga0070681_10020204 | 3300005458 | Bacteria | 6676 |
| 142 | Ga0070681_10027203 | 3300005458 | Bacteria | 5751 |
| 143 | Ga0070681_10047854 | 3300005458 | Bacteria | 4274 |
| 144 | Ga0070681_10206617 | 3300005458 | Bacteria | 1881 |
| 145 | Ga0068867_100024994 | 3300005459 | Bacteria | 4284 |
| 146 | Ga0068867_100081404 | 3300005459 | Bacteria | 2441 |
| 147 | Ga0068867_100122647 | 3300005459 | Bacteria | 2010 |
| 148 | Ga0068867_100272156 | 3300005459 | Bacteria | 1385 |
| 149 | Ga0070685_10012638 | 3300005466 | Bacteria | 4439 |
| 150 | Ga0070685_10164001 | 3300005466 | Bacteria | 1419 |
| 151 | Ga0070707_100252048 | 3300005468 | Bacteria | 1718 |
| 152 | Ga0070707_100657677 | 3300005468 | Bacteria | 1010 |
| 153 | Ga0070699_100406998 | 3300005518 | Bacteria | 1231 |
| 154 | Ga0070679_100010140 | 3300005530 | Bacteria | 8932 |
| 155 | Ga0070679_100011107 | 3300005530 | Bacteria | 8571 |
| 156 | Ga0070684_100030922 | 3300005535 | Bacteria | 4553 |
| 157 | Ga0070684_100081673 | 3300005535 | Bacteria | 2860 |
| 158 | Ga0068853_100005277 | 3300005539 | Bacteria | 10116 |
| 159 | Ga0068853_100010108 | 3300005539 | Bacteria | 7625 |
| 160 | Ga0068853_100071078 | 3300005539 | Bacteria | 3030 |
| 161 | Ga0068853_100097710 | 3300005539 | Bacteria | 2593 |
| 162 | Ga0068853_100595339 | 3300005539 | Bacteria | 1050 |
| 163 | Ga0070672_100003221 | 3300005543 | Bacteria | 10563 |
| 164 | Ga0070672_100242747 | 3300005543 | Bacteria | 1515 |
| 165 | Ga0070672_100341286 | 3300005543 | Bacteria | 1276 |
| 166 | Ga0070686_100273192 | 3300005544 | Bacteria | 1243 |
| 167 | Ga0070686_100509861 | 3300005544 | Bacteria | 935 |
| 168 | Ga0070695_100000088 | 3300005545 | Bacteria | 38984 |
| 169 | Ga0070695_100008380 | 3300005545 | Bacteria | 6135 |
| 170 | Ga0070695_100126206 | 3300005545 | Bacteria | 1757 |
| 171 | Ga0070695_100258945 | 3300005545 | Bacteria | 1270 |
| 172 | Ga0070695_100317945 | 3300005545 | Bacteria | 1156 |
| 173 | Ga0070696_100018761 | 3300005546 | Bacteria | 4680 |
| 174 | Ga0070696_100047274 | 3300005546 | Bacteria | 2985 |
| 175 | Ga0070696_100120101 | 3300005546 | Bacteria | 1902 |
| 176 | Ga0070665_100021137 | 3300005548 | Bacteria | 6542 |
| 177 | Ga0070665_100041633 | 3300005548 | Bacteria | 4618 |
| 178 | Ga0070665_100062066 | 3300005548 | Bacteria | 3747 |
| 179 | Ga0070665_100088181 | 3300005548 | Bacteria | 3108 |
| 180 | Ga0070665_100981455 | 3300005548 | Bacteria | 857 |
| 181 | Ga0070704_100005398 | 3300005549 | Bacteria | 7444 |
| 182 | Ga0070704_100019709 | 3300005549 | Bacteria | 4339 |
| 183 | Ga0070704_100043795 | 3300005549 | Bacteria | 3105 |
| 184 | Ga0068855_100036765 | 3300005563 | Bacteria | 5826 |
| 185 | Ga0068855_100068463 | 3300005563 | Bacteria | 4133 |
| 186 | Ga0068855_101024888 | 3300005563 | Bacteria | 866 |
| 187 | Ga0070664_100035563 | 3300005564 | Bacteria | 4182 |
| 188 | Ga0070664_100104031 | 3300005564 | Bacteria | 2472 |
| 189 | Ga0070664_100129446 | 3300005564 | Bacteria | 2216 |
| 190 | Ga0070664_100363142 | 3300005564 | Bacteria | 1319 |
| 191 | Ga0070664_100556568 | 3300005564 | Bacteria | 1061 |
| 192 | Ga0068857_100004707 | 3300005577 | Bacteria | 11566 |
| 193 | Ga0068857_100099316 | 3300005577 | Bacteria | 2611 |
| 194 | Ga0068854_100013937 | 3300005578 | Bacteria | 5288 |
| 195 | Ga0068856_100090862 | 3300005614 | Bacteria | 3038 |
| 196 | Ga0068856_100274594 | 3300005614 | Bacteria | 1702 |
| 197 | Ga0068856_100316935 | 3300005614 | Bacteria | 1577 |
| 198 | Ga0068856_100377500 | 3300005614 | Bacteria | 1437 |
| 199 | Ga0068856_100513005 | 3300005614 | Bacteria | 1220 |
| 200 | Ga0070702_100002160 | 3300005615 | Bacteria | 8361 |
| 201 | Ga0070702_100058756 | 3300005615 | Bacteria | 2229 |
| 202 | Ga0070702_100090997 | 3300005615 | Bacteria | 1850 |
| 203 | Ga0070702_100551387 | 3300005615 | Bacteria | 856 |
| 204 | Ga0068852_100009156 | 3300005616 | Bacteria | 7334 |
| 205 | Ga0068852_100029216 | 3300005616 | Bacteria | 4525 |
| 206 | Ga0068852_100335326 | 3300005616 | Bacteria | 1472 |
| 207 | Ga0068859_100047469 | 3300005617 | Bacteria | 4314 |
| 208 | Ga0068859_100093559 | 3300005617 | Bacteria | 3057 |
| 209 | Ga0068859_100312167 | 3300005617 | Bacteria | 1666 |
| 210 | Ga0068859_100557151 | 3300005617 | Bacteria | 1241 |
| 211 | Ga0068864_100004704 | 3300005618 | Bacteria | 11195 |
| 212 | Ga0068864_100009782 | 3300005618 | Bacteria | 7905 |
| 213 | Ga0068864_100080001 | 3300005618 | Bacteria | 2863 |
| 214 | Ga0068864_100201456 | 3300005618 | Bacteria | 1829 |
| 215 | Ga0068866_10004095 | 3300005718 | Bacteria | 5982 |
| 216 | Ga0068866_10197501 | 3300005718 | Bacteria | 1200 |
| 217 | Ga0068861_100017474 | 3300005719 | Bacteria | 5094 |
| 218 | Ga0068861_100057206 | 3300005719 | Bacteria | 2978 |
| 219 | Ga0068861_100295122 | 3300005719 | Bacteria | 1401 |
| 220 | Ga0068861_100475583 | 3300005719 | Bacteria | 1125 |
| 221 | Ga0068851_10009739 | 3300005834 | Bacteria | 4476 |
| 222 | Ga0068870_10004328 | 3300005840 | Bacteria | 6109 |
| 223 | Ga0068870_10005082 | 3300005840 | Bacteria | 5719 |
| 224 | Ga0068863_100005050 | 3300005841 | Bacteria | 13012 |
| 225 | Ga0068863_100014875 | 3300005841 | Bacteria | 7475 |
| 226 | Ga0068863_100044944 | 3300005841 | Bacteria | 4192 |
| 227 | Ga0068863_100512502 | 3300005841 | Bacteria | 1182 |
| 228 | Ga0068858_100008255 | 3300005842 | Bacteria | 10009 |
| 229 | Ga0068858_100041195 | 3300005842 | Bacteria | 4283 |
| 230 | Ga0068860_100007113 | 3300005843 | Bacteria | 11195 |
| 231 | Ga0068860_100046816 | 3300005843 | Bacteria | 4123 |
| 232 | Ga0068862_100007625 | 3300005844 | Bacteria | 8962 |
| 233 | Ga0068862_100086826 | 3300005844 | Bacteria | 2720 |
| 234 | Ga0068862_100394166 | 3300005844 | Bacteria | 1294 |
| 235 | Ga0081455_10004617 | 3300005937 | Bacteria | 15376 |
| 236 | Ga0081455_10005751 | 3300005937 | Bacteria | 13521 |
| 237 | Ga0081455_10235690 | 3300005937 | Bacteria | 1348 |
| 238 | Ga0081455_10299808 | 3300005937 | Bacteria | 1154 |
| 239 | Ga0081538_10020707 | 3300005981 | Bacteria | 4829 |
| 240 | Ga0081540_1001688 | 3300005983 | Bacteria | 18755 |
| 241 | Ga0081540_1002923 | 3300005983 | Bacteria | 13756 |
| 242 | Ga0081540_1009895 | 3300005983 | Bacteria | 6508 |
| 243 | Ga0081539_10003785 | 3300005985 | Bacteria | 17869 |
| 244 | Ga0081539_10019455 | 3300005985 | Bacteria | 4646 |
| 245 | Ga0081539_10021469 | 3300005985 | Bacteria | 4312 |
| 246 | Ga0081539_10072437 | 3300005985 | Bacteria | 1841 |
| 247 | Ga0081539_10095390 | 3300005985 | Bacteria | 1528 |
| 248 | Ga0070717_10003779 | 3300006028 | Bacteria | 10878 |
| 249 | Ga0070717_10015928 | 3300006028 | Bacteria | 5819 |
| 250 | Ga0070717_10048243 | 3300006028 | Bacteria | 3492 |
| 251 | Ga0070717_10139812 | 3300006028 | Bacteria | 2088 |
| 252 | Ga0070717_10441941 | 3300006028 | Bacteria | 1171 |
| 253 | Ga0075365_10026618 | 3300006038 | Bacteria | 3673 |
| 254 | Ga0075365_10140400 | 3300006038 | Bacteria | 1677 |
| 255 | Ga0075365_10163298 | 3300006038 | Bacteria | 1553 |
| 256 | Ga0075365_10273891 | 3300006038 | Bacteria | 1187 |
| 257 | Ga0075365_10496570 | 3300006038 | Bacteria | 862 |
| 258 | Ga0075364_10002553 | 3300006051 | Bacteria | 10200 |
| 259 | Ga0075432_10076047 | 3300006058 | Bacteria | 1212 |
| 260 | Ga0070716_100010739 | 3300006173 | Bacteria | 4601 |
| 261 | Ga0070716_100053462 | 3300006173 | Bacteria | 2303 |
| 262 | Ga0070716_100184782 | 3300006173 | Bacteria | 1372 |
| 263 | Ga0070716_100359132 | 3300006173 | Bacteria | 1034 |
| 264 | Ga0070712_100003573 | 3300006175 | Bacteria | 9577 |
| 265 | Ga0070712_100016638 | 3300006175 | Bacteria | 4751 |
| 266 | Ga0070712_100122234 | 3300006175 | Bacteria | 1960 |
| 267 | Ga0070712_100139359 | 3300006175 | Bacteria | 1849 |
| 268 | Ga0070712_100365042 | 3300006175 | Bacteria | 1185 |
| 269 | Ga0070712_100407066 | 3300006175 | Bacteria | 1125 |
| 270 | Ga0075362_10241676 | 3300006177 | Bacteria | 887 |
| 271 | Ga0075367_10003976 | 3300006178 | Bacteria | 7138 |
| 272 | Ga0075369_10064360 | 3300006186 | Bacteria | 1605 |
| 273 | Ga0097621_100004513 | 3300006237 | Bacteria | 9706 |
| 274 | Ga0097621_100467307 | 3300006237 | Bacteria | 1139 |
| 275 | Ga0075370_10057493 | 3300006353 | Bacteria | 2211 |
| 276 | Ga0075370_10211328 | 3300006353 | Bacteria | 1146 |
| 277 | Ga0068871_100012856 | 3300006358 | Bacteria | 6197 |
| 278 | Ga0068871_100256293 | 3300006358 | Bacteria | 1525 |
| 279 | Ga0068871_100640353 | 3300006358 | Bacteria | 970 |
| 280 | Ga0075428_100121815 | 3300006844 | Bacteria | 2840 |
| 281 | Ga0075428_100128951 | 3300006844 | Bacteria | 2752 |
| 282 | Ga0075428_100146476 | 3300006844 | Bacteria | 2566 |
| 283 | Ga0075428_100379353 | 3300006844 | Bacteria | 1516 |
| 284 | Ga0075428_100427259 | 3300006844 | Bacteria | 1419 |
| 285 | Ga0075428_100614108 | 3300006844 | Bacteria | 1161 |
| 286 | Ga0075428_100907265 | 3300006844 | Bacteria | 934 |
| 287 | Ga0075430_100047302 | 3300006846 | Bacteria | 3632 |
| 288 | Ga0075430_100066972 | 3300006846 | Bacteria | 3015 |
| 289 | Ga0075430_100348701 | 3300006846 | Bacteria | 1223 |
| 290 | Ga0075431_100061704 | 3300006847 | Bacteria | 3868 |
| 291 | Ga0075431_100205538 | 3300006847 | Bacteria | 2013 |
| 292 | Ga0075431_100517639 | 3300006847 | Bacteria | 1183 |
| 293 | Ga0075433_10196719 | 3300006852 | Bacteria | 1793 |
| 294 | Ga0075434_100118279 | 3300006871 | Bacteria | 2664 |
| 295 | Ga0075434_100131513 | 3300006871 | Bacteria | 2522 |
| 296 | Ga0075434_100211466 | 3300006871 | Bacteria | 1959 |
| 297 | Ga0075434_100229670 | 3300006871 | Bacteria | 1875 |
| 298 | Ga0075434_100445691 | 3300006871 | Bacteria | 1316 |
| 299 | Ga0075429_100296701 | 3300006880 | Bacteria | 1415 |
| 300 | Ga0075429_100347525 | 3300006880 | Bacteria | 1298 |
| 301 | Ga0068865_100008478 | 3300006881 | Bacteria | 6355 |
| 302 | Ga0068865_100054808 | 3300006881 | Bacteria | 2772 |
| 303 | Ga0075436_100008678 | 3300006914 | Bacteria | 6946 |
| 304 | Ga0075436_100088469 | 3300006914 | Bacteria | 2152 |
| 305 | Ga0075436_100104645 | 3300006914 | Bacteria | 1973 |
| 306 | Ga0075436_100434978 | 3300006914 | Bacteria | 954 |
| 307 | Ga0097620_100047472 | 3300006931 | Bacteria | 4314 |
| 308 | Ga0097620_100093559 | 3300006931 | Bacteria | 3057 |
| 309 | Ga0097620_100312184 | 3300006931 | Bacteria | 1666 |
| 310 | Ga0097620_100557091 | 3300006931 | Bacteria | 1241 |
| 311 | Ga0099824_1009169 | 3300006942 | Bacteria | 12291 |
| 312 | Ga0099822_1012158 | 3300006943 | Bacteria | 10347 |
| 313 | Ga0075435_100008690 | 3300007076 | Bacteria | 7305 |
| 314 | Ga0075435_100709120 | 3300007076 | Bacteria | 875 |
| 315 | Ga0099794_10008987 | 3300007265 | Bacteria | 4171 |
| 316 | Ga0099794_10040959 | 3300007265 | Bacteria | 2204 |
| 317 | Ga0099794_10074240 | 3300007265 | Bacteria | 1670 |
| 318 | Ga0099795_10000441 | 3300007788 | Bacteria | 7618 |
| 319 | Ga0099795_10024476 | 3300007788 | Bacteria | 2014 |
| 320 | Ga0099795_10066158 | 3300007788 | Bacteria | 1353 |
| 321 | Ga0099795_10094123 | 3300007788 | Bacteria | 1166 |
| 322 | Ga0105251_10088082 | 3300009011 | Bacteria | 1428 |
| 323 | Ga0105244_10081325 | 3300009036 | Bacteria | 1603 |
| 324 | Ga0105240_10048174 | 3300009093 | Bacteria | 5388 |
| 325 | Ga0105240_10063893 | 3300009093 | Bacteria | 4576 |
| 326 | Ga0105240_10099376 | 3300009093 | Bacteria | 3542 |
| 327 | Ga0105240_11046430 | 3300009093 | Bacteria | 871 |
| 328 | Ga0111539_10087869 | 3300009094 | Bacteria | 3652 |
| 329 | Ga0111539_10097294 | 3300009094 | Bacteria | 3457 |
| 330 | Ga0111539_10122649 | 3300009094 | Bacteria | 3046 |
| 331 | Ga0111539_10170022 | 3300009094 | Bacteria | 2547 |
| 332 | Ga0105245_10006657 | 3300009098 | Bacteria | 10142 |
| 333 | Ga0105245_10011565 | 3300009098 | Bacteria | 7688 |
| 334 | Ga0105245_10042174 | 3300009098 | Bacteria | 4071 |
| 335 | Ga0105247_10003741 | 3300009101 | Bacteria | 9868 |
| 336 | Ga0105247_10020804 | 3300009101 | Bacteria | 3946 |
| 337 | Ga0105247_10035674 | 3300009101 | Bacteria | 3032 |
| 338 | Ga0105247_10038462 | 3300009101 | Bacteria | 2921 |
| 339 | Ga0105247_10049424 | 3300009101 | Bacteria | 2586 |
| 340 | Ga0105247_10074650 | 3300009101 | Bacteria | 2127 |
| 341 | Ga0114129_10059852 | 3300009147 | Bacteria | 5325 |
| 342 | Ga0114129_10203045 | 3300009147 | Bacteria | 2683 |
| 343 | Ga0114129_10422172 | 3300009147 | Bacteria | 1754 |
| 344 | Ga0114129_10723256 | 3300009147 | Bacteria | 1277 |
| 345 | Ga0105243_10070118 | 3300009148 | Bacteria | 2829 |
| 346 | Ga0105243_10282345 | 3300009148 | Bacteria | 1496 |
| 347 | Ga0105241_10008231 | 3300009174 | Bacteria | 7678 |
| 348 | Ga0105241_10034255 | 3300009174 | Bacteria | 3814 |
| 349 | Ga0105242_10029002 | 3300009176 | Bacteria | 4410 |
| 350 | Ga0105242_10295399 | 3300009176 | Bacteria | 1477 |
| 351 | Ga0105248_10059261 | 3300009177 | Bacteria | 4300 |
| 352 | Ga0105248_10138902 | 3300009177 | Bacteria | 2741 |
| 353 | Ga0105248_10369308 | 3300009177 | Bacteria | 1615 |
| 354 | Ga0105248_10393057 | 3300009177 | Bacteria | 1561 |
| 355 | Ga0105248_10615759 | 3300009177 | Bacteria | 1225 |
| 356 | Ga0105248_10629628 | 3300009177 | Bacteria | 1210 |
| 357 | Ga0105237_10002982 | 3300009545 | Bacteria | 20460 |
| 358 | Ga0105237_10053877 | 3300009545 | Bacteria | 4033 |
| 359 | Ga0105237_10055541 | 3300009545 | Bacteria | 3965 |
| 360 | Ga0105237_10131772 | 3300009545 | Bacteria | 2494 |
| 361 | Ga0105238_10005756 | 3300009551 | Bacteria | 12263 |
| 362 | Ga0105238_10029879 | 3300009551 | Bacteria | 5549 |
| 363 | Ga0105238_10064315 | 3300009551 | Bacteria | 3668 |
| 364 | Ga0105238_10091379 | 3300009551 | Bacteria | 3031 |
| 365 | Ga0105238_10117557 | 3300009551 | Bacteria | 2639 |
| 366 | Ga0105238_10639322 | 3300009551 | Bacteria | 1073 |
| 367 | Ga0105249_10026496 | 3300009553 | Bacteria | 5224 |
| 368 | Ga0105249_10057738 | 3300009553 | Bacteria | 3556 |
| 369 | Ga0105249_10092266 | 3300009553 | Bacteria | 2835 |
| 370 | Ga0105249_10133579 | 3300009553 | Bacteria | 2372 |
| 371 | Ga0105029_107684 | 3300009984 | Bacteria | 785 |
| 372 | Ga0099796_10001698 | 3300010159 | Bacteria | 4566 |
| 373 | Ga0099796_10001865 | 3300010159 | Bacteria | 4439 |
| 374 | Ga0099796_10007090 | 3300010159 | Bacteria | 2912 |
| 375 | Ga0099796_10048575 | 3300010159 | Bacteria | 1464 |
| 376 | Ga0099796_10052230 | 3300010159 | Bacteria | 1423 |
| 377 | Ga0105239_10016807 | 3300010375 | Bacteria | 8088 |
| 378 | Ga0105239_10035074 | 3300010375 | Bacteria | 5509 |
| 379 | Ga0105239_10090414 | 3300010375 | Bacteria | 3377 |
| 380 | Ga0105239_10169861 | 3300010375 | Bacteria | 2438 |
| 381 | Ga0105239_10299879 | 3300010375 | Bacteria | 1810 |
| 382 | Ga0105246_10020411 | 3300011119 | Bacteria | 4249 |
| 383 | Ga0105246_10065320 | 3300011119 | Bacteria | 2544 |
| 384 | Ga0105246_10136614 | 3300011119 | Bacteria | 1838 |
| 385 | Ga0105246_10749675 | 3300011119 | Bacteria | 861 |
| 386 | Ga0157371_10498812 | 3300013102 | Bacteria | 899 |
| 387 | Ga0157370_10035007 | 3300013104 | Bacteria | 4886 |
| 388 | Ga0157370_10114027 | 3300013104 | Bacteria | 2525 |
| 389 | Ga0157370_10508487 | 3300013104 | Bacteria | 1106 |
| 390 | Ga0157370_10770111 | 3300013104 | Bacteria | 876 |
| 391 | Ga0157369_10001818 | 3300013105 | Bacteria | 25829 |
| 392 | Ga0157369_10008070 | 3300013105 | Bacteria | 12073 |
| 393 | Ga0157369_10101657 | 3300013105 | Bacteria | 3063 |
| 394 | Ga0157374_10010373 | 3300013296 | Bacteria | 8014 |
| 395 | Ga0157374_10034810 | 3300013296 | Bacteria | 4603 |
| 396 | Ga0157378_10129148 | 3300013297 | Bacteria | 2337 |
| 397 | Ga0157378_10142012 | 3300013297 | Bacteria | 2230 |
| 398 | Ga0157378_10738696 | 3300013297 | Bacteria | 1006 |
| 399 | Ga0163162_10087541 | 3300013306 | Bacteria | 3193 |
| 400 | Ga0163162_10243031 | 3300013306 | Bacteria | 1931 |
| 401 | Ga0163162_10373032 | 3300013306 | Bacteria | 1560 |
| 402 | Ga0163162_10381981 | 3300013306 | Bacteria | 1542 |
| 403 | Ga0163162_11075866 | 3300013306 | Bacteria | 911 |
| 404 | Ga0157372_10004050 | 3300013307 | Bacteria | 15705 |
| 405 | Ga0157372_10160662 | 3300013307 | Bacteria | 2597 |
| 406 | Ga0157372_10438263 | 3300013307 | Bacteria | 1523 |
| 407 | Ga0157372_10538770 | 3300013307 | Bacteria | 1361 |
| 408 | Ga0157375_10015123 | 3300013308 | Bacteria | 6902 |
| 409 | Ga0157375_10090637 | 3300013308 | Bacteria | 3116 |
| 410 | Ga0157375_10407215 | 3300013308 | Bacteria | 1526 |
| 411 | Ga0157375_10418534 | 3300013308 | Unclassified | 1506 |
| 412 | Ga0157375_11042996 | 3300013308 | Bacteria | 956 |
| 413 | Ga0163163_10010748 | 3300014325 | Bacteria | 8256 |
| 414 | Ga0163163_10049335 | 3300014325 | Bacteria | 4142 |
| 415 | Ga0163163_10138553 | 3300014325 | Bacteria | 2475 |
| 416 | Ga0163163_10236146 | 3300014325 | Bacteria | 1877 |
| 417 | Ga0163163_10417182 | 3300014325 | Bacteria | 1401 |
| 418 | Ga0157380_10025703 | 3300014326 | Bacteria | 4468 |
| 419 | Ga0157380_10048738 | 3300014326 | Bacteria | 3338 |
| 420 | Ga0157380_10081638 | 3300014326 | Bacteria | 2645 |
| 421 | Ga0157377_10007621 | 3300014745 | Bacteria | 5238 |
| 422 | Ga0157377_10493536 | 3300014745 | Bacteria | 854 |
| 423 | Ga0157379_10027562 | 3300014968 | Bacteria | 5058 |
| 424 | Ga0157379_10238949 | 3300014968 | Bacteria | 1648 |
| 425 | Ga0157376_10074712 | 3300014969 | Bacteria | 2890 |
| 426 | Ga0157376_10182891 | 3300014969 | Bacteria | 1917 |
| 427 | Ga0157376_10381575 | 3300014969 | Bacteria | 1358 |
| 428 | Ga0163161_10015441 | 3300017792 | Bacteria | 5324 |
| 429 | Ga0163161_10373676 | 3300017792 | Bacteria | 1138 |
| 430 | Ga0213873_10012361 | 3300021358 | Bacteria | 1850 |
| 431 | Ga0213872_10048695 | 3300021361 | Bacteria | 1926 |
| 432 | Ga0213872_10056759 | 3300021361 | Bacteria | 1774 |
| 433 | Ga0213874_10016816 | 3300021377 | Bacteria | 1954 |
| 434 | Ga0213876_10003691 | 3300021384 | Bacteria | 8687 |
| 435 | Ga0213876_10127457 | 3300021384 | Bacteria | 1352 |
| 436 | Ga0213871_10002516 | 3300021441 | Bacteria | 3378 |
| 437 | Ga0213871_10018478 | 3300021441 | Bacteria | 1706 |
| 438 | Ga0224572_1041130 | 3300024225 | Bacteria | 870 |
| 439 | Ga0209435_100091 | 3300025206 | Bacteria | 41951 |
| 440 | Ga0209646_1000295 | 3300025246 | Bacteria | 41951 |
| 441 | Ga0209026_1000366 | 3300025250 | Bacteria | 41951 |
| 442 | Ga0209759_1000513 | 3300025256 | Bacteria | 41951 |
| 443 | Ga0209233_1002293 | 3300025261 | Bacteria | 7134 |
| 444 | Ga0209233_1008990 | 3300025261 | Bacteria | 3057 |
| 445 | Ga0209130_1000389 | 3300025284 | Bacteria | 48487 |
| 446 | Ga0209758_1004239 | 3300025297 | Bacteria | 12134 |
| 447 | Ga0207426_1000361 | 3300025302 | Bacteria | 81889 |
| 448 | Ga0207426_1025172 | 3300025302 | Bacteria | 2008 |
| 449 | Ga0207697_10008248 | 3300025315 | Bacteria | 4573 |
| 450 | Ga0207656_10013388 | 3300025321 | Bacteria | 3135 |
| 451 | Ga0207656_10020494 | 3300025321 | Bacteria | 2629 |
| 452 | Ga0207682_10013567 | 3300025893 | Bacteria | 3174 |
| 453 | Ga0207692_10000880 | 3300025898 | Bacteria | 10851 |
| 454 | Ga0207642_10187404 | 3300025899 | Bacteria | 1132 |
| 455 | Ga0207710_10002838 | 3300025900 | Bacteria | 7895 |
| 456 | Ga0207710_10019649 | 3300025900 | Bacteria | 2882 |
| 457 | Ga0207710_10082431 | 3300025900 | Bacteria | 1494 |
| 458 | Ga0207688_10001906 | 3300025901 | Bacteria | 11175 |
| 459 | Ga0207688_10002332 | 3300025901 | Bacteria | 10203 |
| 460 | Ga0207688_10048591 | 3300025901 | Bacteria | 2370 |
| 461 | Ga0207680_10079461 | 3300025903 | Bacteria | 2057 |
| 462 | Ga0207680_10377148 | 3300025903 | Bacteria | 999 |
| 463 | Ga0207647_10004250 | 3300025904 | Bacteria | 10615 |
| 464 | Ga0207647_10088873 | 3300025904 | Bacteria | 1844 |
| 465 | Ga0207647_10094052 | 3300025904 | Bacteria | 1786 |
| 466 | Ga0207685_10074761 | 3300025905 | Bacteria | 1384 |
| 467 | Ga0207685_10201347 | 3300025905 | Bacteria | 935 |
| 468 | Ga0207699_10002228 | 3300025906 | Bacteria | 9146 |
| 469 | Ga0207699_10082613 | 3300025906 | Bacteria | 1996 |
| 470 | Ga0207699_10111388 | 3300025906 | Bacteria | 1755 |
| 471 | Ga0207699_10428640 | 3300025906 | Bacteria | 946 |
| 472 | Ga0207645_10010970 | 3300025907 | Bacteria | 6200 |
| 473 | Ga0207645_10026220 | 3300025907 | Bacteria | 3767 |
| 474 | Ga0207645_10034046 | 3300025907 | Bacteria | 3273 |
| 475 | Ga0207645_10038240 | 3300025907 | Bacteria | 3077 |
| 476 | Ga0207643_10002034 | 3300025908 | Bacteria | 11165 |
| 477 | Ga0207643_10014811 | 3300025908 | Bacteria | 4241 |
| 478 | Ga0207705_10161483 | 3300025909 | Bacteria | 1684 |
| 479 | Ga0207684_10083513 | 3300025910 | Bacteria | 2720 |
| 480 | Ga0207684_10111421 | 3300025910 | Bacteria | 2343 |
| 481 | Ga0207684_10742172 | 3300025910 | Bacteria | 832 |
| 482 | Ga0207654_10002780 | 3300025911 | Bacteria | 8888 |
| 483 | Ga0207654_10078431 | 3300025911 | Bacteria | 1982 |
| 484 | Ga0207707_10010663 | 3300025912 | Bacteria | 7984 |
| 485 | Ga0207707_10017265 | 3300025912 | Bacteria | 6289 |
| 486 | Ga0207707_10053530 | 3300025912 | Bacteria | 3513 |
| 487 | Ga0207707_10807096 | 3300025912 | Bacteria | 781 |
| 488 | Ga0207695_10254758 | 3300025913 | Bacteria | 1654 |
| 489 | Ga0207671_10007430 | 3300025914 | Bacteria | 9508 |
| 490 | Ga0207671_10150972 | 3300025914 | Bacteria | 1795 |
| 491 | Ga0207671_10170500 | 3300025914 | Bacteria | 1690 |
| 492 | Ga0207671_10174915 | 3300025914 | Bacteria | 1668 |
| 493 | Ga0207671_10589229 | 3300025914 | Bacteria | 886 |
| 494 | Ga0207693_10006271 | 3300025915 | Bacteria | 9862 |
| 495 | Ga0207693_10017660 | 3300025915 | Bacteria | 5688 |
| 496 | Ga0207693_10020813 | 3300025915 | Bacteria | 5216 |
| 497 | Ga0207693_10122957 | 3300025915 | Bacteria | 2038 |
| 498 | Ga0207693_10334496 | 3300025915 | Bacteria | 1185 |
| 499 | Ga0207693_10454112 | 3300025915 | Bacteria | 1001 |
| 500 | Ga0207693_10498647 | 3300025915 | Bacteria | 950 |
| 501 | Ga0207663_10002278 | 3300025916 | Bacteria | 9186 |
| 502 | Ga0207663_10050857 | 3300025916 | Bacteria | 2577 |
| 503 | Ga0207663_10096389 | 3300025916 | Bacteria | 1976 |
| 504 | Ga0207663_10164948 | 3300025916 | Bacteria | 1568 |
| 505 | Ga0207663_10282365 | 3300025916 | Bacteria | 1234 |
| 506 | Ga0207663_10633890 | 3300025916 | Bacteria | 842 |
| 507 | Ga0207660_10005920 | 3300025917 | Bacteria | 7941 |
| 508 | Ga0207660_10055147 | 3300025917 | Bacteria | 2839 |
| 509 | Ga0207660_10072531 | 3300025917 | Bacteria | 2508 |
| 510 | Ga0207660_10089440 | 3300025917 | Bacteria | 2279 |
| 511 | Ga0207660_10268682 | 3300025917 | Bacteria | 1351 |
| 512 | Ga0207660_10362776 | 3300025917 | Bacteria | 1162 |
| 513 | Ga0207662_10004685 | 3300025918 | Bacteria | 7219 |
| 514 | Ga0207662_10006282 | 3300025918 | Bacteria | 6401 |
| 515 | Ga0207657_10002785 | 3300025919 | Bacteria | 18801 |
| 516 | Ga0207657_10038506 | 3300025919 | Bacteria | 4256 |
| 517 | Ga0207657_10150596 | 3300025919 | Bacteria | 1895 |
| 518 | Ga0207649_10000031 | 3300025920 | Bacteria | 146217 |
| 519 | Ga0207649_10000033 | 3300025920 | Bacteria | 139416 |
| 520 | Ga0207649_10137525 | 3300025920 | Bacteria | 1667 |
| 521 | Ga0207649_10417491 | 3300025920 | Bacteria | 1007 |
| 522 | Ga0207652_10007295 | 3300025921 | Bacteria | 8904 |
| 523 | Ga0207652_10034133 | 3300025921 | Bacteria | 4287 |
| 524 | Ga0207652_10067755 | 3300025921 | Bacteria | 3096 |
| 525 | Ga0207652_10400632 | 3300025921 | Bacteria | 1238 |
| 526 | Ga0207652_10615235 | 3300025921 | Bacteria | 973 |
| 527 | Ga0207681_10109735 | 3300025923 | Bacteria | 2005 |
| 528 | Ga0207681_10117307 | 3300025923 | Bacteria | 1946 |
| 529 | Ga0207694_10004400 | 3300025924 | Bacteria | 11004 |
| 530 | Ga0207694_10076254 | 3300025924 | Bacteria | 2626 |
| 531 | Ga0207694_10463499 | 3300025924 | Bacteria | 1059 |
| 532 | Ga0207650_10002738 | 3300025925 | Bacteria | 12166 |
| 533 | Ga0207650_10027115 | 3300025925 | Bacteria | 4097 |
| 534 | Ga0207650_10063064 | 3300025925 | Bacteria | 2770 |
| 535 | Ga0207650_10131050 | 3300025925 | Bacteria | 1962 |
| 536 | Ga0207659_10010009 | 3300025926 | Bacteria | 5940 |
| 537 | Ga0207659_10015533 | 3300025926 | Bacteria | 4936 |
| 538 | Ga0207687_10005847 | 3300025927 | Bacteria | 8137 |
| 539 | Ga0207687_10010555 | 3300025927 | Bacteria | 6036 |
| 540 | Ga0207687_10111636 | 3300025927 | Bacteria | 2030 |
| 541 | Ga0207687_10142963 | 3300025927 | Bacteria | 1817 |
| 542 | Ga0207700_10006859 | 3300025928 | Bacteria | 6924 |
| 543 | Ga0207700_10046006 | 3300025928 | Bacteria | 3224 |
| 544 | Ga0207700_10048646 | 3300025928 | Bacteria | 3150 |
| 545 | Ga0207700_10086525 | 3300025928 | Bacteria | 2463 |
| 546 | Ga0207700_10132540 | 3300025928 | Bacteria | 2037 |
| 547 | Ga0207700_10140670 | 3300025928 | Bacteria | 1983 |
| 548 | Ga0207700_10306789 | 3300025928 | Bacteria | 1372 |
| 549 | Ga0207700_10316065 | 3300025928 | Bacteria | 1352 |
| 550 | Ga0207700_10481406 | 3300025928 | Bacteria | 1097 |
| 551 | Ga0207700_10764645 | 3300025928 | Bacteria | 863 |
| 552 | Ga0207700_10898641 | 3300025928 | Bacteria | 793 |
| 553 | Ga0207664_10032247 | 3300025929 | Bacteria | 4014 |
| 554 | Ga0207664_10072622 | 3300025929 | Bacteria | 2774 |
| 555 | Ga0207664_10353106 | 3300025929 | Bacteria | 1302 |
| 556 | Ga0207644_10010237 | 3300025931 | Bacteria | 6181 |
| 557 | Ga0207644_10010951 | 3300025931 | Bacteria | 5991 |
| 558 | Ga0207644_10012480 | 3300025931 | Bacteria | 5645 |
| 559 | Ga0207690_10002494 | 3300025932 | Bacteria | 11127 |
| 560 | Ga0207690_10069545 | 3300025932 | Bacteria | 2422 |
| 561 | Ga0207690_10073108 | 3300025932 | Bacteria | 2370 |
| 562 | Ga0207690_10225112 | 3300025932 | Bacteria | 1437 |
| 563 | Ga0207690_10316053 | 3300025932 | Bacteria | 1226 |
| 564 | Ga0207706_10001779 | 3300025933 | Bacteria | 21159 |
| 565 | Ga0207706_10003134 | 3300025933 | Bacteria | 15886 |
| 566 | Ga0207706_10024619 | 3300025933 | Bacteria | 5395 |
| 567 | Ga0207706_10081024 | 3300025933 | Bacteria | 2853 |
| 568 | Ga0207706_10256945 | 3300025933 | Bacteria | 1525 |
| 569 | Ga0207706_10294259 | 3300025933 | Bacteria | 1415 |
| 570 | Ga0207706_10351132 | 3300025933 | Bacteria | 1282 |
| 571 | Ga0207686_10044106 | 3300025934 | Bacteria | 2736 |
| 572 | Ga0207709_10016786 | 3300025935 | Bacteria | 4078 |
| 573 | Ga0207709_10115209 | 3300025935 | Bacteria | 1805 |
| 574 | Ga0207709_10352062 | 3300025935 | Bacteria | 1112 |
| 575 | Ga0207670_10021392 | 3300025936 | Bacteria | 3990 |
| 576 | Ga0207670_10029969 | 3300025936 | Bacteria | 3472 |
| 577 | Ga0207670_10290942 | 3300025936 | Bacteria | 1276 |
| 578 | Ga0207669_10005756 | 3300025937 | Bacteria | 5595 |
| 579 | Ga0207669_10520971 | 3300025937 | Bacteria | 954 |
| 580 | Ga0207704_10010329 | 3300025938 | Bacteria | 4549 |
| 581 | Ga0207665_10015878 | 3300025939 | Bacteria | 4942 |
| 582 | Ga0207665_10083685 | 3300025939 | Bacteria | 2201 |
| 583 | Ga0207665_10144852 | 3300025939 | Bacteria | 1697 |
| 584 | Ga0207665_10382972 | 3300025939 | Bacteria | 1068 |
| 585 | Ga0207691_10006507 | 3300025940 | Bacteria | 11273 |
| 586 | Ga0207691_10007515 | 3300025940 | Bacteria | 10489 |
| 587 | Ga0207691_10253496 | 3300025940 | Bacteria | 1518 |
| 588 | Ga0207691_10317525 | 3300025940 | Bacteria | 1336 |
| 589 | Ga0207691_10426154 | 3300025940 | Bacteria | 1130 |
| 590 | Ga0207711_10010088 | 3300025941 | Bacteria | 7851 |
| 591 | Ga0207711_10118037 | 3300025941 | Bacteria | 2367 |
| 592 | Ga0207711_10182716 | 3300025941 | Bacteria | 1908 |
| 593 | Ga0207711_10381207 | 3300025941 | Bacteria | 1308 |
| 594 | Ga0207689_10001370 | 3300025942 | Bacteria | 23353 |
| 595 | Ga0207689_10008563 | 3300025942 | Bacteria | 8915 |
| 596 | Ga0207661_10012149 | 3300025944 | Bacteria | 6252 |
| 597 | Ga0207661_10035468 | 3300025944 | Bacteria | 3887 |
| 598 | Ga0207679_10176707 | 3300025945 | Bacteria | 1763 |
| 599 | Ga0207679_10280389 | 3300025945 | Bacteria | 1429 |
| 600 | Ga0207679_10583956 | 3300025945 | Bacteria | 1005 |
| 601 | Ga0207679_10797351 | 3300025945 | Bacteria | 861 |
| 602 | Ga0207679_10839664 | 3300025945 | Bacteria | 839 |
| 603 | Ga0207667_10010887 | 3300025949 | Bacteria | 10605 |
| 604 | Ga0207667_10182003 | 3300025949 | Bacteria | 2158 |
| 605 | Ga0207667_10929025 | 3300025949 | Bacteria | 860 |
| 606 | Ga0207651_10006050 | 3300025960 | Bacteria | 6284 |
| 607 | Ga0207651_10049466 | 3300025960 | Bacteria | 2848 |
| 608 | Ga0207651_10175172 | 3300025960 | Bacteria | 1696 |
| 609 | Ga0207712_10055094 | 3300025961 | Bacteria | 2796 |
| 610 | Ga0207712_10082319 | 3300025961 | Bacteria | 2346 |
| 611 | Ga0207712_10257091 | 3300025961 | Bacteria | 1415 |
| 612 | Ga0207712_10488089 | 3300025961 | Bacteria | 1051 |
| 613 | Ga0207668_10029634 | 3300025972 | Bacteria | 3588 |
| 614 | Ga0207668_10066722 | 3300025972 | Bacteria | 2551 |
| 615 | Ga0207668_10130771 | 3300025972 | Bacteria | 1916 |
| 616 | Ga0207668_10315769 | 3300025972 | Bacteria | 1295 |
| 617 | Ga0207668_10437286 | 3300025972 | Bacteria | 1113 |
| 618 | Ga0207640_10028881 | 3300025981 | Bacteria | 3397 |
| 619 | Ga0207640_10137437 | 3300025981 | Bacteria | 1776 |
| 620 | Ga0207640_10517461 | 3300025981 | Bacteria | 997 |
| 621 | Ga0207658_10271554 | 3300025986 | Bacteria | 1450 |
| 622 | Ga0207677_10007022 | 3300026023 | Bacteria | 6195 |
| 623 | Ga0207677_10859754 | 3300026023 | Bacteria | 815 |
| 624 | Ga0207703_10005527 | 3300026035 | Bacteria | 10149 |
| 625 | Ga0207703_10087571 | 3300026035 | Bacteria | 2611 |
| 626 | Ga0207703_10178690 | 3300026035 | Bacteria | 1872 |
| 627 | Ga0207703_10301275 | 3300026035 | Bacteria | 1462 |
| 628 | Ga0207639_10018693 | 3300026041 | Bacteria | 4928 |
| 629 | Ga0207639_10179605 | 3300026041 | Bacteria | 1799 |
| 630 | Ga0207639_10434586 | 3300026041 | Bacteria | 1189 |
| 631 | Ga0207639_10574955 | 3300026041 | Bacteria | 1037 |
| 632 | Ga0207678_10004671 | 3300026067 | Bacteria | 12299 |
| 633 | Ga0207678_10006952 | 3300026067 | Bacteria | 10045 |
| 634 | Ga0207678_10025982 | 3300026067 | Bacteria | 5109 |
| 635 | Ga0207678_10027109 | 3300026067 | Bacteria | 4996 |
| 636 | Ga0207678_10856244 | 3300026067 | Bacteria | 803 |
| 637 | Ga0207708_10001428 | 3300026075 | Bacteria | 17910 |
| 638 | Ga0207708_10007178 | 3300026075 | Bacteria | 8235 |
| 639 | Ga0207708_10029917 | 3300026075 | Bacteria | 4129 |
| 640 | Ga0207702_10088425 | 3300026078 | Bacteria | 2706 |
| 641 | Ga0207702_10270409 | 3300026078 | Bacteria | 1603 |
| 642 | Ga0207702_10405922 | 3300026078 | Bacteria | 1315 |
| 643 | Ga0207702_10735139 | 3300026078 | Bacteria | 974 |
| 644 | Ga0207702_10748554 | 3300026078 | Bacteria | 965 |
| 645 | Ga0207641_10017293 | 3300026088 | Bacteria | 5902 |
| 646 | Ga0207641_10025809 | 3300026088 | Bacteria | 4846 |
| 647 | Ga0207641_10256148 | 3300026088 | Bacteria | 1636 |
| 648 | Ga0207648_10004473 | 3300026089 | Bacteria | 14342 |
| 649 | Ga0207648_10010764 | 3300026089 | Bacteria | 8642 |
| 650 | Ga0207648_10139092 | 3300026089 | Bacteria | 2140 |
| 651 | Ga0207648_10309360 | 3300026089 | Bacteria | 1418 |
| 652 | Ga0207648_10431927 | 3300026089 | Bacteria | 1197 |
| 653 | Ga0207676_10010604 | 3300026095 | Bacteria | 6568 |
| 654 | Ga0207676_10010854 | 3300026095 | Bacteria | 6497 |
| 655 | Ga0207676_10067232 | 3300026095 | Bacteria | 2862 |
| 656 | Ga0207674_10015065 | 3300026116 | Bacteria | 8514 |
| 657 | Ga0207674_10051516 | 3300026116 | Bacteria | 4201 |
| 658 | Ga0207674_10081726 | 3300026116 | Bacteria | 3233 |
| 659 | Ga0207674_10174528 | 3300026116 | Bacteria | 2102 |
| 660 | Ga0207674_10308462 | 3300026116 | Bacteria | 1532 |
| 661 | Ga0207675_100001777 | 3300026118 | Bacteria | 21552 |
| 662 | Ga0207675_100003458 | 3300026118 | Bacteria | 15440 |
| 663 | Ga0207675_100213360 | 3300026118 | Bacteria | 1858 |
| 664 | Ga0207675_100348625 | 3300026118 | Bacteria | 1451 |
| 665 | Ga0207675_100756441 | 3300026118 | Bacteria | 983 |
| 666 | Ga0207683_10003755 | 3300026121 | Bacteria | 13166 |
| 667 | Ga0207683_10010729 | 3300026121 | Bacteria | 7811 |
| 668 | Ga0207683_10023225 | 3300026121 | Bacteria | 5331 |
| 669 | Ga0207683_10048576 | 3300026121 | Bacteria | 3715 |
| 670 | Ga0207683_10315499 | 3300026121 | Bacteria | 1431 |
| 671 | Ga0207698_10005989 | 3300026142 | Bacteria | 7558 |
| 672 | Ga0207698_10153205 | 3300026142 | Bacteria | 2004 |
| 673 | Ga0207698_10257106 | 3300026142 | Bacteria | 1602 |
| 674 | Ga0207698_10666931 | 3300026142 | Bacteria | 1032 |
| 675 | Ga0209589_1000006 | 3300027357 | Bacteria | 436292 |
| 676 | Ga0209489_100007 | 3300027361 | Bacteria | 436292 |
| 677 | Ga0209700_100008 | 3300027363 | Bacteria | 436292 |
| 678 | Ga0209179_1005350 | 3300027512 | Bacteria | 2003 |
| 679 | Ga0209179_1014263 | 3300027512 | Bacteria | 1456 |
| 680 | Ga0209588_1001156 | 3300027671 | Bacteria | 6803 |
| 681 | Ga0209588_1046820 | 3300027671 | Bacteria | 1399 |
| 682 | Ga0207428_10094389 | 3300027907 | Bacteria | 2319 |
| 683 | Ga0207428_10391742 | 3300027907 | Bacteria | 1018 |
| 684 | Ga0268266_10002524 | 3300028379 | Bacteria | 19477 |
| 685 | Ga0268266_10002721 | 3300028379 | Bacteria | 18537 |
| 686 | Ga0268266_10005528 | 3300028379 | Bacteria | 11762 |
| 687 | Ga0268266_10008468 | 3300028379 | Bacteria | 9143 |
| 688 | Ga0268266_10010821 | 3300028379 | Bacteria | 7948 |
| 689 | Ga0268266_10181864 | 3300028379 | Bacteria | 1915 |
| 690 | Ga0268266_10267273 | 3300028379 | Bacteria | 1587 |
| 691 | Ga0268265_10007472 | 3300028380 | Bacteria | 7379 |
| 692 | Ga0268265_10123881 | 3300028380 | Bacteria | 2135 |
| 693 | Ga0268265_10164209 | 3300028380 | Bacteria | 1890 |
| 694 | Ga0268265_10881527 | 3300028380 | Bacteria | 877 |
| 695 | Ga0268264_10000174 | 3300028381 | Bacteria | 137254 |
| 696 | Ga0268264_10031810 | 3300028381 | Bacteria | 4327 |
| 697 | Ga0268264_10055736 | 3300028381 | Bacteria | 3303 |
| 698 | Ga0268264_10645447 | 3300028381 | Bacteria | 1047 |
| 699 | Ga0265338_10069616 | 3300028800 | Bacteria | 3021 |
| 700 | Ga0265338_10087780 | 3300028800 | Bacteria | 2583 |
| 701 | Ga0265324_10006333 | 3300029957 | Bacteria | 4957 |
| 702 | Ga0265330_10006018 | 3300031235 | Bacteria | 6007 |
| 703 | Ga0265330_10168617 | 3300031235 | Bacteria | 928 |
| 704 | Ga0265332_10039386 | 3300031238 | Bacteria | 2047 |
| 705 | Ga0265328_10000006 | 3300031239 | Bacteria | 227698 |
| 706 | Ga0265328_10000450 | 3300031239 | Bacteria | 19127 |
| 707 | Ga0265328_10009243 | 3300031239 | Bacteria | 4022 |
| 708 | Ga0265328_10021734 | 3300031239 | Bacteria | 2446 |
| 709 | Ga0265328_10051919 | 3300031239 | Bacteria | 1505 |
| 710 | Ga0265328_10082408 | 3300031239 | Bacteria | 1186 |
| 711 | Ga0265320_10002095 | 3300031240 | Bacteria | 14042 |
| 712 | Ga0265325_10008854 | 3300031241 | Bacteria | 5913 |
| 713 | Ga0265325_10013263 | 3300031241 | Bacteria | 4697 |
| 714 | Ga0265325_10024250 | 3300031241 | Bacteria | 3302 |
| 715 | Ga0265325_10026580 | 3300031241 | Bacteria | 3133 |
| 716 | Ga0265325_10115409 | 3300031241 | Bacteria | 1300 |
| 717 | Ga0265340_10003647 | 3300031247 | Bacteria | 8655 |
| 718 | Ga0265340_10006812 | 3300031247 | Bacteria | 6253 |
| 719 | Ga0265340_10033125 | 3300031247 | Bacteria | 2575 |
| 720 | Ga0265340_10123680 | 3300031247 | Bacteria | 1189 |
| 721 | Ga0265339_10000137 | 3300031249 | Bacteria | 60322 |
| 722 | Ga0265339_10009370 | 3300031249 | Bacteria | 6159 |
| 723 | Ga0265339_10030160 | 3300031249 | Bacteria | 3072 |
| 724 | Ga0265339_10041964 | 3300031249 | Bacteria | 2535 |
| 725 | Ga0265331_10000141 | 3300031250 | Bacteria | 94896 |
| 726 | Ga0265331_10000145 | 3300031250 | Bacteria | 92545 |
| 727 | Ga0265331_10000673 | 3300031250 | Bacteria | 29339 |
| 728 | Ga0265331_10000882 | 3300031250 | Bacteria | 24333 |
| 729 | Ga0265331_10019993 | 3300031250 | Bacteria | 3446 |
| 730 | Ga0265331_10099921 | 3300031250 | Bacteria | 1336 |
| 731 | Ga0265331_10133630 | 3300031250 | Bacteria | 1131 |
| 732 | Ga0265327_10000033 | 3300031251 | Bacteria | 317182 |
| 733 | Ga0265327_10000070 | 3300031251 | Bacteria | 217350 |
| 734 | Ga0265327_10000703 | 3300031251 | Bacteria | 53052 |
| 735 | Ga0265327_10008302 | 3300031251 | Bacteria | 7769 |
| 736 | Ga0265327_10099810 | 3300031251 | Bacteria | 1402 |
| 737 | Ga0265316_10000091 | 3300031344 | Bacteria | 96882 |
| 738 | Ga0265316_10041888 | 3300031344 | Bacteria | 3661 |
| 739 | Ga0265316_10068276 | 3300031344 | Bacteria | 2747 |
| 740 | Ga0265316_10070886 | 3300031344 | Bacteria | 2687 |
| 741 | Ga0265316_10398203 | 3300031344 | Bacteria | 992 |
| 742 | Ga0265316_10414470 | 3300031344 | Bacteria | 969 |
| 743 | Ga0265316_10621841 | 3300031344 | Bacteria | 765 |
| 744 | Ga0307509_10006398 | 3300031507 | Bacteria | 15864 |
| 745 | Ga0307509_10046824 | 3300031507 | Bacteria | 4653 |
| 746 | Ga0307509_10050219 | 3300031507 | Bacteria | 4467 |
| 747 | Ga0307509_10283105 | 3300031507 | Bacteria | 1418 |
| 748 | Ga0265313_10000269 | 3300031595 | Bacteria | 56767 |
| 749 | Ga0265313_10000782 | 3300031595 | Bacteria | 32152 |
| 750 | Ga0265313_10001300 | 3300031595 | Bacteria | 23590 |
| 751 | Ga0265313_10080712 | 3300031595 | Bacteria | 1478 |
| 752 | Ga0265313_10148342 | 3300031595 | Bacteria | 1004 |
| 753 | Ga0307508_10000105 | 3300031616 | Bacteria | 99107 |
| 754 | Ga0307508_10063281 | 3300031616 | Bacteria | 3264 |
| 755 | Ga0307508_10094506 | 3300031616 | Bacteria | 2580 |
| 756 | Ga0265314_10001057 | 3300031711 | Bacteria | 32018 |
| 757 | Ga0265314_10002651 | 3300031711 | Bacteria | 17962 |
| 758 | Ga0265314_10002789 | 3300031711 | Bacteria | 17445 |
| 759 | Ga0265314_10006484 | 3300031711 | Bacteria | 10350 |
| 760 | Ga0265314_10042742 | 3300031711 | Bacteria | 3228 |
| 761 | Ga0265314_10061525 | 3300031711 | Bacteria | 2556 |
| 762 | Ga0265314_10095947 | 3300031711 | Bacteria | 1919 |
| 763 | Ga0265314_10176091 | 3300031711 | Bacteria | 1286 |
| 764 | Ga0265342_10008664 | 3300031712 | Bacteria | 7262 |
| 765 | Ga0265342_10019274 | 3300031712 | Bacteria | 4400 |
| 766 | Ga0265342_10033550 | 3300031712 | Bacteria | 3155 |
| 767 | Ga0265342_10041441 | 3300031712 | Bacteria | 2788 |
| 768 | Ga0265342_10299282 | 3300031712 | Bacteria | 848 |
| 769 | Ga0316576_10389413 | 3300031727 | Bacteria | 1034 |
| 770 | Ga0316578_10005177 | 3300031728 | Bacteria | 6289 |
| 771 | Ga0307516_10000657 | 3300031730 | Bacteria | 46760 |
| 772 | Ga0307516_10025929 | 3300031730 | Bacteria | 5960 |
| 773 | Ga0307516_10046721 | 3300031730 | Bacteria | 4270 |
| 774 | Ga0307516_10121468 | 3300031730 | Bacteria | 2402 |
| 775 | Ga0307518_10422147 | 3300031838 | Bacteria | 731 |
| 776 | Ga0307406_10380002 | 3300031901 | Bacteria | 1113 |
| 777 | Ga0307416_100285090 | 3300032002 | Bacteria | 1631 |
| 778 | Ga0307415_100046127 | 3300032126 | Bacteria | 2926 |
| 779 | Ga0316583_10000233 | 3300032133 | Bacteria | 15084 |
| 780 | Ga0307507_10101126 | 3300033179 | Bacteria | 2412 |
| 781 | Ga0307510_10027931 | 3300033180 | Bacteria | 6453 |
| 782 | Ga0307510_10028847 | 3300033180 | Bacteria | 6330 |
| 783 | Ga0307510_10032970 | 3300033180 | Bacteria | 5828 |
| 784 | Ga0315911_1000003 | 3300033442 | Bacteria | 502217 |
| 785 | Ga0316215_1003294 | 3300033544 | Bacteria | 1535 |
| 786 | Ga0373959_0122038 | 3300034820 | Bacteria | 638 |
| 787 | Ga0373938_0014387 | 3300034957 | Bacteria | 1518 |
| 788 | Ga0373926_0107403 | 3300035083 | Bacteria | 1047 |
| 789 | Ga0373928_0010982 | 3300035084 | Bacteria | 1786 |
| 790 | Ga0373934_0022581 | 3300035086 | Bacteria | 2428 |
| 791 | Ga0373934_0095934 | 3300035086 | Bacteria | 1198 |
| 792 | Ga0373940_0158077 | 3300035088 | Bacteria | 726 |
| 793 | Ga0373944_0019687 | 3300035089 | Bacteria | 1938 |
| 794 | Ga0373944_0033857 | 3300035089 | Bacteria | 1550 |
| 795 | Ga0373944_0129889 | 3300035089 | Bacteria | 875 |
| 796 | Ga0373949_0042525 | 3300035090 | Bacteria | 1122 |
| 797 | Ga0373923_0012312 | 3300035111 | Bacteria | 3159 |
| 798 | Ga0373923_0155147 | 3300035111 | Bacteria | 1042 |
| 799 | Ga0373936_0000885 | 3300035113 | Bacteria | 10703 |
| 800 | Ga0373936_0003367 | 3300035113 | Bacteria | 5990 |
| 801 | Ga0373936_0095937 | 3300035113 | Bacteria | 1247 |
| 802 | Ga0373939_0113964 | 3300035114 | Bacteria | 945 |
| 803 | Ga0373945_0007786 | 3300035116 | Bacteria | 3476 |
| 804 | Ga0373945_0014890 | 3300035116 | Bacteria | 2611 |
| 805 | Ga0373945_0016878 | 3300035116 | Bacteria | 2468 |
| 806 | Ga0373945_0105297 | 3300035116 | Bacteria | 1108 |
| 807 | Ga0373953_0004630 | 3300035117 | Bacteria | 4398 |
| 808 | Ga0373953_0004698 | 3300035117 | Bacteria | 4375 |
| 809 | Ga0373953_0036551 | 3300035117 | Bacteria | 1935 |
| 810 | Ga0373953_0176723 | 3300035117 | Bacteria | 920 |
| 811 | Ga0373954_0000950 | 3300035118 | Bacteria | 11319 |
| 812 | Ga0373954_0009404 | 3300035118 | Bacteria | 4297 |
| 813 | Ga0373954_0023202 | 3300035118 | Bacteria | 2819 |
| 814 | Ga0373954_0034271 | 3300035118 | Bacteria | 2351 |
| 815 | Ga0373954_0042781 | 3300035118 | Bacteria | 2112 |
| 816 | Ga0373954_0214303 | 3300035118 | Bacteria | 947 |
| 817 | Ga0373956_0066659 | 3300035119 | Bacteria | 1638 |
| 818 | Ga0373956_0115695 | 3300035119 | Bacteria | 1250 |
| 819 | Ga0373956_0134170 | 3300035119 | Bacteria | 1160 |
| 820 | Ga0373957_0011342 | 3300035120 | Bacteria | 2973 |
| 821 | Ga0373957_0014124 | 3300035120 | Bacteria | 2724 |
| 822 | Ga0373957_0085738 | 3300035120 | Bacteria | 1247 |
| 823 | Ga0373943_0014141 | 3300035170 | Bacteria | 3609 |
| 824 | Ga0373943_0047480 | 3300035170 | Bacteria | 2099 |
| 825 | Ga0373943_0057788 | 3300035170 | Bacteria | 1929 |
| 826 | Ga0373943_0102654 | 3300035170 | Bacteria | 1498 |
| 827 | Ga0373943_0128823 | 3300035170 | Bacteria | 1352 |
| 828 | Ga0373943_0201324 | 3300035170 | Bacteria | 1102 |
| 829 | Ga0373943_0252177 | 3300035170 | Bacteria | 991 |
| 830 | Ga0373943_0268221 | 3300035170 | Bacteria | 962 |
| 831 | Ga0373946_0001576 | 3300035171 | Bacteria | 7942 |
| 832 | Ga0373946_0006921 | 3300035171 | Bacteria | 4129 |
| 833 | Ga0373946_0039314 | 3300035171 | Bacteria | 1931 |
| 834 | Ga0373946_0202706 | 3300035171 | Bacteria | 951 |
| 835 | Ga0373955_0000742 | 3300035172 | Bacteria | 14009 |
| 836 | Ga0373955_0000886 | 3300035172 | Bacteria | 12852 |
| 837 | Ga0373955_0047053 | 3300035172 | Bacteria | 2334 |
| 838 | Ga0373955_0072915 | 3300035172 | Bacteria | 1924 |
| 839 | Ga0373955_0164645 | 3300035172 | Bacteria | 1310 |
| 840 | Ga0373961_0006767 | 3300035241 | Bacteria | 2758 |
| 841 | Ga0316574_0293439 | 3300035398 | Bacteria | 1035 |
| 842 | Ga0373924_0004542 | 3300035410 | Bacteria | 4850 |
| 843 | Ga0373924_0010961 | 3300035410 | Bacteria | 3356 |
| 844 | Ga0373924_0018781 | 3300035410 | Bacteria | 2670 |
| 845 | Ga0373931_0008548 | 3300035691 | Bacteria | 4859 |
| 846 | Ga0373931_0033811 | 3300035691 | Bacteria | 2651 |
| 847 | Ga0373931_0036799 | 3300035691 | Bacteria | 2553 |
| 848 | Ga0373931_0255773 | 3300035691 | Bacteria | 1067 |
| 849 | Ga0373931_0272597 | 3300035691 | Bacteria | 1036 |
| 850 | Ga0373935_0000096 | 3300035692 | Bacteria | 39013 |
| 851 | Ga0373935_0000478 | 3300035692 | Bacteria | 20767 |
| 852 | Ga0373935_0030724 | 3300035692 | Bacteria | 3330 |
| 853 | Ga0373935_0056406 | 3300035692 | Bacteria | 2504 |
| 854 | Ga0373935_0085096 | 3300035692 | Bacteria | 2061 |
| 855 | Ga0373935_0164907 | 3300035692 | Bacteria | 1512 |
| 856 | Ga0373935_0343190 | 3300035692 | Bacteria | 1063 |
| 857 | Ga0373935_0386684 | 3300035692 | Bacteria | 1003 |
| 858 | Ga0373927_0001272 | 3300035695 | Bacteria | 19085 |
| 859 | Ga0373927_0002293 | 3300035695 | Bacteria | 14012 |
| 860 | Ga0373927_0008757 | 3300035695 | Bacteria | 6798 |
| 861 | Ga0373927_0018308 | 3300035695 | Bacteria | 4603 |
| 862 | Ga0373927_0074347 | 3300035695 | Bacteria | 2200 |
| 863 | Ga0373927_0136821 | 3300035695 | Bacteria | 1601 |
| 864 | Ga0373927_0138432 | 3300035695 | Bacteria | 1591 |
| 865 | Ga0373927_0157523 | 3300035695 | Bacteria | 1487 |
| 866 | Ga0373927_0255099 | 3300035695 | Bacteria | 1153 |
| 867 | Ga0373933_0001294 | 3300035724 | Bacteria | 14734 |
| 868 | Ga0373933_0003722 | 3300035724 | Bacteria | 8429 |
| 869 | Ga0373933_0042183 | 3300035724 | Bacteria | 2696 |
| 870 | Ga0373933_0268650 | 3300035724 | Bacteria | 1100 |
| 871 | Ga0373947_0000081 | 3300035725 | Bacteria | 48660 |
| 872 | Ga0373947_0000843 | 3300035725 | Bacteria | 18525 |
| 873 | Ga0373947_0007899 | 3300035725 | Bacteria | 6138 |
| 874 | Ga0373947_0061030 | 3300035725 | Bacteria | 2290 |
| 875 | Ga0373947_0062604 | 3300035725 | Bacteria | 2264 |
| 876 | Ga0373947_0089470 | 3300035725 | Bacteria | 1918 |
| 877 | Ga0373947_0166631 | 3300035725 | Bacteria | 1428 |
| 878 | Ga0373947_0405417 | 3300035725 | Bacteria | 920 |
| 879 | Ga0373937_0000515 | 3300036401 | Bacteria | 34939 |
| 880 | Ga0373937_0002933 | 3300036401 | Bacteria | 14270 |
| 881 | Ga0373937_0005300 | 3300036401 | Bacteria | 11020 |
| 882 | Ga0373937_0032217 | 3300036401 | Bacteria | 4754 |
| 883 | Ga0373937_0043424 | 3300036401 | Bacteria | 4103 |
| 884 | Ga0373937_0047034 | 3300036401 | Bacteria | 3947 |
| 885 | Ga0373937_0067718 | 3300036401 | Bacteria | 3290 |
| 886 | Ga0373937_0074952 | 3300036401 | Bacteria | 3123 |
| 887 | Ga0373937_0148832 | 3300036401 | Bacteria | 2193 |
| 888 | Ga0373937_0187739 | 3300036401 | Bacteria | 1941 |
| 889 | Ga0373937_0423725 | 3300036401 | Bacteria | 1263 |
| 890 | Ga0373937_0536984 | 3300036401 | Bacteria | 1111 |
| 891 | Ga0373937_1094580 | 3300036401 | Bacteria | 745 |
| 892 | Ga0372808_004176 | 3300036459 | Bacteria | 1825 |
| 893 | Ga0316582_0524902 | 3300036647 | Bacteria | 816 |
| 894 | Ga0316584_0006337 | 3300036712 | Bacteria | 8016 |
| 895 | Ga0316584_0068926 | 3300036712 | Bacteria | 2652 |
| 896 | Ga0316584_0141881 | 3300036712 | Bacteria | 1791 |
| 897 | Ga0373925_0000011 | 3300037068 | Bacteria | 209840 |
| 898 | Ga0373925_0001296 | 3300037068 | Bacteria | 21916 |
| 899 | Ga0373925_0025284 | 3300037068 | Bacteria | 4337 |
| 900 | Ga0373925_0079999 | 3300037068 | Bacteria | 2484 |
| 901 | Ga0373925_0109099 | 3300037068 | Bacteria | 2136 |
| 902 | Ga0373925_0112460 | 3300037068 | Bacteria | 2105 |
| 903 | Ga0373925_0123453 | 3300037068 | Bacteria | 2012 |
| 904 | Ga0373925_0138814 | 3300037068 | Bacteria | 1901 |
| 905 | Ga0373925_0426242 | 3300037068 | Bacteria | 1084 |
| 906 | Ga0373925_0644329 | 3300037068 | Bacteria | 873 |
| 907 | Ga0395899_0101941 | 3300037312 | Bacteria | 2071 |
| 908 | Ga0395900_0347141 | 3300037418 | Bacteria | 1458 |
| 909 | Ga0395898_0022529 | 3300037466 | Bacteria | 6379 |
| 910 | Ga0395898_0030141 | 3300037466 | Bacteria | 5431 |
| 911 | Ga0395905_0001778 | 3300037471 | Bacteria | 25004 |
| 912 | Ga0395905_0020451 | 3300037471 | Bacteria | 6271 |
| 913 | Ga0436364_0489075 | 3300037853 | Bacteria | 2109 |
| 914 | Ga0395901_0352855 | 3300038443 | Bacteria | 1518 |
| 915 | Ga0395901_1153766 | 3300038443 | Bacteria | 743 |
| 916 | Ga0436365_0081603 | 3300039437 | Bacteria | 4352 |
| 917 | Ga0436365_0808140 | 3300039437 | Bacteria | 2653 |
| 918 | Ga0436360_0050348 | 3300039438 | Bacteria | 4179 |
| 919 | Ga0436360_0170277 | 3300039438 | Bacteria | 1118 |
| 920 | Ga0436360_0320963 | 3300039438 | Bacteria | 1204 |
| 921 | Ga0436360_1074814 | 3300039438 | Bacteria | 5161 |
| 922 | Ga0436360_1356508 | 3300039438 | Bacteria | 1278 |
| 923 | Ga0436361_0256757 | 3300039447 | Bacteria | 1736 |
| 924 | Ga0436361_0369023 | 3300039447 | Bacteria | 6346 |
| 925 | Ga0436361_0452542 | 3300039447 | Bacteria | 1827 |
| 926 | Ga0436361_0539018 | 3300039447 | Bacteria | 2789 |
| 927 | Ga0436361_0740814 | 3300039447 | Bacteria | 4372 |
| 928 | Ga0436361_0825589 | 3300039447 | Bacteria | 1275 |
| 929 | Ga0436361_1002425 | 3300039447 | Bacteria | 2703 |
| 930 | Ga0436363_0202525 | 3300039450 | Bacteria | 5216 |
| 931 | Ga0436363_0419001 | 3300039450 | Bacteria | 4507 |
| 932 | Ga0436363_0510027 | 3300039450 | Bacteria | 861 |
| 933 | Ga0436363_0772297 | 3300039450 | Bacteria | 1349 |
| 934 | Ga0436363_0947874 | 3300039450 | Bacteria | 1015 |
| 935 | Ga0436363_1300598 | 3300039450 | Bacteria | 1694 |
| 936 | Ga0436362_0138375 | 3300039453 | Bacteria | 2240 |
| 937 | Ga0436362_0756530 | 3300039453 | Bacteria | 3447 |
| 938 | Ga0439453_0000337 | 3300041408 | Bacteria | 4926 |
| 939 | Ga0451793_1820481 | 3300041452 | Bacteria | 1081 |
| 940 | Ga0439442_039143 | 3300042002 | Bacteria | 994 |
| 941 | Ga0439443_020201 | 3300042003 | Bacteria | 1044 |
| 942 | Ga0439434_0137912 | 3300042435 | Bacteria | 803 |
| 943 | Ga0439435_0003544 | 3300042436 | Bacteria | 3261 |
| 944 | Ga0439435_0010286 | 3300042436 | Bacteria | 2216 |
| 945 | Ga0451577_0341346 | 3300042876 | Bacteria | 1358 |
| 946 | Ga0453683_0012709 | 3300044673 | Bacteria | 5512 |
| 947 | Ga0466966_0047159 | 3300044684 | Bacteria | 2749 |
| 948 | Ga0466963_0035869 | 3300044694 | Bacteria | 3231 |
| 949 | Ga0466963_0255841 | 3300044694 | Bacteria | 1229 |
| 950 | Ga0453684_0000006 | 3300044712 | Bacteria | 1364191 |
| 951 | Ga0453684_0000031 | 3300044712 | Bacteria | 752632 |
| 952 | Ga0453684_0032690 | 3300044712 | Bacteria | 7272 |
| 953 | Ga0453684_0037507 | 3300044712 | Bacteria | 6651 |
| 954 | Ga0453684_0054779 | 3300044712 | Bacteria | 5191 |
| 955 | Ga0453684_0720980 | 3300044712 | Bacteria | 1082 |
| 956 | Ga0466957_0014629 | 3300044842 | Bacteria | 4571 |
| 957 | Ga0466959_0142724 | 3300045049 | Bacteria | 1691 |
| 958 | Ga0451576_0000056 | 3300045051 | Bacteria | 303398 |
| 959 | Ga0451576_0000919 | 3300045051 | Bacteria | 55733 |
| 960 | Ga0451576_0024090 | 3300045051 | Bacteria | 6577 |
| 961 | Ga0451576_0111401 | 3300045051 | Bacteria | 2848 |
| 962 | Ga0466958_0196272 | 3300045836 | Bacteria | 1284 |
| 963 | Ga0466967_0071219 | 3300045976 | Bacteria | 3112 |
| 964 | Ga0495592_0000493 | 3300046454 | Bacteria | 28774 |
| 965 | Ga0495592_0027393 | 3300046454 | Bacteria | 4321 |
| 966 | Ga0495592_0058610 | 3300046454 | Bacteria | 2839 |
| 967 | Ga0495592_0132347 | 3300046454 | Bacteria | 1743 |
| 968 | Ga0495592_0145179 | 3300046454 | Bacteria | 1646 |
| 969 | Ga0495592_0344353 | 3300046454 | Bacteria | 957 |
| 970 | Ga0495603_0002952 | 3300046455 | Bacteria | 10061 |
| 971 | Ga0495603_0004318 | 3300046455 | Bacteria | 8477 |
| 972 | Ga0495603_0008319 | 3300046455 | Bacteria | 6271 |
| 973 | Ga0495603_0018514 | 3300046455 | Bacteria | 4214 |
| 974 | Ga0495603_0102521 | 3300046455 | Bacteria | 1670 |
| 975 | Ga0495590_0044817 | 3300046457 | Bacteria | 1542 |
| 976 | Ga0495590_0063082 | 3300046457 | Bacteria | 1297 |
| 977 | Ga0495629_0002893 | 3300046459 | Bacteria | 13107 |
| 978 | Ga0495629_0003465 | 3300046459 | Bacteria | 11932 |
| 979 | Ga0495629_0032712 | 3300046459 | Bacteria | 3681 |
| 980 | Ga0495629_0046403 | 3300046459 | Bacteria | 3048 |
| 981 | Ga0495629_0074389 | 3300046459 | Bacteria | 2372 |
| 982 | Ga0495629_0099874 | 3300046459 | Bacteria | 2025 |
| 983 | Ga0495629_0193713 | 3300046459 | Bacteria | 1406 |
| 984 | Ga0495629_0390467 | 3300046459 | Bacteria | 946 |
| 985 | Ga0495638_0011130 | 3300046460 | Bacteria | 6214 |
| 986 | Ga0495638_0151907 | 3300046460 | Bacteria | 1343 |
| 987 | Ga0495641_0002491 | 3300046461 | Bacteria | 14496 |
| 988 | Ga0495641_0217332 | 3300046461 | Bacteria | 857 |
| 989 | Ga0495651_0000364 | 3300046462 | Bacteria | 34831 |
| 990 | Ga0495651_0015118 | 3300046462 | Bacteria | 5965 |
| 991 | Ga0495651_0018706 | 3300046462 | Bacteria | 5367 |
| 992 | Ga0495651_0090272 | 3300046462 | Bacteria | 2298 |
| 993 | Ga0495651_0098904 | 3300046462 | Bacteria | 2176 |
| 994 | Ga0495651_0131710 | 3300046462 | Bacteria | 1824 |
| 995 | Ga0495653_0000398 | 3300046463 | Bacteria | 34931 |
| 996 | Ga0495653_0025322 | 3300046463 | Bacteria | 4771 |
| 997 | Ga0495653_0032960 | 3300046463 | Bacteria | 4108 |
| 998 | Ga0495653_0076978 | 3300046463 | Bacteria | 2478 |
| 999 | Ga0495653_0130834 | 3300046463 | Bacteria | 1777 |
| 1000 | Ga0495653_0155527 | 3300046463 | Bacteria | 1593 |
| 1001 | Ga0495580_0000749 | 3300046472 | Bacteria | 27814 |
| 1002 | Ga0495580_0006621 | 3300046472 | Bacteria | 9413 |
| 1003 | Ga0495580_0072398 | 3300046472 | Bacteria | 2407 |
| 1004 | Ga0495580_0120756 | 3300046472 | Bacteria | 1819 |
| 1005 | Ga0495580_0519254 | 3300046472 | Bacteria | 794 |
| 1006 | Ga0495582_0000038 | 3300046473 | Bacteria | 67536 |
| 1007 | Ga0495582_0104553 | 3300046473 | Bacteria | 1587 |
| 1008 | Ga0495605_0135223 | 3300046474 | Bacteria | 1109 |
| 1009 | Ga0495605_0260953 | 3300046474 | Bacteria | 739 |
| 1010 | Ga0495639_0000092 | 3300046475 | Bacteria | 43860 |
| 1011 | Ga0495639_0014639 | 3300046475 | Bacteria | 3398 |
| 1012 | Ga0495639_0020661 | 3300046475 | Bacteria | 2877 |
| 1013 | Ga0495639_0158744 | 3300046475 | Bacteria | 1094 |
| 1014 | Ga0495662_0002976 | 3300046476 | Bacteria | 8551 |
| 1015 | Ga0495662_0008650 | 3300046476 | Bacteria | 5004 |
| 1016 | Ga0495662_0040962 | 3300046476 | Bacteria | 2236 |
| 1017 | Ga0495662_0340939 | 3300046476 | Bacteria | 737 |
| 1018 | Ga0495664_0000019 | 3300046477 | Bacteria | 153012 |
| 1019 | Ga0495664_0002736 | 3300046477 | Bacteria | 9481 |
| 1020 | Ga0495664_0003467 | 3300046477 | Bacteria | 8586 |
| 1021 | Ga0495664_0008379 | 3300046477 | Bacteria | 5767 |
| 1022 | Ga0495664_0010424 | 3300046477 | Bacteria | 5215 |
| 1023 | Ga0495664_0087932 | 3300046477 | Bacteria | 1867 |
| 1024 | Ga0495664_0278017 | 3300046477 | Bacteria | 1012 |
| 1025 | Ga0495584_0020845 | 3300046491 | Bacteria | 3328 |
| 1026 | Ga0495584_0074952 | 3300046491 | Bacteria | 1701 |
| 1027 | Ga0495585_0030191 | 3300046492 | Bacteria | 3083 |
| 1028 | Ga0495585_0150291 | 3300046492 | Bacteria | 1215 |
| 1029 | Ga0495594_0001994 | 3300046499 | Bacteria | 10639 |
| 1030 | Ga0495594_0161170 | 3300046499 | Bacteria | 1275 |
| 1031 | Ga0495594_0167624 | 3300046499 | Bacteria | 1249 |
| 1032 | Ga0495594_0263434 | 3300046499 | Bacteria | 982 |
| 1033 | Ga0495596_0131316 | 3300046500 | Bacteria | 972 |
| 1034 | Ga0495606_0291294 | 3300046507 | Bacteria | 888 |
| 1035 | Ga0495608_0000026 | 3300046511 | Bacteria | 156234 |
| 1036 | Ga0495608_0040232 | 3300046511 | Bacteria | 3132 |
| 1037 | Ga0495608_0090254 | 3300046511 | Bacteria | 1982 |
| 1038 | Ga0495616_0037108 | 3300046513 | Bacteria | 2509 |
| 1039 | Ga0495616_0193452 | 3300046513 | Bacteria | 898 |
| 1040 | Ga0495618_0000015 | 3300046514 | Bacteria | 152478 |
| 1041 | Ga0495618_0000705 | 3300046514 | Bacteria | 23292 |
| 1042 | Ga0495618_0015933 | 3300046514 | Bacteria | 4589 |
| 1043 | Ga0495618_0038274 | 3300046514 | Bacteria | 3013 |
| 1044 | Ga0495618_0045102 | 3300046514 | Bacteria | 2781 |
| 1045 | Ga0495618_0075820 | 3300046514 | Bacteria | 2142 |
| 1046 | Ga0495620_0038186 | 3300046515 | Bacteria | 2133 |
| 1047 | Ga0495620_0105029 | 3300046515 | Bacteria | 1123 |
| 1048 | Ga0495628_0000006 | 3300046516 | Bacteria | 306606 |
| 1049 | Ga0495628_0074103 | 3300046516 | Bacteria | 2652 |
| 1050 | Ga0495628_0082302 | 3300046516 | Bacteria | 2500 |
| 1051 | Ga0495630_0001838 | 3300046517 | Bacteria | 14813 |
| 1052 | Ga0495630_0004473 | 3300046517 | Bacteria | 9800 |
| 1053 | Ga0495630_0009360 | 3300046517 | Bacteria | 7042 |
| 1054 | Ga0495630_0034189 | 3300046517 | Bacteria | 3794 |
| 1055 | Ga0495630_0042211 | 3300046517 | Bacteria | 3407 |
| 1056 | Ga0495630_0233841 | 3300046517 | Bacteria | 1404 |
| 1057 | Ga0495631_0013380 | 3300046518 | Bacteria | 3983 |
| 1058 | Ga0495631_0044415 | 3300046518 | Bacteria | 1958 |
| 1059 | Ga0495632_0154205 | 3300046519 | Bacteria | 1061 |
| 1060 | Ga0495643_0089309 | 3300046522 | Bacteria | 1592 |
| 1061 | Ga0495644_0016167 | 3300046523 | Bacteria | 2858 |
| 1062 | Ga0495644_0249174 | 3300046523 | Bacteria | 690 |
| 1063 | Ga0495648_0015002 | 3300046524 | Bacteria | 5644 |
| 1064 | Ga0495648_0143397 | 3300046524 | Bacteria | 1254 |
| 1065 | Ga0495648_0152429 | 3300046524 | Bacteria | 1204 |
| 1066 | Ga0495648_0188554 | 3300046524 | Bacteria | 1042 |
| 1067 | Ga0495663_0014873 | 3300046525 | Bacteria | 2186 |
| 1068 | Ga0495666_0006104 | 3300046526 | Bacteria | 6060 |
| 1069 | Ga0495666_0007530 | 3300046526 | Bacteria | 5447 |
| 1070 | Ga0495652_0000030 | 3300046529 | Bacteria | 152921 |
| 1071 | Ga0495652_0019294 | 3300046529 | Bacteria | 6075 |
| 1072 | Ga0495652_0032264 | 3300046529 | Bacteria | 4582 |
| 1073 | Ga0495652_0035784 | 3300046529 | Bacteria | 4320 |
| 1074 | Ga0495652_0252724 | 3300046529 | Bacteria | 1305 |
| 1075 | Ga0495665_0000186 | 3300046531 | Bacteria | 31853 |
| 1076 | Ga0495665_0017149 | 3300046531 | Bacteria | 3896 |
| 1077 | Ga0495665_0036835 | 3300046531 | Bacteria | 2611 |
| 1078 | Ga0495665_0090938 | 3300046531 | Bacteria | 1604 |
| 1079 | Ga0495640_0000246 | 3300046533 | Bacteria | 35995 |
| 1080 | Ga0495640_0001008 | 3300046533 | Bacteria | 21806 |
| 1081 | Ga0495640_0002127 | 3300046533 | Bacteria | 15810 |
| 1082 | Ga0495640_0037739 | 3300046533 | Bacteria | 3404 |
| 1083 | Ga0495640_0060449 | 3300046533 | Bacteria | 2577 |
| 1084 | Ga0495640_0233108 | 3300046533 | Bacteria | 1157 |
| 1085 | Ga0495640_0303996 | 3300046533 | Bacteria | 990 |
| 1086 | Ga0495586_0331955 | 3300046535 | Bacteria | 872 |
| 1087 | Ga0495586_0384130 | 3300046535 | Bacteria | 808 |
| 1088 | Ga0495587_0000021 | 3300046536 | Bacteria | 152895 |
| 1089 | Ga0495587_0144911 | 3300046536 | Bacteria | 1354 |
| 1090 | Ga0495587_0217249 | 3300046536 | Bacteria | 1079 |
| 1091 | Ga0495587_0240169 | 3300046536 | Bacteria | 1020 |
| 1092 | Ga0495598_0002784 | 3300046537 | Bacteria | 3636 |
| 1093 | Ga0495598_0111028 | 3300046537 | Bacteria | 919 |
| 1094 | Ga0495621_0018686 | 3300046539 | Bacteria | 2254 |
| 1095 | Ga0495645_0000001 | 3300046543 | Bacteria | 657910 |
| 1096 | Ga0495645_0019743 | 3300046543 | Bacteria | 4855 |
| 1097 | Ga0495645_0023021 | 3300046543 | Bacteria | 4509 |
| 1098 | Ga0495645_0034293 | 3300046543 | Bacteria | 3703 |
| 1099 | Ga0495645_0156786 | 3300046543 | Bacteria | 1577 |
| 1100 | Ga0495645_0474007 | 3300046543 | Bacteria | 786 |
| 1101 | Ga0495622_0012358 | 3300046557 | Bacteria | 3952 |
| 1102 | Ga0495622_0027174 | 3300046557 | Bacteria | 2670 |
| 1103 | Ga0495622_0066724 | 3300046557 | Bacteria | 1663 |
| 1104 | Ga0495667_0000027 | 3300046559 | Bacteria | 152535 |
| 1105 | Ga0495667_0013545 | 3300046559 | Bacteria | 5516 |
| 1106 | Ga0495667_0117742 | 3300046559 | Bacteria | 1716 |
| 1107 | Ga0495667_0154015 | 3300046559 | Bacteria | 1479 |
| 1108 | Ga0495667_0257268 | 3300046559 | Bacteria | 1111 |
| 1109 | Ga0495656_0003198 | 3300046615 | Bacteria | 5518 |
| 1110 | Ga0495656_0068974 | 3300046615 | Bacteria | 1565 |
| 1111 | Ga0495668_0011373 | 3300046616 | Bacteria | 5334 |
| 1112 | Ga0495668_0015058 | 3300046616 | Bacteria | 4524 |
| 1113 | Ga0495668_0099735 | 3300046616 | Bacteria | 1589 |
| 1114 | Ga0495634_0000008 | 3300046642 | Bacteria | 163983 |
| 1115 | Ga0495634_0000706 | 3300046642 | Bacteria | 32394 |
| 1116 | Ga0495634_0015350 | 3300046642 | Bacteria | 5505 |
| 1117 | Ga0495634_0021107 | 3300046642 | Bacteria | 4610 |
| 1118 | Ga0495634_0023535 | 3300046642 | Bacteria | 4327 |
| 1119 | Ga0495611_0012542 | 3300046648 | Bacteria | 3603 |
| 1120 | Ga0495625_0050870 | 3300046660 | Bacteria | 2971 |
| 1121 | Ga0495625_0081568 | 3300046660 | Bacteria | 2251 |
| 1122 | Ga0495625_0245777 | 3300046660 | Bacteria | 1163 |
| 1123 | Ga0495635_0000028 | 3300046663 | Bacteria | 121669 |
| 1124 | Ga0495635_0002553 | 3300046663 | Bacteria | 12464 |
| 1125 | Ga0495635_0012050 | 3300046663 | Bacteria | 6061 |
| 1126 | Ga0495635_0022409 | 3300046663 | Bacteria | 4398 |
| 1127 | Ga0495635_0039315 | 3300046663 | Bacteria | 3272 |
| 1128 | Ga0495635_0061392 | 3300046663 | Bacteria | 2582 |
| 1129 | Ga0495635_0103202 | 3300046663 | Bacteria | 1949 |
| 1130 | Ga0495635_0163069 | 3300046663 | Bacteria | 1517 |
| 1131 | Ga0495659_0033429 | 3300046664 | Bacteria | 1805 |
| 1132 | Ga0495661_0034000 | 3300046665 | Bacteria | 3211 |
| 1133 | Ga0495588_0003404 | 3300046674 | Bacteria | 6912 |
| 1134 | Ga0495588_0113239 | 3300046674 | Bacteria | 1429 |
| 1135 | Ga0495588_0231807 | 3300046674 | Bacteria | 974 |
| 1136 | Ga0495588_0246739 | 3300046674 | Bacteria | 942 |
| 1137 | Ga0495657_0004008 | 3300046675 | Bacteria | 11813 |
| 1138 | Ga0495657_0031662 | 3300046675 | Bacteria | 3695 |
| 1139 | Ga0495657_0305561 | 3300046675 | Bacteria | 948 |
| 1140 | Ga0495599_0000232 | 3300046678 | Bacteria | 34997 |
| 1141 | Ga0495599_0044273 | 3300046678 | Bacteria | 2791 |
| 1142 | Ga0495623_0000448 | 3300046679 | Bacteria | 27077 |
| 1143 | Ga0495623_0098569 | 3300046679 | Bacteria | 1783 |
| 1144 | Ga0495623_0128708 | 3300046679 | Bacteria | 1518 |
| 1145 | Ga0495646_0000148 | 3300046680 | Bacteria | 35382 |
| 1146 | Ga0495646_0032422 | 3300046680 | Bacteria | 3251 |
| 1147 | Ga0495646_0122361 | 3300046680 | Bacteria | 1471 |
| 1148 | Ga0495646_0161842 | 3300046680 | Bacteria | 1238 |
| 1149 | Ga0495646_0377122 | 3300046680 | Bacteria | 740 |
| 1150 | Ga0495647_0000203 | 3300046681 | Bacteria | 16019 |
| 1151 | Ga0495647_0008947 | 3300046681 | Bacteria | 3377 |
| 1152 | Ga0495647_0047420 | 3300046681 | Bacteria | 1658 |
| 1153 | Ga0495647_0238845 | 3300046681 | Bacteria | 806 |
| 1154 | Ga0495658_0001537 | 3300046683 | Bacteria | 12092 |
| 1155 | Ga0495658_0015719 | 3300046683 | Bacteria | 3886 |
| 1156 | Ga0495658_0016381 | 3300046683 | Bacteria | 3816 |
| 1157 | Ga0495658_0056336 | 3300046683 | Bacteria | 2242 |
| 1158 | Ga0495658_0065199 | 3300046683 | Bacteria | 2101 |
| 1159 | Ga0495669_0009514 | 3300046684 | Bacteria | 4099 |
| 1160 | Ga0495669_0282784 | 3300046684 | Bacteria | 798 |
| 1161 | Ga0495613_0017873 | 3300046689 | Bacteria | 5286 |
| 1162 | Ga0495613_0022543 | 3300046689 | Bacteria | 4690 |
| 1163 | Ga0495613_0079448 | 3300046689 | Bacteria | 2385 |
| 1164 | Ga0495613_0120984 | 3300046689 | Bacteria | 1880 |
| 1165 | Ga0495613_0121448 | 3300046689 | Bacteria | 1876 |
| 1166 | Ga0495613_0190890 | 3300046689 | Bacteria | 1448 |
| 1167 | Ga0495613_0198031 | 3300046689 | Bacteria | 1417 |
| 1168 | Ga0495613_0538409 | 3300046689 | Bacteria | 783 |
| 1169 | Ga0495624_0001987 | 3300046690 | Bacteria | 15598 |
| 1170 | Ga0495624_0018144 | 3300046690 | Bacteria | 4708 |
| 1171 | Ga0495624_0029729 | 3300046690 | Bacteria | 3563 |
| 1172 | Ga0495624_0044550 | 3300046690 | Bacteria | 2828 |
| 1173 | Ga0495624_0063304 | 3300046690 | Bacteria | 2312 |
| 1174 | Ga0495624_0327486 | 3300046690 | Bacteria | 922 |
| 1175 | Ga0495670_0003950 | 3300046691 | Bacteria | 7281 |
| 1176 | Ga0495670_0022339 | 3300046691 | Bacteria | 3124 |
| 1177 | Ga0495670_0201466 | 3300046691 | Bacteria | 1054 |
| 1178 | Ga0495670_0313003 | 3300046691 | Bacteria | 842 |
| 1179 | Ga0495671_0067264 | 3300046692 | Bacteria | 1762 |
| 1180 | Ga0495671_0186494 | 3300046692 | Bacteria | 1007 |
| 1181 | Ga0495649_0127772 | 3300046694 | Bacteria | 1342 |
| 1182 | Ga0495649_0284314 | 3300046694 | Bacteria | 845 |
| 1183 | Ga0495589_0057399 | 3300046794 | Bacteria | 1915 |
| 1184 | Ga0495589_0097600 | 3300046794 | Bacteria | 1423 |
| 1185 | Ga0495600_0000195 | 3300046809 | Bacteria | 35017 |
| 1186 | Ga0495600_0002506 | 3300046809 | Bacteria | 10545 |
| 1187 | Ga0495600_0020494 | 3300046809 | Bacteria | 4228 |
| 1188 | Ga0495600_0025066 | 3300046809 | Bacteria | 3843 |
| 1189 | Ga0495600_0059898 | 3300046809 | Bacteria | 2486 |
| 1190 | Ga0495600_0163254 | 3300046809 | Bacteria | 1439 |
| 1191 | Ga0495660_0311530 | 3300046810 | Bacteria | 710 |
| 1192 | Ga0495581_0000019 | 3300047315 | Bacteria | 57810 |
| 1193 | Ga0495581_0013871 | 3300047315 | Bacteria | 4671 |
| 1194 | Ga0495581_0088455 | 3300047315 | Bacteria | 1796 |
| 1195 | Ga0495581_0157969 | 3300047315 | Bacteria | 1325 |
| 1196 | Ga0495581_0175987 | 3300047315 | Bacteria | 1251 |
| 1197 | Ga0495581_0183224 | 3300047315 | Bacteria | 1225 |
| 1198 | Ga0495581_0263521 | 3300047315 | Bacteria | 1008 |
| 1199 | Ga0495581_0319024 | 3300047315 | Bacteria | 908 |
| 1200 | Ga0495604_0000002 | 3300047317 | Bacteria | 530904 |
| 1201 | Ga0495604_0009212 | 3300047317 | Bacteria | 7815 |
| 1202 | Ga0495604_0034714 | 3300047317 | Bacteria | 3989 |
| 1203 | Ga0495604_0079171 | 3300047317 | Bacteria | 2465 |
| 1204 | Ga0495604_0085241 | 3300047317 | Bacteria | 2358 |
| 1205 | Ga0495604_0276700 | 3300047317 | Bacteria | 1135 |
| 1206 | Ga0495636_0034181 | 3300047318 | Bacteria | 2091 |
| 1207 | Ga0495674_0000004 | 3300047319 | Bacteria | 531855 |
| 1208 | Ga0495674_0003455 | 3300047319 | Bacteria | 15353 |
| 1209 | Ga0495674_0048516 | 3300047319 | Bacteria | 3757 |
| 1210 | Ga0495674_0168307 | 3300047319 | Bacteria | 1830 |
| 1211 | Ga0495674_0270718 | 3300047319 | Bacteria | 1393 |
| 1212 | Ga0495674_0290211 | 3300047319 | Bacteria | 1338 |
| 1213 | Ga0495672_0149882 | 3300047320 | Bacteria | 1210 |
| 1214 | Ga0495672_0171915 | 3300047320 | Bacteria | 1104 |
| 1215 | Ga0495676_0020934 | 3300047321 | Bacteria | 5726 |
| 1216 | Ga0495676_0048740 | 3300047321 | Bacteria | 3412 |
| 1217 | Ga0495676_0078890 | 3300047321 | Bacteria | 2505 |
| 1218 | Ga0495676_0095015 | 3300047321 | Bacteria | 2219 |
| 1219 | Ga0495676_0298644 | 3300047321 | Bacteria | 1087 |
| 1220 | Ga0495680_0001465 | 3300047322 | Bacteria | 25478 |
| 1221 | Ga0495680_0003584 | 3300047322 | Bacteria | 15203 |
| 1222 | Ga0495680_0015898 | 3300047322 | Bacteria | 6478 |
| 1223 | Ga0495680_0033269 | 3300047322 | Bacteria | 4175 |
| 1224 | Ga0495680_0035652 | 3300047322 | Bacteria | 4005 |
| 1225 | Ga0495680_0081665 | 3300047322 | Bacteria | 2440 |
| 1226 | Ga0495680_0305013 | 3300047322 | Bacteria | 1117 |
| 1227 | Ga0495683_0023073 | 3300047323 | Bacteria | 3199 |
| 1228 | Ga0495675_0000351 | 3300047444 | Bacteria | 32308 |
| 1229 | Ga0495675_0020965 | 3300047444 | Bacteria | 4160 |
| 1230 | Ga0495675_0124763 | 3300047444 | Bacteria | 1602 |
| 1231 | Ga0495675_0157773 | 3300047444 | Bacteria | 1398 |
| 1232 | Ga0495677_0014595 | 3300047445 | Bacteria | 2858 |
| 1233 | Ga0495677_0015227 | 3300047445 | Bacteria | 2795 |
| 1234 | Ga0495677_0141474 | 3300047445 | Bacteria | 924 |
| 1235 | Ga0495679_039674 | 3300047446 | Bacteria | 1467 |
| 1236 | Ga0495685_124816 | 3300047447 | Bacteria | 844 |
| 1237 | Ga0495673_0013698 | 3300047469 | Bacteria | 4246 |
| 1238 | Ga0495673_0018331 | 3300047469 | Bacteria | 3531 |
| 1239 | Ga0495673_0162883 | 3300047469 | Bacteria | 855 |
| 1240 | Ga0495684_0000004 | 3300047471 | Bacteria | 307093 |
| 1241 | Ga0495684_0002699 | 3300047471 | Bacteria | 14047 |
| 1242 | Ga0495684_0006327 | 3300047471 | Bacteria | 9203 |
| 1243 | Ga0495684_0011826 | 3300047471 | Bacteria | 6733 |
| 1244 | Ga0495684_0026662 | 3300047471 | Bacteria | 4440 |
| 1245 | Ga0495684_0148165 | 3300047471 | Bacteria | 1756 |
| 1246 | Ga0495684_0251155 | 3300047471 | Bacteria | 1287 |
| 1247 | Ga0495686_0074432 | 3300047472 | Bacteria | 2084 |
| 1248 | Ga0495686_0140297 | 3300047472 | Bacteria | 1426 |
| 1249 | Ga0495593_0000250 | 3300047673 | Bacteria | 29194 |
| 1250 | Ga0495593_0007024 | 3300047673 | Bacteria | 6602 |
| 1251 | Ga0495593_0031371 | 3300047673 | Bacteria | 2903 |
| 1252 | Ga0495593_0039653 | 3300047673 | Bacteria | 2538 |
| 1253 | Ga0495593_0083810 | 3300047673 | Bacteria | 1646 |
| 1254 | Ga0495593_0188875 | 3300047673 | Bacteria | 1037 |
| 1255 | Ga0495602_0000001 | 3300048088 | Bacteria | 510904 |
| 1256 | Ga0495602_0015663 | 3300048088 | Bacteria | 7642 |
| 1257 | Ga0495602_0039711 | 3300048088 | Bacteria | 4329 |
| 1258 | Ga0495602_0488502 | 3300048088 | Bacteria | 863 |
| 1259 | Ga0495614_0084919 | 3300048089 | Bacteria | 1374 |
| 1260 | Ga0495626_0058422 | 3300048091 | Bacteria | 1762 |
| 1261 | Ga0496100_0000842 | 3300048903 | Bacteria | 14711 |
| 1262 | Ga0496100_0025238 | 3300048903 | Bacteria | 3633 |
| 1263 | Ga0496100_0046119 | 3300048903 | Bacteria | 2800 |
| 1264 | Ga0496100_0310976 | 3300048903 | Bacteria | 1181 |
| 1265 | Ga0496100_0392737 | 3300048903 | Bacteria | 1055 |
| 1266 | Ga0496100_0403206 | 3300048903 | Bacteria | 1042 |
| 1267 | Ga0496100_0532549 | 3300048903 | Bacteria | 907 |
| 1268 | Ga0496100_0584448 | 3300048903 | Bacteria | 866 |
| 1269 | Ga0496100_0709386 | 3300048903 | Bacteria | 785 |
| 1270 | Ga0496101_0001211 | 3300048904 | Bacteria | 15442 |
| 1271 | Ga0496101_0010196 | 3300048904 | Bacteria | 6200 |
| 1272 | Ga0496101_0032129 | 3300048904 | Bacteria | 3693 |
| 1273 | Ga0496101_0037494 | 3300048904 | Bacteria | 3439 |
| 1274 | Ga0496101_0051165 | 3300048904 | Bacteria | 2976 |
| 1275 | Ga0496101_0060112 | 3300048904 | Bacteria | 2757 |
| 1276 | Ga0496101_0183719 | 3300048904 | Bacteria | 1611 |
| 1277 | Ga0496101_0201052 | 3300048904 | Bacteria | 1540 |
| 1278 | Ga0496101_0233004 | 3300048904 | Bacteria | 1432 |
| 1279 | Ga0496101_0542824 | 3300048904 | Bacteria | 919 |
| 1280 | Ga0496102_0000617 | 3300048905 | Bacteria | 36855 |
| 1281 | Ga0496102_0011697 | 3300048905 | Bacteria | 7572 |
| 1282 | Ga0496102_0028987 | 3300048905 | Bacteria | 4948 |
| 1283 | Ga0496102_0029422 | 3300048905 | Bacteria | 4915 |
| 1284 | Ga0496102_0068983 | 3300048905 | Bacteria | 3245 |
| 1285 | Ga0496102_0093582 | 3300048905 | Bacteria | 2784 |
| 1286 | Ga0496102_0310052 | 3300048905 | Bacteria | 1487 |
| 1287 | Ga0496102_0463740 | 3300048905 | Bacteria | 1188 |
| 1288 | Ga0496103_0007489 | 3300048906 | Bacteria | 6505 |
| 1289 | Ga0496103_0010791 | 3300048906 | Bacteria | 5406 |
| 1290 | Ga0496103_0010836 | 3300048906 | Bacteria | 5396 |
| 1291 | Ga0496103_0032320 | 3300048906 | Bacteria | 3193 |
| 1292 | Ga0496103_0035956 | 3300048906 | Bacteria | 3032 |
| 1293 | Ga0496103_0126230 | 3300048906 | Bacteria | 1632 |
| 1294 | Ga0496104_0000538 | 3300048907 | Bacteria | 32550 |
| 1295 | Ga0496104_0000602 | 3300048907 | Bacteria | 30848 |
| 1296 | Ga0496104_0001834 | 3300048907 | Bacteria | 18376 |
| 1297 | Ga0496104_0006005 | 3300048907 | Bacteria | 10645 |
| 1298 | Ga0496104_0011586 | 3300048907 | Bacteria | 7903 |
| 1299 | Ga0496104_0022907 | 3300048907 | Bacteria | 5739 |
| 1300 | Ga0496104_0023409 | 3300048907 | Bacteria | 5679 |
| 1301 | Ga0496104_0030685 | 3300048907 | Bacteria | 4996 |
| 1302 | Ga0496104_0033068 | 3300048907 | Bacteria | 4814 |
| 1303 | Ga0496104_0046946 | 3300048907 | Bacteria | 4069 |
| 1304 | Ga0496104_0170737 | 3300048907 | Bacteria | 2085 |
| 1305 | Ga0496104_0245800 | 3300048907 | Bacteria | 1702 |
| 1306 | Ga0496104_0276427 | 3300048907 | Bacteria | 1592 |
| 1307 | Ga0496105_0002373 | 3300048908 | Bacteria | 13644 |
| 1308 | Ga0496105_0004135 | 3300048908 | Bacteria | 10885 |
| 1309 | Ga0496105_0022659 | 3300048908 | Bacteria | 5088 |
| 1310 | Ga0496105_0026177 | 3300048908 | Bacteria | 4755 |
| 1311 | Ga0496105_0050267 | 3300048908 | Bacteria | 3443 |
| 1312 | Ga0496105_0054388 | 3300048908 | Bacteria | 3305 |
| 1313 | Ga0496105_0078540 | 3300048908 | Bacteria | 2725 |
| 1314 | Ga0496105_0176113 | 3300048908 | Bacteria | 1752 |
| 1315 | Ga0496105_0226816 | 3300048908 | Bacteria | 1519 |
| 1316 | Ga0496105_0295102 | 3300048908 | Bacteria | 1304 |
| 1317 | Ga0496105_0506829 | 3300048908 | Bacteria | 947 |
| 1318 | Ga0496105_0549099 | 3300048908 | Bacteria | 902 |
| 1319 | Ga0496105_0792354 | 3300048908 | Bacteria | 721 |
| 1320 | Ga0496106_0000405 | 3300048909 | Bacteria | 30644 |
| 1321 | Ga0496106_0013666 | 3300048909 | Bacteria | 5994 |
| 1322 | Ga0496106_0026406 | 3300048909 | Bacteria | 4325 |
| 1323 | Ga0496106_0036756 | 3300048909 | Bacteria | 3663 |
| 1324 | Ga0496106_0070055 | 3300048909 | Bacteria | 2678 |
| 1325 | Ga0496106_0092378 | 3300048909 | Bacteria | 2337 |
| 1326 | Ga0496106_0347998 | 3300048909 | Bacteria | 1190 |
| 1327 | Ga0496107_0001082 | 3300048910 | Bacteria | 16345 |
| 1328 | Ga0496107_0001145 | 3300048910 | Bacteria | 16048 |
| 1329 | Ga0496107_0030443 | 3300048910 | Bacteria | 3847 |
| 1330 | Ga0496107_0046438 | 3300048910 | Bacteria | 3126 |
| 1331 | Ga0496107_0154833 | 3300048910 | Bacteria | 1696 |
| 1332 | Ga0496107_0170673 | 3300048910 | Bacteria | 1614 |
| 1333 | Ga0496107_0271152 | 3300048910 | Bacteria | 1263 |
| 1334 | Ga0496108_0001230 | 3300048911 | Bacteria | 20080 |
| 1335 | Ga0496108_0003869 | 3300048911 | Bacteria | 12021 |
| 1336 | Ga0496108_0012570 | 3300048911 | Bacteria | 6896 |
| 1337 | Ga0496108_0014737 | 3300048911 | Bacteria | 6380 |
| 1338 | Ga0496108_0021443 | 3300048911 | Bacteria | 5311 |
| 1339 | Ga0496108_0029580 | 3300048911 | Bacteria | 4538 |
| 1340 | Ga0496108_0034009 | 3300048911 | Bacteria | 4233 |
| 1341 | Ga0496108_0183347 | 3300048911 | Bacteria | 1813 |
| 1342 | Ga0496108_0238341 | 3300048911 | Bacteria | 1582 |
| 1343 | Ga0496108_0378507 | 3300048911 | Bacteria | 1236 |
| 1344 | Ga0496108_0572736 | 3300048911 | Bacteria | 984 |
| 1345 | Ga0496109_0002911 | 3300048912 | Bacteria | 14299 |
| 1346 | Ga0496109_0004441 | 3300048912 | Bacteria | 11714 |
| 1347 | Ga0496109_0006129 | 3300048912 | Bacteria | 10104 |
| 1348 | Ga0496109_0006276 | 3300048912 | Bacteria | 10002 |
| 1349 | Ga0496109_0008231 | 3300048912 | Bacteria | 8852 |
| 1350 | Ga0496109_0052215 | 3300048912 | Bacteria | 3725 |
| 1351 | Ga0496109_0096114 | 3300048912 | Bacteria | 2744 |
| 1352 | Ga0496109_0107547 | 3300048912 | Bacteria | 2591 |
| 1353 | Ga0496109_0123808 | 3300048912 | Bacteria | 2410 |
| 1354 | Ga0496109_0312075 | 3300048912 | Bacteria | 1484 |
| 1355 | Ga0496109_0316444 | 3300048912 | Bacteria | 1473 |
| 1356 | Ga0496109_0613669 | 3300048912 | Bacteria | 1024 |
| 1357 | Ga0496109_0905120 | 3300048912 | Bacteria | 820 |
| 1358 | Ga0496110_0000468 | 3300048913 | Bacteria | 27460 |
| 1359 | Ga0496110_0017492 | 3300048913 | Bacteria | 5998 |
| 1360 | Ga0496110_0019783 | 3300048913 | Bacteria | 5672 |
| 1361 | Ga0496110_0032199 | 3300048913 | Bacteria | 4526 |
| 1362 | Ga0496110_0035095 | 3300048913 | Bacteria | 4349 |
| 1363 | Ga0496110_0075221 | 3300048913 | Bacteria | 3000 |
| 1364 | Ga0496110_0093168 | 3300048913 | Bacteria | 2696 |
| 1365 | Ga0496110_0102346 | 3300048913 | Bacteria | 2568 |
| 1366 | Ga0496110_0131034 | 3300048913 | Bacteria | 2264 |
| 1367 | Ga0496110_0151100 | 3300048913 | Bacteria | 2103 |
| 1368 | Ga0496110_0177650 | 3300048913 | Bacteria | 1933 |
| 1369 | Ga0496110_0217966 | 3300048913 | Bacteria | 1735 |
| 1370 | Ga0496110_0257669 | 3300048913 | Bacteria | 1588 |
| 1371 | Ga0496111_0001165 | 3300048914 | Bacteria | 14618 |
| 1372 | Ga0496111_0001714 | 3300048914 | Bacteria | 12814 |
| 1373 | Ga0496111_0004338 | 3300048914 | Bacteria | 8949 |
| 1374 | Ga0496111_0036936 | 3300048914 | Bacteria | 3494 |
| 1375 | Ga0496111_0086310 | 3300048914 | Bacteria | 2296 |
| 1376 | Ga0496111_0117006 | 3300048914 | Bacteria | 1966 |
| 1377 | Ga0496111_0243138 | 3300048914 | Bacteria | 1336 |
| 1378 | Ga0496112_0000014 | 3300048915 | Bacteria | 210932 |
| 1379 | Ga0496112_0000527 | 3300048915 | Bacteria | 26121 |
| 1380 | Ga0496112_0003749 | 3300048915 | Bacteria | 12694 |
| 1381 | Ga0496112_0011543 | 3300048915 | Bacteria | 8074 |
| 1382 | Ga0496112_0012163 | 3300048915 | Bacteria | 7899 |
| 1383 | Ga0496112_0038471 | 3300048915 | Bacteria | 4671 |
| 1384 | Ga0496112_0070265 | 3300048915 | Bacteria | 3460 |
| 1385 | Ga0496112_0089626 | 3300048915 | Bacteria | 3044 |
| 1386 | Ga0496112_0092100 | 3300048915 | Bacteria | 3000 |
| 1387 | Ga0496112_0113744 | 3300048915 | Bacteria | 2677 |
| 1388 | Ga0496112_0189750 | 3300048915 | Bacteria | 2017 |
| 1389 | Ga0496112_0279636 | 3300048915 | Bacteria | 1616 |
| 1390 | Ga0496112_0473916 | 3300048915 | Bacteria | 1189 |
| 1391 | Ga0496113_0001893 | 3300048916 | Bacteria | 11943 |
| 1392 | Ga0496113_0003961 | 3300048916 | Bacteria | 8995 |
| 1393 | Ga0496113_0010110 | 3300048916 | Bacteria | 6224 |
| 1394 | Ga0496113_0037525 | 3300048916 | Bacteria | 3557 |
| 1395 | Ga0496113_0055397 | 3300048916 | Bacteria | 2972 |
| 1396 | Ga0496113_0164171 | 3300048916 | Bacteria | 1757 |
| 1397 | Ga0496113_0192022 | 3300048916 | Bacteria | 1621 |
| 1398 | Ga0496114_0084167 | 3300048917 | Bacteria | 2693 |
| 1399 | Ga0496114_0097669 | 3300048917 | Bacteria | 2503 |
| 1400 | Ga0496114_0104086 | 3300048917 | Bacteria | 2427 |
| 1401 | Ga0496114_0125366 | 3300048917 | Bacteria | 2213 |
| 1402 | Ga0496114_0150849 | 3300048917 | Bacteria | 2016 |
| 1403 | Ga0496114_0252240 | 3300048917 | Bacteria | 1553 |
| 1404 | Ga0496114_0311775 | 3300048917 | Bacteria | 1390 |
| 1405 | Ga0496114_0673136 | 3300048917 | Bacteria | 909 |
| 1406 | Ga0496115_0006200 | 3300048918 | Bacteria | 8746 |
| 1407 | Ga0496115_0021274 | 3300048918 | Bacteria | 5009 |
| 1408 | Ga0496115_0069948 | 3300048918 | Bacteria | 2844 |
| 1409 | Ga0496115_0073218 | 3300048918 | Bacteria | 2780 |
| 1410 | Ga0496115_0117378 | 3300048918 | Bacteria | 2189 |
| 1411 | Ga0496115_0193467 | 3300048918 | Bacteria | 1680 |
| 1412 | Ga0496115_0201937 | 3300048918 | Bacteria | 1642 |
| 1413 | Ga0496115_0220417 | 3300048918 | Bacteria | 1565 |
| 1414 | Ga0496115_0220700 | 3300048918 | Bacteria | 1564 |
| 1415 | Ga0496115_0223030 | 3300048918 | Bacteria | 1556 |
| 1416 | Ga0496115_0231694 | 3300048918 | Bacteria | 1523 |
| 1417 | Ga0496115_0330050 | 3300048918 | Bacteria | 1246 |
| 1418 | Ga0496115_0477846 | 3300048918 | Bacteria | 1004 |
| 1419 | Ga0496115_0642331 | 3300048918 | Bacteria | 840 |
| 1420 | Ga0496116_0069466 | 3300048919 | Bacteria | 2239 |
| 1421 | Ga0496117_0001758 | 3300048920 | Bacteria | 29816 |
| 1422 | Ga0496117_0076566 | 3300048920 | Bacteria | 2218 |
| 1423 | Ga0496117_0100245 | 3300048920 | Bacteria | 1835 |
| 1424 | Ga0496118_0017789 | 3300048921 | Bacteria | 6452 |
| 1425 | Ga0496118_0081995 | 3300048921 | Bacteria | 2262 |
| 1426 | Ga0496118_0111000 | 3300048921 | Bacteria | 1819 |
| 1427 | Ga0496119_0018215 | 3300048922 | Bacteria | 5243 |
| 1428 | Ga0496120_0006082 | 3300048923 | Bacteria | 9373 |
| 1429 | Ga0496121_0000283 | 3300048924 | Bacteria | 105735 |
| 1430 | Ga0496121_0023892 | 3300048924 | Bacteria | 5864 |
| 1431 | Ga0496121_0054093 | 3300048924 | Bacteria | 3357 |
| 1432 | Ga0496121_0057138 | 3300048924 | Bacteria | 3236 |
| 1433 | Ga0496121_0060601 | 3300048924 | Bacteria | 3112 |
| 1434 | Ga0496121_0097563 | 3300048924 | Bacteria | 2277 |
| 1435 | Ga0496121_0128993 | 3300048924 | Bacteria | 1896 |
| 1436 | Ga0496121_0190012 | 3300048924 | Bacteria | 1473 |
| 1437 | Ga0496121_0218313 | 3300048924 | Bacteria | 1345 |
| 1438 | Ga0496122_0077145 | 3300048925 | Bacteria | 2342 |
| 1439 | Ga0496124_0065553 | 3300048927 | Bacteria | 3028 |
| 1440 | Ga0496124_0076754 | 3300048927 | Bacteria | 2757 |
| 1441 | Ga0496124_0114179 | 3300048927 | Bacteria | 2169 |
| 1442 | Ga0496124_0130174 | 3300048927 | Bacteria | 2000 |
| 1443 | Ga0496125_0019849 | 3300048928 | Bacteria | 6323 |
| 1444 | Ga0496125_0030819 | 3300048928 | Bacteria | 4790 |
| 1445 | Ga0496125_0043700 | 3300048928 | Bacteria | 3798 |
| 1446 | Ga0496126_0129226 | 3300048929 | Bacteria | 2184 |
| 1447 | Ga0496126_0145419 | 3300048929 | Bacteria | 2036 |
| 1448 | Ga0496126_0170067 | 3300048929 | Bacteria | 1857 |
| 1449 | Ga0495682_0087690 | 3300049460 | Bacteria | 1118 |
| 1450 | Ga0501031_0026174 | 3300049568 | Bacteria | 3805 |
| 1451 | Ga0501031_0499363 | 3300049568 | Bacteria | 785 |
| 1452 | Ga0501032_0092511 | 3300049569 | Bacteria | 2006 |
| 1453 | Ga0501032_0448186 | 3300049569 | Bacteria | 827 |
| 1454 | Ga0501033_0046869 | 3300049570 | Bacteria | 3214 |
| 1455 | Ga0501033_0120574 | 3300049570 | Bacteria | 1904 |
| 1456 | Ga0501033_0551945 | 3300049570 | Bacteria | 793 |
| 1457 | Ga0501034_0035866 | 3300049571 | Bacteria | 5028 |
| 1458 | Ga0501034_0318667 | 3300049571 | Bacteria | 1488 |
| 1459 | Ga0501036_0002481 | 3300049572 | Bacteria | 14464 |
| 1460 | Ga0501036_0058938 | 3300049572 | Bacteria | 3253 |
| 1461 | Ga0501036_0364868 | 3300049572 | Bacteria | 1206 |
| 1462 | Ga0501037_0023005 | 3300049573 | Bacteria | 4609 |
| 1463 | Ga0501037_0057904 | 3300049573 | Bacteria | 2828 |
| 1464 | Ga0501038_0011597 | 3300049574 | Bacteria | 8041 |
| 1465 | Ga0501038_0043917 | 3300049574 | Bacteria | 3885 |
| 1466 | Ga0501038_0090782 | 3300049574 | Bacteria | 2560 |
| 1467 | Ga0501038_0164254 | 3300049574 | Bacteria | 1802 |
| 1468 | Ga0501039_0021356 | 3300049575 | Bacteria | 4967 |
| 1469 | Ga0501039_0208491 | 3300049575 | Bacteria | 1537 |
| 1470 | Ga0501040_0009859 | 3300049576 | Bacteria | 6238 |
| 1471 | Ga0501040_0077664 | 3300049576 | Bacteria | 2297 |
| 1472 | Ga0501040_0188368 | 3300049576 | Bacteria | 1464 |
| 1473 | Ga0501040_0225898 | 3300049576 | Bacteria | 1332 |
| 1474 | Ga0501041_0014421 | 3300049577 | Bacteria | 4693 |
| 1475 | Ga0501041_0032605 | 3300049577 | Bacteria | 3148 |
| 1476 | Ga0501041_0153040 | 3300049577 | Bacteria | 1440 |
| 1477 | Ga0501042_0005234 | 3300049578 | Bacteria | 8334 |
| 1478 | Ga0501042_0037155 | 3300049578 | Bacteria | 3456 |
| 1479 | Ga0501042_0099205 | 3300049578 | Bacteria | 2094 |
| 1480 | Ga0501042_0277750 | 3300049578 | Bacteria | 1210 |
| 1481 | Ga0501042_0283153 | 3300049578 | Bacteria | 1197 |
| 1482 | Ga0501042_0489477 | 3300049578 | Bacteria | 893 |
| 1483 | Ga0501043_0013428 | 3300049579 | Bacteria | 6406 |
| 1484 | Ga0501043_0080598 | 3300049579 | Bacteria | 2558 |
| 1485 | Ga0501046_0014699 | 3300049580 | Bacteria | 6592 |
| 1486 | Ga0501046_0019015 | 3300049580 | Bacteria | 5702 |
| 1487 | Ga0501046_0025386 | 3300049580 | Bacteria | 4850 |
| 1488 | Ga0501046_0216313 | 3300049580 | Bacteria | 1421 |
| 1489 | Ga0501046_0255288 | 3300049580 | Bacteria | 1289 |
| 1490 | Ga0501047_0089977 | 3300049581 | Bacteria | 2946 |
| 1491 | Ga0501047_0096900 | 3300049581 | Bacteria | 2828 |
| 1492 | Ga0501047_0343159 | 3300049581 | Bacteria | 1331 |
| 1493 | Ga0501048_0006475 | 3300049582 | Bacteria | 8902 |
| 1494 | Ga0501048_0094232 | 3300049582 | Bacteria | 2112 |
| 1495 | Ga0501048_0228067 | 3300049582 | Bacteria | 1322 |
| 1496 | Ga0501048_0719108 | 3300049582 | Bacteria | 717 |
| 1497 | Ga0501067_0035095 | 3300049583 | Bacteria | 2784 |
| 1498 | Ga0501068_0031554 | 3300049584 | Bacteria | 3147 |
| 1499 | Ga0501068_0076309 | 3300049584 | Bacteria | 2051 |
| 1500 | Ga0501069_0060890 | 3300049585 | Bacteria | 2108 |
| 1501 | Ga0501069_0148389 | 3300049585 | Bacteria | 1347 |
| 1502 | Ga0501070_0021833 | 3300049586 | Bacteria | 5364 |
| 1503 | Ga0501070_0206954 | 3300049586 | Bacteria | 1611 |
| 1504 | Ga0501070_0213456 | 3300049586 | Bacteria | 1583 |
| 1505 | Ga0501070_0235098 | 3300049586 | Bacteria | 1501 |
| 1506 | Ga0501070_0245273 | 3300049586 | Bacteria | 1466 |
| 1507 | Ga0501070_0250744 | 3300049586 | Bacteria | 1448 |
| 1508 | Ga0501071_0051680 | 3300049587 | Bacteria | 2963 |
| 1509 | Ga0501071_0339764 | 3300049587 | Bacteria | 1142 |
| 1510 | Ga0501071_0458531 | 3300049587 | Bacteria | 976 |
| 1511 | Ga0501072_0001512 | 3300049588 | Bacteria | 17432 |
| 1512 | Ga0501072_0013914 | 3300049588 | Bacteria | 6166 |
| 1513 | Ga0501072_0042411 | 3300049588 | Bacteria | 3574 |
| 1514 | Ga0501072_0065633 | 3300049588 | Bacteria | 2862 |
| 1515 | Ga0501072_0095047 | 3300049588 | Bacteria | 2368 |
| 1516 | Ga0501072_0160351 | 3300049588 | Bacteria | 1794 |
| 1517 | Ga0501072_0716275 | 3300049588 | Bacteria | 786 |
| 1518 | Ga0501073_0005592 | 3300049589 | Bacteria | 9404 |
| 1519 | Ga0501073_0019034 | 3300049589 | Bacteria | 4962 |
| 1520 | Ga0501073_0184961 | 3300049589 | Bacteria | 1442 |
| 1521 | Ga0501073_0226023 | 3300049589 | Bacteria | 1293 |
| 1522 | Ga0501073_0238326 | 3300049589 | Bacteria | 1256 |
| 1523 | Ga0501073_0296907 | 3300049589 | Bacteria | 1115 |
| 1524 | Ga0501074_0027303 | 3300049590 | Bacteria | 4139 |
| 1525 | Ga0501074_0043753 | 3300049590 | Bacteria | 3241 |
| 1526 | Ga0501074_0464979 | 3300049590 | Bacteria | 897 |
| 1527 | Ga0501074_0724765 | 3300049590 | Bacteria | 701 |
| 1528 | Ga0501075_0160035 | 3300049591 | Bacteria | 1717 |
| 1529 | Ga0501075_0219008 | 3300049591 | Bacteria | 1452 |
| 1530 | Ga0501075_0467879 | 3300049591 | Bacteria | 961 |
| 1531 | Ga0501076_0026862 | 3300049592 | Bacteria | 4462 |
| 1532 | Ga0501076_0101972 | 3300049592 | Bacteria | 2313 |
| 1533 | Ga0501076_0114869 | 3300049592 | Bacteria | 2178 |
| 1534 | Ga0501076_0178900 | 3300049592 | Bacteria | 1729 |
| 1535 | Ga0501076_0197265 | 3300049592 | Bacteria | 1643 |
| 1536 | Ga0501076_0309785 | 3300049592 | Bacteria | 1295 |
| 1537 | Ga0501077_0003968 | 3300049593 | Bacteria | 8923 |
| 1538 | Ga0501077_0008803 | 3300049593 | Bacteria | 6263 |
| 1539 | Ga0501077_0021498 | 3300049593 | Bacteria | 4083 |
| 1540 | Ga0501077_0097546 | 3300049593 | Bacteria | 1863 |
| 1541 | Ga0501077_0209235 | 3300049593 | Bacteria | 1239 |
| 1542 | Ga0501077_0335716 | 3300049593 | Bacteria | 964 |
| 1543 | Ga0501077_0512926 | 3300049593 | Bacteria | 769 |
| 1544 | Ga0501079_0001178 | 3300049741 | Bacteria | 18318 |
| 1545 | Ga0501079_0046758 | 3300049741 | Bacteria | 3339 |
| 1546 | Ga0501079_0049659 | 3300049741 | Bacteria | 3238 |
| 1547 | Ga0501079_0081736 | 3300049741 | Bacteria | 2498 |
| 1548 | Ga0501079_0161339 | 3300049741 | Bacteria | 1748 |
| 1549 | Ga0501079_0615055 | 3300049741 | Bacteria | 855 |
| 1550 | Ga0501079_0700644 | 3300049741 | Bacteria | 797 |
| 1551 | Ga0501080_0007750 | 3300049742 | Bacteria | 9706 |
| 1552 | Ga0501080_0100700 | 3300049742 | Bacteria | 2680 |
| 1553 | Ga0501080_0138185 | 3300049742 | Bacteria | 2254 |
| 1554 | Ga0501080_0184529 | 3300049742 | Bacteria | 1918 |
| 1555 | Ga0501080_0241087 | 3300049742 | Bacteria | 1650 |
| 1556 | Ga0501081_0013714 | 3300049743 | Bacteria | 5329 |
| 1557 | Ga0501081_0057512 | 3300049743 | Bacteria | 2689 |
| 1558 | Ga0501081_0081853 | 3300049743 | Bacteria | 2261 |
| 1559 | Ga0501081_0118370 | 3300049743 | Bacteria | 1884 |
| 1560 | Ga0501081_0139745 | 3300049743 | Bacteria | 1735 |
| 1561 | Ga0501081_0459323 | 3300049743 | Bacteria | 947 |
| 1562 | Ga0501083_0085981 | 3300049744 | Bacteria | 2080 |
| 1563 | Ga0501083_0117991 | 3300049744 | Bacteria | 1741 |
| 1564 | Ga0501083_0233603 | 3300049744 | Bacteria | 1197 |
| 1565 | Ga0501035_0068660 | 3300049822 | Bacteria | 3142 |
| 1566 | Ga0501035_0420111 | 3300049822 | Bacteria | 1110 |
| 1567 | Ga0501035_0475011 | 3300049822 | Bacteria | 1032 |
| 1568 | Ga0501035_0779311 | 3300049822 | Bacteria | 765 |
| 1569 | Ga0501044_0074734 | 3300049823 | Bacteria | 3442 |
| 1570 | Ga0501044_0137435 | 3300049823 | Bacteria | 2434 |
| 1571 | Ga0501045_0020987 | 3300049824 | Bacteria | 4669 |
| 1572 | Ga0501045_0024775 | 3300049824 | Bacteria | 4310 |
| 1573 | Ga0501045_0039471 | 3300049824 | Bacteria | 3435 |
| 1574 | Ga0501045_0041521 | 3300049824 | Bacteria | 3347 |
| 1575 | Ga0501045_0278970 | 3300049824 | Bacteria | 1244 |
| 1576 | Ga0501045_0531644 | 3300049824 | Bacteria | 873 |
| 1577 | nmdc:mga03683_17787_c1 | 3300050489 | Bacteria | 2695 |
| 1578 | nmdc:mga00v17_188659_c1 | 3300050491 | Bacteria | 1331 |
| 1579 | nmdc:mga00v17_25224_c1 | 3300050491 | Bacteria | 3454 |
| 1580 | nmdc:mga00v17_2904_c1 | 3300050491 | Bacteria | 8786 |
| 1581 | nmdc:mga0yw44_119488_c1 | 3300050492 | Bacteria | 1696 |
| 1582 | nmdc:mga0yw44_1963_c1 | 3300050492 | Bacteria | 8529 |
| 1583 | nmdc:mga0yw44_6715_c1 | 3300050492 | Bacteria | 5591 |
| 1584 | nmdc:mga0yw44_70010_c1 | 3300050492 | Bacteria | 2174 |
| 1585 | nmdc:mga0yw44_77943_c1 | 3300050492 | Bacteria | 1722 |
| 1586 | nmdc:mga06z11_26813_c1 | 3300050494 | Bacteria | 2747 |
| 1587 | nmdc:mga06z11_442474_c1 | 3300050494 | Bacteria | 785 |
| 1588 | nmdc:mga06z11_65144_c1 | 3300050494 | Bacteria | 1912 |
| 1589 | nmdc:mga04h51_23443_c1 | 3300050495 | Bacteria | 1312 |
| 1590 | nmdc:mga07m45_177619_c1 | 3300050496 | Bacteria | 1238 |
| 1591 | nmdc:mga07m45_21851_c1 | 3300050496 | Bacteria | 3488 |
| 1592 | nmdc:mga07m45_34845_c1 | 3300050496 | Bacteria | 2799 |
| 1593 | nmdc:mga05p37_137815_c1 | 3300050507 | Bacteria | 2991 |
| 1594 | nmdc:mga05p37_250969_c1 | 3300050507 | Bacteria | 2122 |
| 1595 | nmdc:mga05p37_329373_c1 | 3300050507 | Bacteria | 1804 |
| 1596 | nmdc:mga05p37_442270_c1 | 3300050507 | Bacteria | 1507 |
| 1597 | nmdc:mga05p37_4993_c2 | 3300050507 | Bacteria | 6721 |
| 1598 | nmdc:mga05p37_548803_c1 | 3300050507 | Bacteria | 1316 |
| 1599 | nmdc:mga09592_280592_c1 | 3300050508 | Bacteria | 1445 |
| 1600 | nmdc:mga09592_374686_c1 | 3300050508 | Bacteria | 1231 |
| 1601 | nmdc:mga09592_78389_c1 | 3300050508 | Bacteria | 2811 |
| 1602 | nmdc:mga0qj67_348644_c1 | 3300050509 | Bacteria | 1197 |
| 1603 | nmdc:mga0qj67_602649_c1 | 3300050509 | Bacteria | 879 |
| 1604 | nmdc:mga0qj67_786278_c1 | 3300050509 | Bacteria | 754 |
| 1605 | nmdc:mga06r32_136705_c1 | 3300050510 | Bacteria | 2425 |
| 1606 | nmdc:mga06r32_314861_c1 | 3300050510 | Bacteria | 1551 |
| 1607 | nmdc:mga06r32_60002_c1 | 3300050510 | Bacteria | 3659 |
| 1608 | nmdc:mga08y16_149896_c1 | 3300050511 | Bacteria | 2424 |
| 1609 | nmdc:mga08y16_27944_c1 | 3300050511 | Bacteria | 5947 |
| 1610 | nmdc:mga08y16_430061_c1 | 3300050511 | Bacteria | 1348 |
| 1611 | nmdc:mga0n895_143248_c1 | 3300050512 | Bacteria | 2419 |
| 1612 | nmdc:mga0n895_14768_c1 | 3300050512 | Bacteria | 7104 |
| 1613 | nmdc:mga0n895_319480_c1 | 3300050512 | Bacteria | 1573 |
| 1614 | nmdc:mga0n895_390435_c1 | 3300050512 | Bacteria | 1408 |
| 1615 | nmdc:mga0n895_54579_c1 | 3300050512 | Bacteria | 3931 |
| 1616 | nmdc:mga0n895_56599_c1 | 3300050512 | Bacteria | 3863 |
| 1617 | nmdc:mga0n895_702211_c1 | 3300050512 | Bacteria | 1007 |
| 1618 | nmdc:mga0rr50_2831_c1 | 3300050513 | Bacteria | 9866 |
| 1619 | nmdc:mga0rr50_877259_c1 | 3300050513 | Bacteria | 765 |
| 1620 | nmdc:mga08x19_24_c1 | 3300050514 | Bacteria | 245940 |
| 1621 | nmdc:mga08x19_295126_c1 | 3300050514 | Bacteria | 1125 |
| 1622 | nmdc:mga08x19_90102_c1 | 3300050514 | Bacteria | 2023 |
| 1623 | nmdc:mga0a205_126593_c1 | 3300050515 | Bacteria | 2454 |
| 1624 | nmdc:mga0a205_233224_c1 | 3300050515 | Bacteria | 1723 |
| 1625 | nmdc:mga0a205_42460_c2 | 3300050515 | Bacteria | 3584 |
| 1626 | nmdc:mga0sz30_49723_c1 | 3300050516 | Bacteria | 1777 |
| 1627 | Ga0495601_0000023 | 3300053077 | Bacteria | 140141 |
| 1628 | Ga0495601_0014297 | 3300053077 | Bacteria | 4782 |
| 1629 | Ga0495601_0016474 | 3300053077 | Bacteria | 4479 |
| 1630 | Ga0495601_0019932 | 3300053077 | Bacteria | 4093 |
| 1631 | Ga0495601_0023594 | 3300053077 | Bacteria | 3781 |
| 1632 | Ga0495601_0042008 | 3300053077 | Bacteria | 2867 |
| 1633 | Ga0495612_0000005 | 3300053078 | Bacteria | 286943 |
| 1634 | Ga0495655_0005113 | 3300053083 | Bacteria | 2296 |
| 1635 | Ga0495655_0027352 | 3300053083 | Bacteria | 1352 |
| 1636 | Ga0495595_0000013 | 3300053084 | Bacteria | 160811 |
| 1637 | Ga0495595_0004754 | 3300053084 | Bacteria | 5466 |
| 1638 | Ga0495595_0298962 | 3300053084 | Bacteria | 809 |
| 1639 | Ga0495619_0000003 | 3300053085 | Bacteria | 515784 |
| 1640 | Ga0495619_0014748 | 3300053085 | Bacteria | 4936 |
| 1641 | Ga0495619_0028733 | 3300053085 | Bacteria | 3589 |
| 1642 | Ga0495619_0036675 | 3300053085 | Bacteria | 3193 |
| 1643 | Ga0495619_0045584 | 3300053085 | Bacteria | 2881 |
| 1644 | Ga0495619_0137914 | 3300053085 | Bacteria | 1678 |
| 1645 | Ga0495619_0212087 | 3300053085 | Bacteria | 1341 |
| 1646 | Ga0495619_0246669 | 3300053085 | Bacteria | 1237 |
| 1647 | Ga0500643_020103 | 3300053087 | Bacteria | 2189 |
| 1648 | Ga0500643_029467 | 3300053087 | Bacteria | 1688 |
| 1649 | Ga0500647_0033698 | 3300053091 | Bacteria | 2444 |
| 1650 | Ga0500651_0184092 | 3300053093 | Bacteria | 1239 |
| 1651 | Ga0500566_0000049 | 3300053094 | Bacteria | 57920 |
| 1652 | Ga0500566_0019723 | 3300053094 | Bacteria | 3960 |
| 1653 | Ga0500640_041496 | 3300053095 | Bacteria | 2021 |
| 1654 | Ga0500641_0007196 | 3300053096 | Bacteria | 3967 |
| 1655 | Ga0500648_062230 | 3300053097 | Bacteria | 2115 |
| 1656 | Ga0500654_118940 | 3300053099 | Bacteria | 1048 |
| 1657 | Ga0500554_044646 | 3300053102 | Bacteria | 1374 |
| 1658 | Ga0500555_077202 | 3300053103 | Bacteria | 871 |
| 1659 | Ga0500562_014378 | 3300053108 | Bacteria | 2027 |
| 1660 | Ga0500572_000476 | 3300053111 | Bacteria | 13916 |
| 1661 | Ga0500591_027619 | 3300053115 | Bacteria | 2748 |
| 1662 | Ga0500593_032050 | 3300053117 | Bacteria | 2351 |
| 1663 | Ga0500595_000586 | 3300053119 | Bacteria | 21747 |
| 1664 | Ga0500595_001444 | 3300053119 | Bacteria | 12688 |
| 1665 | Ga0500595_002570 | 3300053119 | Bacteria | 8869 |
| 1666 | Ga0500595_013365 | 3300053119 | Bacteria | 3147 |
| 1667 | Ga0500595_028285 | 3300053119 | Bacteria | 1912 |
| 1668 | Ga0500608_030856 | 3300053122 | Bacteria | 2542 |
| 1669 | Ga0500614_016596 | 3300053123 | Bacteria | 1654 |
| 1670 | Ga0500621_100634 | 3300053126 | Bacteria | 1141 |
| 1671 | Ga0500642_0185661 | 3300053130 | Bacteria | 971 |
| 1672 | Ga0500658_0006809 | 3300053134 | Bacteria | 4228 |
| 1673 | Ga0500658_0279235 | 3300053134 | Bacteria | 768 |
| 1674 | Ga0500559_0000654 | 3300053136 | Bacteria | 23267 |
| 1675 | Ga0500559_0016820 | 3300053136 | Bacteria | 3089 |
| 1676 | Ga0500568_0066049 | 3300053139 | Bacteria | 1392 |
| 1677 | Ga0500568_0093983 | 3300053139 | Bacteria | 1129 |
| 1678 | Ga0500573_0016365 | 3300053140 | Bacteria | 4208 |
| 1679 | Ga0500577_0013422 | 3300053142 | Bacteria | 2502 |
| 1680 | Ga0500577_0079270 | 3300053142 | Bacteria | 1306 |
| 1681 | Ga0500589_042895 | 3300053147 | Bacteria | 2108 |
| 1682 | Ga0500590_065126 | 3300053148 | Bacteria | 1823 |
| 1683 | Ga0500603_000031 | 3300053150 | Bacteria | 34081 |
| 1684 | Ga0500603_000171 | 3300053150 | Bacteria | 16423 |
| 1685 | Ga0500622_0263836 | 3300053156 | Bacteria | 750 |
| 1686 | Ga0500627_0107617 | 3300053158 | Bacteria | 1254 |
| 1687 | Ga0500630_000581 | 3300053159 | Bacteria | 16620 |
| 1688 | Ga0500633_0110996 | 3300053160 | Bacteria | 1016 |
| 1689 | Ga0500638_018261 | 3300053162 | Bacteria | 3270 |
| 1690 | Ga0500639_000020 | 3300053163 | Bacteria | 102959 |
| 1691 | Ga0500636_0049485 | 3300053177 | Bacteria | 2473 |
| 1692 | Ga0500636_0058958 | 3300053177 | Bacteria | 2243 |
| 1693 | Ga0500636_0070433 | 3300053177 | Bacteria | 2029 |
| 1694 | Ga0500637_0005363 | 3300053178 | Bacteria | 6198 |
| 1695 | Ga0500637_0007143 | 3300053178 | Bacteria | 5566 |
| 1696 | Ga0500637_0016794 | 3300053178 | Bacteria | 3909 |
| 1697 | Ga0500637_0189385 | 3300053178 | Bacteria | 1176 |
| 1698 | Ga0500611_001811 | 3300053727 | Bacteria | 2440 |
| 1699 | Ga0500611_021826 | 3300053727 | Bacteria | 1227 |
| 1700 | Ga0500645_010565 | 3300053730 | Bacteria | 3048 |
| 1701 | Ga0500609_021471 | 3300053731 | Bacteria | 881 |
| 1702 | Ga0500552_024431 | 3300053733 | Bacteria | 888 |
| 1703 | Ga0500596_003763 | 3300053735 | Bacteria | 2848 |
| 1704 | Ga0500596_008547 | 3300053735 | Bacteria | 1628 |
| 1705 | Ga0501084_0014440 | 3300054114 | Bacteria | 6545 |
| 1706 | Ga0501084_0015558 | 3300054114 | Bacteria | 6309 |
| 1707 | Ga0501084_0036665 | 3300054114 | Bacteria | 4096 |
| 1708 | Ga0501084_0039306 | 3300054114 | Bacteria | 3957 |
| 1709 | Ga0501084_0361418 | 3300054114 | Bacteria | 1227 |
| 1710 | Ga0501082_0000040 | 3300060353 | Bacteria | 91596 |
| 1711 | Ga0501082_0013015 | 3300060353 | Bacteria | 7151 |
| 1712 | Ga0501082_0042865 | 3300060353 | Bacteria | 3900 |
| 1713 | Ga0501082_0059229 | 3300060353 | Bacteria | 3300 |
| 1714 | Ga0501082_0115603 | 3300060353 | Bacteria | 2323 |
| 1715 | Ga0501082_0356681 | 3300060353 | Bacteria | 1275 |
| 1716 | Ga0501082_0463768 | 3300060353 | Bacteria | 1107 |
| 1717 | Ga0501082_0568314 | 3300060353 | Bacteria | 992 |
| 1718 | Ga0501082_0948740 | 3300060353 | Bacteria | 752 |
| 1719 | Ga0530510_0061859 | 3300061734 | Bacteria | 2710 |
| 1720 | Ga0530510_0079726 | 3300061734 | Bacteria | 2381 |
| 1721 | Ga0530510_0250688 | 3300061734 | Bacteria | 1319 |
| 1722 | 2513590484 | 2513237087 | Bacteria | 5817514 |
| 1723 | 2513649496 | 2513237095 | Bacteria | 8976980 |
| 1724 | 2513657248 | 2513237096 | Bacteria | 8722461 |
| 1725 | 2513857716 | 2513237137 | Bacteria | 9558895 |
| 1726 | 2513919256 | 2513237145 | Bacteria | 8979722 |
| 1727 | 2514589642 | 2513237351 | Bacteria | 6968952 |
| 1728 | 2517891047 | 2517572143 | Bacteria | 9484767 |
| 1729 | 2524465181 | 2524023210 | Bacteria | 9029266 |
| 1730 | 2671123712 | 2667528175 | Bacteria | 7532676 |
| 1731 | 2723843425 | 2721755755 | Bacteria | 8322773 |
| 1732 | 2728752686 | 2728368998 | Bacteria | 8720350 |
| 1733 | 2793066401 | 2791355197 | Bacteria | 8420563 |
| 1734 | 2793077851 | |||
| 1735 | 2818237966 | 2816332527 | Bacteria | 8933356 |
| 1736 | 2874611664 | 2874604998 | Bacteria | 7834745 |
| 1737 | 2876814232 | 2876808645 | Bacteria | 8824342 |
| 1738 | 2878743754 | 2878738818 | Bacteria | 7136951 |
| 1739 | 2879114909 | 2879110137 | Bacteria | 8907982 |
| 1740 | 2885387638 | 2885383462 | Bacteria | 9473874 |
| 1741 | 2885418282 | 2885409591 | Bacteria | 9235467 |
| 1742 | 2888381716 | 2888378607 | Bacteria | 9652610 |
| 1743 | 2903749279 | 2903748898 | Bacteria | 9972761 |
| 1744 | 2906616244 | |||
| 1745 | 2906628310 | 2906626472 | Bacteria | 8826946 |
| 1746 | 2906640334 | 2906635258 | Bacteria | 8601019 |
| 1747 | 2906667254 | 2906660503 | Bacteria | 8595048 |
| 1748 | 2922431762 | |||
| 1749 | 2924781567 | 2924776078 | Bacteria | 7492003 |
| 1750 | 2932796602 | 2932794094 | Bacteria | 7915132 |
| 1751 | 2932802616 | 2932801729 | Bacteria | 7987968 |
| 1752 | 2935680019 | 2935675223 | Bacteria | 9928132 |
| 1753 | 2935693901 | 2935684952 | Bacteria | 9590419 |
| 1754 | 2935700659 | 2935694250 | Bacteria | 9291695 |
| 1755 | 2935722023 | 2935713505 | Bacteria | 9608509 |
| 1756 | 2935731332 | 2935722832 | Bacteria | 9608746 |
| 1757 | 2935741032 | 2935732158 | Bacteria | 9706831 |
| 1758 | 2935750408 | 2935741537 | Bacteria | 9707219 |
| 1759 | 2935759663 | 2935750917 | Bacteria | 9590372 |
| 1760 | 2935768583 | 2935760218 | Bacteria | 9817913 |
| 1761 | 2935883573 | 2935883170 | Bacteria | 7964738 |
| 1762 | 2935967062 | 2935959822 | Bacteria | 7869783 |
| 1763 | 2940565568 | 2940556831 | Bacteria | 9590747 |
| 1764 | 2958146568 | 2958144490 | Bacteria | 6677056 |
| 1765 | 2968017563 | 2968016561 | Bacteria | 7022047 |
| 1766 | 2970472261 | 2970469710 | Bacteria | 6969209 |
| 1767 | 3005481580 | 3005474847 | Bacteria | 9259049 |
| 1768 | 8002060756 | 8002060224 | Bacteria | 4026565 |
| 1769 | 8006943174 | 8006933436 | Bacteria | 10410654 |
| 1770 | 8006982969 | 8006973647 | Bacteria | 10679141 |
| 1771 | 8016591194 | 8016583857 | Bacteria | 10421953 |
| 1772 | 8019575114 | 8019565922 | Bacteria | 9639779 |
| 1773 | 8019653219 | 8019648815 | Bacteria | 10014479 |
| 1774 | nmdc:mga0qj67_276001_c1 | |||
| 1775 | JGI24746J21847_1002224 | |||
| 1776 | JGI24737J22298_10046026 | |||
| 1777 | JGI24743J22301_10035741 | |||
| 1778 | JGI24735J21928_10041249 | |||
| 1779 | JGI24750J21931_1001355 | |||
| 1780 | JGI24745J21846_1000775 | |||
| 1781 | JGI24748J21848_1003115 | |||
| 1782 | JGI24749J21850_1002812 | |||
| 1783 | JGI24744J21845_10000934 | |||
| 1784 | JGI24034J26672_10011810 | |||
| 1785 | JGI24742J22300_10000424 | |||
| 1786 | JGI24742J22300_10003626 | |||
| 1787 | JGI25156J39149_1000198 | |||
| 1788 | JGI25154J39366_1000209 | |||
| 1789 | JGI25157J39369_1000240 | |||
| 1790 | JGI25159J45721_1007087 | |||
| 1791 | JGI25406J46586_10004053 | |||
| 1792 | JGI25165J46597_1011687 | |||
| 1793 | JGI25153J46596_10000946 | |||
| 1794 | rootH1_10253643 | |||
| 1795 | JGI25160J50197_1024073 | |||
| 1796 | JGI25405J52794_10011223 | |||
| 1797 | Ga0055543_1014759 | |||
| 1798 | Ga0065165_1000785 | |||
| 1799 | Ga0065165_1016570 | |||
| 1800 | Ga0065707_10091172 | |||
| 1801 | Ga0065707_10199625 | |||
| 1802 | Ga0070658_10067069 | |||
| 1803 | Ga0070658_10131651 | |||
| 1804 | Ga0070676_10013244 | |||
| 1805 | Ga0070676_10025116 | |||
| 1806 | Ga0070676_10031955 | |||
| 1807 | Ga0070676_10489589 | |||
| 1808 | Ga0070683_100529961 | |||
| 1809 | Ga0070690_100010416 | |||
| 1810 | Ga0070670_100009831 | |||
| 1811 | Ga0070670_100080110 | |||
| 1812 | Ga0070670_100113554 | |||
| 1813 | Ga0070670_100222332 | |||
| 1814 | Ga0068869_100005796 | |||
| 1815 | Ga0068869_100033165 | |||
| 1816 | Ga0070666_10008356 | |||
| 1817 | Ga0070666_10431938 | |||
| 1818 | Ga0070680_100070310 | |||
| 1819 | Ga0070680_100117171 | |||
| 1820 | Ga0070682_100008701 | |||
| 1821 | Ga0070682_100009990 | |||
| 1822 | Ga0070682_100498948 | |||
| 1823 | Ga0068868_100006107 | |||
| 1824 | Ga0068868_100040882 | |||
| 1825 | Ga0070660_100000939 | |||
| 1826 | Ga0070660_100025758 | |||
| 1827 | Ga0070660_100255115 | |||
| 1828 | Ga0070689_100018460 | |||
| 1829 | Ga0070689_100020568 | |||
| 1830 | Ga0070689_100022682 | |||
| 1831 | Ga0070689_100160791 | |||
| 1832 | Ga0070691_10010464 | |||
| 1833 | Ga0070691_10142950 | |||
| 1834 | Ga0070687_100008830 | |||
| 1835 | Ga0070687_100028601 | |||
| 1836 | Ga0070661_100027242 | |||
| 1837 | Ga0070661_100307306 | |||
| 1838 | Ga0070661_100889811 | |||
| 1839 | Ga0070692_10071462 | |||
| 1840 | Ga0070692_10096682 | |||
| 1841 | Ga0070668_100010470 | |||
| 1842 | Ga0070668_100011094 | |||
| 1843 | Ga0070668_100021106 | |||
| 1844 | Ga0070668_100162264 | |||
| 1845 | Ga0070669_100014612 | |||
| 1846 | Ga0070669_100022662 | |||
| 1847 | Ga0070669_100054921 | |||
| 1848 | Ga0070669_100115944 | |||
| 1849 | Ga0070669_100214713 | |||
| 1850 | Ga0070669_100357841 | |||
| 1851 | Ga0070675_100007433 | |||
| 1852 | Ga0070675_100010507 | |||
| 1853 | Ga0070671_100001845 | |||
| 1854 | Ga0070671_100049276 | |||
| 1855 | Ga0070671_100072337 | |||
| 1856 | Ga0070671_100341681 | |||
| 1857 | Ga0070674_100009356 | |||
| 1858 | Ga0070674_100109690 | |||
| 1859 | Ga0070673_100006459 | |||
| 1860 | Ga0070673_100007902 | |||
| 1861 | Ga0070673_100012955 | |||
| 1862 | Ga0070688_100056856 | |||
| 1863 | Ga0070688_100212681 | |||
| 1864 | Ga0070659_100004243 | |||
| 1865 | Ga0070659_100020505 | |||
| 1866 | Ga0070659_100052526 | |||
| 1867 | Ga0070659_100173866 | |||
| 1868 | Ga0070659_100442758 | |||
| 1869 | Ga0070667_100089323 | |||
| 1870 | Ga0070667_100628389 | |||
| 1871 | Ga0070667_100731439 | |||
| 1872 | Ga0070709_10311234 | |||
| 1873 | Ga0070709_10382254 | |||
| 1874 | Ga0070714_100020133 | |||
| 1875 | Ga0070714_100083496 | |||
| 1876 | Ga0070714_100342879 | |||
| 1877 | Ga0070714_100401132 | |||
| 1878 | Ga0070714_100407643 | |||
| 1879 | Ga0070713_100006457 | |||
| 1880 | Ga0070713_100012781 | |||
| 1881 | Ga0070713_100082029 | |||
| 1882 | Ga0070713_100130847 | |||
| 1883 | Ga0070713_100186406 | |||
| 1884 | Ga0070713_100242797 | |||
| 1885 | Ga0070713_100577855 | |||
| 1886 | Ga0070713_100801842 | |||
| 1887 | Ga0070710_10001738 | |||
| 1888 | Ga0070710_10145602 | |||
| 1889 | Ga0070710_10392002 | |||
| 1890 | Ga0070701_10007943 | |||
| 1891 | Ga0070711_100004017 | |||
| 1892 | Ga0070711_100028343 | |||
| 1893 | Ga0070711_100068473 | |||
| 1894 | Ga0070711_100225585 | |||
| 1895 | Ga0070705_100060768 | |||
| 1896 | Ga0070705_100452288 | |||
| 1897 | Ga0070700_100023233 | |||
| 1898 | Ga0070700_100164743 | |||
| 1899 | Ga0070694_100039271 | |||
| 1900 | Ga0070694_100091305 | |||
| 1901 | Ga0070694_100101966 | |||
| 1902 | Ga0070663_100009487 | |||
| 1903 | Ga0070663_100026948 | |||
| 1904 | Ga0070663_100603274 | |||
| 1905 | Ga0070663_100726812 | |||
| 1906 | Ga0070678_100085452 | |||
| 1907 | Ga0070662_100012811 | |||
| 1908 | Ga0070662_100016757 | |||
| 1909 | Ga0070662_100045051 | |||
| 1910 | Ga0070662_100108225 | |||
| 1911 | Ga0070662_100123661 | |||
| 1912 | Ga0070662_100415041 | |||
| 1913 | Ga0070662_100576393 | |||
| 1914 | Ga0070681_10020204 | |||
| 1915 | Ga0070681_10027203 | |||
| 1916 | Ga0070681_10047854 | |||
| 1917 | Ga0070681_10206617 | |||
| 1918 | Ga0068867_100024994 | |||
| 1919 | Ga0068867_100081404 | |||
| 1920 | Ga0068867_100122647 | |||
| 1921 | Ga0068867_100272156 | |||
| 1922 | Ga0070685_10012638 | |||
| 1923 | Ga0070685_10164001 | |||
| 1924 | Ga0070707_100252048 | |||
| 1925 | Ga0070707_100657677 | |||
| 1926 | Ga0070699_100406998 | |||
| 1927 | Ga0070679_100010140 | |||
| 1928 | Ga0070679_100011107 | |||
| 1929 | Ga0070684_100030922 | |||
| 1930 | Ga0070684_100081673 | |||
| 1931 | Ga0068853_100005277 | |||
| 1932 | Ga0068853_100010108 | |||
| 1933 | Ga0068853_100071078 | |||
| 1934 | Ga0068853_100097710 | |||
| 1935 | Ga0068853_100595339 | |||
| 1936 | Ga0070672_100003221 | |||
| 1937 | Ga0070672_100242747 | |||
| 1938 | Ga0070672_100341286 | |||
| 1939 | Ga0070686_100273192 | |||
| 1940 | Ga0070686_100509861 | |||
| 1941 | Ga0070695_100000088 | |||
| 1942 | Ga0070695_100008380 | |||
| 1943 | Ga0070695_100126206 | |||
| 1944 | Ga0070695_100258945 | |||
| 1945 | Ga0070695_100317945 | |||
| 1946 | Ga0070696_100018761 | |||
| 1947 | Ga0070696_100047274 | |||
| 1948 | Ga0070696_100120101 | |||
| 1949 | Ga0070665_100021137 | |||
| 1950 | Ga0070665_100041633 | |||
| 1951 | Ga0070665_100062066 | |||
| 1952 | Ga0070665_100088181 | |||
| 1953 | Ga0070665_100981455 | |||
| 1954 | Ga0070704_100005398 | |||
| 1955 | Ga0070704_100019709 | |||
| 1956 | Ga0070704_100043795 | |||
| 1957 | Ga0068855_100036765 | |||
| 1958 | Ga0068855_100068463 | |||
| 1959 | Ga0068855_101024888 | |||
| 1960 | Ga0070664_100035563 | |||
| 1961 | Ga0070664_100104031 | |||
| 1962 | Ga0070664_100129446 | |||
| 1963 | Ga0070664_100363142 | |||
| 1964 | Ga0070664_100556568 | |||
| 1965 | Ga0068857_100004707 | |||
| 1966 | Ga0068857_100099316 | |||
| 1967 | Ga0068854_100013937 | |||
| 1968 | Ga0068856_100090862 | |||
| 1969 | Ga0068856_100274594 | |||
| 1970 | Ga0068856_100316935 | |||
| 1971 | Ga0068856_100377500 | |||
| 1972 | Ga0068856_100513005 | |||
| 1973 | Ga0070702_100002160 | |||
| 1974 | Ga0070702_100058756 | |||
| 1975 | Ga0070702_100090997 | |||
| 1976 | Ga0070702_100551387 | |||
| 1977 | Ga0068852_100009156 | |||
| 1978 | Ga0068852_100029216 | |||
| 1979 | Ga0068852_100335326 | |||
| 1980 | Ga0068859_100047469 | |||
| 1981 | Ga0068859_100093559 | |||
| 1982 | Ga0068859_100312167 | |||
| 1983 | Ga0068859_100557151 | |||
| 1984 | Ga0068864_100004704 | |||
| 1985 | Ga0068864_100009782 | |||
| 1986 | Ga0068864_100080001 | |||
| 1987 | Ga0068864_100201456 | |||
| 1988 | Ga0068866_10004095 | |||
| 1989 | Ga0068866_10197501 | |||
| 1990 | Ga0068861_100017474 | |||
| 1991 | Ga0068861_100057206 | |||
| 1992 | Ga0068861_100295122 | |||
| 1993 | Ga0068861_100475583 | |||
| 1994 | Ga0068851_10009739 | |||
| 1995 | Ga0068870_10004328 | |||
| 1996 | Ga0068870_10005082 | |||
| 1997 | Ga0068863_100005050 | |||
| 1998 | Ga0068863_100014875 | |||
| 1999 | Ga0068863_100044944 | |||
| 2000 | Ga0068863_100512502 | |||
| 2001 | Ga0068858_100008255 | |||
| 2002 | Ga0068858_100041195 | |||
| 2003 | Ga0068860_100007113 | |||
| 2004 | Ga0068860_100046816 | |||
| 2005 | Ga0068862_100007625 | |||
| 2006 | Ga0068862_100086826 | |||
| 2007 | Ga0068862_100394166 | |||
| 2008 | Ga0081455_10004617 | |||
| 2009 | Ga0081455_10005751 | |||
| 2010 | Ga0081455_10235690 | |||
| 2011 | Ga0081455_10299808 | |||
| 2012 | Ga0081538_10020707 | |||
| 2013 | Ga0081540_1001688 | |||
| 2014 | Ga0081540_1002923 | |||
| 2015 | Ga0081540_1009895 | |||
| 2016 | Ga0081539_10003785 | |||
| 2017 | Ga0081539_10019455 | |||
| 2018 | Ga0081539_10021469 | |||
| 2019 | Ga0081539_10072437 | |||
| 2020 | Ga0081539_10095390 | |||
| 2021 | Ga0070717_10003779 | |||
| 2022 | Ga0070717_10015928 | |||
| 2023 | Ga0070717_10048243 | |||
| 2024 | Ga0070717_10139812 | |||
| 2025 | Ga0070717_10441941 | |||
| 2026 | Ga0075365_10026618 | |||
| 2027 | Ga0075365_10140400 | |||
| 2028 | Ga0075365_10163298 | |||
| 2029 | Ga0075365_10273891 | |||
| 2030 | Ga0075365_10496570 | |||
| 2031 | Ga0075364_10002553 | |||
| 2032 | Ga0075432_10076047 | |||
| 2033 | Ga0070716_100010739 | |||
| 2034 | Ga0070716_100053462 | |||
| 2035 | Ga0070716_100184782 | |||
| 2036 | Ga0070716_100359132 | |||
| 2037 | Ga0070712_100003573 | |||
| 2038 | Ga0070712_100016638 | |||
| 2039 | Ga0070712_100122234 | |||
| 2040 | Ga0070712_100139359 | |||
| 2041 | Ga0070712_100365042 | |||
| 2042 | Ga0070712_100407066 | |||
| 2043 | Ga0075362_10241676 | |||
| 2044 | Ga0075367_10003976 | |||
| 2045 | Ga0075369_10064360 | |||
| 2046 | Ga0097621_100004513 | |||
| 2047 | Ga0097621_100467307 | |||
| 2048 | Ga0075370_10057493 | |||
| 2049 | Ga0075370_10211328 | |||
| 2050 | Ga0068871_100012856 | |||
| 2051 | Ga0068871_100256293 | |||
| 2052 | Ga0068871_100640353 | |||
| 2053 | Ga0075428_100121815 | |||
| 2054 | Ga0075428_100128951 | |||
| 2055 | Ga0075428_100146476 | |||
| 2056 | Ga0075428_100379353 | |||
| 2057 | Ga0075428_100427259 | |||
| 2058 | Ga0075428_100614108 | |||
| 2059 | Ga0075428_100907265 | |||
| 2060 | Ga0075430_100047302 | |||
| 2061 | Ga0075430_100066972 | |||
| 2062 | Ga0075430_100348701 | |||
| 2063 | Ga0075431_100061704 | |||
| 2064 | Ga0075431_100205538 | |||
| 2065 | Ga0075431_100517639 | |||
| 2066 | Ga0075433_10196719 | |||
| 2067 | Ga0075434_100118279 | |||
| 2068 | Ga0075434_100131513 | |||
| 2069 | Ga0075434_100211466 | |||
| 2070 | Ga0075434_100229670 | |||
| 2071 | Ga0075434_100445691 | |||
| 2072 | Ga0075429_100296701 | |||
| 2073 | Ga0075429_100347525 | |||
| 2074 | Ga0068865_100008478 | |||
| 2075 | Ga0068865_100054808 | |||
| 2076 | Ga0075436_100008678 | |||
| 2077 | Ga0075436_100088469 | |||
| 2078 | Ga0075436_100104645 | |||
| 2079 | Ga0075436_100434978 | |||
| 2080 | Ga0097620_100047472 | |||
| 2081 | Ga0097620_100093559 | |||
| 2082 | Ga0097620_100312184 | |||
| 2083 | Ga0097620_100557091 | |||
| 2084 | Ga0099824_1009169 | |||
| 2085 | Ga0099822_1012158 | |||
| 2086 | Ga0075435_100008690 | |||
| 2087 | Ga0075435_100709120 | |||
| 2088 | Ga0099794_10008987 | |||
| 2089 | Ga0099794_10040959 | |||
| 2090 | Ga0099794_10074240 | |||
| 2091 | Ga0099795_10000441 | |||
| 2092 | Ga0099795_10024476 | |||
| 2093 | Ga0099795_10066158 | |||
| 2094 | Ga0099795_10094123 | |||
| 2095 | Ga0105251_10088082 | |||
| 2096 | Ga0105244_10081325 | |||
| 2097 | Ga0105240_10048174 | |||
| 2098 | Ga0105240_10063893 | |||
| 2099 | Ga0105240_10099376 | |||
| 2100 | Ga0105240_11046430 | |||
| 2101 | Ga0111539_10087869 | |||
| 2102 | Ga0111539_10097294 | |||
| 2103 | Ga0111539_10122649 | |||
| 2104 | Ga0111539_10170022 | |||
| 2105 | Ga0105245_10006657 | |||
| 2106 | Ga0105245_10011565 | |||
| 2107 | Ga0105245_10042174 | |||
| 2108 | Ga0105247_10003741 | |||
| 2109 | Ga0105247_10020804 | |||
| 2110 | Ga0105247_10035674 | |||
| 2111 | Ga0105247_10038462 | |||
| 2112 | Ga0105247_10049424 | |||
| 2113 | Ga0105247_10074650 | |||
| 2114 | Ga0114129_10059852 | |||
| 2115 | Ga0114129_10203045 | |||
| 2116 | Ga0114129_10422172 | |||
| 2117 | Ga0114129_10723256 | |||
| 2118 | Ga0105243_10070118 | |||
| 2119 | Ga0105243_10282345 | |||
| 2120 | Ga0105241_10008231 | |||
| 2121 | Ga0105241_10034255 | |||
| 2122 | Ga0105242_10029002 | |||
| 2123 | Ga0105242_10295399 | |||
| 2124 | Ga0105248_10059261 | |||
| 2125 | Ga0105248_10138902 | |||
| 2126 | Ga0105248_10369308 | |||
| 2127 | Ga0105248_10393057 | |||
| 2128 | Ga0105248_10615759 | |||
| 2129 | Ga0105248_10629628 | |||
| 2130 | Ga0105237_10002982 | |||
| 2131 | Ga0105237_10053877 | |||
| 2132 | Ga0105237_10055541 | |||
| 2133 | Ga0105237_10131772 | |||
| 2134 | Ga0105238_10005756 | |||
| 2135 | Ga0105238_10029879 | |||
| 2136 | Ga0105238_10064315 | |||
| 2137 | Ga0105238_10091379 | |||
| 2138 | Ga0105238_10117557 | |||
| 2139 | Ga0105238_10639322 | |||
| 2140 | Ga0105249_10026496 | |||
| 2141 | Ga0105249_10057738 | |||
| 2142 | Ga0105249_10092266 | |||
| 2143 | Ga0105249_10133579 | |||
| 2144 | Ga0105029_107684 | |||
| 2145 | Ga0099796_10001698 | |||
| 2146 | Ga0099796_10001865 | |||
| 2147 | Ga0099796_10007090 | |||
| 2148 | Ga0099796_10048575 | |||
| 2149 | Ga0099796_10052230 | |||
| 2150 | Ga0105239_10016807 | |||
| 2151 | Ga0105239_10035074 | |||
| 2152 | Ga0105239_10090414 | |||
| 2153 | Ga0105239_10169861 | |||
| 2154 | Ga0105239_10299879 | |||
| 2155 | Ga0105246_10020411 | |||
| 2156 | Ga0105246_10065320 | |||
| 2157 | Ga0105246_10136614 | |||
| 2158 | Ga0105246_10749675 | |||
| 2159 | Ga0157371_10498812 | |||
| 2160 | Ga0157370_10035007 | |||
| 2161 | Ga0157370_10114027 | |||
| 2162 | Ga0157370_10508487 | |||
| 2163 | Ga0157370_10770111 | |||
| 2164 | Ga0157369_10001818 | |||
| 2165 | Ga0157369_10008070 | |||
| 2166 | Ga0157369_10101657 | |||
| 2167 | Ga0157374_10010373 | |||
| 2168 | Ga0157374_10034810 | |||
| 2169 | Ga0157378_10129148 | |||
| 2170 | Ga0157378_10142012 | |||
| 2171 | Ga0157378_10738696 | |||
| 2172 | Ga0163162_10087541 | |||
| 2173 | Ga0163162_10243031 | |||
| 2174 | Ga0163162_10373032 | |||
| 2175 | Ga0163162_10381981 | |||
| 2176 | Ga0163162_11075866 | |||
| 2177 | Ga0157372_10004050 | |||
| 2178 | Ga0157372_10160662 | |||
| 2179 | Ga0157372_10438263 | |||
| 2180 | Ga0157372_10538770 | |||
| 2181 | Ga0157375_10015123 | |||
| 2182 | Ga0157375_10090637 | |||
| 2183 | Ga0157375_10407215 | |||
| 2184 | Ga0157375_10418534 | |||
| 2185 | Ga0157375_11042996 | |||
| 2186 | Ga0163163_10010748 | |||
| 2187 | Ga0163163_10049335 | |||
| 2188 | Ga0163163_10138553 | |||
| 2189 | Ga0163163_10236146 | |||
| 2190 | Ga0163163_10417182 | |||
| 2191 | Ga0157380_10025703 | |||
| 2192 | Ga0157380_10048738 | |||
| 2193 | Ga0157380_10081638 | |||
| 2194 | Ga0157377_10007621 | |||
| 2195 | Ga0157377_10493536 | |||
| 2196 | Ga0157379_10027562 | |||
| 2197 | Ga0157379_10238949 | |||
| 2198 | Ga0157376_10074712 | |||
| 2199 | Ga0157376_10182891 | |||
| 2200 | Ga0157376_10381575 | |||
| 2201 | Ga0163161_10015441 | |||
| 2202 | Ga0163161_10373676 | |||
| 2203 | Ga0213873_10012361 | |||
| 2204 | Ga0213872_10048695 | |||
| 2205 | Ga0213872_10056759 | |||
| 2206 | Ga0213874_10016816 | |||
| 2207 | Ga0213876_10003691 | |||
| 2208 | Ga0213876_10127457 | |||
| 2209 | Ga0213871_10002516 | |||
| 2210 | Ga0213871_10018478 | |||
| 2211 | Ga0224572_1041130 | |||
| 2212 | Ga0209435_100091 | |||
| 2213 | Ga0209646_1000295 | |||
| 2214 | Ga0209026_1000366 | |||
| 2215 | Ga0209759_1000513 | |||
| 2216 | Ga0209233_1002293 | |||
| 2217 | Ga0209233_1008990 | |||
| 2218 | Ga0209130_1000389 | |||
| 2219 | Ga0209758_1004239 | |||
| 2220 | Ga0207426_1000361 | |||
| 2221 | Ga0207426_1025172 | |||
| 2222 | Ga0207697_10008248 | |||
| 2223 | Ga0207656_10013388 | |||
| 2224 | Ga0207656_10020494 | |||
| 2225 | Ga0207682_10013567 | |||
| 2226 | Ga0207692_10000880 | |||
| 2227 | Ga0207642_10187404 | |||
| 2228 | Ga0207710_10002838 | |||
| 2229 | Ga0207710_10019649 | |||
| 2230 | Ga0207710_10082431 | |||
| 2231 | Ga0207688_10001906 | |||
| 2232 | Ga0207688_10002332 | |||
| 2233 | Ga0207688_10048591 | |||
| 2234 | Ga0207680_10079461 | |||
| 2235 | Ga0207680_10377148 | |||
| 2236 | Ga0207647_10004250 | |||
| 2237 | Ga0207647_10088873 | |||
| 2238 | Ga0207647_10094052 | |||
| 2239 | Ga0207685_10074761 | |||
| 2240 | Ga0207685_10201347 | |||
| 2241 | Ga0207699_10002228 | |||
| 2242 | Ga0207699_10082613 | |||
| 2243 | Ga0207699_10111388 | |||
| 2244 | Ga0207699_10428640 | |||
| 2245 | Ga0207645_10010970 | |||
| 2246 | Ga0207645_10026220 | |||
| 2247 | Ga0207645_10034046 | |||
| 2248 | Ga0207645_10038240 | |||
| 2249 | Ga0207643_10002034 | |||
| 2250 | Ga0207643_10014811 | |||
| 2251 | Ga0207705_10161483 | |||
| 2252 | Ga0207684_10083513 | |||
| 2253 | Ga0207684_10111421 | |||
| 2254 | Ga0207684_10742172 | |||
| 2255 | Ga0207654_10002780 | |||
| 2256 | Ga0207654_10078431 | |||
| 2257 | Ga0207707_10010663 | |||
| 2258 | Ga0207707_10017265 | |||
| 2259 | Ga0207707_10053530 | |||
| 2260 | Ga0207707_10807096 | |||
| 2261 | Ga0207695_10254758 | |||
| 2262 | Ga0207671_10007430 | |||
| 2263 | Ga0207671_10150972 | |||
| 2264 | Ga0207671_10170500 | |||
| 2265 | Ga0207671_10174915 | |||
| 2266 | Ga0207671_10589229 | |||
| 2267 | Ga0207693_10006271 | |||
| 2268 | Ga0207693_10017660 | |||
| 2269 | Ga0207693_10020813 | |||
| 2270 | Ga0207693_10122957 | |||
| 2271 | Ga0207693_10334496 | |||
| 2272 | Ga0207693_10454112 | |||
| 2273 | Ga0207693_10498647 | |||
| 2274 | Ga0207663_10002278 | |||
| 2275 | Ga0207663_10050857 | |||
| 2276 | Ga0207663_10096389 | |||
| 2277 | Ga0207663_10164948 | |||
| 2278 | Ga0207663_10282365 | |||
| 2279 | Ga0207663_10633890 | |||
| 2280 | Ga0207660_10005920 | |||
| 2281 | Ga0207660_10055147 | |||
| 2282 | Ga0207660_10072531 | |||
| 2283 | Ga0207660_10089440 | |||
| 2284 | Ga0207660_10268682 | |||
| 2285 | Ga0207660_10362776 | |||
| 2286 | Ga0207662_10004685 | |||
| 2287 | Ga0207662_10006282 | |||
| 2288 | Ga0207657_10002785 | |||
| 2289 | Ga0207657_10038506 | |||
| 2290 | Ga0207657_10150596 | |||
| 2291 | Ga0207649_10000031 | |||
| 2292 | Ga0207649_10000033 | |||
| 2293 | Ga0207649_10137525 | |||
| 2294 | Ga0207649_10417491 | |||
| 2295 | Ga0207652_10007295 | |||
| 2296 | Ga0207652_10034133 | |||
| 2297 | Ga0207652_10067755 | |||
| 2298 | Ga0207652_10400632 | |||
| 2299 | Ga0207652_10615235 | |||
| 2300 | Ga0207681_10109735 | |||
| 2301 | Ga0207681_10117307 | |||
| 2302 | Ga0207694_10004400 | |||
| 2303 | Ga0207694_10076254 | |||
| 2304 | Ga0207694_10463499 | |||
| 2305 | Ga0207650_10002738 | |||
| 2306 | Ga0207650_10027115 | |||
| 2307 | Ga0207650_10063064 | |||
| 2308 | Ga0207650_10131050 | |||
| 2309 | Ga0207659_10010009 | |||
| 2310 | Ga0207659_10015533 | |||
| 2311 | Ga0207687_10005847 | |||
| 2312 | Ga0207687_10010555 | |||
| 2313 | Ga0207687_10111636 | |||
| 2314 | Ga0207687_10142963 | |||
| 2315 | Ga0207700_10006859 | |||
| 2316 | Ga0207700_10046006 | |||
| 2317 | Ga0207700_10048646 | |||
| 2318 | Ga0207700_10086525 | |||
| 2319 | Ga0207700_10132540 | |||
| 2320 | Ga0207700_10140670 | |||
| 2321 | Ga0207700_10306789 | |||
| 2322 | Ga0207700_10316065 | |||
| 2323 | Ga0207700_10481406 | |||
| 2324 | Ga0207700_10764645 | |||
| 2325 | Ga0207700_10898641 | |||
| 2326 | Ga0207664_10032247 | |||
| 2327 | Ga0207664_10072622 | |||
| 2328 | Ga0207664_10353106 | |||
| 2329 | Ga0207644_10010237 | |||
| 2330 | Ga0207644_10010951 | |||
| 2331 | Ga0207644_10012480 | |||
| 2332 | Ga0207690_10002494 | |||
| 2333 | Ga0207690_10069545 | |||
| 2334 | Ga0207690_10073108 | |||
| 2335 | Ga0207690_10225112 | |||
| 2336 | Ga0207690_10316053 | |||
| 2337 | Ga0207706_10001779 | |||
| 2338 | Ga0207706_10003134 | |||
| 2339 | Ga0207706_10024619 | |||
| 2340 | Ga0207706_10081024 | |||
| 2341 | Ga0207706_10256945 | |||
| 2342 | Ga0207706_10294259 | |||
| 2343 | Ga0207706_10351132 | |||
| 2344 | Ga0207686_10044106 | |||
| 2345 | Ga0207709_10016786 | |||
| 2346 | Ga0207709_10115209 | |||
| 2347 | Ga0207709_10352062 | |||
| 2348 | Ga0207670_10021392 | |||
| 2349 | Ga0207670_10029969 | |||
| 2350 | Ga0207670_10290942 | |||
| 2351 | Ga0207669_10005756 | |||
| 2352 | Ga0207669_10520971 | |||
| 2353 | Ga0207704_10010329 | |||
| 2354 | Ga0207665_10015878 | |||
| 2355 | Ga0207665_10083685 | |||
| 2356 | Ga0207665_10144852 | |||
| 2357 | Ga0207665_10382972 | |||
| 2358 | Ga0207691_10006507 | |||
| 2359 | Ga0207691_10007515 | |||
| 2360 | Ga0207691_10253496 | |||
| 2361 | Ga0207691_10317525 | |||
| 2362 | Ga0207691_10426154 | |||
| 2363 | Ga0207711_10010088 | |||
| 2364 | Ga0207711_10118037 | |||
| 2365 | Ga0207711_10182716 | |||
| 2366 | Ga0207711_10381207 | |||
| 2367 | Ga0207689_10001370 | |||
| 2368 | Ga0207689_10008563 | |||
| 2369 | Ga0207661_10012149 | |||
| 2370 | Ga0207661_10035468 | |||
| 2371 | Ga0207679_10176707 | |||
| 2372 | Ga0207679_10280389 | |||
| 2373 | Ga0207679_10583956 | |||
| 2374 | Ga0207679_10797351 | |||
| 2375 | Ga0207679_10839664 | |||
| 2376 | Ga0207667_10010887 | |||
| 2377 | Ga0207667_10182003 | |||
| 2378 | Ga0207667_10929025 | |||
| 2379 | Ga0207651_10006050 | |||
| 2380 | Ga0207651_10049466 | |||
| 2381 | Ga0207651_10175172 | |||
| 2382 | Ga0207712_10055094 | |||
| 2383 | Ga0207712_10082319 | |||
| 2384 | Ga0207712_10257091 | |||
| 2385 | Ga0207712_10488089 | |||
| 2386 | Ga0207668_10029634 | |||
| 2387 | Ga0207668_10066722 | |||
| 2388 | Ga0207668_10130771 | |||
| 2389 | Ga0207668_10315769 | |||
| 2390 | Ga0207668_10437286 | |||
| 2391 | Ga0207640_10028881 | |||
| 2392 | Ga0207640_10137437 | |||
| 2393 | Ga0207640_10517461 | |||
| 2394 | Ga0207658_10271554 | |||
| 2395 | Ga0207677_10007022 | |||
| 2396 | Ga0207677_10859754 | |||
| 2397 | Ga0207703_10005527 | |||
| 2398 | Ga0207703_10087571 | |||
| 2399 | Ga0207703_10178690 | |||
| 2400 | Ga0207703_10301275 | |||
| 2401 | Ga0207639_10018693 | |||
| 2402 | Ga0207639_10179605 | |||
| 2403 | Ga0207639_10434586 | |||
| 2404 | Ga0207639_10574955 | |||
| 2405 | Ga0207678_10004671 | |||
| 2406 | Ga0207678_10006952 | |||
| 2407 | Ga0207678_10025982 | |||
| 2408 | Ga0207678_10027109 | |||
| 2409 | Ga0207678_10856244 | |||
| 2410 | Ga0207708_10001428 | |||
| 2411 | Ga0207708_10007178 | |||
| 2412 | Ga0207708_10029917 | |||
| 2413 | Ga0207702_10088425 | |||
| 2414 | Ga0207702_10270409 | |||
| 2415 | Ga0207702_10405922 | |||
| 2416 | Ga0207702_10735139 | |||
| 2417 | Ga0207702_10748554 | |||
| 2418 | Ga0207641_10017293 | |||
| 2419 | Ga0207641_10025809 | |||
| 2420 | Ga0207641_10256148 | |||
| 2421 | Ga0207648_10004473 | |||
| 2422 | Ga0207648_10010764 | |||
| 2423 | Ga0207648_10139092 | |||
| 2424 | Ga0207648_10309360 | |||
| 2425 | Ga0207648_10431927 | |||
| 2426 | Ga0207676_10010604 | |||
| 2427 | Ga0207676_10010854 | |||
| 2428 | Ga0207676_10067232 | |||
| 2429 | Ga0207674_10015065 | |||
| 2430 | Ga0207674_10051516 | |||
| 2431 | Ga0207674_10081726 | |||
| 2432 | Ga0207674_10174528 | |||
| 2433 | Ga0207674_10308462 | |||
| 2434 | Ga0207675_100001777 | |||
| 2435 | Ga0207675_100003458 | |||
| 2436 | Ga0207675_100213360 | |||
| 2437 | Ga0207675_100348625 | |||
| 2438 | Ga0207675_100756441 | |||
| 2439 | Ga0207683_10003755 | |||
| 2440 | Ga0207683_10010729 | |||
| 2441 | Ga0207683_10023225 | |||
| 2442 | Ga0207683_10048576 | |||
| 2443 | Ga0207683_10315499 | |||
| 2444 | Ga0207698_10005989 | |||
| 2445 | Ga0207698_10153205 | |||
| 2446 | Ga0207698_10257106 | |||
| 2447 | Ga0207698_10666931 | |||
| 2448 | Ga0209589_1000006 | |||
| 2449 | Ga0209489_100007 | |||
| 2450 | Ga0209700_100008 | |||
| 2451 | Ga0209179_1005350 | |||
| 2452 | Ga0209179_1014263 | |||
| 2453 | Ga0209588_1001156 | |||
| 2454 | Ga0209588_1046820 | |||
| 2455 | Ga0207428_10094389 | |||
| 2456 | Ga0207428_10391742 | |||
| 2457 | Ga0268266_10002524 | |||
| 2458 | Ga0268266_10002721 | |||
| 2459 | Ga0268266_10005528 | |||
| 2460 | Ga0268266_10008468 | |||
| 2461 | Ga0268266_10010821 | |||
| 2462 | Ga0268266_10181864 | |||
| 2463 | Ga0268266_10267273 | |||
| 2464 | Ga0268265_10007472 | |||
| 2465 | Ga0268265_10123881 | |||
| 2466 | Ga0268265_10164209 | |||
| 2467 | Ga0268265_10881527 | |||
| 2468 | Ga0268264_10000174 | |||
| 2469 | Ga0268264_10031810 | |||
| 2470 | Ga0268264_10055736 | |||
| 2471 | Ga0268264_10645447 | |||
| 2472 | Ga0265338_10069616 | |||
| 2473 | Ga0265338_10087780 | |||
| 2474 | Ga0265324_10006333 | |||
| 2475 | Ga0265330_10006018 | |||
| 2476 | Ga0265330_10168617 | |||
| 2477 | Ga0265332_10039386 | |||
| 2478 | Ga0265328_10000006 | |||
| 2479 | Ga0265328_10000450 | |||
| 2480 | Ga0265328_10009243 | |||
| 2481 | Ga0265328_10021734 | |||
| 2482 | Ga0265328_10051919 | |||
| 2483 | Ga0265328_10082408 | |||
| 2484 | Ga0265320_10002095 | |||
| 2485 | Ga0265325_10008854 | |||
| 2486 | Ga0265325_10013263 | |||
| 2487 | Ga0265325_10024250 | |||
| 2488 | Ga0265325_10026580 | |||
| 2489 | Ga0265325_10115409 | |||
| 2490 | Ga0265340_10003647 | |||
| 2491 | Ga0265340_10006812 | |||
| 2492 | Ga0265340_10033125 | |||
| 2493 | Ga0265340_10123680 | |||
| 2494 | Ga0265339_10000137 | |||
| 2495 | Ga0265339_10009370 | |||
| 2496 | Ga0265339_10030160 | |||
| 2497 | Ga0265339_10041964 | |||
| 2498 | Ga0265331_10000141 | |||
| 2499 | Ga0265331_10000145 | |||
| 2500 | Ga0265331_10000673 | |||
| 2501 | Ga0265331_10000882 | |||
| 2502 | Ga0265331_10019993 | |||
| 2503 | Ga0265331_10099921 | |||
| 2504 | Ga0265331_10133630 | |||
| 2505 | Ga0265327_10000033 | |||
| 2506 | Ga0265327_10000070 | |||
| 2507 | Ga0265327_10000703 | |||
| 2508 | Ga0265327_10008302 | |||
| 2509 | Ga0265327_10099810 | |||
| 2510 | Ga0265316_10000091 | |||
| 2511 | Ga0265316_10041888 | |||
| 2512 | Ga0265316_10068276 | |||
| 2513 | Ga0265316_10070886 | |||
| 2514 | Ga0265316_10398203 | |||
| 2515 | Ga0265316_10414470 | |||
| 2516 | Ga0265316_10621841 | |||
| 2517 | Ga0307509_10006398 | |||
| 2518 | Ga0307509_10046824 | |||
| 2519 | Ga0307509_10050219 | |||
| 2520 | Ga0307509_10283105 | |||
| 2521 | Ga0265313_10000269 | |||
| 2522 | Ga0265313_10000782 | |||
| 2523 | Ga0265313_10001300 | |||
| 2524 | Ga0265313_10080712 | |||
| 2525 | Ga0265313_10148342 | |||
| 2526 | Ga0307508_10000105 | |||
| 2527 | Ga0307508_10063281 | |||
| 2528 | Ga0307508_10094506 | |||
| 2529 | Ga0265314_10001057 | |||
| 2530 | Ga0265314_10002651 | |||
| 2531 | Ga0265314_10002789 | |||
| 2532 | Ga0265314_10006484 | |||
| 2533 | Ga0265314_10042742 | |||
| 2534 | Ga0265314_10061525 | |||
| 2535 | Ga0265314_10095947 | |||
| 2536 | Ga0265314_10176091 | |||
| 2537 | Ga0265342_10008664 | |||
| 2538 | Ga0265342_10019274 | |||
| 2539 | Ga0265342_10033550 | |||
| 2540 | Ga0265342_10041441 | |||
| 2541 | Ga0265342_10299282 | |||
| 2542 | Ga0316576_10389413 | |||
| 2543 | Ga0316578_10005177 | |||
| 2544 | Ga0307516_10000657 | |||
| 2545 | Ga0307516_10025929 | |||
| 2546 | Ga0307516_10046721 | |||
| 2547 | Ga0307516_10121468 | |||
| 2548 | Ga0307518_10422147 | |||
| 2549 | Ga0307406_10380002 | |||
| 2550 | Ga0307416_100285090 | |||
| 2551 | Ga0307415_100046127 | |||
| 2552 | Ga0316583_10000233 | |||
| 2553 | Ga0307507_10101126 | |||
| 2554 | Ga0307510_10027931 | |||
| 2555 | Ga0307510_10028847 | |||
| 2556 | Ga0307510_10032970 | |||
| 2557 | Ga0315911_1000003 | |||
| 2558 | Ga0316215_1003294 | |||
| 2559 | Ga0373959_0122038 | |||
| 2560 | Ga0373938_0014387 | |||
| 2561 | Ga0373926_0107403 | |||
| 2562 | Ga0373928_0010982 | |||
| 2563 | Ga0373934_0022581 | |||
| 2564 | Ga0373934_0095934 | |||
| 2565 | Ga0373940_0158077 | |||
| 2566 | Ga0373944_0019687 | |||
| 2567 | Ga0373944_0033857 | |||
| 2568 | Ga0373944_0129889 | |||
| 2569 | Ga0373949_0042525 | |||
| 2570 | Ga0373923_0012312 | |||
| 2571 | Ga0373923_0155147 | |||
| 2572 | Ga0373936_0000885 | |||
| 2573 | Ga0373936_0003367 | |||
| 2574 | Ga0373936_0095937 | |||
| 2575 | Ga0373939_0113964 | |||
| 2576 | Ga0373945_0007786 | |||
| 2577 | Ga0373945_0014890 | |||
| 2578 | Ga0373945_0016878 | |||
| 2579 | Ga0373945_0105297 | |||
| 2580 | Ga0373953_0004630 | |||
| 2581 | Ga0373953_0004698 | |||
| 2582 | Ga0373953_0036551 | |||
| 2583 | Ga0373953_0176723 | |||
| 2584 | Ga0373954_0000950 | |||
| 2585 | Ga0373954_0009404 | |||
| 2586 | Ga0373954_0023202 | |||
| 2587 | Ga0373954_0034271 | |||
| 2588 | Ga0373954_0042781 | |||
| 2589 | Ga0373954_0214303 | |||
| 2590 | Ga0373956_0066659 | |||
| 2591 | Ga0373956_0115695 | |||
| 2592 | Ga0373956_0134170 | |||
| 2593 | Ga0373957_0011342 | |||
| 2594 | Ga0373957_0014124 | |||
| 2595 | Ga0373957_0085738 | |||
| 2596 | Ga0373943_0014141 | |||
| 2597 | Ga0373943_0047480 | |||
| 2598 | Ga0373943_0057788 | |||
| 2599 | Ga0373943_0102654 | |||
| 2600 | Ga0373943_0128823 | |||
| 2601 | Ga0373943_0201324 | |||
| 2602 | Ga0373943_0252177 | |||
| 2603 | Ga0373943_0268221 | |||
| 2604 | Ga0373946_0001576 | |||
| 2605 | Ga0373946_0006921 | |||
| 2606 | Ga0373946_0039314 | |||
| 2607 | Ga0373946_0202706 | |||
| 2608 | Ga0373955_0000742 | |||
| 2609 | Ga0373955_0000886 | |||
| 2610 | Ga0373955_0047053 | |||
| 2611 | Ga0373955_0072915 | |||
| 2612 | Ga0373955_0164645 | |||
| 2613 | Ga0373961_0006767 | |||
| 2614 | Ga0316574_0293439 | |||
| 2615 | Ga0373924_0004542 | |||
| 2616 | Ga0373924_0010961 | |||
| 2617 | Ga0373924_0018781 | |||
| 2618 | Ga0373931_0008548 | |||
| 2619 | Ga0373931_0033811 | |||
| 2620 | Ga0373931_0036799 | |||
| 2621 | Ga0373931_0255773 | |||
| 2622 | Ga0373931_0272597 | |||
| 2623 | Ga0373935_0000096 | |||
| 2624 | Ga0373935_0000478 | |||
| 2625 | Ga0373935_0030724 | |||
| 2626 | Ga0373935_0056406 | |||
| 2627 | Ga0373935_0085096 | |||
| 2628 | Ga0373935_0164907 | |||
| 2629 | Ga0373935_0343190 | |||
| 2630 | Ga0373935_0386684 | |||
| 2631 | Ga0373927_0001272 | |||
| 2632 | Ga0373927_0002293 | |||
| 2633 | Ga0373927_0008757 | |||
| 2634 | Ga0373927_0018308 | |||
| 2635 | Ga0373927_0074347 | |||
| 2636 | Ga0373927_0136821 | |||
| 2637 | Ga0373927_0138432 | |||
| 2638 | Ga0373927_0157523 | |||
| 2639 | Ga0373927_0255099 | |||
| 2640 | Ga0373933_0001294 | |||
| 2641 | Ga0373933_0003722 | |||
| 2642 | Ga0373933_0042183 | |||
| 2643 | Ga0373933_0268650 | |||
| 2644 | Ga0373947_0000081 | |||
| 2645 | Ga0373947_0000843 | |||
| 2646 | Ga0373947_0007899 | |||
| 2647 | Ga0373947_0061030 | |||
| 2648 | Ga0373947_0062604 | |||
| 2649 | Ga0373947_0089470 | |||
| 2650 | Ga0373947_0166631 | |||
| 2651 | Ga0373947_0405417 | |||
| 2652 | Ga0373937_0000515 | |||
| 2653 | Ga0373937_0002933 | |||
| 2654 | Ga0373937_0005300 | |||
| 2655 | Ga0373937_0032217 | |||
| 2656 | Ga0373937_0043424 | |||
| 2657 | Ga0373937_0047034 | |||
| 2658 | Ga0373937_0067718 | |||
| 2659 | Ga0373937_0074952 | |||
| 2660 | Ga0373937_0148832 | |||
| 2661 | Ga0373937_0187739 | |||
| 2662 | Ga0373937_0423725 | |||
| 2663 | Ga0373937_0536984 | |||
| 2664 | Ga0373937_1094580 | |||
| 2665 | Ga0372808_004176 | |||
| 2666 | Ga0316582_0524902 | |||
| 2667 | Ga0316584_0006337 | |||
| 2668 | Ga0316584_0068926 | |||
| 2669 | Ga0316584_0141881 | |||
| 2670 | Ga0373925_0000011 | |||
| 2671 | Ga0373925_0001296 | |||
| 2672 | Ga0373925_0025284 | |||
| 2673 | Ga0373925_0079999 | |||
| 2674 | Ga0373925_0109099 | |||
| 2675 | Ga0373925_0112460 | |||
| 2676 | Ga0373925_0123453 | |||
| 2677 | Ga0373925_0138814 | |||
| 2678 | Ga0373925_0426242 | |||
| 2679 | Ga0373925_0644329 | |||
| 2680 | Ga0395899_0101941 | |||
| 2681 | Ga0395900_0347141 | |||
| 2682 | Ga0395898_0022529 | |||
| 2683 | Ga0395898_0030141 | |||
| 2684 | Ga0395905_0001778 | |||
| 2685 | Ga0395905_0020451 | |||
| 2686 | Ga0436364_0489075 | |||
| 2687 | Ga0395901_0352855 | |||
| 2688 | Ga0395901_1153766 | |||
| 2689 | Ga0436365_0081603 | |||
| 2690 | Ga0436365_0808140 | |||
| 2691 | Ga0436360_0050348 | |||
| 2692 | Ga0436360_0170277 | |||
| 2693 | Ga0436360_0320963 | |||
| 2694 | Ga0436360_1074814 | |||
| 2695 | Ga0436360_1356508 | |||
| 2696 | Ga0436361_0256757 | |||
| 2697 | Ga0436361_0369023 | |||
| 2698 | Ga0436361_0452542 | |||
| 2699 | Ga0436361_0539018 | |||
| 2700 | Ga0436361_0740814 | |||
| 2701 | Ga0436361_0825589 | |||
| 2702 | Ga0436361_1002425 | |||
| 2703 | Ga0436363_0202525 | |||
| 2704 | Ga0436363_0419001 | |||
| 2705 | Ga0436363_0510027 | |||
| 2706 | Ga0436363_0772297 | |||
| 2707 | Ga0436363_0947874 | |||
| 2708 | Ga0436363_1300598 | |||
| 2709 | Ga0436362_0138375 | |||
| 2710 | Ga0436362_0756530 | |||
| 2711 | Ga0439453_0000337 | |||
| 2712 | Ga0451793_1820481 | |||
| 2713 | Ga0439442_039143 | |||
| 2714 | Ga0439443_020201 | |||
| 2715 | Ga0439434_0137912 | |||
| 2716 | Ga0439435_0003544 | |||
| 2717 | Ga0439435_0010286 | |||
| 2718 | Ga0451577_0341346 | |||
| 2719 | Ga0453683_0012709 | |||
| 2720 | Ga0466966_0047159 | |||
| 2721 | Ga0466963_0035869 | |||
| 2722 | Ga0466963_0255841 | |||
| 2723 | Ga0453684_0000006 | |||
| 2724 | Ga0453684_0000031 | |||
| 2725 | Ga0453684_0032690 | |||
| 2726 | Ga0453684_0037507 | |||
| 2727 | Ga0453684_0054779 | |||
| 2728 | Ga0453684_0720980 | |||
| 2729 | Ga0466957_0014629 | |||
| 2730 | Ga0466959_0142724 | |||
| 2731 | Ga0451576_0000056 | |||
| 2732 | Ga0451576_0000919 | |||
| 2733 | Ga0451576_0024090 | |||
| 2734 | Ga0451576_0111401 | |||
| 2735 | Ga0466958_0196272 | |||
| 2736 | Ga0466967_0071219 | |||
| 2737 | Ga0495592_0000493 | |||
| 2738 | Ga0495592_0027393 | |||
| 2739 | Ga0495592_0058610 | |||
| 2740 | Ga0495592_0132347 | |||
| 2741 | Ga0495592_0145179 | |||
| 2742 | Ga0495592_0344353 | |||
| 2743 | Ga0495603_0002952 | |||
| 2744 | Ga0495603_0004318 | |||
| 2745 | Ga0495603_0008319 | |||
| 2746 | Ga0495603_0018514 | |||
| 2747 | Ga0495603_0102521 | |||
| 2748 | Ga0495590_0044817 | |||
| 2749 | Ga0495590_0063082 | |||
| 2750 | Ga0495629_0002893 | |||
| 2751 | Ga0495629_0003465 | |||
| 2752 | Ga0495629_0032712 | |||
| 2753 | Ga0495629_0046403 | |||
| 2754 | Ga0495629_0074389 | |||
| 2755 | Ga0495629_0099874 | |||
| 2756 | Ga0495629_0193713 | |||
| 2757 | Ga0495629_0390467 | |||
| 2758 | Ga0495638_0011130 | |||
| 2759 | Ga0495638_0151907 | |||
| 2760 | Ga0495641_0002491 | |||
| 2761 | Ga0495641_0217332 | |||
| 2762 | Ga0495651_0000364 | |||
| 2763 | Ga0495651_0015118 | |||
| 2764 | Ga0495651_0018706 | |||
| 2765 | Ga0495651_0090272 | |||
| 2766 | Ga0495651_0098904 | |||
| 2767 | Ga0495651_0131710 | |||
| 2768 | Ga0495653_0000398 | |||
| 2769 | Ga0495653_0025322 | |||
| 2770 | Ga0495653_0032960 | |||
| 2771 | Ga0495653_0076978 | |||
| 2772 | Ga0495653_0130834 | |||
| 2773 | Ga0495653_0155527 | |||
| 2774 | Ga0495580_0000749 | |||
| 2775 | Ga0495580_0006621 | |||
| 2776 | Ga0495580_0072398 | |||
| 2777 | Ga0495580_0120756 | |||
| 2778 | Ga0495580_0519254 | |||
| 2779 | Ga0495582_0000038 | |||
| 2780 | Ga0495582_0104553 | |||
| 2781 | Ga0495605_0135223 | |||
| 2782 | Ga0495605_0260953 | |||
| 2783 | Ga0495639_0000092 | |||
| 2784 | Ga0495639_0014639 | |||
| 2785 | Ga0495639_0020661 | |||
| 2786 | Ga0495639_0158744 | |||
| 2787 | Ga0495662_0002976 | |||
| 2788 | Ga0495662_0008650 | |||
| 2789 | Ga0495662_0040962 | |||
| 2790 | Ga0495662_0340939 | |||
| 2791 | Ga0495664_0000019 | |||
| 2792 | Ga0495664_0002736 | |||
| 2793 | Ga0495664_0003467 | |||
| 2794 | Ga0495664_0008379 | |||
| 2795 | Ga0495664_0010424 | |||
| 2796 | Ga0495664_0087932 | |||
| 2797 | Ga0495664_0278017 | |||
| 2798 | Ga0495584_0020845 | |||
| 2799 | Ga0495584_0074952 | |||
| 2800 | Ga0495585_0030191 | |||
| 2801 | Ga0495585_0150291 | |||
| 2802 | Ga0495594_0001994 | |||
| 2803 | Ga0495594_0161170 | |||
| 2804 | Ga0495594_0167624 | |||
| 2805 | Ga0495594_0263434 | |||
| 2806 | Ga0495596_0131316 | |||
| 2807 | Ga0495606_0291294 | |||
| 2808 | Ga0495608_0000026 | |||
| 2809 | Ga0495608_0040232 | |||
| 2810 | Ga0495608_0090254 | |||
| 2811 | Ga0495616_0037108 | |||
| 2812 | Ga0495616_0193452 | |||
| 2813 | Ga0495618_0000015 | |||
| 2814 | Ga0495618_0000705 | |||
| 2815 | Ga0495618_0015933 | |||
| 2816 | Ga0495618_0038274 | |||
| 2817 | Ga0495618_0045102 | |||
| 2818 | Ga0495618_0075820 | |||
| 2819 | Ga0495620_0038186 | |||
| 2820 | Ga0495620_0105029 | |||
| 2821 | Ga0495628_0000006 | |||
| 2822 | Ga0495628_0074103 | |||
| 2823 | Ga0495628_0082302 | |||
| 2824 | Ga0495630_0001838 | |||
| 2825 | Ga0495630_0004473 | |||
| 2826 | Ga0495630_0009360 | |||
| 2827 | Ga0495630_0034189 | |||
| 2828 | Ga0495630_0042211 | |||
| 2829 | Ga0495630_0233841 | |||
| 2830 | Ga0495631_0013380 | |||
| 2831 | Ga0495631_0044415 | |||
| 2832 | Ga0495632_0154205 | |||
| 2833 | Ga0495643_0089309 | |||
| 2834 | Ga0495644_0016167 | |||
| 2835 | Ga0495644_0249174 | |||
| 2836 | Ga0495648_0015002 | |||
| 2837 | Ga0495648_0143397 | |||
| 2838 | Ga0495648_0152429 | |||
| 2839 | Ga0495648_0188554 | |||
| 2840 | Ga0495663_0014873 | |||
| 2841 | Ga0495666_0006104 | |||
| 2842 | Ga0495666_0007530 | |||
| 2843 | Ga0495652_0000030 | |||
| 2844 | Ga0495652_0019294 | |||
| 2845 | Ga0495652_0032264 | |||
| 2846 | Ga0495652_0035784 | |||
| 2847 | Ga0495652_0252724 | |||
| 2848 | Ga0495665_0000186 | |||
| 2849 | Ga0495665_0017149 | |||
| 2850 | Ga0495665_0036835 | |||
| 2851 | Ga0495665_0090938 | |||
| 2852 | Ga0495640_0000246 | |||
| 2853 | Ga0495640_0001008 | |||
| 2854 | Ga0495640_0002127 | |||
| 2855 | Ga0495640_0037739 | |||
| 2856 | Ga0495640_0060449 | |||
| 2857 | Ga0495640_0233108 | |||
| 2858 | Ga0495640_0303996 | |||
| 2859 | Ga0495586_0331955 | |||
| 2860 | Ga0495586_0384130 | |||
| 2861 | Ga0495587_0000021 | |||
| 2862 | Ga0495587_0144911 | |||
| 2863 | Ga0495587_0217249 | |||
| 2864 | Ga0495587_0240169 | |||
| 2865 | Ga0495598_0002784 | |||
| 2866 | Ga0495598_0111028 | |||
| 2867 | Ga0495621_0018686 | |||
| 2868 | Ga0495645_0000001 | |||
| 2869 | Ga0495645_0019743 | |||
| 2870 | Ga0495645_0023021 | |||
| 2871 | Ga0495645_0034293 | |||
| 2872 | Ga0495645_0156786 | |||
| 2873 | Ga0495645_0474007 | |||
| 2874 | Ga0495622_0012358 | |||
| 2875 | Ga0495622_0027174 | |||
| 2876 | Ga0495622_0066724 | |||
| 2877 | Ga0495667_0000027 | |||
| 2878 | Ga0495667_0013545 | |||
| 2879 | Ga0495667_0117742 | |||
| 2880 | Ga0495667_0154015 | |||
| 2881 | Ga0495667_0257268 | |||
| 2882 | Ga0495656_0003198 | |||
| 2883 | Ga0495656_0068974 | |||
| 2884 | Ga0495668_0011373 | |||
| 2885 | Ga0495668_0015058 | |||
| 2886 | Ga0495668_0099735 | |||
| 2887 | Ga0495634_0000008 | |||
| 2888 | Ga0495634_0000706 | |||
| 2889 | Ga0495634_0015350 | |||
| 2890 | Ga0495634_0021107 | |||
| 2891 | Ga0495634_0023535 | |||
| 2892 | Ga0495611_0012542 | |||
| 2893 | Ga0495625_0050870 | |||
| 2894 | Ga0495625_0081568 | |||
| 2895 | Ga0495625_0245777 | |||
| 2896 | Ga0495635_0000028 | |||
| 2897 | Ga0495635_0002553 | |||
| 2898 | Ga0495635_0012050 | |||
| 2899 | Ga0495635_0022409 | |||
| 2900 | Ga0495635_0039315 | |||
| 2901 | Ga0495635_0061392 | |||
| 2902 | Ga0495635_0103202 | |||
| 2903 | Ga0495635_0163069 | |||
| 2904 | Ga0495659_0033429 | |||
| 2905 | Ga0495661_0034000 | |||
| 2906 | Ga0495588_0003404 | |||
| 2907 | Ga0495588_0113239 | |||
| 2908 | Ga0495588_0231807 | |||
| 2909 | Ga0495588_0246739 | |||
| 2910 | Ga0495657_0004008 | |||
| 2911 | Ga0495657_0031662 | |||
| 2912 | Ga0495657_0305561 | |||
| 2913 | Ga0495599_0000232 | |||
| 2914 | Ga0495599_0044273 | |||
| 2915 | Ga0495623_0000448 | |||
| 2916 | Ga0495623_0098569 | |||
| 2917 | Ga0495623_0128708 | |||
| 2918 | Ga0495646_0000148 | |||
| 2919 | Ga0495646_0032422 | |||
| 2920 | Ga0495646_0122361 | |||
| 2921 | Ga0495646_0161842 | |||
| 2922 | Ga0495646_0377122 | |||
| 2923 | Ga0495647_0000203 | |||
| 2924 | Ga0495647_0008947 | |||
| 2925 | Ga0495647_0047420 | |||
| 2926 | Ga0495647_0238845 | |||
| 2927 | Ga0495658_0001537 | |||
| 2928 | Ga0495658_0015719 | |||
| 2929 | Ga0495658_0016381 | |||
| 2930 | Ga0495658_0056336 | |||
| 2931 | Ga0495658_0065199 | |||
| 2932 | Ga0495669_0009514 | |||
| 2933 | Ga0495669_0282784 | |||
| 2934 | Ga0495613_0017873 | |||
| 2935 | Ga0495613_0022543 | |||
| 2936 | Ga0495613_0079448 | |||
| 2937 | Ga0495613_0120984 | |||
| 2938 | Ga0495613_0121448 | |||
| 2939 | Ga0495613_0190890 | |||
| 2940 | Ga0495613_0198031 | |||
| 2941 | Ga0495613_0538409 | |||
| 2942 | Ga0495624_0001987 | |||
| 2943 | Ga0495624_0018144 | |||
| 2944 | Ga0495624_0029729 | |||
| 2945 | Ga0495624_0044550 | |||
| 2946 | Ga0495624_0063304 | |||
| 2947 | Ga0495624_0327486 | |||
| 2948 | Ga0495670_0003950 | |||
| 2949 | Ga0495670_0022339 | |||
| 2950 | Ga0495670_0201466 | |||
| 2951 | Ga0495670_0313003 | |||
| 2952 | Ga0495671_0067264 | |||
| 2953 | Ga0495671_0186494 | |||
| 2954 | Ga0495649_0127772 | |||
| 2955 | Ga0495649_0284314 | |||
| 2956 | Ga0495589_0057399 | |||
| 2957 | Ga0495589_0097600 | |||
| 2958 | Ga0495600_0000195 | |||
| 2959 | Ga0495600_0002506 | |||
| 2960 | Ga0495600_0020494 | |||
| 2961 | Ga0495600_0025066 | |||
| 2962 | Ga0495600_0059898 | |||
| 2963 | Ga0495600_0163254 | |||
| 2964 | Ga0495660_0311530 | |||
| 2965 | Ga0495581_0000019 | |||
| 2966 | Ga0495581_0013871 | |||
| 2967 | Ga0495581_0088455 | |||
| 2968 | Ga0495581_0157969 | |||
| 2969 | Ga0495581_0175987 | |||
| 2970 | Ga0495581_0183224 | |||
| 2971 | Ga0495581_0263521 | |||
| 2972 | Ga0495581_0319024 | |||
| 2973 | Ga0495604_0000002 | |||
| 2974 | Ga0495604_0009212 | |||
| 2975 | Ga0495604_0034714 | |||
| 2976 | Ga0495604_0079171 | |||
| 2977 | Ga0495604_0085241 | |||
| 2978 | Ga0495604_0276700 | |||
| 2979 | Ga0495636_0034181 | |||
| 2980 | Ga0495674_0000004 | |||
| 2981 | Ga0495674_0003455 | |||
| 2982 | Ga0495674_0048516 | |||
| 2983 | Ga0495674_0168307 | |||
| 2984 | Ga0495674_0270718 | |||
| 2985 | Ga0495674_0290211 | |||
| 2986 | Ga0495672_0149882 | |||
| 2987 | Ga0495672_0171915 | |||
| 2988 | Ga0495676_0020934 | |||
| 2989 | Ga0495676_0048740 | |||
| 2990 | Ga0495676_0078890 | |||
| 2991 | Ga0495676_0095015 | |||
| 2992 | Ga0495676_0298644 | |||
| 2993 | Ga0495680_0001465 | |||
| 2994 | Ga0495680_0003584 | |||
| 2995 | Ga0495680_0015898 | |||
| 2996 | Ga0495680_0033269 | |||
| 2997 | Ga0495680_0035652 | |||
| 2998 | Ga0495680_0081665 | |||
| 2999 | Ga0495680_0305013 | |||
| 3000 | Ga0495683_0023073 | |||
| 3001 | Ga0495675_0000351 | |||
| 3002 | Ga0495675_0020965 | |||
| 3003 | Ga0495675_0124763 | |||
| 3004 | Ga0495675_0157773 | |||
| 3005 | Ga0495677_0014595 | |||
| 3006 | Ga0495677_0015227 | |||
| 3007 | Ga0495677_0141474 | |||
| 3008 | Ga0495679_039674 | |||
| 3009 | Ga0495685_124816 | |||
| 3010 | Ga0495673_0013698 | |||
| 3011 | Ga0495673_0018331 | |||
| 3012 | Ga0495673_0162883 | |||
| 3013 | Ga0495684_0000004 | |||
| 3014 | Ga0495684_0002699 | |||
| 3015 | Ga0495684_0006327 | |||
| 3016 | Ga0495684_0011826 | |||
| 3017 | Ga0495684_0026662 | |||
| 3018 | Ga0495684_0148165 | |||
| 3019 | Ga0495684_0251155 | |||
| 3020 | Ga0495686_0074432 | |||
| 3021 | Ga0495686_0140297 | |||
| 3022 | Ga0495593_0000250 | |||
| 3023 | Ga0495593_0007024 | |||
| 3024 | Ga0495593_0031371 | |||
| 3025 | Ga0495593_0039653 | |||
| 3026 | Ga0495593_0083810 | |||
| 3027 | Ga0495593_0188875 | |||
| 3028 | Ga0495602_0000001 | |||
| 3029 | Ga0495602_0015663 | |||
| 3030 | Ga0495602_0039711 | |||
| 3031 | Ga0495602_0488502 | |||
| 3032 | Ga0495614_0084919 | |||
| 3033 | Ga0495626_0058422 | |||
| 3034 | Ga0496100_0000842 | |||
| 3035 | Ga0496100_0025238 | |||
| 3036 | Ga0496100_0046119 | |||
| 3037 | Ga0496100_0310976 | |||
| 3038 | Ga0496100_0392737 | |||
| 3039 | Ga0496100_0403206 | |||
| 3040 | Ga0496100_0532549 | |||
| 3041 | Ga0496100_0584448 | |||
| 3042 | Ga0496100_0709386 | |||
| 3043 | Ga0496101_0001211 | |||
| 3044 | Ga0496101_0010196 | |||
| 3045 | Ga0496101_0032129 | |||
| 3046 | Ga0496101_0037494 | |||
| 3047 | Ga0496101_0051165 | |||
| 3048 | Ga0496101_0060112 | |||
| 3049 | Ga0496101_0183719 | |||
| 3050 | Ga0496101_0201052 | |||
| 3051 | Ga0496101_0233004 | |||
| 3052 | Ga0496101_0542824 | |||
| 3053 | Ga0496102_0000617 | |||
| 3054 | Ga0496102_0011697 | |||
| 3055 | Ga0496102_0028987 | |||
| 3056 | Ga0496102_0029422 | |||
| 3057 | Ga0496102_0068983 | |||
| 3058 | Ga0496102_0093582 | |||
| 3059 | Ga0496102_0310052 | |||
| 3060 | Ga0496102_0463740 | |||
| 3061 | Ga0496103_0007489 | |||
| 3062 | Ga0496103_0010791 | |||
| 3063 | Ga0496103_0010836 | |||
| 3064 | Ga0496103_0032320 | |||
| 3065 | Ga0496103_0035956 | |||
| 3066 | Ga0496103_0126230 | |||
| 3067 | Ga0496104_0000538 | |||
| 3068 | Ga0496104_0000602 | |||
| 3069 | Ga0496104_0001834 | |||
| 3070 | Ga0496104_0006005 | |||
| 3071 | Ga0496104_0011586 | |||
| 3072 | Ga0496104_0022907 | |||
| 3073 | Ga0496104_0023409 | |||
| 3074 | Ga0496104_0030685 | |||
| 3075 | Ga0496104_0033068 | |||
| 3076 | Ga0496104_0046946 | |||
| 3077 | Ga0496104_0170737 | |||
| 3078 | Ga0496104_0245800 | |||
| 3079 | Ga0496104_0276427 | |||
| 3080 | Ga0496105_0002373 | |||
| 3081 | Ga0496105_0004135 | |||
| 3082 | Ga0496105_0022659 | |||
| 3083 | Ga0496105_0026177 | |||
| 3084 | Ga0496105_0050267 | |||
| 3085 | Ga0496105_0054388 | |||
| 3086 | Ga0496105_0078540 | |||
| 3087 | Ga0496105_0176113 | |||
| 3088 | Ga0496105_0226816 | |||
| 3089 | Ga0496105_0295102 | |||
| 3090 | Ga0496105_0506829 | |||
| 3091 | Ga0496105_0549099 | |||
| 3092 | Ga0496105_0792354 | |||
| 3093 | Ga0496106_0000405 | |||
| 3094 | Ga0496106_0013666 | |||
| 3095 | Ga0496106_0026406 | |||
| 3096 | Ga0496106_0036756 | |||
| 3097 | Ga0496106_0070055 | |||
| 3098 | Ga0496106_0092378 | |||
| 3099 | Ga0496106_0347998 | |||
| 3100 | Ga0496107_0001082 | |||
| 3101 | Ga0496107_0001145 | |||
| 3102 | Ga0496107_0030443 | |||
| 3103 | Ga0496107_0046438 | |||
| 3104 | Ga0496107_0154833 | |||
| 3105 | Ga0496107_0170673 | |||
| 3106 | Ga0496107_0271152 | |||
| 3107 | Ga0496108_0001230 | |||
| 3108 | Ga0496108_0003869 | |||
| 3109 | Ga0496108_0012570 | |||
| 3110 | Ga0496108_0014737 | |||
| 3111 | Ga0496108_0021443 | |||
| 3112 | Ga0496108_0029580 | |||
| 3113 | Ga0496108_0034009 | |||
| 3114 | Ga0496108_0183347 | |||
| 3115 | Ga0496108_0238341 | |||
| 3116 | Ga0496108_0378507 | |||
| 3117 | Ga0496108_0572736 | |||
| 3118 | Ga0496109_0002911 | |||
| 3119 | Ga0496109_0004441 | |||
| 3120 | Ga0496109_0006129 | |||
| 3121 | Ga0496109_0006276 | |||
| 3122 | Ga0496109_0008231 | |||
| 3123 | Ga0496109_0052215 | |||
| 3124 | Ga0496109_0096114 | |||
| 3125 | Ga0496109_0107547 | |||
| 3126 | Ga0496109_0123808 | |||
| 3127 | Ga0496109_0312075 | |||
| 3128 | Ga0496109_0316444 | |||
| 3129 | Ga0496109_0613669 | |||
| 3130 | Ga0496109_0905120 | |||
| 3131 | Ga0496110_0000468 | |||
| 3132 | Ga0496110_0017492 | |||
| 3133 | Ga0496110_0019783 | |||
| 3134 | Ga0496110_0032199 | |||
| 3135 | Ga0496110_0035095 | |||
| 3136 | Ga0496110_0075221 | |||
| 3137 | Ga0496110_0093168 | |||
| 3138 | Ga0496110_0102346 | |||
| 3139 | Ga0496110_0131034 | |||
| 3140 | Ga0496110_0151100 | |||
| 3141 | Ga0496110_0177650 | |||
| 3142 | Ga0496110_0217966 | |||
| 3143 | Ga0496110_0257669 | |||
| 3144 | Ga0496111_0001165 | |||
| 3145 | Ga0496111_0001714 | |||
| 3146 | Ga0496111_0004338 | |||
| 3147 | Ga0496111_0036936 | |||
| 3148 | Ga0496111_0086310 | |||
| 3149 | Ga0496111_0117006 | |||
| 3150 | Ga0496111_0243138 | |||
| 3151 | Ga0496112_0000014 | |||
| 3152 | Ga0496112_0000527 | |||
| 3153 | Ga0496112_0003749 | |||
| 3154 | Ga0496112_0011543 | |||
| 3155 | Ga0496112_0012163 | |||
| 3156 | Ga0496112_0038471 | |||
| 3157 | Ga0496112_0070265 | |||
| 3158 | Ga0496112_0089626 | |||
| 3159 | Ga0496112_0092100 | |||
| 3160 | Ga0496112_0113744 | |||
| 3161 | Ga0496112_0189750 | |||
| 3162 | Ga0496112_0279636 | |||
| 3163 | Ga0496112_0473916 | |||
| 3164 | Ga0496113_0001893 | |||
| 3165 | Ga0496113_0003961 | |||
| 3166 | Ga0496113_0010110 | |||
| 3167 | Ga0496113_0037525 | |||
| 3168 | Ga0496113_0055397 | |||
| 3169 | Ga0496113_0164171 | |||
| 3170 | Ga0496113_0192022 | |||
| 3171 | Ga0496114_0084167 | |||
| 3172 | Ga0496114_0097669 | |||
| 3173 | Ga0496114_0104086 | |||
| 3174 | Ga0496114_0125366 | |||
| 3175 | Ga0496114_0150849 | |||
| 3176 | Ga0496114_0252240 | |||
| 3177 | Ga0496114_0311775 | |||
| 3178 | Ga0496114_0673136 | |||
| 3179 | Ga0496115_0006200 | |||
| 3180 | Ga0496115_0021274 | |||
| 3181 | Ga0496115_0069948 | |||
| 3182 | Ga0496115_0073218 | |||
| 3183 | Ga0496115_0117378 | |||
| 3184 | Ga0496115_0193467 | |||
| 3185 | Ga0496115_0201937 | |||
| 3186 | Ga0496115_0220417 | |||
| 3187 | Ga0496115_0220700 | |||
| 3188 | Ga0496115_0223030 | |||
| 3189 | Ga0496115_0231694 | |||
| 3190 | Ga0496115_0330050 | |||
| 3191 | Ga0496115_0477846 | |||
| 3192 | Ga0496115_0642331 | |||
| 3193 | Ga0496116_0069466 | |||
| 3194 | Ga0496117_0001758 | |||
| 3195 | Ga0496117_0076566 | |||
| 3196 | Ga0496117_0100245 | |||
| 3197 | Ga0496118_0017789 | |||
| 3198 | Ga0496118_0081995 | |||
| 3199 | Ga0496118_0111000 | |||
| 3200 | Ga0496119_0018215 | |||
| 3201 | Ga0496120_0006082 | |||
| 3202 | Ga0496121_0000283 | |||
| 3203 | Ga0496121_0023892 | |||
| 3204 | Ga0496121_0054093 | |||
| 3205 | Ga0496121_0057138 | |||
| 3206 | Ga0496121_0060601 | |||
| 3207 | Ga0496121_0097563 | |||
| 3208 | Ga0496121_0128993 | |||
| 3209 | Ga0496121_0190012 | |||
| 3210 | Ga0496121_0218313 | |||
| 3211 | Ga0496122_0077145 | |||
| 3212 | Ga0496124_0065553 | |||
| 3213 | Ga0496124_0076754 | |||
| 3214 | Ga0496124_0114179 | |||
| 3215 | Ga0496124_0130174 | |||
| 3216 | Ga0496125_0019849 | |||
| 3217 | Ga0496125_0030819 | |||
| 3218 | Ga0496125_0043700 | |||
| 3219 | Ga0496126_0129226 | |||
| 3220 | Ga0496126_0145419 | |||
| 3221 | Ga0496126_0170067 | |||
| 3222 | Ga0495682_0087690 | |||
| 3223 | Ga0501031_0026174 | |||
| 3224 | Ga0501031_0499363 | |||
| 3225 | Ga0501032_0092511 | |||
| 3226 | Ga0501032_0448186 | |||
| 3227 | Ga0501033_0046869 | |||
| 3228 | Ga0501033_0120574 | |||
| 3229 | Ga0501033_0551945 | |||
| 3230 | Ga0501034_0035866 | |||
| 3231 | Ga0501034_0318667 | |||
| 3232 | Ga0501036_0002481 | |||
| 3233 | Ga0501036_0058938 | |||
| 3234 | Ga0501036_0364868 | |||
| 3235 | Ga0501037_0023005 | |||
| 3236 | Ga0501037_0057904 | |||
| 3237 | Ga0501038_0011597 | |||
| 3238 | Ga0501038_0043917 | |||
| 3239 | Ga0501038_0090782 | |||
| 3240 | Ga0501038_0164254 | |||
| 3241 | Ga0501039_0021356 | |||
| 3242 | Ga0501039_0208491 | |||
| 3243 | Ga0501040_0009859 | |||
| 3244 | Ga0501040_0077664 | |||
| 3245 | Ga0501040_0188368 | |||
| 3246 | Ga0501040_0225898 | |||
| 3247 | Ga0501041_0014421 | |||
| 3248 | Ga0501041_0032605 | |||
| 3249 | Ga0501041_0153040 | |||
| 3250 | Ga0501042_0005234 | |||
| 3251 | Ga0501042_0037155 | |||
| 3252 | Ga0501042_0099205 | |||
| 3253 | Ga0501042_0277750 | |||
| 3254 | Ga0501042_0283153 | |||
| 3255 | Ga0501042_0489477 | |||
| 3256 | Ga0501043_0013428 | |||
| 3257 | Ga0501043_0080598 | |||
| 3258 | Ga0501046_0014699 | |||
| 3259 | Ga0501046_0019015 | |||
| 3260 | Ga0501046_0025386 | |||
| 3261 | Ga0501046_0216313 | |||
| 3262 | Ga0501046_0255288 | |||
| 3263 | Ga0501047_0089977 | |||
| 3264 | Ga0501047_0096900 | |||
| 3265 | Ga0501047_0343159 | |||
| 3266 | Ga0501048_0006475 | |||
| 3267 | Ga0501048_0094232 | |||
| 3268 | Ga0501048_0228067 | |||
| 3269 | Ga0501048_0719108 | |||
| 3270 | Ga0501067_0035095 | |||
| 3271 | Ga0501068_0031554 | |||
| 3272 | Ga0501068_0076309 | |||
| 3273 | Ga0501069_0060890 | |||
| 3274 | Ga0501069_0148389 | |||
| 3275 | Ga0501070_0021833 | |||
| 3276 | Ga0501070_0206954 | |||
| 3277 | Ga0501070_0213456 | |||
| 3278 | Ga0501070_0235098 | |||
| 3279 | Ga0501070_0245273 | |||
| 3280 | Ga0501070_0250744 | |||
| 3281 | Ga0501071_0051680 | |||
| 3282 | Ga0501071_0339764 | |||
| 3283 | Ga0501071_0458531 | |||
| 3284 | Ga0501072_0001512 | |||
| 3285 | Ga0501072_0013914 | |||
| 3286 | Ga0501072_0042411 | |||
| 3287 | Ga0501072_0065633 | |||
| 3288 | Ga0501072_0095047 | |||
| 3289 | Ga0501072_0160351 | |||
| 3290 | Ga0501072_0716275 | |||
| 3291 | Ga0501073_0005592 | |||
| 3292 | Ga0501073_0019034 | |||
| 3293 | Ga0501073_0184961 | |||
| 3294 | Ga0501073_0226023 | |||
| 3295 | Ga0501073_0238326 | |||
| 3296 | Ga0501073_0296907 | |||
| 3297 | Ga0501074_0027303 | |||
| 3298 | Ga0501074_0043753 | |||
| 3299 | Ga0501074_0464979 | |||
| 3300 | Ga0501074_0724765 | |||
| 3301 | Ga0501075_0160035 | |||
| 3302 | Ga0501075_0219008 | |||
| 3303 | Ga0501075_0467879 | |||
| 3304 | Ga0501076_0026862 | |||
| 3305 | Ga0501076_0101972 | |||
| 3306 | Ga0501076_0114869 | |||
| 3307 | Ga0501076_0178900 | |||
| 3308 | Ga0501076_0197265 | |||
| 3309 | Ga0501076_0309785 | |||
| 3310 | Ga0501077_0003968 | |||
| 3311 | Ga0501077_0008803 | |||
| 3312 | Ga0501077_0021498 | |||
| 3313 | Ga0501077_0097546 | |||
| 3314 | Ga0501077_0209235 | |||
| 3315 | Ga0501077_0335716 | |||
| 3316 | Ga0501077_0512926 | |||
| 3317 | Ga0501079_0001178 | |||
| 3318 | Ga0501079_0046758 | |||
| 3319 | Ga0501079_0049659 | |||
| 3320 | Ga0501079_0081736 | |||
| 3321 | Ga0501079_0161339 | |||
| 3322 | Ga0501079_0615055 | |||
| 3323 | Ga0501079_0700644 | |||
| 3324 | Ga0501080_0007750 | |||
| 3325 | Ga0501080_0100700 | |||
| 3326 | Ga0501080_0138185 | |||
| 3327 | Ga0501080_0184529 | |||
| 3328 | Ga0501080_0241087 | |||
| 3329 | Ga0501081_0013714 | |||
| 3330 | Ga0501081_0057512 | |||
| 3331 | Ga0501081_0081853 | |||
| 3332 | Ga0501081_0118370 | |||
| 3333 | Ga0501081_0139745 | |||
| 3334 | Ga0501081_0459323 | |||
| 3335 | Ga0501083_0085981 | |||
| 3336 | Ga0501083_0117991 | |||
| 3337 | Ga0501083_0233603 | |||
| 3338 | Ga0501035_0068660 | |||
| 3339 | Ga0501035_0420111 | |||
| 3340 | Ga0501035_0475011 | |||
| 3341 | Ga0501035_0779311 | |||
| 3342 | Ga0501044_0074734 | |||
| 3343 | Ga0501044_0137435 | |||
| 3344 | Ga0501045_0020987 | |||
| 3345 | Ga0501045_0024775 | |||
| 3346 | Ga0501045_0039471 | |||
| 3347 | Ga0501045_0041521 | |||
| 3348 | Ga0501045_0278970 | |||
| 3349 | Ga0501045_0531644 | |||
| 3350 | nmdc:mga03683_17787_c1 | |||
| 3351 | nmdc:mga00v17_188659_c1 | |||
| 3352 | nmdc:mga00v17_25224_c1 | |||
| 3353 | nmdc:mga00v17_2904_c1 | |||
| 3354 | nmdc:mga0yw44_119488_c1 | |||
| 3355 | nmdc:mga0yw44_1963_c1 | |||
| 3356 | nmdc:mga0yw44_6715_c1 | |||
| 3357 | nmdc:mga0yw44_70010_c1 | |||
| 3358 | nmdc:mga0yw44_77943_c1 | |||
| 3359 | nmdc:mga06z11_26813_c1 | |||
| 3360 | nmdc:mga06z11_442474_c1 | |||
| 3361 | nmdc:mga06z11_65144_c1 | |||
| 3362 | nmdc:mga04h51_23443_c1 | |||
| 3363 | nmdc:mga07m45_177619_c1 | |||
| 3364 | nmdc:mga07m45_21851_c1 | |||
| 3365 | nmdc:mga07m45_34845_c1 | |||
| 3366 | nmdc:mga05p37_137815_c1 | |||
| 3367 | nmdc:mga05p37_250969_c1 | |||
| 3368 | nmdc:mga05p37_329373_c1 | |||
| 3369 | nmdc:mga05p37_442270_c1 | |||
| 3370 | nmdc:mga05p37_4993_c2 | |||
| 3371 | nmdc:mga05p37_548803_c1 | |||
| 3372 | nmdc:mga09592_280592_c1 | |||
| 3373 | nmdc:mga09592_374686_c1 | |||
| 3374 | nmdc:mga09592_78389_c1 | |||
| 3375 | nmdc:mga0qj67_348644_c1 | |||
| 3376 | nmdc:mga0qj67_602649_c1 | |||
| 3377 | nmdc:mga0qj67_786278_c1 | |||
| 3378 | nmdc:mga06r32_136705_c1 | |||
| 3379 | nmdc:mga06r32_314861_c1 | |||
| 3380 | nmdc:mga06r32_60002_c1 | |||
| 3381 | nmdc:mga08y16_149896_c1 | |||
| 3382 | nmdc:mga08y16_27944_c1 | |||
| 3383 | nmdc:mga08y16_430061_c1 | |||
| 3384 | nmdc:mga0n895_143248_c1 | |||
| 3385 | nmdc:mga0n895_14768_c1 | |||
| 3386 | nmdc:mga0n895_319480_c1 | |||
| 3387 | nmdc:mga0n895_390435_c1 | |||
| 3388 | nmdc:mga0n895_54579_c1 | |||
| 3389 | nmdc:mga0n895_56599_c1 | |||
| 3390 | nmdc:mga0n895_702211_c1 | |||
| 3391 | nmdc:mga0rr50_2831_c1 | |||
| 3392 | nmdc:mga0rr50_877259_c1 | |||
| 3393 | nmdc:mga08x19_24_c1 | |||
| 3394 | nmdc:mga08x19_295126_c1 | |||
| 3395 | nmdc:mga08x19_90102_c1 | |||
| 3396 | nmdc:mga0a205_126593_c1 | |||
| 3397 | nmdc:mga0a205_233224_c1 | |||
| 3398 | nmdc:mga0a205_42460_c2 | |||
| 3399 | nmdc:mga0sz30_49723_c1 | |||
| 3400 | Ga0495601_0000023 | |||
| 3401 | Ga0495601_0014297 | |||
| 3402 | Ga0495601_0016474 | |||
| 3403 | Ga0495601_0019932 | |||
| 3404 | Ga0495601_0023594 | |||
| 3405 | Ga0495601_0042008 | |||
| 3406 | Ga0495612_0000005 | |||
| 3407 | Ga0495655_0005113 | |||
| 3408 | Ga0495655_0027352 | |||
| 3409 | Ga0495595_0000013 | |||
| 3410 | Ga0495595_0004754 | |||
| 3411 | Ga0495595_0298962 | |||
| 3412 | Ga0495619_0000003 | |||
| 3413 | Ga0495619_0014748 | |||
| 3414 | Ga0495619_0028733 | |||
| 3415 | Ga0495619_0036675 | |||
| 3416 | Ga0495619_0045584 | |||
| 3417 | Ga0495619_0137914 | |||
| 3418 | Ga0495619_0212087 | |||
| 3419 | Ga0495619_0246669 | |||
| 3420 | Ga0500643_020103 | |||
| 3421 | Ga0500643_029467 | |||
| 3422 | Ga0500647_0033698 | |||
| 3423 | Ga0500651_0184092 | |||
| 3424 | Ga0500566_0000049 | |||
| 3425 | Ga0500566_0019723 | |||
| 3426 | Ga0500640_041496 | |||
| 3427 | Ga0500641_0007196 | |||
| 3428 | Ga0500648_062230 | |||
| 3429 | Ga0500654_118940 | |||
| 3430 | Ga0500554_044646 | |||
| 3431 | Ga0500555_077202 | |||
| 3432 | Ga0500562_014378 | |||
| 3433 | Ga0500572_000476 | |||
| 3434 | Ga0500591_027619 | |||
| 3435 | Ga0500593_032050 | |||
| 3436 | Ga0500595_000586 | |||
| 3437 | Ga0500595_001444 | |||
| 3438 | Ga0500595_002570 | |||
| 3439 | Ga0500595_013365 | |||
| 3440 | Ga0500595_028285 | |||
| 3441 | Ga0500608_030856 | |||
| 3442 | Ga0500614_016596 | |||
| 3443 | Ga0500621_100634 | |||
| 3444 | Ga0500642_0185661 | |||
| 3445 | Ga0500658_0006809 | |||
| 3446 | Ga0500658_0279235 | |||
| 3447 | Ga0500559_0000654 | |||
| 3448 | Ga0500559_0016820 | |||
| 3449 | Ga0500568_0066049 | |||
| 3450 | Ga0500568_0093983 | |||
| 3451 | Ga0500573_0016365 | |||
| 3452 | Ga0500577_0013422 | |||
| 3453 | Ga0500577_0079270 | |||
| 3454 | Ga0500589_042895 | |||
| 3455 | Ga0500590_065126 | |||
| 3456 | Ga0500603_000031 | |||
| 3457 | Ga0500603_000171 | |||
| 3458 | Ga0500622_0263836 | |||
| 3459 | Ga0500627_0107617 | |||
| 3460 | Ga0500630_000581 | |||
| 3461 | Ga0500633_0110996 | |||
| 3462 | Ga0500638_018261 | |||
| 3463 | Ga0500639_000020 | |||
| 3464 | Ga0500636_0049485 | |||
| 3465 | Ga0500636_0058958 | |||
| 3466 | Ga0500636_0070433 | |||
| 3467 | Ga0500637_0005363 | |||
| 3468 | Ga0500637_0007143 | |||
| 3469 | Ga0500637_0016794 | |||
| 3470 | Ga0500637_0189385 | |||
| 3471 | Ga0500611_001811 | |||
| 3472 | Ga0500611_021826 | |||
| 3473 | Ga0500645_010565 | |||
| 3474 | Ga0500609_021471 | |||
| 3475 | Ga0500552_024431 | |||
| 3476 | Ga0500596_003763 | |||
| 3477 | Ga0500596_008547 | |||
| 3478 | Ga0501084_0014440 | |||
| 3479 | Ga0501084_0015558 | |||
| 3480 | Ga0501084_0036665 | |||
| 3481 | Ga0501084_0039306 | |||
| 3482 | Ga0501084_0361418 | |||
| 3483 | Ga0501082_0000040 | |||
| 3484 | Ga0501082_0013015 | |||
| 3485 | Ga0501082_0042865 | |||
| 3486 | Ga0501082_0059229 | |||
| 3487 | Ga0501082_0115603 | |||
| 3488 | Ga0501082_0356681 | |||
| 3489 | Ga0501082_0463768 | |||
| 3490 | Ga0501082_0568314 | |||
| 3491 | Ga0501082_0948740 | |||
| 3492 | Ga0530510_0061859 | |||
| 3493 | Ga0530510_0079726 | |||
| 3494 | Ga0530510_0250688 | |||
| 3495 | 2513590484 | |||
| 3496 | 2513649496 | |||
| 3497 | 2513657248 | |||
| 3498 | 2513857716 | |||
| 3499 | 2513919256 | |||
| 3500 | 2514589642 | |||
| 3501 | 2517891047 | |||
| 3502 | 2524465181 | |||
| 3503 | 2671123712 | |||
| 3504 | 2723843425 | |||
| 3505 | 2728752686 | |||
| 3506 | 2793066401 | |||
| 3507 | 2793077851 | |||
| 3508 | 2818237966 | |||
| 3509 | 2874611664 | |||
| 3510 | 2876814232 | |||
| 3511 | 2878743754 | |||
| 3512 | 2879114909 | |||
| 3513 | 2885387638 | |||
| 3514 | 2885418282 | |||
| 3515 | 2888381716 | |||
| 3516 | 2903749279 | |||
| 3517 | 2906616244 | |||
| 3518 | 2906628310 | |||
| 3519 | 2906640334 | |||
| 3520 | 2906667254 | |||
| 3521 | 2922431762 | |||
| 3522 | 2924781567 | |||
| 3523 | 2932796602 | |||
| 3524 | 2932802616 | |||
| 3525 | 2935680019 | |||
| 3526 | 2935693901 | |||
| 3527 | 2935700659 | |||
| 3528 | 2935722023 | |||
| 3529 | 2935731332 | |||
| 3530 | 2935741032 | |||
| 3531 | 2935750408 | |||
| 3532 | 2935759663 | |||
| 3533 | 2935768583 | |||
| 3534 | 2935883573 | |||
| 3535 | 2935967062 | |||
| 3536 | 2940565568 | |||
| 3537 | 2958146568 | |||
| 3538 | 2968017563 | |||
| 3539 | 2970472261 | |||
| 3540 | 3005481580 | |||
| 3541 | 8002060756 | |||
| 3542 | 8006943174 | |||
| 3543 | 8006982969 | |||
| 3544 | 8016591194 | |||
| 3545 | 8019575114 | |||
| 3546 | 8019653219 |
Family Sequences
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7f9o-assembly1.cif.gz_P | psi-ndh supercomplex of barley | 0.8117 | 114 | 191 |
| 7p64-assembly1.cif.gz_K | complex i from e. coli, ddm/lmng-purified, under turnover at ph 6, open state | 0.7925 | 110 | 191 |
| 7a24-assembly1.cif.gz_K | assembly intermediate of the plant mitochondrial complex i | 0.7511 | 114 | 189 |
| 6khi-assembly1.cif.gz_E | supercomplex for cylic electron transport in cyanobacteria | 0.7451 | 114 | 187 |
| 7nyu-assembly1.cif.gz_K | respiratory complex i from escherichia coli - conformation 2 | 0.7156 | 114 | 208 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 6humE00 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.7419 | 114 | 184 | 1.10.287.3510 |
| af_Q6R9N1_4_99_1.10.287.3510 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.672 | 116 | 190 | 1.10.287.3510 |
| 3rkoK00 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.6595 | 114 | 190 | 1.10.287.3510 |
| af_Q57879_1_79_1.10.287.3510 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.6478 | 11 | 76 | 1.10.287.3510 |
| 6nbqE00 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.61 | 114 | 196 | 1.10.287.3510 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A257T7U1-F1-model_v4 | Formate hydrogenlyase | 0.9229 | 6 | 145 |
GO:0005886
GO:0016829 |
| AF-T1ARD1-F1-model_v4 | Respiratory-chain NADH dehydrogenase, subunit 1 | 0.9149 | 5 | 157 |
GO:0005886
|
| AF-A0A3A0CAQ0-F1-model_v4 | Hydrogenase | 0.9136 | 1 | 196 |
GO:0005886
|
| AF-A0A7Y3LL32-F1-model_v4 | Hydrogenase-4 component E | 0.9132 | 1 | 208 |
GO:0005886
|
| AF-A0A537SC42-F1-model_v4 | Hydrogenase-4 component E | 0.9123 | 1 | 136 |
GO:0005886
|