F495659
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1775 | 762 | 3550 | 583 |
Family's Representative Sequence
| Representative Sequence | 3300039437|Ga0436365_1008765|Ga0436365_1008765_532_2454 |
| Length | 640 |
| Sequence | MTQARPSAPPGTPGPAGNGAATRRPAPRSGAPSEQQDTVLQQPVRPDASRRTHVDPEPATGAQSLVRSLEAVGCDVVFGIPGGAILPAYDPLFDSTLLRHILVRHEQGAGHAAEGYARSTGKVGVLLVTSGPGATNAVTALTDALMDSIPLVCITGQVPTHLIGNDAFQECDTVGITRPCTKHNYLVKNVNDLARVLHEAFHIAANGRPGPVVIDIPKDVQFATGTYVGPKQVQLKSYKPKVKGDLDKIKAAVEMLANAKKPIIYSGGGIINSGKEASHLLREFARMTGFPVTSTLMGLGAFPAADPQWLGMLGMHGTYEANWTMHDCDVMLCIGARFDDRITGRVDAFSPGSRKIHVDIDASSINKNVKVDLPIVGDCAHVLEDMIRLWKEGAKQVNKTALAAWWKQIDKWRDRKSLAYRPSNETIKPQYAIERLYALTKDRDVYITTEVGQHQMWAAQFFKFQEPNRWMTSGGLGTMGYGLPASIGVQLAHPKSLVIDIAGEASVLMTMQEMSTAAQYRLPIKIFILNNQYMGMVRQWQELLHGGRYSESYTAALPDFVKLAEAYHGVGIRVDKPGDLDHAIKEMIDVDKPVIFDCMVDQAENCFPMIPSGKAHNEMLLGDVEQDIRKAIDERGKVLV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 2 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 3 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 4 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 5 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 6 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 7 | 3300000045 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere | Metagenome | Rhizosphere |
| 8 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 9 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 10 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 11 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 12 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 13 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 14 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 15 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 16 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 17 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 18 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 19 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 20 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 21 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 22 | 3300003544 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 23 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 24 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 25 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 26 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 27 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 28 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 29 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 30 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 31 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 32 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 33 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 34 | 3300005277 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) | Metagenome | Rhizosphere |
| 35 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 36 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 37 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 38 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 39 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 40 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 44 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 47 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 51 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 53 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 64 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 79 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 80 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 81 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 82 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 83 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 85 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 86 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 87 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 89 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 90 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 94 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 95 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 97 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 98 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 99 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 101 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 102 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 103 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 104 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 105 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 106 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 107 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 108 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 109 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 110 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 111 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 112 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 113 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 114 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 115 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 116 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 117 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 118 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 119 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 120 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 121 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 122 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 123 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 124 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 125 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 126 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 127 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 128 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 129 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 130 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 131 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 133 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 134 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 135 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 148 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 149 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 150 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300013249 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 | Metagenome | Rhizosphere |
| 154 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 162 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 166 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 167 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 168 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 169 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 170 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 171 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 172 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 173 | 3300022739 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules | Metagenome | Nodule |
| 174 | 3300022740 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules | Metagenome | Nodule |
| 175 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 176 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 177 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 178 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 179 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 180 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 182 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 183 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 184 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 186 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 187 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 188 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 190 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 191 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 192 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 193 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 194 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 195 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 196 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 197 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 198 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 199 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 263 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 268 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 270 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 272 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 276 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 277 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 278 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 279 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 280 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 281 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 282 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 283 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 284 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 285 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 286 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 287 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 288 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 289 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 290 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 291 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 292 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 293 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 294 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 295 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 296 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 297 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 298 | 3300031967 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules | Metagenome | Nodule |
| 299 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 300 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 301 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 302 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 303 | 3300033430 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules | Metagenome | Nodule |
| 304 | 3300033464 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules | Metagenome | Nodule |
| 305 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 306 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 307 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 308 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 309 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 310 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 311 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 312 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 313 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 314 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 315 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 316 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 317 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 318 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 319 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 320 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 321 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 322 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 323 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 324 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 325 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 326 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 327 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 328 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 329 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 330 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 331 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 332 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 333 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 334 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 335 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 336 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 337 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 338 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 339 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 340 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 341 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 342 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 343 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 344 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 345 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 346 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 347 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 348 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 349 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 350 | 3300038725 | Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 | Metagenome | Unclassified |
| 351 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 352 | 3300038727 | Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 | Metagenome | Unclassified |
| 353 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 354 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 355 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 356 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 357 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 358 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 359 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 360 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 361 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 362 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 363 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 364 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 365 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 366 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 367 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 368 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 369 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 370 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 371 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 372 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 373 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 374 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 434 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 435 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 436 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 437 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 438 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 439 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 440 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 441 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 442 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 443 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 444 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 445 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 446 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 447 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 448 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 449 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 450 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 451 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 452 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 453 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 454 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 455 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 456 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 457 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 458 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 459 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 460 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 461 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 462 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 463 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 464 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 465 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 466 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 467 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 468 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 469 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 470 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 471 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 472 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 473 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 474 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 475 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 476 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 477 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 478 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 479 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 480 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 481 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 482 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 483 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 484 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 485 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 486 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 487 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 488 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 489 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 490 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 491 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 492 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 493 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 494 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 495 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 496 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 497 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 498 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 499 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 500 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 501 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 502 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 503 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 504 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 505 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 506 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 507 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 508 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 509 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 510 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 511 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 512 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 513 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 514 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 515 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 516 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 517 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 518 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 519 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 520 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 521 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 522 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 523 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 524 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 525 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 526 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 527 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 528 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 529 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 530 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 531 | 2508501127 | Mesorhizobium sp. WSM2561 | Isolate | Nodule |
| 532 | 2510065019 | Rhizobium leguminosarum bv. trifolii WSM1689 | Isolate | Nodule |
| 533 | 2510461076 | Rhizobium leguminosarum bv. trifolii TA1 | Isolate | Nodule |
| 534 | 2510917030 | Rhizobium sp. CF142 | Isolate | Rhizosphere |
| 535 | 2511231027 | Phyllobacterium sp. YR531 | Isolate | Rhizosphere |
| 536 | 2511231221 | Azospirillum lipoferum 4B | Isolate | Rhizosphere |
| 537 | 2512875016 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 538 | 2512875024 | |||
| 539 | 2512875026 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 540 | 2513237085 | Rhizobium leguminosarum bv. viciae UPM1137 | Isolate | Nodule |
| 541 | 2513237087 | Azorhizobium doebereinerae UFLA1-100 | Isolate | Nodule |
| 542 | 2513237089 | Sinorhizobium medicae DI28 | Isolate | Nodule |
| 543 | 2513237093 | Rhizobium leguminosarum bv. phaseoli FA23 | Isolate | Nodule |
| 544 | 2513237103 | Rhizobium leguminosarum bv. viciae VF39 | Isolate | Nodule |
| 545 | 2513237156 | Sinorhizobium medicae WSM1369 | Isolate | Nodule |
| 546 | 2513237160 | Sinorhizobium medicae WSM244 | Isolate | Nodule |
| 547 | 2513237162 | Rhizobium ruizarguesonis GB30 | Isolate | Nodule |
| 548 | 2513237164 | Mesorhizobium loti CJ3sym | Isolate | Nodule |
| 549 | 2515075009 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 550 | 2515154113 | Rhizobium ruizarguesonis Vc2 | Isolate | Nodule |
| 551 | 2515154116 | Rhizobium ruizarguesonis Ps8 | Isolate | Nodule |
| 552 | 2515154134 | Rhizobium gallicum bv. gallicum R602sp | Isolate | Nodule |
| 553 | 2516653077 | Rhizobium acaciae WSM1481 | Isolate | Nodule |
| 554 | 2516653085 | Rhizobium leguminosarum bv. phaseoli 4292 | Isolate | Nodule |
| 555 | 2517093000 | Rhizobium leguminosarum bv. trifolii SRDI943 | Isolate | Nodule |
| 556 | 2517287029 | Rhizobium leguminosarum bv. trifolii SRDI565 | Isolate | Nodule |
| 557 | 2517487022 | Sinorhizobium medicae WSM4191 | Isolate | Nodule |
| 558 | 2522572158 | Azospirillum halopraeferens DSM 3675 | Isolate | Unclassified |
| 559 | 2523533628 | Maridesulfovibrio zosterae DSM 11974 | Isolate | Rhizosphere |
| 560 | 2534681786 | Brucella suis 92/29 | Isolate | Unclassified |
| 561 | 2534681796 | Rhizobium grahamii CCGE 502 | Isolate | Nodule |
| 562 | 2582581298 | Rhizobium alamii YR540 | Isolate | Rhizosphere |
| 563 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 564 | 2585427526 | Rhizobium leguminosarum OV152 | Isolate | Rhizosphere |
| 565 | 2585427529 | Rhizobium alamii YR584 | Isolate | Rhizosphere |
| 566 | 2597489875 | Mesorhizobium ciceri ca181 | Isolate | Unclassified |
| 567 | 2597490356 | Azospirillum brasilense sp7 | Isolate | Unclassified |
| 568 | 2599185301 | Mesorhizobium sp. NFR06 | Isolate | Rhizoplane |
| 569 | 2599185352 | Sinorhizobium sp. NFACC03 | Isolate | Rhizoplane |
| 570 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 571 | 2643221557 | Ensifer sp. Root558 | Isolate | Unclassified |
| 572 | 2643221599 | Rhizobium sp. Root708 | Isolate | Unclassified |
| 573 | 2643221610 | Ensifer sp. Root74 | Isolate | Unclassified |
| 574 | 2643221618 | Ensifer sp. Root231 | Isolate | Unclassified |
| 575 | 2643221626 | Ensifer sp. Root31 | Isolate | Unclassified |
| 576 | 2643221655 | Ensifer sp. Root1252 | Isolate | Unclassified |
| 577 | 2643221659 | Ensifer sp. Root127 | Isolate | Unclassified |
| 578 | 2643221668 | Ensifer sp. Root423 | Isolate | Unclassified |
| 579 | 2643221675 | Ensifer sp. Root1298 | Isolate | Unclassified |
| 580 | 2643221680 | Ensifer sp. Root1312 | Isolate | Unclassified |
| 581 | 2643221698 | Ensifer sp. Root142 | Isolate | Unclassified |
| 582 | 2643221712 | Ensifer sp. Root258 | Isolate | Unclassified |
| 583 | 2643221723 | Ensifer sp. Root278 | Isolate | Unclassified |
| 584 | 2643221726 | Ensifer sp. Root954 | Isolate | Unclassified |
| 585 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 586 | 2738541317 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 587 | 2751185800 | Brucella pituitosa AA2 | Isolate | Unclassified |
| 588 | 2751185821 | Ensifer shofinae CCBAU 251167 | Isolate | Unclassified |
| 589 | 2758568016 | [Ochrobactrum] quorumnocens A44 | Isolate | Rhizosphere |
| 590 | 2765235802 | Phyllobacterium bourgognense 31-25a | Isolate | Rhizoplane |
| 591 | 2765235942 | Rhizobium sp. WYCCWR10014 | Isolate | Nodule |
| 592 | 2767802442 | Phyllobacterium brassicacearum 29-15 | Isolate | Rhizoplane |
| 593 | 2775506901 | Microvirga ossetica V5/3m | Isolate | Unclassified |
| 594 | 2775506902 | Phyllobacterium zundukense Tri-48 | Isolate | Unclassified |
| 595 | 2775506904 | Phyllobacterium zundukense Tri-38 | Isolate | Unclassified |
| 596 | 2791355123 | Mesorhizobium sophorae ICMP 19535 | Isolate | Unclassified |
| 597 | 2791355253 | Rhizobium rhizosphaerae RD15 | Isolate | Rhizosphere |
| 598 | 2791355263 | Rhizobium chutanense C5 | Isolate | Nodule |
| 599 | 2802428858 | Sinorhizobium medicae M14-1 | Isolate | Nodule |
| 600 | 2802428859 | Sinorhizobium medicae SF3.41 | Isolate | Nodule |
| 601 | 2802428860 | Sinorhizobium medicae M19-1 | Isolate | Nodule |
| 602 | 2802428861 | Sinorhizobium medicae USDA1037 | Isolate | Nodule |
| 603 | 2802428862 | Sinorhizobium medicae M7-4 | Isolate | Nodule |
| 604 | 2802428863 | Sinorhizobium medicae M26-2 | Isolate | Nodule |
| 605 | 2828305725 | Xanthobacter tagetidis DSM 11105 | Isolate | Unclassified |
| 606 | 2837678835 | Jiella endophytica CBS5Q-3 | Isolate | Unclassified |
| 607 | 2838680041 | Rhizobium leguminosarum SEMIA 415 | Isolate | Nodule |
| 608 | 2838686498 | Rhizobium leguminosarum SEMIA 416 | Isolate | Nodule |
| 609 | 2838694306 | Rhizobium leguminosarum SEMIA 421 | Isolate | Nodule |
| 610 | 2838707686 | Rhizobium leguminosarum SEMIA 430 | Isolate | Nodule |
| 611 | 2838729681 | Rhizobium leguminosarum SEMIA 445 | Isolate | Nodule |
| 612 | 2838742623 | Rhizobium leguminosarum SEMIA 449 | Isolate | Nodule |
| 613 | 2839993093 | Phyllobacterium endophyticum PEPV15 | Isolate | Unclassified |
| 614 | 2840764183 | Phyllobacterium sophorae CCBAU 03422 | Isolate | Unclassified |
| 615 | 2841734538 | Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 | Isolate | Nodule |
| 616 | 2841851746 | Rhizobium leguminosarum SEMIA 498 | Isolate | Nodule |
| 617 | 2842077413 | Rhizobium leguminosarum SEMIA 422 | Isolate | Nodule |
| 618 | 2842110456 | Rhizobium esperanzae SEMIA 414 | Isolate | Nodule |
| 619 | 2842118031 | Rhizobium esperanzae SEMIA 420 | Isolate | Nodule |
| 620 | 2842156927 | Rhizobium leguminosarum SEMIA 459 | Isolate | Nodule |
| 621 | 2842163707 | Rhizobium leguminosarum SEMIA 460 | Isolate | Nodule |
| 622 | 2842180545 | Rhizobium leguminosarum SEMIA 463 | Isolate | Nodule |
| 623 | 2842217011 | Rhizobium leguminosarum SEMIA 475 | Isolate | Nodule |
| 624 | 2842229732 | Rhizobium leguminosarum SEMIA 481 | Isolate | Nodule |
| 625 | 2842237096 | Rhizobium leguminosarum SEMIA 482 | Isolate | Nodule |
| 626 | 2842243621 | Rhizobium leguminosarum SEMIA 483 | Isolate | Nodule |
| 627 | 2842257432 | Rhizobium leguminosarum SEMIA 485 | Isolate | Nodule |
| 628 | 2842271015 | Rhizobium leguminosarum SEMIA 488 | Isolate | Nodule |
| 629 | 2842291075 | Rhizobium leguminosarum SEMIA 491 | Isolate | Nodule |
| 630 | 2842304105 | Rhizobium leguminosarum SEMIA 499 | Isolate | Nodule |
| 631 | 2842333319 | Skermanella aerolata SEMIA 4010 | Isolate | Nodule |
| 632 | 2842370503 | Rhizobium leguminosarum SEMIA 4022 | Isolate | Nodule |
| 633 | 2842377471 | Rhizobium leguminosarum SEMIA 4024 | Isolate | Nodule |
| 634 | 2842384541 | Rhizobium leguminosarum SEMIA 4025 | Isolate | Nodule |
| 635 | 2842694124 | Methylopila sp. R-72369 | Isolate | Unclassified |
| 636 | 2842871566 | Phyllobacterium sp. R-73111 | Isolate | Unclassified |
| 637 | 2844163670 | Ensifer sp. 1H6 | Isolate | Unclassified |
| 638 | 2844454524 | Rhizobium leguminosarum bv. viciae BIHB 1217 | Isolate | Nodule |
| 639 | 2846952575 | Azospirillum brasilense sp7 | Isolate | Unclassified |
| 640 | 2848858292 | Azospirillum brasilense Az39 | Isolate | Unclassified |
| 641 | 2854911287 | Brucella lupini LUP21 | Isolate | Unclassified |
| 642 | 2856342000 | Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 | Isolate | Nodule |
| 643 | 2856364286 | Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 | Isolate | Nodule |
| 644 | 2857516855 | Rhizobium sp. R-72456 | Isolate | Unclassified |
| 645 | 2869162929 | Mesorhizobium sanjuanii BSA136 | Isolate | Nodule |
| 646 | 2869242130 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 | Isolate | Nodule |
| 647 | 2869285874 | Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 | Isolate | Nodule |
| 648 | 2871429161 | Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 | Isolate | Nodule |
| 649 | 2871474448 | Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 | Isolate | Nodule |
| 650 | 2874146452 | Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 | Isolate | Nodule |
| 651 | 2874155637 | Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 | Isolate | Nodule |
| 652 | 2876363079 | Mesorhizobium loti R7ANS::ICEMlSym2042 | Isolate | Nodule |
| 653 | 2876413966 | Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 | Isolate | Nodule |
| 654 | 2878745973 | Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 | Isolate | Nodule |
| 655 | 2878788777 | Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 | Isolate | Nodule |
| 656 | 2882632389 | Mesorhizobium waimense ICMP19557 | Isolate | Unclassified |
| 657 | 2883291878 | Hypericibacter terrae R5913 | Isolate | Rhizosphere |
| 658 | 2883354860 | Hypericibacter adhaerens R5959 | Isolate | Rhizosphere |
| 659 | 2885312484 | Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 | Isolate | Nodule |
| 660 | 2888343758 | Mesorhizobium sp. AA22 | Isolate | Unclassified |
| 661 | 2889790730 | Chelativorans xinjiangense lm93 | Isolate | Rhizosphere |
| 662 | 2889914905 | Chelativorans alearense UJN715 | Isolate | Rhizosphere |
| 663 | 2891048133 | Martelella lutilitoris GH2-6 | Isolate | Rhizosphere |
| 664 | 2894652903 | Phyllobacterium sp. SYP-B3895 | Isolate | Rhizosphere |
| 665 | 2897803580 | Azospirillum doebereinerae GSF71 | Isolate | Unclassified |
| 666 | 2903448605 | Mesorhizobium japonicum Opo-235 | Isolate | Nodule |
| 667 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 668 | 2903521522 | Mesorhizobium loti R7ANS::ICEMlSym2014 | Isolate | Nodule |
| 669 | 2903528002 | Mesorhizobium loti R7ANS::ICEMlSym2037 | Isolate | Nodule |
| 670 | 2904578770 | Phyllobacterium sp. 586 | Isolate | Unclassified |
| 671 | 2906308376 | Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 | Isolate | Nodule |
| 672 | 2906321335 | Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 | Isolate | Nodule |
| 673 | 2909042592 | Labrys sp. LIt4 | Isolate | Nodule |
| 674 | 2913308742 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 675 | 2915650412 | Ochrobactrum sp. CM-21-5 | Isolate | Rhizosphere |
| 676 | 2915980308 | Sinorhizobium medicae USDA1149 | Isolate | Nodule |
| 677 | 2916061851 | Sinorhizobium medicae USDA1638 | Isolate | Nodule |
| 678 | 2916178963 | Pseudoalteromonas rhizosphaerae RA15 | Isolate | Rhizosphere |
| 679 | 2917554339 | Chthonobacter rhizosphaerae yh7-1 | Isolate | Rhizosphere |
| 680 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 681 | 2919119836 | Phyllobacterium sp. 1468 | Isolate | Rhizosphere |
| 682 | 2919450847 | Ancylobacter sp. 3268 | Isolate | Rhizosphere |
| 683 | 2919497567 | Shewanella putrefaciens 3469 | Isolate | Unclassified |
| 684 | 2920822456 | Ensifer sesbaniae CCBAU 65729 | Isolate | Unclassified |
| 685 | 2921250672 | Sinorhizobium medicae USDA1169 | Isolate | Nodule |
| 686 | 2924754689 | Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 | Isolate | Nodule |
| 687 | 2928521798 | Phyllobacterium ifriqiyense 1451 | Isolate | Rhizosphere |
| 688 | 2933570622 | Rhizobium leguminosarum SEMIA 409 | Isolate | Nodule |
| 689 | 2933586486 | Rhizobium leguminosarum SEMIA 4039 | Isolate | Nodule |
| 690 | 2935894831 | Rhizobium leguminosarum SEMIA 419 | Isolate | Nodule |
| 691 | 2935901341 | Rhizobium leguminosarum SEMIA 4082 | Isolate | Nodule |
| 692 | 2936367885 | Rhizobium changzhiense WYCCWR 11290 | Isolate | Nodule |
| 693 | 2936375103 | Rhizobium changzhiense WYCCWR 11317 | Isolate | Nodule |
| 694 | 2936381700 | Rhizobium chutanense C16 | Isolate | Unclassified |
| 695 | 2937029754 | Sinorhizobium medicae USDA1624 | Isolate | Nodule |
| 696 | 2937036028 | Sinorhizobium medicae USDA1608 | Isolate | Nodule |
| 697 | 2937078374 | Sinorhizobium medicae USDA1004 | Isolate | Nodule |
| 698 | 2937084907 | Sinorhizobium medicae USDA1664 | Isolate | Nodule |
| 699 | 2937813078 | Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 | Isolate | Nodule |
| 700 | 2937822353 | Mesorhizobium neociceri CCANP35 | Isolate | Nodule |
| 701 | 2937836603 | Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 | Isolate | Nodule |
| 702 | 2937848649 | Mesorhizobium sp. WSM4310 | Isolate | Unclassified |
| 703 | 2941499720 | Ensifer sp. 4252 | Isolate | Rhizosphere |
| 704 | 2954011201 | Phyllobacterium ifrigiyense W4I11 | Isolate | Rhizosphere |
| 705 | 2957375807 | Sinorhizobium medicae USDA1632 | Isolate | Nodule |
| 706 | 2957437181 | Sinorhizobium medicae USDA1694 | Isolate | Nodule |
| 707 | 2958071322 | Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 | Isolate | Nodule |
| 708 | 2958130278 | Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 | Isolate | Nodule |
| 709 | 2958179912 | Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 | Isolate | Nodule |
| 710 | 2960591022 | Sinorhizobium medicae USDA1066 | Isolate | Nodule |
| 711 | 2960631154 | Sinorhizobium medicae USDA1629 | Isolate | Nodule |
| 712 | 2960680706 | Sinorhizobium medicae USDA1150 | Isolate | Nodule |
| 713 | 2960693952 | Sinorhizobium medicae USDA1630 | Isolate | Nodule |
| 714 | 2961077736 | Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 | Isolate | Nodule |
| 715 | 2963644680 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 716 | 2967686174 | Sinorhizobium medicae USDA1641 | Isolate | Nodule |
| 717 | 2967728569 | Sinorhizobium medicae USDA1607 | Isolate | Nodule |
| 718 | 2968083720 | Mesorhizobium erdmanii Opo-242 | Isolate | Unclassified |
| 719 | 2970026789 | Sinorhizobium medicae USDA1611 | Isolate | Nodule |
| 720 | 2970122695 | Sinorhizobium medicae 3082 | Isolate | Nodule |
| 721 | 2970143518 | Sinorhizobium medicae USDA1652 | Isolate | Nodule |
| 722 | 2970524798 | Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 | Isolate | Nodule |
| 723 | 2970532167 | Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 | Isolate | Nodule |
| 724 | 2970540015 | Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 | Isolate | Nodule |
| 725 | 2977530762 | Sinorhizobium medicae USDA1606 | Isolate | Nodule |
| 726 | 2977544691 | Sinorhizobium medicae USDA1631 | Isolate | Nodule |
| 727 | 2977843712 | Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 | Isolate | Nodule |
| 728 | 2977922695 | Mesorhizobium sp. WSM4305 | Isolate | Unclassified |
| 729 | 2977986579 | Mesorhizobium intechi BD68 | Isolate | Unclassified |
| 730 | 2989771324 | Rhizobium rhizolycopersici DBTS2 | Isolate | Rhizosphere |
| 731 | 3002141150 | Phyllobacterium sp. 628 | Isolate | Unclassified |
| 732 | 3004211236 | Mesorhizobium sp. WSM4307 | Isolate | Unclassified |
| 733 | 3004218560 | Mesorhizobium sp. WSM4315 | Isolate | Unclassified |
| 734 | 3004334049 | Mesorhizobium huakuii 583 | Isolate | Unclassified |
| 735 | 3005409236 | Rhizobium sp. P32RR-XVIII | Isolate | Rhizosphere |
| 736 | 3005445848 | Rhizobium sp. WYJ-E13 | Isolate | Unclassified |
| 737 | 3005452660 | Rhizobium grahamii BG7 | Isolate | Unclassified |
| 738 | 637000159 | Mesorhizobium japonicum MAFF 303099 | Isolate | Unclassified |
| 739 | 639633055 | Rhizobium leguminosarum bv. viciae 3841 | Isolate | Unclassified |
| 740 | 646564506 | Arcobacter nitrofigilis DSM 7299 | Isolate | Unclassified |
| 741 | 8001845381 | Ancylobacter sonchi VKM B-3145 | Isolate | Unclassified |
| 742 | 8002060224 | Methylocystis sp. Sn-Cys | Isolate | Unclassified |
| 743 | 8003999396 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 744 | 8004387939 | Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 | Isolate | Nodule |
| 745 | 8004395343 | Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 | Isolate | Nodule |
| 746 | 8004633249 | Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 | Isolate | Nodule |
| 747 | 8004714634 | Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 | Isolate | Nodule |
| 748 | 8005307578 | Rhizobium leguminosarum bv. phaseoli LCS0306 | Isolate | Unclassified |
| 749 | 8005376324 | Rhizobium changzhiense WYCCWR 11279 | Isolate | Nodule |
| 750 | 8005460587 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 751 | 8005542996 | Rhizobium grahamii CCGM3 | Isolate | Unclassified |
| 752 | 8005556819 | Rhizobium sp. WYCCWR 11128 | Isolate | Nodule |
| 753 | 8005563573 | Rhizobium sp. WYCCWR 11152 | Isolate | Nodule |
| 754 | 8005658619 | Rhizobium terrae CC-HIH110 | Isolate | Unclassified |
| 755 | 8018163183 | Rhizobium sp. WYCCWR 11146 | Isolate | Nodule |
| 756 | 8023680758 | Rhizobium leguminosarum SARCC-132 | Isolate | Nodule |
| 757 | 8024479707 | Rhizobium leguminosarum Tri-43 | Isolate | Nodule |
| 758 | 8045864390 | Aurantimonas endophytica KCTC 52296 | Isolate | Unclassified |
| 759 | 8054002106 | Azospirillum lipoferum 59b | Isolate | Unclassified |
| 760 | 8054563764 | Acuticoccus kalidii M5D2P5 | Isolate | Unclassified |
| 761 | 8055617313 | Mesorhizobium onobrychidis OM4 | Isolate | Nodule |
| 762 | 8057874678 | Rhizobium acaciae 1AS12 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 86.59 |
| Metatranscriptomes | 0.28 |
| Isolates | 13.13 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.82 |
| Nodule | 8.11 |
| Rhizoplane | 6.48 |
| Rhizosphere | 70.59 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0436365_1008765 | 3300039437 | Bacteria | 3154 |
| 2 | 2214544948 | 2209111006 | Bacteria | 6076 |
| 3 | ARcpr5oldR_c000012 | 3300000041 | Bacteria | 38255 |
| 4 | ARSoilYngRDRAFT_c00099 | 3300000042 | Bacteria | 14927 |
| 5 | ARcpr5yngRDRAFT_c000315 | 3300000043 | Bacteria | 6778 |
| 6 | ARSoilOldRDRAFT_c000006 | 3300000044 | Bacteria | 57169 |
| 7 | ARCol0oldRDRAFT_c00232 | 3300000045 | Bacteria | 5172 |
| 8 | ARCol0yngRDRAFT_1000024 | 3300000652 | Bacteria | 27598 |
| 9 | JGI24746J21847_1000004 | 3300001977 | Bacteria | 23439 |
| 10 | JGI24740J21852_10006274 | 3300001979 | Bacteria | 4939 |
| 11 | JGI24739J22299_10001737 | 3300001989 | Bacteria | 8290 |
| 12 | JGI24738J21930_10000058 | 3300002075 | Bacteria | 22933 |
| 13 | JGI24744J21845_10000137 | 3300002077 | Bacteria | 10295 |
| 14 | JGI24035J26624_1000170 | 3300002126 | Bacteria | 6006 |
| 15 | JGI24034J26672_10001946 | 3300002239 | Bacteria | 2795 |
| 16 | JGI25158J39367_1000110 | 3300002739 | Bacteria | 19044 |
| 17 | JGI25158J39367_1004702 | 3300002739 | Bacteria | 2038 |
| 18 | JGI25152J39213_1006078 | 3300002773 | Bacteria | 3370 |
| 19 | JGI25159J45721_1000040 | 3300002987 | Bacteria | 68143 |
| 20 | JGI25159J45721_1000788 | 3300002987 | Bacteria | 13784 |
| 21 | JGI25159J45721_1000966 | 3300002987 | Bacteria | 12481 |
| 22 | JGI25153J46596_10002364 | 3300003215 | Bacteria | 10923 |
| 23 | JGI25160J50197_1000001 | 3300003354 | Bacteria | 782301 |
| 24 | JGI25160J50197_1000128 | 3300003354 | Bacteria | 68143 |
| 25 | JGI25161J50226_1000001 | 3300003374 | Bacteria | 655036 |
| 26 | JGI25161J50226_1000107 | 3300003374 | Bacteria | 65408 |
| 27 | JGI25161J50226_1000885 | 3300003374 | Bacteria | 10945 |
| 28 | Ga0007417J51691_1018129 | 3300003544 | Bacteria | 2138 |
| 29 | Ga0006562J51391_1007616 | 3300003578 | Bacteria | 4153 |
| 30 | JGI25404J52841_10000854 | 3300003659 | Bacteria | 4902 |
| 31 | Ga0055542_1000519 | 3300003762 | Bacteria | 34751 |
| 32 | Ga0055526_1004726 | 3300003771 | Bacteria | 8073 |
| 33 | Ga0055536_1002507 | 3300003781 | Bacteria | 10298 |
| 34 | Ga0055528_1001892 | 3300003790 | Bacteria | 11917 |
| 35 | Ga0055528_1005580 | 3300003790 | Bacteria | 5823 |
| 36 | Ga0055530_10000091 | 3300003791 | Bacteria | 78039 |
| 37 | Ga0055531_10002140 | 3300003794 | Bacteria | 13526 |
| 38 | Ga0055531_10011122 | 3300003794 | Bacteria | 4384 |
| 39 | Ga0055531_10014104 | 3300003794 | Bacteria | 3628 |
| 40 | JGI25405J52794_10000510 | 3300003911 | Bacteria | 5609 |
| 41 | Ga0055543_1000003 | 3300004625 | Bacteria | 358656 |
| 42 | Ga0055543_1000074 | 3300004625 | Bacteria | 88424 |
| 43 | Ga0055543_1000130 | 3300004625 | Bacteria | 62045 |
| 44 | Ga0065165_1000013 | 3300005262 | Bacteria | 301887 |
| 45 | Ga0065165_1000068 | 3300005262 | Bacteria | 170609 |
| 46 | Ga0065165_1000528 | 3300005262 | Bacteria | 58452 |
| 47 | Ga0065716_1002004 | 3300005277 | Bacteria | 2484 |
| 48 | Ga0065714_10070553 | 3300005288 | Bacteria | 3835 |
| 49 | Ga0065704_10002972 | 3300005289 | Bacteria | 6765 |
| 50 | Ga0065704_10016946 | 3300005289 | Bacteria | 2398 |
| 51 | Ga0065712_10002527 | 3300005290 | Bacteria | 5487 |
| 52 | Ga0065715_10009712 | 3300005293 | Bacteria | 4460 |
| 53 | Ga0065707_10102140 | 3300005295 | Bacteria | 2823 |
| 54 | Ga0070658_10007004 | 3300005327 | Bacteria | 9104 |
| 55 | Ga0070676_10000425 | 3300005328 | Bacteria | 19956 |
| 56 | Ga0070683_100000002 | 3300005329 | Bacteria | 427530 |
| 57 | Ga0070683_100000363 | 3300005329 | Bacteria | 31390 |
| 58 | Ga0070683_100077966 | 3300005329 | Bacteria | 3099 |
| 59 | Ga0070683_100089208 | 3300005329 | Bacteria | 2894 |
| 60 | Ga0070690_100000206 | 3300005330 | Bacteria | 30585 |
| 61 | Ga0070690_100000527 | 3300005330 | Bacteria | 19211 |
| 62 | Ga0070670_100178788 | 3300005331 | Bacteria | 1842 |
| 63 | Ga0070677_10000454 | 3300005333 | Bacteria | 14053 |
| 64 | Ga0068869_100000203 | 3300005334 | Bacteria | 31014 |
| 65 | Ga0068869_100080970 | 3300005334 | Bacteria | 2424 |
| 66 | Ga0070666_10029924 | 3300005335 | Bacteria | 3583 |
| 67 | Ga0070666_10043938 | 3300005335 | Bacteria | 2993 |
| 68 | Ga0070666_10064235 | 3300005335 | Bacteria | 2489 |
| 69 | Ga0070680_100000120 | 3300005336 | Bacteria | 46266 |
| 70 | Ga0070680_100006928 | 3300005336 | Bacteria | 8635 |
| 71 | Ga0070682_100000328 | 3300005337 | Bacteria | 32600 |
| 72 | Ga0070682_100000606 | 3300005337 | Bacteria | 21829 |
| 73 | Ga0068868_100008027 | 3300005338 | Bacteria | 7546 |
| 74 | Ga0068868_100029919 | 3300005338 | Bacteria | 4173 |
| 75 | Ga0070660_100023629 | 3300005339 | Bacteria | 4555 |
| 76 | Ga0070660_100031858 | 3300005339 | Bacteria | 3963 |
| 77 | Ga0070660_100066062 | 3300005339 | Bacteria | 2815 |
| 78 | Ga0070689_100002797 | 3300005340 | Bacteria | 11463 |
| 79 | Ga0070689_100005434 | 3300005340 | Bacteria | 8698 |
| 80 | Ga0070689_100005609 | 3300005340 | Bacteria | 8589 |
| 81 | Ga0070689_100069221 | 3300005340 | Bacteria | 2753 |
| 82 | Ga0070691_10002816 | 3300005341 | Bacteria | 7767 |
| 83 | Ga0070687_100001134 | 3300005343 | Bacteria | 9207 |
| 84 | Ga0070687_100013129 | 3300005343 | Bacteria | 3680 |
| 85 | Ga0070661_100000765 | 3300005344 | Bacteria | 23207 |
| 86 | Ga0070661_100003192 | 3300005344 | Bacteria | 11300 |
| 87 | Ga0070661_100043968 | 3300005344 | Bacteria | 3263 |
| 88 | Ga0070661_100062988 | 3300005344 | Bacteria | 2723 |
| 89 | Ga0070692_10013057 | 3300005345 | Bacteria | 3863 |
| 90 | Ga0070668_100000870 | 3300005347 | Bacteria | 21002 |
| 91 | Ga0070668_100027666 | 3300005347 | Bacteria | 4304 |
| 92 | Ga0070668_100049511 | 3300005347 | Bacteria | 3232 |
| 93 | Ga0070669_100097449 | 3300005353 | Bacteria | 2213 |
| 94 | Ga0070675_100017566 | 3300005354 | Bacteria | 5686 |
| 95 | Ga0070675_100033460 | 3300005354 | Bacteria | 4168 |
| 96 | Ga0070675_100047903 | 3300005354 | Bacteria | 3504 |
| 97 | Ga0070671_100002158 | 3300005355 | Bacteria | 15187 |
| 98 | Ga0070671_100044122 | 3300005355 | Bacteria | 3705 |
| 99 | Ga0070671_100089467 | 3300005355 | Bacteria | 2577 |
| 100 | Ga0070674_100007270 | 3300005356 | Bacteria | 6523 |
| 101 | Ga0070673_100023147 | 3300005364 | Bacteria | 4535 |
| 102 | Ga0070673_100041409 | 3300005364 | Bacteria | 3542 |
| 103 | Ga0070688_100002533 | 3300005365 | Bacteria | 9246 |
| 104 | Ga0070688_100033508 | 3300005365 | Bacteria | 3106 |
| 105 | Ga0070659_100000350 | 3300005366 | Bacteria | 35169 |
| 106 | Ga0070659_100002129 | 3300005366 | Bacteria | 14109 |
| 107 | Ga0070667_100002810 | 3300005367 | Bacteria | 15014 |
| 108 | Ga0070667_100087410 | 3300005367 | Bacteria | 2675 |
| 109 | Ga0070709_10000567 | 3300005434 | Bacteria | 21593 |
| 110 | Ga0070709_10039794 | 3300005434 | Bacteria | 2887 |
| 111 | Ga0070714_100002396 | 3300005435 | Bacteria | 13798 |
| 112 | Ga0070714_100013673 | 3300005435 | Bacteria | 6509 |
| 113 | Ga0070713_100002955 | 3300005436 | Bacteria | 11154 |
| 114 | Ga0070713_100007316 | 3300005436 | Bacteria | 7734 |
| 115 | Ga0070710_10002324 | 3300005437 | Bacteria | 8999 |
| 116 | Ga0070710_10017981 | 3300005437 | Bacteria | 3630 |
| 117 | Ga0070701_10001117 | 3300005438 | Bacteria | 9796 |
| 118 | Ga0070701_10005793 | 3300005438 | Bacteria | 5144 |
| 119 | Ga0070711_100053889 | 3300005439 | Bacteria | 2774 |
| 120 | Ga0070705_100000025 | 3300005440 | Bacteria | 79976 |
| 121 | Ga0070705_100001171 | 3300005440 | Bacteria | 14335 |
| 122 | Ga0070700_100000259 | 3300005441 | Bacteria | 28307 |
| 123 | Ga0070700_100001124 | 3300005441 | Bacteria | 13246 |
| 124 | Ga0070694_100007552 | 3300005444 | Bacteria | 6635 |
| 125 | Ga0070663_100001017 | 3300005455 | Bacteria | 15289 |
| 126 | Ga0070663_100006394 | 3300005455 | Bacteria | 7083 |
| 127 | Ga0070678_100000662 | 3300005456 | Bacteria | 16885 |
| 128 | Ga0070678_100001220 | 3300005456 | Bacteria | 13603 |
| 129 | Ga0070662_100031146 | 3300005457 | Bacteria | 3741 |
| 130 | Ga0070681_10002164 | 3300005458 | Bacteria | 17877 |
| 131 | Ga0070681_10005944 | 3300005458 | Bacteria | 11813 |
| 132 | Ga0070681_10008745 | 3300005458 | Bacteria | 9934 |
| 133 | Ga0070681_10066756 | 3300005458 | Bacteria | 3566 |
| 134 | Ga0070681_10200103 | 3300005458 | Bacteria | 1916 |
| 135 | Ga0068867_100007166 | 3300005459 | Bacteria | 7880 |
| 136 | Ga0068867_100036166 | 3300005459 | Bacteria | 3583 |
| 137 | Ga0070685_10000890 | 3300005466 | Bacteria | 16081 |
| 138 | Ga0070685_10001744 | 3300005466 | Bacteria | 11398 |
| 139 | Ga0070685_10037201 | 3300005466 | Bacteria | 2755 |
| 140 | Ga0070707_100006682 | 3300005468 | Bacteria | 10686 |
| 141 | Ga0070698_100000572 | 3300005471 | Bacteria | 39526 |
| 142 | Ga0070699_100001132 | 3300005518 | Bacteria | 24801 |
| 143 | Ga0070699_100005476 | 3300005518 | Bacteria | 11128 |
| 144 | Ga0070699_100015264 | 3300005518 | Bacteria | 6600 |
| 145 | Ga0070679_100000963 | 3300005530 | Bacteria | 25049 |
| 146 | Ga0070679_100003169 | 3300005530 | Bacteria | 15034 |
| 147 | Ga0070679_100017034 | 3300005530 | Bacteria | 7025 |
| 148 | Ga0070679_100071542 | 3300005530 | Bacteria | 3459 |
| 149 | Ga0070679_100126956 | 3300005530 | Bacteria | 2533 |
| 150 | Ga0070697_100018303 | 3300005536 | Bacteria | 5522 |
| 151 | Ga0068853_100007711 | 3300005539 | Bacteria | 8631 |
| 152 | Ga0070672_100000403 | 3300005543 | Bacteria | 24982 |
| 153 | Ga0070672_100055907 | 3300005543 | Bacteria | 3093 |
| 154 | Ga0070686_100003724 | 3300005544 | Bacteria | 8378 |
| 155 | Ga0070686_100034761 | 3300005544 | Bacteria | 3108 |
| 156 | Ga0070695_100000420 | 3300005545 | Bacteria | 21918 |
| 157 | Ga0070695_100000450 | 3300005545 | Bacteria | 21404 |
| 158 | Ga0070695_100007928 | 3300005545 | Bacteria | 6287 |
| 159 | Ga0070696_100000311 | 3300005546 | Bacteria | 29566 |
| 160 | Ga0070696_100018731 | 3300005546 | Bacteria | 4683 |
| 161 | Ga0070693_100000031 | 3300005547 | Bacteria | 53010 |
| 162 | Ga0070693_100002055 | 3300005547 | Bacteria | 9221 |
| 163 | Ga0070665_100055479 | 3300005548 | Bacteria | 3974 |
| 164 | Ga0070665_100072811 | 3300005548 | Bacteria | 3443 |
| 165 | Ga0070704_100000166 | 3300005549 | Bacteria | 26107 |
| 166 | Ga0070704_100004506 | 3300005549 | Bacteria | 8045 |
| 167 | Ga0070704_100004779 | 3300005549 | Bacteria | 7842 |
| 168 | Ga0070704_100040984 | 3300005549 | Bacteria | 3193 |
| 169 | Ga0068855_100011542 | 3300005563 | Bacteria | 10671 |
| 170 | Ga0068855_100013823 | 3300005563 | Bacteria | 9733 |
| 171 | Ga0068855_100025729 | 3300005563 | Bacteria | 7038 |
| 172 | Ga0068855_100029545 | 3300005563 | Bacteria | 6551 |
| 173 | Ga0068855_100046538 | 3300005563 | Bacteria | 5128 |
| 174 | Ga0068855_100048772 | 3300005563 | Bacteria | 4997 |
| 175 | Ga0068855_100190949 | 3300005563 | Bacteria | 2310 |
| 176 | Ga0070664_100007404 | 3300005564 | Bacteria | 8857 |
| 177 | Ga0070664_100057158 | 3300005564 | Bacteria | 3315 |
| 178 | Ga0068857_100002657 | 3300005577 | Bacteria | 14674 |
| 179 | Ga0068857_100004052 | 3300005577 | Bacteria | 12337 |
| 180 | Ga0068857_100007038 | 3300005577 | Bacteria | 9683 |
| 181 | Ga0068854_100001346 | 3300005578 | Bacteria | 14809 |
| 182 | Ga0068854_100030942 | 3300005578 | Bacteria | 3716 |
| 183 | Ga0068856_100015010 | 3300005614 | Bacteria | 7482 |
| 184 | Ga0068856_100020971 | 3300005614 | Bacteria | 6350 |
| 185 | Ga0068856_100091694 | 3300005614 | Bacteria | 3022 |
| 186 | Ga0068856_100118968 | 3300005614 | Bacteria | 2643 |
| 187 | Ga0070702_100000076 | 3300005615 | Bacteria | 28331 |
| 188 | Ga0070702_100000222 | 3300005615 | Bacteria | 19156 |
| 189 | Ga0068852_100002780 | 3300005616 | Bacteria | 12118 |
| 190 | Ga0068859_100004022 | 3300005617 | Bacteria | 14989 |
| 191 | Ga0068859_100012283 | 3300005617 | Bacteria | 8615 |
| 192 | Ga0068859_100102096 | 3300005617 | Bacteria | 2925 |
| 193 | Ga0068864_100000746 | 3300005618 | Bacteria | 27280 |
| 194 | Ga0068864_100001176 | 3300005618 | Bacteria | 21797 |
| 195 | Ga0068864_100007658 | 3300005618 | Bacteria | 8894 |
| 196 | Ga0068864_100025328 | 3300005618 | Bacteria | 4995 |
| 197 | Ga0068866_10002716 | 3300005718 | Bacteria | 7299 |
| 198 | Ga0068866_10011097 | 3300005718 | Bacteria | 3884 |
| 199 | Ga0068861_100002192 | 3300005719 | Bacteria | 12676 |
| 200 | Ga0068861_100002529 | 3300005719 | Bacteria | 11945 |
| 201 | Ga0068861_100036694 | 3300005719 | Bacteria | 3640 |
| 202 | Ga0068861_100091269 | 3300005719 | Bacteria | 2404 |
| 203 | Ga0068870_10000355 | 3300005840 | Bacteria | 17198 |
| 204 | Ga0068870_10006338 | 3300005840 | Bacteria | 5211 |
| 205 | Ga0068863_100000150 | 3300005841 | Bacteria | 72968 |
| 206 | Ga0068863_100002386 | 3300005841 | Bacteria | 18670 |
| 207 | Ga0068863_100024551 | 3300005841 | Bacteria | 5748 |
| 208 | Ga0068858_100012485 | 3300005842 | Bacteria | 8012 |
| 209 | Ga0068858_100018691 | 3300005842 | Bacteria | 6487 |
| 210 | Ga0068860_100016352 | 3300005843 | Bacteria | 7234 |
| 211 | Ga0068860_100087347 | 3300005843 | Bacteria | 2969 |
| 212 | Ga0068862_100001220 | 3300005844 | Bacteria | 24248 |
| 213 | Ga0068862_100001588 | 3300005844 | Bacteria | 20692 |
| 214 | Ga0068862_100002000 | 3300005844 | Bacteria | 18481 |
| 215 | Ga0068862_100003882 | 3300005844 | Bacteria | 12713 |
| 216 | Ga0068862_100034249 | 3300005844 | Bacteria | 4295 |
| 217 | Ga0081455_10000185 | 3300005937 | Bacteria | 78750 |
| 218 | Ga0081455_10006230 | 3300005937 | Bacteria | 12845 |
| 219 | Ga0081455_10009218 | 3300005937 | Bacteria | 10170 |
| 220 | Ga0081455_10011357 | 3300005937 | Bacteria | 8954 |
| 221 | Ga0081455_10020738 | 3300005937 | Bacteria | 6180 |
| 222 | Ga0081455_10021578 | 3300005937 | Bacteria | 6037 |
| 223 | Ga0081455_10032363 | 3300005937 | Bacteria | 4713 |
| 224 | Ga0081538_10001256 | 3300005981 | Bacteria | 26461 |
| 225 | Ga0081538_10003566 | 3300005981 | Bacteria | 14644 |
| 226 | Ga0081538_10014289 | 3300005981 | Bacteria | 6221 |
| 227 | Ga0081538_10028869 | 3300005981 | Bacteria | 3804 |
| 228 | Ga0081540_1000027 | 3300005983 | Bacteria | 151880 |
| 229 | Ga0081540_1000500 | 3300005983 | Bacteria | 38559 |
| 230 | Ga0081540_1000925 | 3300005983 | Bacteria | 26377 |
| 231 | Ga0081540_1004017 | 3300005983 | Bacteria | 11391 |
| 232 | Ga0081540_1014299 | 3300005983 | Bacteria | 5094 |
| 233 | Ga0081540_1027801 | 3300005983 | Bacteria | 3194 |
| 234 | Ga0081539_10001680 | 3300005985 | Bacteria | 35819 |
| 235 | Ga0070717_10000870 | 3300006028 | Bacteria | 19960 |
| 236 | Ga0070717_10006628 | 3300006028 | Bacteria | 8531 |
| 237 | Ga0070717_10072365 | 3300006028 | Bacteria | 2878 |
| 238 | Ga0075365_10032311 | 3300006038 | Bacteria | 3363 |
| 239 | Ga0075363_100000191 | 3300006048 | Bacteria | 16473 |
| 240 | Ga0075363_100004339 | 3300006048 | Bacteria | 6183 |
| 241 | Ga0075364_10050939 | 3300006051 | Bacteria | 2703 |
| 242 | Ga0075432_10004591 | 3300006058 | Bacteria | 4698 |
| 243 | Ga0070715_10001413 | 3300006163 | Bacteria | 6948 |
| 244 | Ga0070716_100041286 | 3300006173 | Bacteria | 2570 |
| 245 | Ga0075367_10003973 | 3300006178 | Bacteria | 7139 |
| 246 | Ga0075367_10070581 | 3300006178 | Bacteria | 2100 |
| 247 | Ga0068871_100000512 | 3300006358 | Bacteria | 26615 |
| 248 | Ga0068871_100022390 | 3300006358 | Bacteria | 4870 |
| 249 | Ga0075428_100000205 | 3300006844 | Bacteria | 56652 |
| 250 | Ga0075428_100013493 | 3300006844 | Bacteria | 9094 |
| 251 | Ga0075428_100018446 | 3300006844 | Bacteria | 7715 |
| 252 | Ga0075428_100060879 | 3300006844 | Bacteria | 4134 |
| 253 | Ga0075428_100136255 | 3300006844 | Bacteria | 2669 |
| 254 | Ga0075430_100007339 | 3300006846 | Bacteria | 9313 |
| 255 | Ga0075430_100035723 | 3300006846 | Bacteria | 4215 |
| 256 | Ga0075431_100000119 | 3300006847 | Bacteria | 51177 |
| 257 | Ga0075431_100002115 | 3300006847 | Bacteria | 18984 |
| 258 | Ga0075431_100002836 | 3300006847 | Bacteria | 16771 |
| 259 | Ga0075431_100003819 | 3300006847 | Bacteria | 14638 |
| 260 | Ga0075431_100011311 | 3300006847 | Bacteria | 8989 |
| 261 | Ga0075431_100098097 | 3300006847 | Bacteria | 3025 |
| 262 | Ga0075433_10000766 | 3300006852 | Bacteria | 22081 |
| 263 | Ga0075433_10020904 | 3300006852 | Bacteria | 5480 |
| 264 | Ga0075433_10030061 | 3300006852 | Bacteria | 4632 |
| 265 | Ga0075434_100030914 | 3300006871 | Bacteria | 5277 |
| 266 | Ga0075434_100037072 | 3300006871 | Bacteria | 4826 |
| 267 | Ga0075434_100048266 | 3300006871 | Bacteria | 4224 |
| 268 | Ga0075434_100082038 | 3300006871 | Bacteria | 3222 |
| 269 | Ga0075429_100023992 | 3300006880 | Bacteria | 5291 |
| 270 | Ga0068865_100000085 | 3300006881 | Bacteria | 50007 |
| 271 | Ga0068865_100003897 | 3300006881 | Bacteria | 8950 |
| 272 | Ga0075436_100012301 | 3300006914 | Bacteria | 5863 |
| 273 | Ga0075436_100030360 | 3300006914 | Bacteria | 3720 |
| 274 | Ga0075436_100036567 | 3300006914 | Bacteria | 3389 |
| 275 | Ga0075436_100044603 | 3300006914 | Bacteria | 3057 |
| 276 | Ga0075436_100070989 | 3300006914 | Bacteria | 2408 |
| 277 | Ga0097620_100004022 | 3300006931 | Bacteria | 14989 |
| 278 | Ga0097620_100012283 | 3300006931 | Bacteria | 8615 |
| 279 | Ga0097620_100102102 | 3300006931 | Bacteria | 2925 |
| 280 | Ga0079104_1012988 | 3300006946 | Bacteria | 2589 |
| 281 | Ga0075435_100005823 | 3300007076 | Bacteria | 8665 |
| 282 | Ga0075435_100038382 | 3300007076 | Bacteria | 3818 |
| 283 | Ga0075435_100071859 | 3300007076 | Bacteria | 2826 |
| 284 | Ga0075435_100102060 | 3300007076 | Bacteria | 2377 |
| 285 | Ga0099795_10000399 | 3300007788 | Bacteria | 7886 |
| 286 | Ga0099795_10007826 | 3300007788 | Bacteria | 3010 |
| 287 | Ga0105240_10061096 | 3300009093 | Bacteria | 4696 |
| 288 | Ga0105240_10079923 | 3300009093 | Bacteria | 4023 |
| 289 | Ga0111539_10001586 | 3300009094 | Bacteria | 30280 |
| 290 | Ga0111539_10002672 | 3300009094 | Bacteria | 23612 |
| 291 | Ga0111539_10003892 | 3300009094 | Bacteria | 19636 |
| 292 | Ga0111539_10027109 | 3300009094 | Bacteria | 6998 |
| 293 | Ga0111539_10114005 | 3300009094 | Bacteria | 3170 |
| 294 | Ga0111539_10128525 | 3300009094 | Bacteria | 2968 |
| 295 | Ga0105245_10000235 | 3300009098 | Bacteria | 52697 |
| 296 | Ga0105245_10002212 | 3300009098 | Bacteria | 17605 |
| 297 | Ga0105245_10003656 | 3300009098 | Bacteria | 13737 |
| 298 | Ga0105247_10003562 | 3300009101 | Bacteria | 10117 |
| 299 | Ga0105247_10009146 | 3300009101 | Bacteria | 6030 |
| 300 | Ga0105247_10014081 | 3300009101 | Bacteria | 4798 |
| 301 | Ga0114129_10001232 | 3300009147 | Bacteria | 34070 |
| 302 | Ga0114129_10004296 | 3300009147 | Bacteria | 20137 |
| 303 | Ga0114129_10004982 | 3300009147 | Bacteria | 18716 |
| 304 | Ga0114129_10010606 | 3300009147 | Bacteria | 13139 |
| 305 | Ga0114129_10022620 | 3300009147 | Bacteria | 8916 |
| 306 | Ga0114129_10072701 | 3300009147 | Bacteria | 4794 |
| 307 | Ga0114129_10139267 | 3300009147 | Bacteria | 3328 |
| 308 | Ga0114129_10145429 | 3300009147 | Bacteria | 3248 |
| 309 | Ga0105243_10000699 | 3300009148 | Bacteria | 32411 |
| 310 | Ga0105243_10002433 | 3300009148 | Bacteria | 15555 |
| 311 | Ga0105241_10002051 | 3300009174 | Bacteria | 15218 |
| 312 | Ga0105241_10054635 | 3300009174 | Bacteria | 3058 |
| 313 | Ga0105241_10148425 | 3300009174 | Bacteria | 1916 |
| 314 | Ga0105242_10000134 | 3300009176 | Bacteria | 53681 |
| 315 | Ga0105242_10000187 | 3300009176 | Bacteria | 47568 |
| 316 | Ga0105248_10002875 | 3300009177 | Bacteria | 19107 |
| 317 | Ga0105248_10020430 | 3300009177 | Bacteria | 7337 |
| 318 | Ga0105248_10075570 | 3300009177 | Bacteria | 3786 |
| 319 | Ga0105248_10105852 | 3300009177 | Bacteria | 3172 |
| 320 | Ga0105237_10000721 | 3300009545 | Bacteria | 45754 |
| 321 | Ga0105237_10028441 | 3300009545 | Bacteria | 5694 |
| 322 | Ga0105237_10081836 | 3300009545 | Bacteria | 3220 |
| 323 | Ga0105238_10010548 | 3300009551 | Bacteria | 9278 |
| 324 | Ga0105238_10015586 | 3300009551 | Bacteria | 7695 |
| 325 | Ga0105238_10140785 | 3300009551 | Bacteria | 2389 |
| 326 | Ga0105238_10226862 | 3300009551 | Bacteria | 1845 |
| 327 | Ga0105249_10000325 | 3300009553 | Bacteria | 48220 |
| 328 | Ga0105249_10002879 | 3300009553 | Bacteria | 14855 |
| 329 | Ga0105249_10004088 | 3300009553 | Bacteria | 12596 |
| 330 | Ga0099796_10000546 | 3300010159 | Bacteria | 6432 |
| 331 | Ga0099796_10004916 | 3300010159 | Bacteria | 3285 |
| 332 | Ga0099796_10004953 | 3300010159 | Bacteria | 3279 |
| 333 | Ga0105239_10061461 | 3300010375 | Bacteria | 4123 |
| 334 | Ga0105239_10113187 | 3300010375 | Bacteria | 3009 |
| 335 | Ga0105239_10200166 | 3300010375 | Bacteria | 2237 |
| 336 | Ga0105246_10000041 | 3300011119 | Bacteria | 48215 |
| 337 | Ga0157371_10011541 | 3300013102 | Bacteria | 6794 |
| 338 | Ga0157370_10072345 | 3300013104 | Bacteria | 3253 |
| 339 | Ga0157369_10007903 | 3300013105 | Bacteria | 12229 |
| 340 | Ga0171463_1003 | 3300013249 | Bacteria | 695693 |
| 341 | Ga0157374_10006924 | 3300013296 | Bacteria | 9641 |
| 342 | Ga0157378_10000434 | 3300013297 | Bacteria | 40722 |
| 343 | Ga0157378_10002326 | 3300013297 | Bacteria | 16888 |
| 344 | Ga0157378_10054673 | 3300013297 | Bacteria | 3554 |
| 345 | Ga0157378_10121812 | 3300013297 | Bacteria | 2405 |
| 346 | Ga0163162_10000973 | 3300013306 | Bacteria | 26626 |
| 347 | Ga0163162_10003414 | 3300013306 | Bacteria | 15155 |
| 348 | Ga0157372_10001290 | 3300013307 | Bacteria | 27083 |
| 349 | Ga0157372_10011705 | 3300013307 | Bacteria | 9342 |
| 350 | Ga0157372_10148634 | 3300013307 | Bacteria | 2703 |
| 351 | Ga0157375_10000181 | 3300013308 | Bacteria | 59305 |
| 352 | Ga0157375_10001982 | 3300013308 | Bacteria | 17680 |
| 353 | Ga0157375_10022227 | 3300013308 | Bacteria | 5836 |
| 354 | Ga0163163_10002557 | 3300014325 | Bacteria | 15412 |
| 355 | Ga0163163_10111071 | 3300014325 | Bacteria | 2770 |
| 356 | Ga0157380_10000893 | 3300014326 | Bacteria | 18745 |
| 357 | Ga0182008_10044160 | 3300014497 | Bacteria | 2217 |
| 358 | Ga0157377_10005582 | 3300014745 | Bacteria | 5925 |
| 359 | Ga0157377_10035004 | 3300014745 | Bacteria | 2751 |
| 360 | Ga0157379_10000364 | 3300014968 | Bacteria | 36402 |
| 361 | Ga0157379_10049263 | 3300014968 | Bacteria | 3761 |
| 362 | Ga0157376_10000142 | 3300014969 | Bacteria | 49085 |
| 363 | Ga0157376_10000539 | 3300014969 | Bacteria | 24390 |
| 364 | Ga0157376_10086973 | 3300014969 | Bacteria | 2696 |
| 365 | Ga0183363_1295 | 3300015690 | Bacteria | 7061 |
| 366 | Ga0163161_10000081 | 3300017792 | Bacteria | 97213 |
| 367 | Ga0163161_10004604 | 3300017792 | Bacteria | 9599 |
| 368 | Ga0163161_10092646 | 3300017792 | Bacteria | 2238 |
| 369 | Ga0197907_10190156 | 3300020069 | Bacteria | 2621 |
| 370 | Ga0206350_10429826 | 3300020080 | Bacteria | 3612 |
| 371 | Ga0213873_10006007 | 3300021358 | Bacteria | 2366 |
| 372 | Ga0213872_10000620 | 3300021361 | Bacteria | 26865 |
| 373 | Ga0213872_10004301 | 3300021361 | Bacteria | 7606 |
| 374 | Ga0213872_10008938 | 3300021361 | Bacteria | 4821 |
| 375 | Ga0213872_10010374 | 3300021361 | Bacteria | 4437 |
| 376 | Ga0213872_10022855 | 3300021361 | Bacteria | 2877 |
| 377 | Ga0213872_10030390 | 3300021361 | Bacteria | 2476 |
| 378 | Ga0213876_10000749 | 3300021384 | Bacteria | 22477 |
| 379 | Ga0213876_10001133 | 3300021384 | Bacteria | 16987 |
| 380 | Ga0213876_10017442 | 3300021384 | Bacteria | 3791 |
| 381 | Ga0213875_10000175 | 3300021388 | Bacteria | 67639 |
| 382 | Ga0213875_10001215 | 3300021388 | Bacteria | 17481 |
| 383 | Ga0228711_1000008 | 3300022739 | Bacteria | 169893 |
| 384 | Ga0228710_1000009 | 3300022740 | Bacteria | 169770 |
| 385 | Ga0209760_100855 | 3300025207 | Bacteria | 3941 |
| 386 | Ga0209436_100011 | 3300025208 | Bacteria | 139405 |
| 387 | Ga0209437_100047 | 3300025233 | Bacteria | 405163 |
| 388 | Ga0209437_100242 | 3300025233 | Bacteria | 89060 |
| 389 | Ga0207425_1005009 | 3300025245 | Bacteria | 3853 |
| 390 | Ga0209026_1000962 | 3300025250 | Bacteria | 14417 |
| 391 | Ga0209677_103834 | 3300025253 | Bacteria | 4637 |
| 392 | Ga0209148_1000128 | 3300025254 | Bacteria | 179154 |
| 393 | Ga0209148_1000660 | 3300025254 | Bacteria | 29677 |
| 394 | Ga0209129_1000244 | 3300025258 | Bacteria | 57688 |
| 395 | Ga0209129_1000347 | 3300025258 | Bacteria | 39276 |
| 396 | Ga0209129_1000642 | 3300025258 | Bacteria | 23416 |
| 397 | Ga0209233_1000048 | 3300025261 | Bacteria | 453669 |
| 398 | Ga0209233_1000069 | 3300025261 | Bacteria | 367639 |
| 399 | Ga0209233_1002912 | 3300025261 | Bacteria | 6116 |
| 400 | Ga0209233_1004867 | 3300025261 | Bacteria | 4521 |
| 401 | Ga0207666_1000083 | 3300025271 | Bacteria | 15617 |
| 402 | Ga0209455_1000174 | 3300025272 | Bacteria | 109384 |
| 403 | Ga0209455_1001949 | 3300025272 | Bacteria | 8509 |
| 404 | Ga0209673_1001566 | 3300025273 | Bacteria | 20457 |
| 405 | Ga0209673_1002650 | 3300025273 | Bacteria | 11969 |
| 406 | Ga0209673_1013596 | 3300025273 | Bacteria | 3202 |
| 407 | Ga0209130_1000003 | 3300025284 | Bacteria | 677988 |
| 408 | Ga0209130_1000034 | 3300025284 | Bacteria | 302439 |
| 409 | Ga0209130_1000081 | 3300025284 | Bacteria | 166440 |
| 410 | Ga0207673_1000016 | 3300025290 | Bacteria | 12790 |
| 411 | Ga0209675_1000678 | 3300025291 | Bacteria | 23795 |
| 412 | Ga0209676_1001813 | 3300025292 | Bacteria | 17850 |
| 413 | Ga0209025_1002141 | 3300025294 | Bacteria | 22141 |
| 414 | Ga0209025_1009219 | 3300025294 | Bacteria | 6923 |
| 415 | Ga0209025_1043086 | 3300025294 | Bacteria | 1907 |
| 416 | Ga0209564_1000013 | 3300025295 | Bacteria | 775755 |
| 417 | Ga0209564_1000225 | 3300025295 | Bacteria | 126209 |
| 418 | Ga0209564_1003031 | 3300025295 | Bacteria | 11969 |
| 419 | Ga0209564_1003908 | 3300025295 | Bacteria | 9551 |
| 420 | Ga0209758_1000118 | 3300025297 | Bacteria | 195889 |
| 421 | Ga0209758_1000139 | 3300025297 | Bacteria | 175148 |
| 422 | Ga0209758_1000463 | 3300025297 | Bacteria | 67158 |
| 423 | Ga0209758_1001457 | 3300025297 | Bacteria | 27782 |
| 424 | Ga0209758_1002020 | 3300025297 | Bacteria | 21835 |
| 425 | Ga0209758_1002746 | 3300025297 | Bacteria | 17264 |
| 426 | Ga0209758_1012312 | 3300025297 | Bacteria | 4801 |
| 427 | Ga0209050_1000029 | 3300025298 | Bacteria | 465801 |
| 428 | Ga0209050_1002022 | 3300025298 | Bacteria | 18857 |
| 429 | Ga0209050_1002735 | 3300025298 | Bacteria | 14222 |
| 430 | Ga0209256_1000442 | 3300025299 | Bacteria | 63395 |
| 431 | Ga0209256_1001655 | 3300025299 | Bacteria | 21671 |
| 432 | Ga0209256_1007486 | 3300025299 | Bacteria | 5367 |
| 433 | Ga0207426_1000006 | 3300025302 | Bacteria | 1025969 |
| 434 | Ga0207426_1000008 | 3300025302 | Bacteria | 848730 |
| 435 | Ga0207426_1000011 | 3300025302 | Bacteria | 791203 |
| 436 | Ga0209051_1003289 | 3300025303 | Bacteria | 10720 |
| 437 | Ga0209051_1003936 | 3300025303 | Bacteria | 9464 |
| 438 | Ga0209257_1000271 | 3300025304 | Bacteria | 118632 |
| 439 | Ga0209257_1000559 | 3300025304 | Bacteria | 63844 |
| 440 | Ga0209257_1002648 | 3300025304 | Bacteria | 17217 |
| 441 | Ga0207697_10000045 | 3300025315 | Bacteria | 48192 |
| 442 | Ga0207682_10000046 | 3300025893 | Bacteria | 51587 |
| 443 | Ga0207682_10000171 | 3300025893 | Bacteria | 29817 |
| 444 | Ga0207710_10002314 | 3300025900 | Bacteria | 8901 |
| 445 | Ga0207710_10007155 | 3300025900 | Bacteria | 4734 |
| 446 | Ga0207710_10010128 | 3300025900 | Bacteria | 3966 |
| 447 | Ga0207688_10000092 | 3300025901 | Bacteria | 34911 |
| 448 | Ga0207688_10001093 | 3300025901 | Bacteria | 13904 |
| 449 | Ga0207688_10026400 | 3300025901 | Bacteria | 3193 |
| 450 | Ga0207680_10002071 | 3300025903 | Bacteria | 9399 |
| 451 | Ga0207680_10022223 | 3300025903 | Bacteria | 3447 |
| 452 | Ga0207647_10002086 | 3300025904 | Bacteria | 15284 |
| 453 | Ga0207647_10027804 | 3300025904 | Bacteria | 3683 |
| 454 | Ga0207685_10002312 | 3300025905 | Bacteria | 4333 |
| 455 | Ga0207699_10003273 | 3300025906 | Bacteria | 7719 |
| 456 | Ga0207645_10000275 | 3300025907 | Bacteria | 42638 |
| 457 | Ga0207645_10001966 | 3300025907 | Bacteria | 16515 |
| 458 | Ga0207645_10046566 | 3300025907 | Bacteria | 2770 |
| 459 | Ga0207643_10000025 | 3300025908 | Bacteria | 101583 |
| 460 | Ga0207643_10001083 | 3300025908 | Bacteria | 16109 |
| 461 | Ga0207705_10001898 | 3300025909 | Bacteria | 16368 |
| 462 | Ga0207705_10070957 | 3300025909 | Bacteria | 2525 |
| 463 | Ga0207684_10007905 | 3300025910 | Bacteria | 9508 |
| 464 | Ga0207654_10000936 | 3300025911 | Bacteria | 16037 |
| 465 | Ga0207707_10003472 | 3300025912 | Bacteria | 13959 |
| 466 | Ga0207707_10017968 | 3300025912 | Bacteria | 6164 |
| 467 | Ga0207707_10025765 | 3300025912 | Bacteria | 5143 |
| 468 | Ga0207707_10059251 | 3300025912 | Bacteria | 3332 |
| 469 | Ga0207707_10062325 | 3300025912 | Bacteria | 3244 |
| 470 | Ga0207707_10113062 | 3300025912 | Bacteria | 2373 |
| 471 | Ga0207695_10001525 | 3300025913 | Bacteria | 38311 |
| 472 | Ga0207695_10001672 | 3300025913 | Bacteria | 35718 |
| 473 | Ga0207695_10020168 | 3300025913 | Bacteria | 7643 |
| 474 | Ga0207695_10045418 | 3300025913 | Bacteria | 4663 |
| 475 | Ga0207695_10126603 | 3300025913 | Bacteria | 2516 |
| 476 | Ga0207671_10008391 | 3300025914 | Bacteria | 8769 |
| 477 | Ga0207693_10000829 | 3300025915 | Bacteria | 27465 |
| 478 | Ga0207693_10004304 | 3300025915 | Bacteria | 12054 |
| 479 | Ga0207693_10011371 | 3300025915 | Bacteria | 7207 |
| 480 | Ga0207693_10012320 | 3300025915 | Bacteria | 6910 |
| 481 | Ga0207693_10017674 | 3300025915 | Bacteria | 5685 |
| 482 | Ga0207663_10020705 | 3300025916 | Bacteria | 3729 |
| 483 | Ga0207663_10020766 | 3300025916 | Bacteria | 3726 |
| 484 | Ga0207660_10000131 | 3300025917 | Bacteria | 44091 |
| 485 | Ga0207660_10001363 | 3300025917 | Bacteria | 16372 |
| 486 | Ga0207660_10065532 | 3300025917 | Bacteria | 2625 |
| 487 | Ga0207662_10000657 | 3300025918 | Bacteria | 15659 |
| 488 | Ga0207662_10001580 | 3300025918 | Bacteria | 11150 |
| 489 | Ga0207657_10000112 | 3300025919 | Bacteria | 79849 |
| 490 | Ga0207657_10003184 | 3300025919 | Bacteria | 17560 |
| 491 | Ga0207657_10013490 | 3300025919 | Bacteria | 8013 |
| 492 | Ga0207657_10023488 | 3300025919 | Bacteria | 5741 |
| 493 | Ga0207657_10054696 | 3300025919 | Bacteria | 3450 |
| 494 | Ga0207649_10000048 | 3300025920 | Bacteria | 110714 |
| 495 | Ga0207652_10003368 | 3300025921 | Bacteria | 13195 |
| 496 | Ga0207652_10003790 | 3300025921 | Bacteria | 12388 |
| 497 | Ga0207652_10014059 | 3300025921 | Bacteria | 6479 |
| 498 | Ga0207652_10038068 | 3300025921 | Bacteria | 4075 |
| 499 | Ga0207652_10086404 | 3300025921 | Bacteria | 2750 |
| 500 | Ga0207652_10120492 | 3300025921 | Bacteria | 2334 |
| 501 | Ga0207646_10048746 | 3300025922 | Bacteria | 3796 |
| 502 | Ga0207681_10000131 | 3300025923 | Bacteria | 61025 |
| 503 | Ga0207681_10013850 | 3300025923 | Bacteria | 4996 |
| 504 | Ga0207694_10026887 | 3300025924 | Bacteria | 4381 |
| 505 | Ga0207694_10057786 | 3300025924 | Bacteria | 3017 |
| 506 | Ga0207694_10065703 | 3300025924 | Bacteria | 2829 |
| 507 | Ga0207694_10081960 | 3300025924 | Bacteria | 2535 |
| 508 | Ga0207650_10060458 | 3300025925 | Bacteria | 2827 |
| 509 | Ga0207650_10113204 | 3300025925 | Bacteria | 2103 |
| 510 | Ga0207659_10000040 | 3300025926 | Bacteria | 91375 |
| 511 | Ga0207659_10010222 | 3300025926 | Bacteria | 5885 |
| 512 | Ga0207659_10018709 | 3300025926 | Bacteria | 4545 |
| 513 | Ga0207687_10000122 | 3300025927 | Bacteria | 52776 |
| 514 | Ga0207687_10014550 | 3300025927 | Bacteria | 5151 |
| 515 | Ga0207687_10018688 | 3300025927 | Bacteria | 4580 |
| 516 | Ga0207687_10025052 | 3300025927 | Bacteria | 3991 |
| 517 | Ga0207700_10000974 | 3300025928 | Bacteria | 16532 |
| 518 | Ga0207700_10038862 | 3300025928 | Bacteria | 3458 |
| 519 | Ga0207644_10002729 | 3300025931 | Bacteria | 11369 |
| 520 | Ga0207644_10015860 | 3300025931 | Bacteria | 5065 |
| 521 | Ga0207690_10000104 | 3300025932 | Bacteria | 68527 |
| 522 | Ga0207690_10000512 | 3300025932 | Bacteria | 25163 |
| 523 | Ga0207690_10009059 | 3300025932 | Bacteria | 5908 |
| 524 | Ga0207690_10015332 | 3300025932 | Bacteria | 4643 |
| 525 | Ga0207690_10040226 | 3300025932 | Bacteria | 3055 |
| 526 | Ga0207706_10000311 | 3300025933 | Bacteria | 52676 |
| 527 | Ga0207706_10001805 | 3300025933 | Bacteria | 21014 |
| 528 | Ga0207706_10008103 | 3300025933 | Bacteria | 9697 |
| 529 | Ga0207706_10151500 | 3300025933 | Bacteria | 2039 |
| 530 | Ga0207686_10000377 | 3300025934 | Bacteria | 31093 |
| 531 | Ga0207686_10028007 | 3300025934 | Bacteria | 3306 |
| 532 | Ga0207709_10000585 | 3300025935 | Bacteria | 30473 |
| 533 | Ga0207709_10008650 | 3300025935 | Bacteria | 5621 |
| 534 | Ga0207709_10011384 | 3300025935 | Bacteria | 4907 |
| 535 | Ga0207670_10007327 | 3300025936 | Bacteria | 6147 |
| 536 | Ga0207670_10012130 | 3300025936 | Bacteria | 5029 |
| 537 | Ga0207670_10023246 | 3300025936 | Bacteria | 3856 |
| 538 | Ga0207669_10000102 | 3300025937 | Bacteria | 42874 |
| 539 | Ga0207669_10003612 | 3300025937 | Bacteria | 6710 |
| 540 | Ga0207669_10010809 | 3300025937 | Bacteria | 4411 |
| 541 | Ga0207669_10019553 | 3300025937 | Bacteria | 3529 |
| 542 | Ga0207669_10053870 | 3300025937 | Bacteria | 2426 |
| 543 | Ga0207704_10000071 | 3300025938 | Bacteria | 64527 |
| 544 | Ga0207665_10000542 | 3300025939 | Bacteria | 25445 |
| 545 | Ga0207665_10005622 | 3300025939 | Bacteria | 8356 |
| 546 | Ga0207665_10033292 | 3300025939 | Bacteria | 3415 |
| 547 | Ga0207691_10000257 | 3300025940 | Bacteria | 52675 |
| 548 | Ga0207691_10002528 | 3300025940 | Bacteria | 17873 |
| 549 | Ga0207691_10023849 | 3300025940 | Bacteria | 5758 |
| 550 | Ga0207691_10086071 | 3300025940 | Bacteria | 2820 |
| 551 | Ga0207711_10014250 | 3300025941 | Bacteria | 6603 |
| 552 | Ga0207711_10025808 | 3300025941 | Bacteria | 4927 |
| 553 | Ga0207711_10098602 | 3300025941 | Bacteria | 2582 |
| 554 | Ga0207711_10106957 | 3300025941 | Bacteria | 2483 |
| 555 | Ga0207689_10000134 | 3300025942 | Bacteria | 62937 |
| 556 | Ga0207689_10051943 | 3300025942 | Bacteria | 3379 |
| 557 | Ga0207661_10000003 | 3300025944 | Bacteria | 611941 |
| 558 | Ga0207661_10000204 | 3300025944 | Bacteria | 38344 |
| 559 | Ga0207661_10071743 | 3300025944 | Bacteria | 2831 |
| 560 | Ga0207679_10000090 | 3300025945 | Bacteria | 79412 |
| 561 | Ga0207679_10004910 | 3300025945 | Bacteria | 8336 |
| 562 | Ga0207679_10028035 | 3300025945 | Bacteria | 3903 |
| 563 | Ga0207667_10001369 | 3300025949 | Bacteria | 30569 |
| 564 | Ga0207667_10022115 | 3300025949 | Bacteria | 7035 |
| 565 | Ga0207667_10057994 | 3300025949 | Bacteria | 4063 |
| 566 | Ga0207667_10058443 | 3300025949 | Bacteria | 4044 |
| 567 | Ga0207667_10071354 | 3300025949 | Bacteria | 3611 |
| 568 | Ga0207667_10087144 | 3300025949 | Bacteria | 3230 |
| 569 | Ga0207651_10000017 | 3300025960 | Bacteria | 100256 |
| 570 | Ga0207651_10002790 | 3300025960 | Bacteria | 8394 |
| 571 | Ga0207651_10016867 | 3300025960 | Bacteria | 4295 |
| 572 | Ga0207651_10033854 | 3300025960 | Bacteria | 3301 |
| 573 | Ga0207712_10000114 | 3300025961 | Bacteria | 87261 |
| 574 | Ga0207712_10002157 | 3300025961 | Bacteria | 12853 |
| 575 | Ga0207712_10011464 | 3300025961 | Bacteria | 5647 |
| 576 | Ga0207712_10046176 | 3300025961 | Bacteria | 3019 |
| 577 | Ga0207668_10000033 | 3300025972 | Bacteria | 121080 |
| 578 | Ga0207668_10000139 | 3300025972 | Bacteria | 49764 |
| 579 | Ga0207668_10004255 | 3300025972 | Bacteria | 8396 |
| 580 | Ga0207668_10007278 | 3300025972 | Bacteria | 6571 |
| 581 | Ga0207668_10029136 | 3300025972 | Bacteria | 3615 |
| 582 | Ga0207668_10040338 | 3300025972 | Bacteria | 3149 |
| 583 | Ga0207640_10000221 | 3300025981 | Bacteria | 40097 |
| 584 | Ga0207658_10005120 | 3300025986 | Bacteria | 9027 |
| 585 | Ga0207658_10008572 | 3300025986 | Bacteria | 6956 |
| 586 | Ga0207658_10032185 | 3300025986 | Bacteria | 3730 |
| 587 | Ga0207677_10000989 | 3300026023 | Bacteria | 15674 |
| 588 | Ga0207677_10003410 | 3300026023 | Bacteria | 8421 |
| 589 | Ga0207703_10037396 | 3300026035 | Bacteria | 3867 |
| 590 | Ga0207703_10064191 | 3300026035 | Bacteria | 3013 |
| 591 | Ga0207703_10122856 | 3300026035 | Bacteria | 2231 |
| 592 | Ga0207639_10003962 | 3300026041 | Bacteria | 9992 |
| 593 | Ga0207678_10000086 | 3300026067 | Bacteria | 76696 |
| 594 | Ga0207678_10000131 | 3300026067 | Bacteria | 62864 |
| 595 | Ga0207678_10005906 | 3300026067 | Bacteria | 10905 |
| 596 | Ga0207678_10009376 | 3300026067 | Bacteria | 8615 |
| 597 | Ga0207678_10015605 | 3300026067 | Bacteria | 6678 |
| 598 | Ga0207708_10000192 | 3300026075 | Bacteria | 48193 |
| 599 | Ga0207708_10000679 | 3300026075 | Bacteria | 26002 |
| 600 | Ga0207708_10008198 | 3300026075 | Bacteria | 7741 |
| 601 | Ga0207708_10019626 | 3300026075 | Bacteria | 5097 |
| 602 | Ga0207708_10050405 | 3300026075 | Bacteria | 3168 |
| 603 | Ga0207708_10148413 | 3300026075 | Bacteria | 1844 |
| 604 | Ga0207702_10000198 | 3300026078 | Bacteria | 71277 |
| 605 | Ga0207702_10008405 | 3300026078 | Bacteria | 8710 |
| 606 | Ga0207702_10014635 | 3300026078 | Bacteria | 6510 |
| 607 | Ga0207702_10053882 | 3300026078 | Bacteria | 3406 |
| 608 | Ga0207641_10000246 | 3300026088 | Bacteria | 70235 |
| 609 | Ga0207641_10022801 | 3300026088 | Bacteria | 5154 |
| 610 | Ga0207641_10092917 | 3300026088 | Bacteria | 2643 |
| 611 | Ga0207648_10000483 | 3300026089 | Bacteria | 44295 |
| 612 | Ga0207648_10001913 | 3300026089 | Bacteria | 22748 |
| 613 | Ga0207676_10000372 | 3300026095 | Bacteria | 38295 |
| 614 | Ga0207676_10005821 | 3300026095 | Bacteria | 8715 |
| 615 | Ga0207676_10018086 | 3300026095 | Bacteria | 5118 |
| 616 | Ga0207674_10000355 | 3300026116 | Bacteria | 59230 |
| 617 | Ga0207674_10003117 | 3300026116 | Bacteria | 20454 |
| 618 | Ga0207674_10007248 | 3300026116 | Bacteria | 12933 |
| 619 | Ga0207675_100000111 | 3300026118 | Bacteria | 66086 |
| 620 | Ga0207675_100001557 | 3300026118 | Bacteria | 22972 |
| 621 | Ga0207675_100004582 | 3300026118 | Bacteria | 13325 |
| 622 | Ga0207683_10000512 | 3300026121 | Bacteria | 35724 |
| 623 | Ga0207683_10006472 | 3300026121 | Bacteria | 10023 |
| 624 | Ga0207683_10008939 | 3300026121 | Bacteria | 8534 |
| 625 | Ga0207683_10010713 | 3300026121 | Bacteria | 7817 |
| 626 | Ga0207683_10012332 | 3300026121 | Bacteria | 7294 |
| 627 | Ga0207683_10018283 | 3300026121 | Bacteria | 5979 |
| 628 | Ga0207683_10057924 | 3300026121 | Bacteria | 3401 |
| 629 | Ga0207698_10000524 | 3300026142 | Bacteria | 22268 |
| 630 | Ga0209281_1000106 | 3300027111 | Bacteria | 219666 |
| 631 | Ga0209281_1000426 | 3300027111 | Bacteria | 62651 |
| 632 | Ga0209981_1001049 | 3300027378 | Bacteria | 3510 |
| 633 | Ga0209999_1002321 | 3300027543 | Bacteria | 3352 |
| 634 | Ga0210002_1000804 | 3300027617 | Bacteria | 4285 |
| 635 | Ga0209983_1003168 | 3300027665 | Bacteria | 3530 |
| 636 | Ga0209282_1000024 | 3300027666 | Bacteria | 170348 |
| 637 | Ga0209966_1002710 | 3300027695 | Bacteria | 2962 |
| 638 | Ga0209813_10000820 | 3300027866 | Bacteria | 7044 |
| 639 | Ga0209813_10003047 | 3300027866 | Bacteria | 3894 |
| 640 | Ga0209974_10000322 | 3300027876 | Bacteria | 15645 |
| 641 | Ga0207428_10000620 | 3300027907 | Bacteria | 41879 |
| 642 | Ga0207428_10001181 | 3300027907 | Bacteria | 28103 |
| 643 | Ga0207428_10011769 | 3300027907 | Bacteria | 7714 |
| 644 | Ga0207428_10018259 | 3300027907 | Bacteria | 5994 |
| 645 | Ga0207428_10030202 | 3300027907 | Bacteria | 4483 |
| 646 | Ga0207428_10036079 | 3300027907 | Bacteria | 4036 |
| 647 | Ga0268266_10001055 | 3300028379 | Bacteria | 34552 |
| 648 | Ga0268266_10025775 | 3300028379 | Bacteria | 5003 |
| 649 | Ga0268266_10026025 | 3300028379 | Bacteria | 4977 |
| 650 | Ga0268266_10047366 | 3300028379 | Bacteria | 3682 |
| 651 | Ga0268265_10000312 | 3300028380 | Bacteria | 53940 |
| 652 | Ga0268265_10001908 | 3300028380 | Bacteria | 16572 |
| 653 | Ga0268265_10105875 | 3300028380 | Bacteria | 2283 |
| 654 | Ga0268264_10000412 | 3300028381 | Bacteria | 60566 |
| 655 | Ga0268264_10002132 | 3300028381 | Bacteria | 17654 |
| 656 | Ga0268264_10019365 | 3300028381 | Bacteria | 5563 |
| 657 | Ga0268264_10109317 | 3300028381 | Bacteria | 2418 |
| 658 | Ga0268264_10187505 | 3300028381 | Bacteria | 1883 |
| 659 | Ga0265337_1000961 | 3300028556 | Bacteria | 15089 |
| 660 | Ga0307515_10019424 | 3300028794 | Bacteria | 12229 |
| 661 | Ga0265338_10036784 | 3300028800 | Bacteria | 4676 |
| 662 | Ga0265338_10059255 | 3300028800 | Bacteria | 3373 |
| 663 | Ga0265330_10012173 | 3300031235 | Bacteria | 4025 |
| 664 | Ga0265330_10020649 | 3300031235 | Bacteria | 3010 |
| 665 | Ga0265332_10014858 | 3300031238 | Bacteria | 3441 |
| 666 | Ga0265332_10015002 | 3300031238 | Bacteria | 3424 |
| 667 | Ga0265328_10013540 | 3300031239 | Bacteria | 3227 |
| 668 | Ga0265320_10001466 | 3300031240 | Bacteria | 17239 |
| 669 | Ga0265325_10000036 | 3300031241 | Bacteria | 96858 |
| 670 | Ga0265325_10000464 | 3300031241 | Bacteria | 29365 |
| 671 | Ga0265325_10006666 | 3300031241 | Bacteria | 6986 |
| 672 | Ga0265325_10022638 | 3300031241 | Bacteria | 3439 |
| 673 | Ga0265325_10033804 | 3300031241 | Bacteria | 2724 |
| 674 | Ga0265325_10037137 | 3300031241 | Bacteria | 2576 |
| 675 | Ga0265325_10045502 | 3300031241 | Bacteria | 2280 |
| 676 | Ga0265325_10051647 | 3300031241 | Bacteria | 2113 |
| 677 | Ga0265340_10000517 | 3300031247 | Bacteria | 21236 |
| 678 | Ga0265340_10012309 | 3300031247 | Bacteria | 4521 |
| 679 | Ga0265340_10015660 | 3300031247 | Bacteria | 3937 |
| 680 | Ga0265339_10008913 | 3300031249 | Bacteria | 6348 |
| 681 | Ga0265339_10017127 | 3300031249 | Bacteria | 4297 |
| 682 | Ga0265339_10017213 | 3300031249 | Bacteria | 4285 |
| 683 | Ga0265331_10000075 | 3300031250 | Bacteria | 149131 |
| 684 | Ga0265331_10000078 | 3300031250 | Bacteria | 143415 |
| 685 | Ga0265331_10001331 | 3300031250 | Bacteria | 18290 |
| 686 | Ga0265331_10005666 | 3300031250 | Bacteria | 7502 |
| 687 | Ga0265331_10008072 | 3300031250 | Bacteria | 6014 |
| 688 | Ga0265331_10026655 | 3300031250 | Bacteria | 2903 |
| 689 | Ga0265327_10000180 | 3300031251 | Bacteria | 134665 |
| 690 | Ga0265327_10000553 | 3300031251 | Bacteria | 64026 |
| 691 | Ga0265316_10017409 | 3300031344 | Bacteria | 6214 |
| 692 | Ga0265316_10102058 | 3300031344 | Bacteria | 2179 |
| 693 | Ga0265313_10000513 | 3300031595 | Bacteria | 40580 |
| 694 | Ga0265313_10000638 | 3300031595 | Bacteria | 36091 |
| 695 | Ga0265313_10003540 | 3300031595 | Bacteria | 12587 |
| 696 | Ga0265313_10013706 | 3300031595 | Bacteria | 4840 |
| 697 | Ga0307508_10042605 | 3300031616 | Bacteria | 4071 |
| 698 | Ga0316575_10002263 | 3300031665 | Bacteria | 6432 |
| 699 | Ga0316575_10002645 | 3300031665 | Bacteria | 6035 |
| 700 | Ga0316575_10002783 | 3300031665 | Bacteria | 5917 |
| 701 | Ga0316575_10004010 | 3300031665 | Bacteria | 5157 |
| 702 | Ga0316575_10018408 | 3300031665 | Bacteria | 2662 |
| 703 | Ga0316579_10001061 | 3300031691 | Bacteria | 9725 |
| 704 | Ga0316579_10001551 | 3300031691 | Bacteria | 8388 |
| 705 | Ga0316579_10004056 | 3300031691 | Bacteria | 5780 |
| 706 | Ga0316579_10011064 | 3300031691 | Bacteria | 3828 |
| 707 | Ga0316579_10011579 | 3300031691 | Bacteria | 3751 |
| 708 | Ga0316579_10016860 | 3300031691 | Bacteria | 3197 |
| 709 | Ga0265314_10000771 | 3300031711 | Bacteria | 38181 |
| 710 | Ga0265314_10010382 | 3300031711 | Bacteria | 7773 |
| 711 | Ga0265314_10032009 | 3300031711 | Bacteria | 3875 |
| 712 | Ga0265342_10000360 | 3300031712 | Bacteria | 50461 |
| 713 | Ga0265342_10000715 | 3300031712 | Bacteria | 34304 |
| 714 | Ga0265342_10005336 | 3300031712 | Bacteria | 9833 |
| 715 | Ga0265342_10047300 | 3300031712 | Bacteria | 2582 |
| 716 | Ga0316576_10000198 | 3300031727 | Bacteria | 25137 |
| 717 | Ga0316576_10005194 | 3300031727 | Bacteria | 7913 |
| 718 | Ga0316576_10011388 | 3300031727 | Bacteria | 5828 |
| 719 | Ga0316576_10122419 | 3300031727 | Bacteria | 1954 |
| 720 | Ga0316578_10000077 | 3300031728 | Bacteria | 22228 |
| 721 | Ga0316578_10005155 | 3300031728 | Bacteria | 6297 |
| 722 | Ga0316578_10006984 | 3300031728 | Bacteria | 5617 |
| 723 | Ga0316578_10014499 | 3300031728 | Bacteria | 4212 |
| 724 | Ga0316578_10014887 | 3300031728 | Bacteria | 4169 |
| 725 | Ga0316578_10019116 | 3300031728 | Bacteria | 3765 |
| 726 | Ga0316578_10021684 | 3300031728 | Bacteria | 3568 |
| 727 | Ga0316578_10050852 | 3300031728 | Bacteria | 2425 |
| 728 | Ga0316578_10060071 | 3300031728 | Bacteria | 2237 |
| 729 | Ga0307516_10000257 | 3300031730 | Bacteria | 68036 |
| 730 | Ga0316577_10000871 | 3300031733 | Bacteria | 13225 |
| 731 | Ga0316577_10001039 | 3300031733 | Bacteria | 12534 |
| 732 | Ga0316577_10004396 | 3300031733 | Bacteria | 7267 |
| 733 | Ga0316577_10061094 | 3300031733 | Bacteria | 2103 |
| 734 | Ga0315914_1000012 | 3300031967 | Bacteria | 169896 |
| 735 | Ga0307414_10077197 | 3300032004 | Bacteria | 2423 |
| 736 | Ga0316583_10000473 | 3300032133 | Bacteria | 11927 |
| 737 | Ga0316583_10001032 | 3300032133 | Bacteria | 9019 |
| 738 | Ga0316583_10001042 | 3300032133 | Bacteria | 8984 |
| 739 | Ga0316583_10007189 | 3300032133 | Bacteria | 4003 |
| 740 | Ga0316583_10009989 | 3300032133 | Bacteria | 3418 |
| 741 | Ga0316585_10000049 | 3300032137 | Bacteria | 18889 |
| 742 | Ga0316585_10003164 | 3300032137 | Bacteria | 4494 |
| 743 | Ga0316585_10004124 | 3300032137 | Bacteria | 4034 |
| 744 | Ga0316585_10005790 | 3300032137 | Bacteria | 3501 |
| 745 | Ga0316580_10001570 | 3300032139 | Bacteria | 6027 |
| 746 | Ga0316580_10020181 | 3300032139 | Bacteria | 2051 |
| 747 | Ga0315913_1000006 | 3300033430 | Bacteria | 169893 |
| 748 | Ga0315915_1000010 | 3300033464 | Bacteria | 240214 |
| 749 | Ga0316588_1005591 | 3300033528 | Bacteria | 2459 |
| 750 | Ga0373930_0000084 | 3300034816 | Bacteria | 9515 |
| 751 | Ga0373948_0000552 | 3300034817 | Bacteria | 4727 |
| 752 | Ga0373948_0003692 | 3300034817 | Bacteria | 2375 |
| 753 | Ga0373950_0000815 | 3300034818 | Bacteria | 3910 |
| 754 | Ga0373959_0000425 | 3300034820 | Bacteria | 8056 |
| 755 | Ga0373938_0000231 | 3300034957 | Bacteria | 8683 |
| 756 | Ga0373938_0000567 | 3300034957 | Bacteria | 5975 |
| 757 | Ga0373926_0011880 | 3300035083 | Bacteria | 2937 |
| 758 | Ga0373928_0000206 | 3300035084 | Bacteria | 11362 |
| 759 | Ga0373929_0000733 | 3300035085 | Bacteria | 6348 |
| 760 | Ga0373940_0000021 | 3300035088 | Bacteria | 17555 |
| 761 | Ga0373940_0009488 | 3300035088 | Bacteria | 2265 |
| 762 | Ga0373949_0001483 | 3300035090 | Bacteria | 6691 |
| 763 | Ga0373949_0006727 | 3300035090 | Bacteria | 2525 |
| 764 | Ga0373951_0000265 | 3300035091 | Bacteria | 17187 |
| 765 | Ga0373952_0000034 | 3300035092 | Bacteria | 15897 |
| 766 | Ga0373952_0000042 | 3300035092 | Bacteria | 15314 |
| 767 | Ga0373923_0005769 | 3300035111 | Bacteria | 4225 |
| 768 | Ga0373923_0010174 | 3300035111 | Bacteria | 3416 |
| 769 | Ga0373932_0000344 | 3300035112 | Bacteria | 14241 |
| 770 | Ga0373932_0006490 | 3300035112 | Bacteria | 2766 |
| 771 | Ga0373936_0000864 | 3300035113 | Bacteria | 10809 |
| 772 | Ga0373939_0002998 | 3300035114 | Bacteria | 3963 |
| 773 | Ga0373941_0000157 | 3300035115 | Bacteria | 12338 |
| 774 | Ga0373945_0000731 | 3300035116 | Bacteria | 9564 |
| 775 | Ga0373953_0010038 | 3300035117 | Bacteria | 3282 |
| 776 | Ga0373953_0010454 | 3300035117 | Bacteria | 3230 |
| 777 | Ga0373953_0013202 | 3300035117 | Bacteria | 2945 |
| 778 | Ga0373954_0005581 | 3300035118 | Bacteria | 5449 |
| 779 | Ga0373954_0009228 | 3300035118 | Bacteria | 4339 |
| 780 | Ga0373956_0022433 | 3300035119 | Bacteria | 2702 |
| 781 | Ga0373957_0001308 | 3300035120 | Bacteria | 6688 |
| 782 | Ga0373960_0002888 | 3300035121 | Bacteria | 3887 |
| 783 | Ga0373960_0006657 | 3300035121 | Bacteria | 2718 |
| 784 | Ga0373943_0003877 | 3300035170 | Bacteria | 6808 |
| 785 | Ga0373943_0010393 | 3300035170 | Bacteria | 4171 |
| 786 | Ga0373943_0010994 | 3300035170 | Bacteria | 4067 |
| 787 | Ga0373943_0068648 | 3300035170 | Bacteria | 1790 |
| 788 | Ga0373955_0004247 | 3300035172 | Bacteria | 6326 |
| 789 | Ga0373955_0025856 | 3300035172 | Bacteria | 3018 |
| 790 | Ga0373955_0032828 | 3300035172 | Bacteria | 2729 |
| 791 | Ga0373955_0045087 | 3300035172 | Bacteria | 2378 |
| 792 | Ga0373961_0000304 | 3300035241 | Bacteria | 21873 |
| 793 | Ga0373961_0010703 | 3300035241 | Bacteria | 2264 |
| 794 | Ga0373962_0000142 | 3300035242 | Bacteria | 14926 |
| 795 | Ga0373962_0000927 | 3300035242 | Bacteria | 6746 |
| 796 | Ga0373962_0004411 | 3300035242 | Bacteria | 3399 |
| 797 | Ga0316574_0003836 | 3300035398 | Bacteria | 7804 |
| 798 | Ga0316574_0007168 | 3300035398 | Bacteria | 6091 |
| 799 | Ga0316574_0012852 | 3300035398 | Bacteria | 4800 |
| 800 | Ga0316574_0027465 | 3300035398 | Bacteria | 3429 |
| 801 | Ga0316574_0077481 | 3300035398 | Bacteria | 2107 |
| 802 | Ga0373924_0000412 | 3300035410 | Bacteria | 13128 |
| 803 | Ga0373924_0013444 | 3300035410 | Bacteria | 3076 |
| 804 | Ga0373931_0000765 | 3300035691 | Bacteria | 13438 |
| 805 | Ga0373931_0002775 | 3300035691 | Bacteria | 7794 |
| 806 | Ga0373931_0015851 | 3300035691 | Bacteria | 3700 |
| 807 | Ga0373931_0039406 | 3300035691 | Bacteria | 2476 |
| 808 | Ga0373931_0050482 | 3300035691 | Bacteria | 2213 |
| 809 | Ga0373935_0000100 | 3300035692 | Bacteria | 38385 |
| 810 | Ga0373927_0005863 | 3300035695 | Bacteria | 8425 |
| 811 | Ga0373927_0038482 | 3300035695 | Bacteria | 3105 |
| 812 | Ga0373927_0077725 | 3300035695 | Bacteria | 2150 |
| 813 | Ga0373933_0001555 | 3300035724 | Bacteria | 13441 |
| 814 | Ga0373933_0007191 | 3300035724 | Bacteria | 6066 |
| 815 | Ga0373933_0011180 | 3300035724 | Bacteria | 4939 |
| 816 | Ga0373937_0000028 | 3300036401 | Bacteria | 123801 |
| 817 | Ga0373937_0006851 | 3300036401 | Bacteria | 9832 |
| 818 | Ga0373937_0008559 | 3300036401 | Bacteria | 8888 |
| 819 | Ga0373937_0009265 | 3300036401 | Bacteria | 8548 |
| 820 | Ga0373937_0011718 | 3300036401 | Bacteria | 7689 |
| 821 | Ga0373937_0012323 | 3300036401 | Bacteria | 7517 |
| 822 | Ga0373937_0028626 | 3300036401 | Bacteria | 5043 |
| 823 | Ga0373937_0092513 | 3300036401 | Bacteria | 2803 |
| 824 | Ga0316582_0000522 | 3300036647 | Bacteria | 14576 |
| 825 | Ga0316582_0001859 | 3300036647 | Bacteria | 9575 |
| 826 | Ga0316582_0025562 | 3300036647 | Bacteria | 3547 |
| 827 | Ga0316582_0026382 | 3300036647 | Bacteria | 3497 |
| 828 | Ga0316582_0030685 | 3300036647 | Bacteria | 3277 |
| 829 | Ga0316582_0041248 | 3300036647 | Bacteria | 2884 |
| 830 | Ga0316582_0049370 | 3300036647 | Bacteria | 2662 |
| 831 | Ga0316582_0053019 | 3300036647 | Bacteria | 2579 |
| 832 | Ga0316582_0057998 | 3300036647 | Bacteria | 2474 |
| 833 | Ga0316582_0062214 | 3300036647 | Bacteria | 2396 |
| 834 | Ga0316584_0002243 | 3300036712 | Bacteria | 12130 |
| 835 | Ga0316584_0006512 | 3300036712 | Bacteria | 7909 |
| 836 | Ga0316584_0006565 | 3300036712 | Bacteria | 7880 |
| 837 | Ga0316584_0007146 | 3300036712 | Bacteria | 7612 |
| 838 | Ga0316584_0016129 | 3300036712 | Bacteria | 5352 |
| 839 | Ga0316584_0017993 | 3300036712 | Bacteria | 5092 |
| 840 | Ga0316584_0023952 | 3300036712 | Bacteria | 4463 |
| 841 | Ga0316584_0027441 | 3300036712 | Bacteria | 4191 |
| 842 | Ga0316584_0052086 | 3300036712 | Bacteria | 3061 |
| 843 | Ga0316584_0065493 | 3300036712 | Bacteria | 2722 |
| 844 | Ga0316584_0075582 | 3300036712 | Bacteria | 2524 |
| 845 | Ga0316584_0122781 | 3300036712 | Bacteria | 1940 |
| 846 | Ga0316584_0136554 | 3300036712 | Bacteria | 1830 |
| 847 | Ga0373925_0000034 | 3300037068 | Bacteria | 144257 |
| 848 | Ga0373925_0094579 | 3300037068 | Bacteria | 2288 |
| 849 | Ga0395899_0001908 | 3300037312 | Bacteria | 17203 |
| 850 | Ga0395900_0002494 | 3300037418 | Bacteria | 20228 |
| 851 | Ga0395900_0002564 | 3300037418 | Bacteria | 19910 |
| 852 | Ga0395900_0006623 | 3300037418 | Bacteria | 12054 |
| 853 | Ga0395900_0025258 | 3300037418 | Bacteria | 6081 |
| 854 | Ga0395900_0028120 | 3300037418 | Bacteria | 5757 |
| 855 | Ga0395900_0040008 | 3300037418 | Bacteria | 4831 |
| 856 | Ga0395898_0003555 | 3300037466 | Bacteria | 17378 |
| 857 | Ga0395898_0013055 | 3300037466 | Bacteria | 8559 |
| 858 | Ga0395898_0066968 | 3300037466 | Bacteria | 3478 |
| 859 | Ga0395898_0124783 | 3300037466 | Bacteria | 2466 |
| 860 | Ga0395905_0000736 | 3300037471 | Bacteria | 43138 |
| 861 | Ga0395905_0001625 | 3300037471 | Bacteria | 26720 |
| 862 | Ga0316581_0002447 | 3300037588 | Bacteria | 4444 |
| 863 | Ga0316581_0013022 | 3300037588 | Bacteria | 2352 |
| 864 | Ga0436364_0353649 | 3300037853 | Bacteria | 72201 |
| 865 | Ga0436364_0377291 | 3300037853 | Bacteria | 10299 |
| 866 | Ga0436364_0595239 | 3300037853 | Bacteria | 105667 |
| 867 | Ga0436364_0631135 | 3300037853 | Bacteria | 32086 |
| 868 | Ga0436364_0640611 | 3300037853 | Bacteria | 3548 |
| 869 | Ga0436364_0953382 | 3300037853 | Bacteria | 3311 |
| 870 | Ga0436364_1536187 | 3300037853 | Bacteria | 2463 |
| 871 | Ga0395901_0000697 | 3300038443 | Bacteria | 38340 |
| 872 | Ga0395901_0021620 | 3300038443 | Bacteria | 6591 |
| 873 | Ga0395901_0026968 | 3300038443 | Bacteria | 5899 |
| 874 | Ga0395901_0036300 | 3300038443 | Bacteria | 5093 |
| 875 | Ga0395901_0044558 | 3300038443 | Bacteria | 4601 |
| 876 | Ga0400484_16670 | 3300038725 | Bacteria | 11085 |
| 877 | Ga0400484_31873 | 3300038725 | Bacteria | 18535 |
| 878 | Ga0400490_02503 | 3300038726 | Bacteria | 40089 |
| 879 | Ga0400490_03843 | 3300038726 | Bacteria | 2828 |
| 880 | Ga0400490_09340 | 3300038726 | Bacteria | 10004 |
| 881 | Ga0400490_33722 | 3300038726 | Bacteria | 86861 |
| 882 | Ga0400490_38958 | 3300038726 | Bacteria | 4991 |
| 883 | Ga0400491_03081 | 3300038727 | Bacteria | 5241 |
| 884 | Ga0400491_12422 | 3300038727 | Bacteria | 3690 |
| 885 | Ga0400485_05246 | 3300038735 | Bacteria | 16172 |
| 886 | Ga0400488_12436 | 3300038741 | Bacteria | 3463 |
| 887 | Ga0400488_21807 | 3300038741 | Bacteria | 6678 |
| 888 | Ga0400488_27611 | 3300038741 | Bacteria | 5734 |
| 889 | Ga0400488_42546 | 3300038741 | Bacteria | 1925 |
| 890 | Ga0400486_05863 | 3300038742 | Bacteria | 74939 |
| 891 | Ga0400486_16702 | 3300038742 | Bacteria | 32581 |
| 892 | Ga0400486_24531 | 3300038742 | Bacteria | 5809 |
| 893 | Ga0400483_070746 | 3300039062 | Bacteria | 14539 |
| 894 | Ga0400483_083197 | 3300039062 | Bacteria | 151799 |
| 895 | Ga0400483_150080 | 3300039062 | Bacteria | 5570 |
| 896 | Ga0400483_183599 | 3300039062 | Bacteria | 15488 |
| 897 | Ga0400489_06941 | 3300039093 | Bacteria | 2661 |
| 898 | Ga0400489_08197 | 3300039093 | Bacteria | 46912 |
| 899 | Ga0400489_26368 | 3300039093 | Bacteria | 55478 |
| 900 | Ga0400489_81304 | 3300039093 | Bacteria | 24368 |
| 901 | Ga0400489_86140 | 3300039093 | Bacteria | 19309 |
| 902 | Ga0400487_39128 | 3300039110 | Bacteria | 5607 |
| 903 | Ga0400487_56517 | 3300039110 | Bacteria | 8843 |
| 904 | Ga0436365_0002039 | 3300039437 | Bacteria | 28011 |
| 905 | Ga0436365_0693504 | 3300039437 | Bacteria | 82758 |
| 906 | Ga0436365_0759336 | 3300039437 | Bacteria | 5067 |
| 907 | Ga0436365_1225940 | 3300039437 | Bacteria | 1832 |
| 908 | Ga0436365_1234367 | 3300039437 | Bacteria | 4913 |
| 909 | Ga0436365_1931097 | 3300039437 | Bacteria | 2764 |
| 910 | Ga0436360_0767836 | 3300039438 | Bacteria | 2268 |
| 911 | Ga0436361_0005333 | 3300039447 | Bacteria | 5721 |
| 912 | Ga0436361_0116753 | 3300039447 | Bacteria | 9399 |
| 913 | Ga0436361_0195448 | 3300039447 | Bacteria | 10538 |
| 914 | Ga0436361_0541048 | 3300039447 | Bacteria | 4551 |
| 915 | Ga0436361_0549727 | 3300039447 | Bacteria | 8587 |
| 916 | Ga0436361_0675194 | 3300039447 | Bacteria | 8355 |
| 917 | Ga0436361_0874800 | 3300039447 | Bacteria | 21108 |
| 918 | Ga0436361_0891718 | 3300039447 | Bacteria | 28099 |
| 919 | Ga0436361_0980588 | 3300039447 | Bacteria | 1963 |
| 920 | Ga0436361_1128479 | 3300039447 | Bacteria | 5291 |
| 921 | Ga0436363_0752901 | 3300039450 | Bacteria | 9676 |
| 922 | Ga0436363_0788307 | 3300039450 | Bacteria | 2292 |
| 923 | Ga0436363_0913001 | 3300039450 | Bacteria | 9127 |
| 924 | Ga0436362_1145055 | 3300039453 | Bacteria | 10133 |
| 925 | Ga0451835_0953162 | 3300041492 | Bacteria | 2638 |
| 926 | Ga0451839_0463122 | 3300041496 | Bacteria | 2405 |
| 927 | Ga0451851_0257830 | 3300041507 | Bacteria | 1951 |
| 928 | Ga0439464_0006129 | 3300042439 | Bacteria | 3126 |
| 929 | Ga0451577_0000074 | 3300042876 | Bacteria | 232698 |
| 930 | Ga0451577_0000149 | 3300042876 | Bacteria | 155208 |
| 931 | Ga0451577_0001910 | 3300042876 | Bacteria | 26415 |
| 932 | Ga0451577_0005601 | 3300042876 | Bacteria | 12775 |
| 933 | Ga0451577_0025268 | 3300042876 | Bacteria | 5391 |
| 934 | Ga0451577_0032984 | 3300042876 | Bacteria | 4667 |
| 935 | Ga0451577_0053242 | 3300042876 | Bacteria | 3613 |
| 936 | Ga0451577_0067235 | 3300042876 | Bacteria | 3196 |
| 937 | Ga0453683_0000002 | 3300044673 | Bacteria | 1244396 |
| 938 | Ga0453683_0003375 | 3300044673 | Bacteria | 11793 |
| 939 | Ga0453683_0004460 | 3300044673 | Bacteria | 9926 |
| 940 | Ga0453683_0043120 | 3300044673 | Bacteria | 2831 |
| 941 | Ga0466963_0003563 | 3300044694 | Bacteria | 8941 |
| 942 | Ga0466963_0049606 | 3300044694 | Bacteria | 2776 |
| 943 | Ga0453684_0000006 | 3300044712 | Bacteria | 1364191 |
| 944 | Ga0453684_0000031 | 3300044712 | Bacteria | 752632 |
| 945 | Ga0453684_0000229 | 3300044712 | Bacteria | 241494 |
| 946 | Ga0453684_0000443 | 3300044712 | Bacteria | 168617 |
| 947 | Ga0453684_0000482 | 3300044712 | Bacteria | 158296 |
| 948 | Ga0453684_0000494 | 3300044712 | Bacteria | 155208 |
| 949 | Ga0453684_0002726 | 3300044712 | Bacteria | 41828 |
| 950 | Ga0453684_0003278 | 3300044712 | Bacteria | 36944 |
| 951 | Ga0453684_0007614 | 3300044712 | Bacteria | 19838 |
| 952 | Ga0453684_0010417 | 3300044712 | Bacteria | 15906 |
| 953 | Ga0453684_0011287 | 3300044712 | Bacteria | 15027 |
| 954 | Ga0453684_0018479 | 3300044712 | Bacteria | 10698 |
| 955 | Ga0453684_0061452 | 3300044712 | Bacteria | 4822 |
| 956 | Ga0453684_0070131 | 3300044712 | Bacteria | 4440 |
| 957 | Ga0453684_0123398 | 3300044712 | Bacteria | 3123 |
| 958 | Ga0453684_0156179 | 3300044712 | Bacteria | 2705 |
| 959 | Ga0466957_0002997 | 3300044842 | Bacteria | 9170 |
| 960 | Ga0466957_0015363 | 3300044842 | Bacteria | 4472 |
| 961 | Ga0466959_0102862 | 3300045049 | Bacteria | 2044 |
| 962 | Ga0451576_0000056 | 3300045051 | Bacteria | 303398 |
| 963 | Ga0451576_0000451 | 3300045051 | Bacteria | 93335 |
| 964 | Ga0451576_0000758 | 3300045051 | Bacteria | 63828 |
| 965 | Ga0451576_0003761 | 3300045051 | Bacteria | 20470 |
| 966 | Ga0451576_0009975 | 3300045051 | Bacteria | 10953 |
| 967 | Ga0451576_0014645 | 3300045051 | Bacteria | 8716 |
| 968 | Ga0451576_0055178 | 3300045051 | Bacteria | 4158 |
| 969 | Ga0451576_0127433 | 3300045051 | Bacteria | 2652 |
| 970 | Ga0451576_0171240 | 3300045051 | Bacteria | 2266 |
| 971 | Ga0495592_0000031 | 3300046454 | Bacteria | 128596 |
| 972 | Ga0495592_0003656 | 3300046454 | Bacteria | 11076 |
| 973 | Ga0495592_0031651 | 3300046454 | Bacteria | 3996 |
| 974 | Ga0495603_0000184 | 3300046455 | Bacteria | 32294 |
| 975 | Ga0495603_0043538 | 3300046455 | Bacteria | 2680 |
| 976 | Ga0495629_0001240 | 3300046459 | Bacteria | 20042 |
| 977 | Ga0495629_0002351 | 3300046459 | Bacteria | 14571 |
| 978 | Ga0495629_0056213 | 3300046459 | Bacteria | 2752 |
| 979 | Ga0495638_0021954 | 3300046460 | Bacteria | 4195 |
| 980 | Ga0495641_0008505 | 3300046461 | Bacteria | 6243 |
| 981 | Ga0495641_0060633 | 3300046461 | Bacteria | 1709 |
| 982 | Ga0495651_0023405 | 3300046462 | Bacteria | 4802 |
| 983 | Ga0495653_0000012 | 3300046463 | Bacteria | 266880 |
| 984 | Ga0495653_0008313 | 3300046463 | Bacteria | 8506 |
| 985 | Ga0495580_0001738 | 3300046472 | Bacteria | 19146 |
| 986 | Ga0495580_0102890 | 3300046472 | Bacteria | 1986 |
| 987 | Ga0495582_0000653 | 3300046473 | Bacteria | 19089 |
| 988 | Ga0495582_0009413 | 3300046473 | Bacteria | 5381 |
| 989 | Ga0495582_0047589 | 3300046473 | Bacteria | 2362 |
| 990 | Ga0495639_0000606 | 3300046475 | Bacteria | 16737 |
| 991 | Ga0495662_0011927 | 3300046476 | Bacteria | 4247 |
| 992 | Ga0495662_0012795 | 3300046476 | Bacteria | 4091 |
| 993 | Ga0495664_0000004 | 3300046477 | Bacteria | 489411 |
| 994 | Ga0495664_0000684 | 3300046477 | Bacteria | 17259 |
| 995 | Ga0495584_0014107 | 3300046491 | Bacteria | 4072 |
| 996 | Ga0495585_0040228 | 3300046492 | Bacteria | 2625 |
| 997 | Ga0495594_0001580 | 3300046499 | Bacteria | 11836 |
| 998 | Ga0495607_0008161 | 3300046501 | Bacteria | 7178 |
| 999 | Ga0495608_0000005 | 3300046511 | Bacteria | 350726 |
| 1000 | Ga0495608_0004875 | 3300046511 | Bacteria | 9599 |
| 1001 | Ga0495618_0000024 | 3300046514 | Bacteria | 122536 |
| 1002 | Ga0495620_0024740 | 3300046515 | Bacteria | 2851 |
| 1003 | Ga0495628_0000001 | 3300046516 | Bacteria | 917742 |
| 1004 | Ga0495628_0016177 | 3300046516 | Bacteria | 6223 |
| 1005 | Ga0495628_0016847 | 3300046516 | Bacteria | 6089 |
| 1006 | Ga0495630_0024733 | 3300046517 | Bacteria | 4438 |
| 1007 | Ga0495630_0125639 | 3300046517 | Bacteria | 1947 |
| 1008 | Ga0495643_0002255 | 3300046522 | Bacteria | 15640 |
| 1009 | Ga0495643_0010012 | 3300046522 | Bacteria | 5851 |
| 1010 | Ga0495643_0046437 | 3300046522 | Bacteria | 2354 |
| 1011 | Ga0495666_0019878 | 3300046526 | Bacteria | 3331 |
| 1012 | Ga0495652_0000002 | 3300046529 | Bacteria | 946606 |
| 1013 | Ga0495652_0026104 | 3300046529 | Bacteria | 5162 |
| 1014 | Ga0495652_0041153 | 3300046529 | Bacteria | 3990 |
| 1015 | Ga0495652_0057886 | 3300046529 | Bacteria | 3285 |
| 1016 | Ga0495652_0129965 | 3300046529 | Bacteria | 1995 |
| 1017 | Ga0495665_0008623 | 3300046531 | Bacteria | 5533 |
| 1018 | Ga0495665_0023480 | 3300046531 | Bacteria | 3312 |
| 1019 | Ga0495640_0000001 | 3300046533 | Bacteria | 853827 |
| 1020 | Ga0495640_0014571 | 3300046533 | Bacteria | 5944 |
| 1021 | Ga0495640_0016992 | 3300046533 | Bacteria | 5431 |
| 1022 | Ga0495640_0030510 | 3300046533 | Bacteria | 3858 |
| 1023 | Ga0495587_0000016 | 3300046536 | Bacteria | 185585 |
| 1024 | Ga0495587_0011558 | 3300046536 | Bacteria | 5589 |
| 1025 | Ga0495587_0023771 | 3300046536 | Bacteria | 3764 |
| 1026 | Ga0495587_0041329 | 3300046536 | Bacteria | 2751 |
| 1027 | Ga0495587_0043740 | 3300046536 | Bacteria | 2666 |
| 1028 | Ga0495598_0004096 | 3300046537 | Bacteria | 3136 |
| 1029 | Ga0495597_0005488 | 3300046542 | Bacteria | 6708 |
| 1030 | Ga0495645_0000002 | 3300046543 | Bacteria | 651644 |
| 1031 | Ga0495645_0033385 | 3300046543 | Bacteria | 3755 |
| 1032 | Ga0495622_0002546 | 3300046557 | Bacteria | 8808 |
| 1033 | Ga0495633_0017429 | 3300046558 | Bacteria | 3673 |
| 1034 | Ga0495667_0000007 | 3300046559 | Bacteria | 234736 |
| 1035 | Ga0495667_0001645 | 3300046559 | Bacteria | 14801 |
| 1036 | Ga0495667_0012483 | 3300046559 | Bacteria | 5762 |
| 1037 | Ga0495667_0030459 | 3300046559 | Bacteria | 3625 |
| 1038 | Ga0495667_0042240 | 3300046559 | Bacteria | 3023 |
| 1039 | Ga0495656_0045556 | 3300046615 | Bacteria | 1852 |
| 1040 | Ga0495634_0000003 | 3300046642 | Bacteria | 206222 |
| 1041 | Ga0495634_0062544 | 3300046642 | Bacteria | 2471 |
| 1042 | Ga0495625_0002323 | 3300046660 | Bacteria | 20802 |
| 1043 | Ga0495635_0000002 | 3300046663 | Bacteria | 490490 |
| 1044 | Ga0495635_0009880 | 3300046663 | Bacteria | 6669 |
| 1045 | Ga0495635_0020980 | 3300046663 | Bacteria | 4554 |
| 1046 | Ga0495635_0021013 | 3300046663 | Bacteria | 4550 |
| 1047 | Ga0495635_0038986 | 3300046663 | Bacteria | 3289 |
| 1048 | Ga0495588_0007684 | 3300046674 | Bacteria | 4922 |
| 1049 | Ga0495588_0017333 | 3300046674 | Bacteria | 3495 |
| 1050 | Ga0495588_0021342 | 3300046674 | Bacteria | 3190 |
| 1051 | Ga0495657_0000628 | 3300046675 | Bacteria | 31950 |
| 1052 | Ga0495657_0013418 | 3300046675 | Bacteria | 6047 |
| 1053 | Ga0495657_0025060 | 3300046675 | Bacteria | 4239 |
| 1054 | Ga0495599_0000005 | 3300046678 | Bacteria | 300169 |
| 1055 | Ga0495623_0000016 | 3300046679 | Bacteria | 113454 |
| 1056 | Ga0495623_0000629 | 3300046679 | Bacteria | 23493 |
| 1057 | Ga0495646_0000002 | 3300046680 | Bacteria | 310568 |
| 1058 | Ga0495646_0019857 | 3300046680 | Bacteria | 4249 |
| 1059 | Ga0495647_0004360 | 3300046681 | Bacteria | 4593 |
| 1060 | Ga0495658_0001645 | 3300046683 | Bacteria | 11614 |
| 1061 | Ga0495658_0052956 | 3300046683 | Bacteria | 2303 |
| 1062 | Ga0495613_0000075 | 3300046689 | Bacteria | 97894 |
| 1063 | Ga0495613_0006129 | 3300046689 | Bacteria | 8999 |
| 1064 | Ga0495613_0006324 | 3300046689 | Bacteria | 8858 |
| 1065 | Ga0495613_0028933 | 3300046689 | Bacteria | 4121 |
| 1066 | Ga0495670_0002382 | 3300046691 | Bacteria | 9257 |
| 1067 | Ga0495670_0026699 | 3300046691 | Bacteria | 2859 |
| 1068 | Ga0495600_0000279 | 3300046809 | Bacteria | 27700 |
| 1069 | Ga0495600_0003100 | 3300046809 | Bacteria | 9723 |
| 1070 | Ga0495600_0003563 | 3300046809 | Bacteria | 9160 |
| 1071 | Ga0495600_0050679 | 3300046809 | Bacteria | 2709 |
| 1072 | Ga0495581_0012339 | 3300047315 | Bacteria | 4950 |
| 1073 | Ga0495604_0000020 | 3300047317 | Bacteria | 171989 |
| 1074 | Ga0495604_0013017 | 3300047317 | Bacteria | 6628 |
| 1075 | Ga0495604_0014690 | 3300047317 | Bacteria | 6241 |
| 1076 | Ga0495604_0014747 | 3300047317 | Bacteria | 6229 |
| 1077 | Ga0495604_0032203 | 3300047317 | Bacteria | 4157 |
| 1078 | Ga0495604_0041289 | 3300047317 | Bacteria | 3618 |
| 1079 | Ga0495674_0000002 | 3300047319 | Bacteria | 642785 |
| 1080 | Ga0495674_0027563 | 3300047319 | Bacteria | 5190 |
| 1081 | Ga0495676_0022882 | 3300047321 | Bacteria | 5431 |
| 1082 | Ga0495676_0043295 | 3300047321 | Bacteria | 3687 |
| 1083 | Ga0495680_0001158 | 3300047322 | Bacteria | 29075 |
| 1084 | Ga0495680_0004994 | 3300047322 | Bacteria | 12545 |
| 1085 | Ga0495680_0018635 | 3300047322 | Bacteria | 5883 |
| 1086 | Ga0495680_0045333 | 3300047322 | Bacteria | 3472 |
| 1087 | Ga0495687_002979 | 3300047443 | Bacteria | 12811 |
| 1088 | Ga0495675_0000421 | 3300047444 | Bacteria | 28694 |
| 1089 | Ga0495675_0019971 | 3300047444 | Bacteria | 4257 |
| 1090 | Ga0495675_0042692 | 3300047444 | Bacteria | 2888 |
| 1091 | Ga0495684_0000017 | 3300047471 | Bacteria | 160663 |
| 1092 | Ga0495684_0005969 | 3300047471 | Bacteria | 9462 |
| 1093 | Ga0495686_0031844 | 3300047472 | Bacteria | 3416 |
| 1094 | Ga0495593_0001934 | 3300047673 | Bacteria | 12353 |
| 1095 | Ga0495593_0002939 | 3300047673 | Bacteria | 10257 |
| 1096 | Ga0495593_0007003 | 3300047673 | Bacteria | 6609 |
| 1097 | Ga0495602_0000040 | 3300048088 | Bacteria | 127280 |
| 1098 | Ga0495602_0010632 | 3300048088 | Bacteria | 9549 |
| 1099 | Ga0495602_0021510 | 3300048088 | Bacteria | 6346 |
| 1100 | Ga0495602_0091484 | 3300048088 | Bacteria | 2523 |
| 1101 | Ga0495614_0001218 | 3300048089 | Bacteria | 11066 |
| 1102 | Ga0496100_0003494 | 3300048903 | Bacteria | 8202 |
| 1103 | Ga0496101_0000632 | 3300048904 | Bacteria | 21355 |
| 1104 | Ga0496101_0003925 | 3300048904 | Bacteria | 9293 |
| 1105 | Ga0496101_0004328 | 3300048904 | Bacteria | 8912 |
| 1106 | Ga0496101_0030518 | 3300048904 | Bacteria | 3780 |
| 1107 | Ga0496101_0057906 | 3300048904 | Bacteria | 2804 |
| 1108 | Ga0496102_0003407 | 3300048905 | Bacteria | 13479 |
| 1109 | Ga0496102_0004162 | 3300048905 | Bacteria | 12244 |
| 1110 | Ga0496102_0006945 | 3300048905 | Bacteria | 9657 |
| 1111 | Ga0496102_0013514 | 3300048905 | Bacteria | 7074 |
| 1112 | Ga0496102_0021970 | 3300048905 | Bacteria | 5651 |
| 1113 | Ga0496102_0043051 | 3300048905 | Bacteria | 4093 |
| 1114 | Ga0496103_0000817 | 3300048906 | Bacteria | 22840 |
| 1115 | Ga0496103_0022568 | 3300048906 | Bacteria | 3790 |
| 1116 | Ga0496103_0053903 | 3300048906 | Bacteria | 2493 |
| 1117 | Ga0496104_0000055 | 3300048907 | Bacteria | 124267 |
| 1118 | Ga0496104_0000819 | 3300048907 | Bacteria | 26767 |
| 1119 | Ga0496104_0003719 | 3300048907 | Bacteria | 13171 |
| 1120 | Ga0496104_0009707 | 3300048907 | Bacteria | 8578 |
| 1121 | Ga0496104_0035201 | 3300048907 | Bacteria | 4675 |
| 1122 | Ga0496104_0039755 | 3300048907 | Bacteria | 4404 |
| 1123 | Ga0496104_0040773 | 3300048907 | Bacteria | 4352 |
| 1124 | Ga0496104_0047304 | 3300048907 | Bacteria | 4054 |
| 1125 | Ga0496104_0070290 | 3300048907 | Bacteria | 3328 |
| 1126 | Ga0496104_0108994 | 3300048907 | Bacteria | 2654 |
| 1127 | Ga0496105_0001352 | 3300048908 | Bacteria | 17218 |
| 1128 | Ga0496105_0001979 | 3300048908 | Bacteria | 14748 |
| 1129 | Ga0496105_0003022 | 3300048908 | Bacteria | 12358 |
| 1130 | Ga0496105_0003563 | 3300048908 | Bacteria | 11548 |
| 1131 | Ga0496105_0023369 | 3300048908 | Bacteria | 5012 |
| 1132 | Ga0496105_0036626 | 3300048908 | Bacteria | 4042 |
| 1133 | Ga0496105_0049968 | 3300048908 | Bacteria | 3454 |
| 1134 | Ga0496105_0074109 | 3300048908 | Bacteria | 2812 |
| 1135 | Ga0496106_0000038 | 3300048909 | Bacteria | 111983 |
| 1136 | Ga0496106_0000317 | 3300048909 | Bacteria | 33879 |
| 1137 | Ga0496106_0002333 | 3300048909 | Bacteria | 14152 |
| 1138 | Ga0496106_0004679 | 3300048909 | Bacteria | 10145 |
| 1139 | Ga0496106_0007191 | 3300048909 | Bacteria | 8222 |
| 1140 | Ga0496106_0010888 | 3300048909 | Bacteria | 6719 |
| 1141 | Ga0496106_0019230 | 3300048909 | Bacteria | 5065 |
| 1142 | Ga0496106_0043769 | 3300048909 | Bacteria | 3360 |
| 1143 | Ga0496106_0047722 | 3300048909 | Bacteria | 3223 |
| 1144 | Ga0496106_0100181 | 3300048909 | Bacteria | 2246 |
| 1145 | Ga0496107_0001599 | 3300048910 | Bacteria | 14100 |
| 1146 | Ga0496107_0006515 | 3300048910 | Bacteria | 8030 |
| 1147 | Ga0496107_0008440 | 3300048910 | Bacteria | 7129 |
| 1148 | Ga0496107_0013735 | 3300048910 | Bacteria | 5663 |
| 1149 | Ga0496107_0018740 | 3300048910 | Bacteria | 4877 |
| 1150 | Ga0496107_0032930 | 3300048910 | Bacteria | 3706 |
| 1151 | Ga0496108_0000333 | 3300048911 | Bacteria | 39976 |
| 1152 | Ga0496108_0000774 | 3300048911 | Bacteria | 24964 |
| 1153 | Ga0496108_0005307 | 3300048911 | Bacteria | 10404 |
| 1154 | Ga0496108_0009655 | 3300048911 | Bacteria | 7820 |
| 1155 | Ga0496108_0029948 | 3300048911 | Bacteria | 4511 |
| 1156 | Ga0496108_0038067 | 3300048911 | Bacteria | 4007 |
| 1157 | Ga0496108_0078303 | 3300048911 | Bacteria | 2797 |
| 1158 | Ga0496108_0084837 | 3300048911 | Bacteria | 2688 |
| 1159 | Ga0496108_0182672 | 3300048911 | Bacteria | 1817 |
| 1160 | Ga0496109_0000725 | 3300048912 | Bacteria | 27459 |
| 1161 | Ga0496109_0001051 | 3300048912 | Bacteria | 22839 |
| 1162 | Ga0496109_0001271 | 3300048912 | Bacteria | 20918 |
| 1163 | Ga0496109_0001849 | 3300048912 | Bacteria | 17531 |
| 1164 | Ga0496109_0061984 | 3300048912 | Bacteria | 3420 |
| 1165 | Ga0496109_0068880 | 3300048912 | Bacteria | 3243 |
| 1166 | Ga0496109_0068939 | 3300048912 | Bacteria | 3242 |
| 1167 | Ga0496109_0082300 | 3300048912 | Bacteria | 2966 |
| 1168 | Ga0496109_0103333 | 3300048912 | Bacteria | 2645 |
| 1169 | Ga0496109_0193492 | 3300048912 | Bacteria | 1911 |
| 1170 | Ga0496110_0000247 | 3300048913 | Bacteria | 35042 |
| 1171 | Ga0496110_0009317 | 3300048913 | Bacteria | 7942 |
| 1172 | Ga0496110_0043599 | 3300048913 | Bacteria | 3917 |
| 1173 | Ga0496110_0044345 | 3300048913 | Bacteria | 3884 |
| 1174 | Ga0496110_0057214 | 3300048913 | Bacteria | 3432 |
| 1175 | Ga0496110_0078306 | 3300048913 | Bacteria | 2943 |
| 1176 | Ga0496110_0193133 | 3300048913 | Bacteria | 1848 |
| 1177 | Ga0496111_0005481 | 3300048914 | Bacteria | 8139 |
| 1178 | Ga0496111_0131205 | 3300048914 | Bacteria | 1854 |
| 1179 | Ga0496112_0000650 | 3300048915 | Bacteria | 24136 |
| 1180 | Ga0496112_0007620 | 3300048915 | Bacteria | 9622 |
| 1181 | Ga0496112_0013272 | 3300048915 | Bacteria | 7605 |
| 1182 | Ga0496112_0015252 | 3300048915 | Bacteria | 7164 |
| 1183 | Ga0496112_0025299 | 3300048915 | Bacteria | 5699 |
| 1184 | Ga0496112_0030959 | 3300048915 | Bacteria | 5184 |
| 1185 | Ga0496112_0034454 | 3300048915 | Bacteria | 4927 |
| 1186 | Ga0496112_0056605 | 3300048915 | Bacteria | 3859 |
| 1187 | Ga0496112_0063718 | 3300048915 | Bacteria | 3637 |
| 1188 | Ga0496112_0070475 | 3300048915 | Bacteria | 3455 |
| 1189 | Ga0496112_0099202 | 3300048915 | Bacteria | 2882 |
| 1190 | Ga0496113_0000194 | 3300048916 | Bacteria | 27842 |
| 1191 | Ga0496113_0002472 | 3300048916 | Bacteria | 10762 |
| 1192 | Ga0496113_0017691 | 3300048916 | Bacteria | 4954 |
| 1193 | Ga0496113_0018724 | 3300048916 | Bacteria | 4827 |
| 1194 | Ga0496113_0020287 | 3300048916 | Bacteria | 4670 |
| 1195 | Ga0496113_0101077 | 3300048916 | Bacteria | 2235 |
| 1196 | Ga0496113_0193072 | 3300048916 | Bacteria | 1616 |
| 1197 | Ga0496114_0000528 | 3300048917 | Bacteria | 28153 |
| 1198 | Ga0496114_0007580 | 3300048917 | Bacteria | 8581 |
| 1199 | Ga0496114_0013565 | 3300048917 | Bacteria | 6537 |
| 1200 | Ga0496114_0014530 | 3300048917 | Bacteria | 6324 |
| 1201 | Ga0496114_0015647 | 3300048917 | Bacteria | 6102 |
| 1202 | Ga0496114_0017054 | 3300048917 | Bacteria | 5857 |
| 1203 | Ga0496114_0040713 | 3300048917 | Bacteria | 3848 |
| 1204 | Ga0496115_0000805 | 3300048918 | Bacteria | 22991 |
| 1205 | Ga0496115_0001826 | 3300048918 | Bacteria | 15237 |
| 1206 | Ga0496115_0018100 | 3300048918 | Bacteria | 5400 |
| 1207 | Ga0496115_0030454 | 3300048918 | Bacteria | 4245 |
| 1208 | Ga0496115_0034067 | 3300048918 | Bacteria | 4024 |
| 1209 | Ga0496115_0041163 | 3300048918 | Bacteria | 3675 |
| 1210 | Ga0496115_0048552 | 3300048918 | Bacteria | 3395 |
| 1211 | Ga0496115_0054688 | 3300048918 | Bacteria | 3206 |
| 1212 | Ga0496115_0069377 | 3300048918 | Bacteria | 2855 |
| 1213 | Ga0496116_0033274 | 3300048919 | Bacteria | 3660 |
| 1214 | Ga0496117_0040538 | 3300048920 | Bacteria | 3422 |
| 1215 | Ga0496118_0015279 | 3300048921 | Bacteria | 7119 |
| 1216 | Ga0496118_0047822 | 3300048921 | Bacteria | 3311 |
| 1217 | Ga0496119_0018666 | 3300048922 | Bacteria | 5148 |
| 1218 | Ga0496119_0020298 | 3300048922 | Bacteria | 4852 |
| 1219 | Ga0496120_0015388 | 3300048923 | Bacteria | 5048 |
| 1220 | Ga0496120_0017816 | 3300048923 | Bacteria | 4591 |
| 1221 | Ga0496121_0055198 | 3300048924 | Bacteria | 3311 |
| 1222 | Ga0496121_0065839 | 3300048924 | Bacteria | 2946 |
| 1223 | Ga0496122_0007420 | 3300048925 | Bacteria | 12190 |
| 1224 | Ga0496123_0024542 | 3300048926 | Bacteria | 4579 |
| 1225 | Ga0496124_0045487 | 3300048927 | Bacteria | 3762 |
| 1226 | Ga0496125_0028124 | 3300048928 | Bacteria | 5083 |
| 1227 | Ga0496125_0059330 | 3300048928 | Bacteria | 3084 |
| 1228 | Ga0496126_0049594 | 3300048929 | Bacteria | 3832 |
| 1229 | Ga0496126_0067816 | 3300048929 | Bacteria | 3186 |
| 1230 | Ga0501031_0004595 | 3300049568 | Bacteria | 8952 |
| 1231 | Ga0501031_0019545 | 3300049568 | Bacteria | 4413 |
| 1232 | Ga0501031_0025220 | 3300049568 | Bacteria | 3878 |
| 1233 | Ga0501032_0000057 | 3300049569 | Bacteria | 98201 |
| 1234 | Ga0501032_0013303 | 3300049569 | Bacteria | 5858 |
| 1235 | Ga0501032_0020752 | 3300049569 | Bacteria | 4573 |
| 1236 | Ga0501032_0031108 | 3300049569 | Bacteria | 3660 |
| 1237 | Ga0501033_0010978 | 3300049570 | Bacteria | 6941 |
| 1238 | Ga0501033_0022046 | 3300049570 | Bacteria | 4805 |
| 1239 | Ga0501033_0046006 | 3300049570 | Bacteria | 3245 |
| 1240 | Ga0501033_0081737 | 3300049570 | Bacteria | 2369 |
| 1241 | Ga0501034_0000001 | 3300049571 | Bacteria | 2184493 |
| 1242 | Ga0501034_0000197 | 3300049571 | Bacteria | 114088 |
| 1243 | Ga0501034_0012498 | 3300049571 | Bacteria | 8765 |
| 1244 | Ga0501034_0013138 | 3300049571 | Bacteria | 8533 |
| 1245 | Ga0501034_0022589 | 3300049571 | Bacteria | 6409 |
| 1246 | Ga0501034_0039334 | 3300049571 | Bacteria | 4790 |
| 1247 | Ga0501034_0057397 | 3300049571 | Bacteria | 3914 |
| 1248 | Ga0501034_0072482 | 3300049571 | Bacteria | 3453 |
| 1249 | Ga0501036_0001853 | 3300049572 | Bacteria | 16386 |
| 1250 | Ga0501036_0003456 | 3300049572 | Bacteria | 12623 |
| 1251 | Ga0501036_0004036 | 3300049572 | Bacteria | 11799 |
| 1252 | Ga0501036_0006334 | 3300049572 | Bacteria | 9605 |
| 1253 | Ga0501036_0011132 | 3300049572 | Bacteria | 7441 |
| 1254 | Ga0501036_0017310 | 3300049572 | Bacteria | 6023 |
| 1255 | Ga0501036_0017721 | 3300049572 | Bacteria | 5962 |
| 1256 | Ga0501037_0002950 | 3300049573 | Bacteria | 12335 |
| 1257 | Ga0501037_0006072 | 3300049573 | Bacteria | 8823 |
| 1258 | Ga0501037_0010639 | 3300049573 | Bacteria | 6761 |
| 1259 | Ga0501037_0026383 | 3300049573 | Bacteria | 4294 |
| 1260 | Ga0501038_0001372 | 3300049574 | Bacteria | 22243 |
| 1261 | Ga0501038_0001640 | 3300049574 | Bacteria | 20818 |
| 1262 | Ga0501038_0015750 | 3300049574 | Bacteria | 6871 |
| 1263 | Ga0501038_0016511 | 3300049574 | Bacteria | 6691 |
| 1264 | Ga0501038_0032537 | 3300049574 | Bacteria | 4600 |
| 1265 | Ga0501038_0049711 | 3300049574 | Bacteria | 3625 |
| 1266 | Ga0501038_0077642 | 3300049574 | Bacteria | 2803 |
| 1267 | Ga0501038_0078050 | 3300049574 | Bacteria | 2795 |
| 1268 | Ga0501038_0109001 | 3300049574 | Bacteria | 2295 |
| 1269 | Ga0501039_0000001 | 3300049575 | Bacteria | 449008 |
| 1270 | Ga0501039_0000723 | 3300049575 | Bacteria | 23831 |
| 1271 | Ga0501039_0030818 | 3300049575 | Bacteria | 4136 |
| 1272 | Ga0501039_0114518 | 3300049575 | Bacteria | 2110 |
| 1273 | Ga0501040_0000492 | 3300049576 | Bacteria | 23581 |
| 1274 | Ga0501040_0003036 | 3300049576 | Bacteria | 10886 |
| 1275 | Ga0501040_0012450 | 3300049576 | Bacteria | 5575 |
| 1276 | Ga0501040_0110176 | 3300049576 | Bacteria | 1925 |
| 1277 | Ga0501041_0000249 | 3300049577 | Bacteria | 25299 |
| 1278 | Ga0501041_0025000 | 3300049577 | Bacteria | 3588 |
| 1279 | Ga0501041_0035034 | 3300049577 | Bacteria | 3041 |
| 1280 | Ga0501042_0023400 | 3300049578 | Bacteria | 4323 |
| 1281 | Ga0501042_0094475 | 3300049578 | Bacteria | 2147 |
| 1282 | Ga0501043_0003859 | 3300049579 | Bacteria | 12318 |
| 1283 | Ga0501043_0012502 | 3300049579 | Bacteria | 6641 |
| 1284 | Ga0501043_0022003 | 3300049579 | Bacteria | 5001 |
| 1285 | Ga0501043_0036364 | 3300049579 | Bacteria | 3873 |
| 1286 | Ga0501043_0069057 | 3300049579 | Bacteria | 2775 |
| 1287 | Ga0501043_0114973 | 3300049579 | Bacteria | 2112 |
| 1288 | Ga0501046_0001144 | 3300049580 | Bacteria | 25813 |
| 1289 | Ga0501046_0002082 | 3300049580 | Bacteria | 18977 |
| 1290 | Ga0501046_0006820 | 3300049580 | Bacteria | 10076 |
| 1291 | Ga0501046_0009657 | 3300049580 | Bacteria | 8320 |
| 1292 | Ga0501046_0012841 | 3300049580 | Bacteria | 7123 |
| 1293 | Ga0501046_0020221 | 3300049580 | Bacteria | 5510 |
| 1294 | Ga0501046_0067232 | 3300049580 | Bacteria | 2791 |
| 1295 | Ga0501047_0000186 | 3300049581 | Bacteria | 75102 |
| 1296 | Ga0501047_0004626 | 3300049581 | Bacteria | 12950 |
| 1297 | Ga0501047_0007571 | 3300049581 | Bacteria | 10220 |
| 1298 | Ga0501047_0008844 | 3300049581 | Bacteria | 9499 |
| 1299 | Ga0501047_0016780 | 3300049581 | Bacteria | 6997 |
| 1300 | Ga0501047_0065850 | 3300049581 | Bacteria | 3492 |
| 1301 | Ga0501048_0000754 | 3300049582 | Bacteria | 23695 |
| 1302 | Ga0501048_0001614 | 3300049582 | Bacteria | 17156 |
| 1303 | Ga0501048_0005050 | 3300049582 | Bacteria | 10060 |
| 1304 | Ga0501048_0010444 | 3300049582 | Bacteria | 6933 |
| 1305 | Ga0501048_0018769 | 3300049582 | Bacteria | 5083 |
| 1306 | Ga0501048_0064395 | 3300049582 | Bacteria | 2593 |
| 1307 | Ga0501067_0001373 | 3300049583 | Bacteria | 13182 |
| 1308 | Ga0501067_0001787 | 3300049583 | Bacteria | 11809 |
| 1309 | Ga0501067_0006481 | 3300049583 | Bacteria | 6488 |
| 1310 | Ga0501067_0016632 | 3300049583 | Bacteria | 4064 |
| 1311 | Ga0501067_0044779 | 3300049583 | Bacteria | 2458 |
| 1312 | Ga0501068_0002740 | 3300049584 | Bacteria | 9367 |
| 1313 | Ga0501068_0005934 | 3300049584 | Bacteria | 6706 |
| 1314 | Ga0501068_0010969 | 3300049584 | Bacteria | 5101 |
| 1315 | Ga0501068_0021180 | 3300049584 | Bacteria | 3795 |
| 1316 | Ga0501068_0027014 | 3300049584 | Bacteria | 3386 |
| 1317 | Ga0501068_0037228 | 3300049584 | Bacteria | 2913 |
| 1318 | Ga0501068_0055980 | 3300049584 | Bacteria | 2390 |
| 1319 | Ga0501069_0000649 | 3300049585 | Bacteria | 16136 |
| 1320 | Ga0501069_0071844 | 3300049585 | Bacteria | 1940 |
| 1321 | Ga0501070_0001518 | 3300049586 | Bacteria | 20665 |
| 1322 | Ga0501070_0005823 | 3300049586 | Bacteria | 10517 |
| 1323 | Ga0501070_0006155 | 3300049586 | Bacteria | 10231 |
| 1324 | Ga0501070_0022748 | 3300049586 | Bacteria | 5247 |
| 1325 | Ga0501070_0052449 | 3300049586 | Bacteria | 3385 |
| 1326 | Ga0501070_0064414 | 3300049586 | Bacteria | 3035 |
| 1327 | Ga0501070_0144593 | 3300049586 | Bacteria | 1963 |
| 1328 | Ga0501071_0000026 | 3300049587 | Bacteria | 48260 |
| 1329 | Ga0501071_0004990 | 3300049587 | Bacteria | 8483 |
| 1330 | Ga0501071_0008878 | 3300049587 | Bacteria | 6665 |
| 1331 | Ga0501071_0015552 | 3300049587 | Bacteria | 5225 |
| 1332 | Ga0501071_0025349 | 3300049587 | Bacteria | 4153 |
| 1333 | Ga0501071_0045239 | 3300049587 | Bacteria | 3160 |
| 1334 | Ga0501071_0067374 | 3300049587 | Bacteria | 2603 |
| 1335 | Ga0501071_0078474 | 3300049587 | Bacteria | 2413 |
| 1336 | Ga0501072_0000376 | 3300049588 | Bacteria | 31894 |
| 1337 | Ga0501072_0001954 | 3300049588 | Bacteria | 15357 |
| 1338 | Ga0501072_0003598 | 3300049588 | Bacteria | 11662 |
| 1339 | Ga0501072_0009338 | 3300049588 | Bacteria | 7454 |
| 1340 | Ga0501072_0011310 | 3300049588 | Bacteria | 6817 |
| 1341 | Ga0501072_0025207 | 3300049588 | Bacteria | 4631 |
| 1342 | Ga0501072_0030796 | 3300049588 | Bacteria | 4198 |
| 1343 | Ga0501073_0004401 | 3300049589 | Bacteria | 10586 |
| 1344 | Ga0501073_0026398 | 3300049589 | Bacteria | 4162 |
| 1345 | Ga0501073_0034265 | 3300049589 | Bacteria | 3614 |
| 1346 | Ga0501073_0056814 | 3300049589 | Bacteria | 2737 |
| 1347 | Ga0501074_0003816 | 3300049590 | Bacteria | 10720 |
| 1348 | Ga0501074_0008911 | 3300049590 | Bacteria | 7274 |
| 1349 | Ga0501074_0055765 | 3300049590 | Bacteria | 2847 |
| 1350 | Ga0501075_0000066 | 3300049591 | Bacteria | 45649 |
| 1351 | Ga0501075_0000177 | 3300049591 | Bacteria | 33160 |
| 1352 | Ga0501075_0001334 | 3300049591 | Bacteria | 16016 |
| 1353 | Ga0501075_0025663 | 3300049591 | Bacteria | 4329 |
| 1354 | Ga0501075_0049337 | 3300049591 | Bacteria | 3164 |
| 1355 | Ga0501075_0054088 | 3300049591 | Bacteria | 3019 |
| 1356 | Ga0501075_0073208 | 3300049591 | Bacteria | 2591 |
| 1357 | Ga0501075_0104219 | 3300049591 | Bacteria | 2155 |
| 1358 | Ga0501076_0000014 | 3300049592 | Bacteria | 97509 |
| 1359 | Ga0501076_0000017 | 3300049592 | Bacteria | 94144 |
| 1360 | Ga0501076_0025777 | 3300049592 | Bacteria | 4552 |
| 1361 | Ga0501076_0032698 | 3300049592 | Bacteria | 4061 |
| 1362 | Ga0501076_0036056 | 3300049592 | Bacteria | 3873 |
| 1363 | Ga0501076_0062665 | 3300049592 | Bacteria | 2962 |
| 1364 | Ga0501076_0085346 | 3300049592 | Bacteria | 2537 |
| 1365 | Ga0501077_0000762 | 3300049593 | Bacteria | 19449 |
| 1366 | Ga0501077_0041998 | 3300049593 | Bacteria | 2910 |
| 1367 | Ga0501079_0000198 | 3300049741 | Bacteria | 34763 |
| 1368 | Ga0501079_0002291 | 3300049741 | Bacteria | 13838 |
| 1369 | Ga0501079_0010985 | 3300049741 | Bacteria | 6899 |
| 1370 | Ga0501079_0023591 | 3300049741 | Bacteria | 4722 |
| 1371 | Ga0501079_0025843 | 3300049741 | Bacteria | 4504 |
| 1372 | Ga0501079_0037996 | 3300049741 | Bacteria | 3713 |
| 1373 | Ga0501079_0070833 | 3300049741 | Bacteria | 2693 |
| 1374 | Ga0501079_0137125 | 3300049741 | Bacteria | 1905 |
| 1375 | Ga0501080_0000299 | 3300049742 | Bacteria | 37707 |
| 1376 | Ga0501080_0003003 | 3300049742 | Bacteria | 14872 |
| 1377 | Ga0501080_0006266 | 3300049742 | Bacteria | 10675 |
| 1378 | Ga0501080_0016524 | 3300049742 | Bacteria | 6818 |
| 1379 | Ga0501080_0043429 | 3300049742 | Bacteria | 4186 |
| 1380 | Ga0501080_0054757 | 3300049742 | Bacteria | 3715 |
| 1381 | Ga0501080_0057543 | 3300049742 | Bacteria | 3619 |
| 1382 | Ga0501080_0066335 | 3300049742 | Bacteria | 3357 |
| 1383 | Ga0501080_0095297 | 3300049742 | Bacteria | 2763 |
| 1384 | Ga0501080_0100237 | 3300049742 | Bacteria | 2687 |
| 1385 | Ga0501080_0120368 | 3300049742 | Bacteria | 2433 |
| 1386 | Ga0501080_0186332 | 3300049742 | Bacteria | 1908 |
| 1387 | Ga0501081_0000011 | 3300049743 | Bacteria | 67455 |
| 1388 | Ga0501081_0006493 | 3300049743 | Bacteria | 7595 |
| 1389 | Ga0501081_0025161 | 3300049743 | Bacteria | 4002 |
| 1390 | Ga0501081_0042781 | 3300049743 | Bacteria | 3105 |
| 1391 | Ga0501083_0000302 | 3300049744 | Bacteria | 31114 |
| 1392 | Ga0501083_0001803 | 3300049744 | Bacteria | 14658 |
| 1393 | Ga0501083_0003405 | 3300049744 | Bacteria | 11127 |
| 1394 | Ga0501083_0022725 | 3300049744 | Bacteria | 4352 |
| 1395 | Ga0501083_0037571 | 3300049744 | Bacteria | 3297 |
| 1396 | Ga0501083_0045144 | 3300049744 | Bacteria | 2981 |
| 1397 | Ga0501035_0004131 | 3300049822 | Bacteria | 13799 |
| 1398 | Ga0501035_0005245 | 3300049822 | Bacteria | 12268 |
| 1399 | Ga0501035_0007363 | 3300049822 | Bacteria | 10284 |
| 1400 | Ga0501035_0045974 | 3300049822 | Bacteria | 3927 |
| 1401 | Ga0501035_0050619 | 3300049822 | Bacteria | 3722 |
| 1402 | Ga0501035_0133010 | 3300049822 | Bacteria | 2167 |
| 1403 | Ga0501044_0000351 | 3300049823 | Bacteria | 57748 |
| 1404 | Ga0501044_0000911 | 3300049823 | Bacteria | 35591 |
| 1405 | Ga0501044_0021553 | 3300049823 | Bacteria | 6871 |
| 1406 | Ga0501044_0025277 | 3300049823 | Bacteria | 6294 |
| 1407 | Ga0501044_0034803 | 3300049823 | Bacteria | 5280 |
| 1408 | Ga0501044_0115408 | 3300049823 | Bacteria | 2691 |
| 1409 | Ga0501045_0000024 | 3300049824 | Bacteria | 63402 |
| 1410 | Ga0501045_0004661 | 3300049824 | Bacteria | 9469 |
| 1411 | Ga0501045_0007737 | 3300049824 | Bacteria | 7473 |
| 1412 | Ga0501045_0011432 | 3300049824 | Bacteria | 6236 |
| 1413 | Ga0501045_0013216 | 3300049824 | Bacteria | 5824 |
| 1414 | nmdc:mga03683_30751_c1 | 3300050489 | Bacteria | 2150 |
| 1415 | nmdc:mga00v17_48769_c1 | 3300050491 | Bacteria | 2567 |
| 1416 | nmdc:mga00v17_8594_c1 | 3300050491 | Bacteria | 5498 |
| 1417 | nmdc:mga0yw44_17931_c1 | 3300050492 | Bacteria | 3865 |
| 1418 | nmdc:mga0yw44_2917_c1 | 3300050492 | Bacteria | 7441 |
| 1419 | nmdc:mga0yw44_59210_c1 | 3300050492 | Bacteria | 2343 |
| 1420 | nmdc:mga06z11_2386_c1 | 3300050494 | Bacteria | 7158 |
| 1421 | nmdc:mga06z11_5389_c1 | 3300050494 | Bacteria | 5127 |
| 1422 | nmdc:mga07m45_24460_c1 | 3300050496 | Bacteria | 3308 |
| 1423 | nmdc:mga05p37_109485_c1 | 3300050507 | Bacteria | 3398 |
| 1424 | nmdc:mga05p37_117960_c1 | 3300050507 | Bacteria | 3261 |
| 1425 | nmdc:mga05p37_1804_c1 | 3300050507 | Bacteria | 24969 |
| 1426 | nmdc:mga05p37_42716_c1 | 3300050507 | Bacteria | 5572 |
| 1427 | nmdc:mga05p37_4816_c1 | 3300050507 | Bacteria | 15790 |
| 1428 | nmdc:mga05p37_504_c1 | 3300050507 | Bacteria | 43013 |
| 1429 | nmdc:mga05p37_57442_c1 | 3300050507 | Bacteria | 4793 |
| 1430 | nmdc:mga05p37_58470_c1 | 3300050507 | Bacteria | 4748 |
| 1431 | nmdc:mga05p37_9789_c1 | 3300050507 | Bacteria | 11374 |
| 1432 | nmdc:mga09592_1129_c1 | 3300050508 | Bacteria | 21234 |
| 1433 | nmdc:mga09592_4406_c1 | 3300050508 | Bacteria | 11391 |
| 1434 | nmdc:mga09592_69026_c1 | 3300050508 | Bacteria | 2999 |
| 1435 | nmdc:mga09592_97511_c1 | 3300050508 | Bacteria | 2516 |
| 1436 | nmdc:mga0qj67_1353_c1 | 3300050509 | Bacteria | 17245 |
| 1437 | nmdc:mga0qj67_19786_c1 | 3300050509 | Bacteria | 5148 |
| 1438 | nmdc:mga0qj67_34384_c1 | 3300050509 | Bacteria | 3959 |
| 1439 | nmdc:mga06r32_4483_c1 | 3300050510 | Bacteria | 12500 |
| 1440 | nmdc:mga06r32_4623_c1 | 3300050510 | Bacteria | 12343 |
| 1441 | nmdc:mga06r32_64_c1 | 3300050510 | Bacteria | 67984 |
| 1442 | nmdc:mga06r32_79498_c1 | 3300050510 | Bacteria | 3190 |
| 1443 | nmdc:mga06r32_81008_c1 | 3300050510 | Bacteria | 3161 |
| 1444 | nmdc:mga08y16_110767_c1 | 3300050511 | Bacteria | 2859 |
| 1445 | nmdc:mga08y16_110927_c1 | 3300050511 | Bacteria | 2856 |
| 1446 | nmdc:mga08y16_131869_c1 | 3300050511 | Bacteria | 2598 |
| 1447 | nmdc:mga08y16_242035_c1 | 3300050511 | Bacteria | 1865 |
| 1448 | nmdc:mga08y16_2535_c1 | 3300050511 | Bacteria | 18788 |
| 1449 | nmdc:mga08y16_3182_c1 | 3300050511 | Bacteria | 16989 |
| 1450 | nmdc:mga08y16_329_c1 | 3300050511 | Bacteria | 42868 |
| 1451 | nmdc:mga08y16_74672_c1 | 3300050511 | Bacteria | 3533 |
| 1452 | nmdc:mga08y16_978_c1 | 3300050511 | Bacteria | 27841 |
| 1453 | nmdc:mga0n895_109653_c1 | 3300050512 | Bacteria | 2775 |
| 1454 | nmdc:mga0n895_156100_c1 | 3300050512 | Bacteria | 2313 |
| 1455 | nmdc:mga0n895_18884_c1 | 3300050512 | Bacteria | 6393 |
| 1456 | nmdc:mga0n895_1891_c1 | 3300050512 | Bacteria | 16022 |
| 1457 | nmdc:mga0n895_25009_c1 | 3300050512 | Bacteria | 5636 |
| 1458 | nmdc:mga0n895_296637_c1 | 3300050512 | Bacteria | 1639 |
| 1459 | nmdc:mga0n895_5225_c1 | 3300050512 | Bacteria | 10816 |
| 1460 | nmdc:mga0n895_8473_c1 | 3300050512 | Bacteria | 8903 |
| 1461 | nmdc:mga0rr50_10792_c1 | 3300050513 | Bacteria | 3750 |
| 1462 | nmdc:mga0rr50_30294_c1 | 3300050513 | Bacteria | 3829 |
| 1463 | nmdc:mga08x19_66_c1 | 3300050514 | Bacteria | 105609 |
| 1464 | nmdc:mga08x19_71624_c1 | 3300050514 | Bacteria | 2260 |
| 1465 | nmdc:mga0a205_205275_c1 | 3300050515 | Bacteria | 1860 |
| 1466 | nmdc:mga0a205_720_c1 | 3300050515 | Bacteria | 26644 |
| 1467 | nmdc:mga0a205_8828_c1 | 3300050515 | Bacteria | 9180 |
| 1468 | Ga0495601_0000018 | 3300053077 | Bacteria | 171665 |
| 1469 | Ga0495601_0000352 | 3300053077 | Bacteria | 24145 |
| 1470 | Ga0495601_0000411 | 3300053077 | Bacteria | 22462 |
| 1471 | Ga0495601_0000699 | 3300053077 | Bacteria | 18013 |
| 1472 | Ga0495601_0051389 | 3300053077 | Bacteria | 2601 |
| 1473 | Ga0495612_0000011 | 3300053078 | Bacteria | 224729 |
| 1474 | Ga0495612_0002427 | 3300053078 | Bacteria | 7680 |
| 1475 | Ga0495612_0004316 | 3300053078 | Bacteria | 5900 |
| 1476 | Ga0495595_0000016 | 3300053084 | Bacteria | 134329 |
| 1477 | Ga0495595_0006803 | 3300053084 | Bacteria | 4667 |
| 1478 | Ga0495595_0008161 | 3300053084 | Bacteria | 4295 |
| 1479 | Ga0495619_0000014 | 3300053085 | Bacteria | 261449 |
| 1480 | Ga0495619_0000085 | 3300053085 | Bacteria | 70073 |
| 1481 | Ga0495619_0000442 | 3300053085 | Bacteria | 27859 |
| 1482 | Ga0495619_0000536 | 3300053085 | Bacteria | 25079 |
| 1483 | Ga0495619_0001217 | 3300053085 | Bacteria | 16863 |
| 1484 | Ga0495619_0036059 | 3300053085 | Bacteria | 3219 |
| 1485 | Ga0495619_0061498 | 3300053085 | Bacteria | 2499 |
| 1486 | Ga0500643_001371 | 3300053087 | Bacteria | 14125 |
| 1487 | Ga0500644_0003061 | 3300053088 | Bacteria | 4145 |
| 1488 | Ga0500651_0007290 | 3300053093 | Bacteria | 6451 |
| 1489 | Ga0500651_0023699 | 3300053093 | Bacteria | 3844 |
| 1490 | Ga0500566_0031609 | 3300053094 | Bacteria | 3086 |
| 1491 | Ga0500641_0005527 | 3300053096 | Bacteria | 4476 |
| 1492 | Ga0500641_0007451 | 3300053096 | Bacteria | 3903 |
| 1493 | Ga0500556_0000033 | 3300053104 | Bacteria | 147801 |
| 1494 | Ga0500562_000165 | 3300053108 | Bacteria | 18663 |
| 1495 | Ga0500595_000024 | 3300053119 | Bacteria | 144160 |
| 1496 | Ga0500595_000485 | 3300053119 | Bacteria | 24470 |
| 1497 | Ga0500642_0000750 | 3300053130 | Bacteria | 9528 |
| 1498 | Ga0500642_0007045 | 3300053130 | Bacteria | 3751 |
| 1499 | Ga0500642_0007474 | 3300053130 | Bacteria | 3674 |
| 1500 | Ga0500652_001115 | 3300053131 | Bacteria | 8653 |
| 1501 | Ga0500559_0008307 | 3300053136 | Bacteria | 4560 |
| 1502 | Ga0500568_0006160 | 3300053139 | Bacteria | 6067 |
| 1503 | Ga0500616_0001013 | 3300053153 | Bacteria | 30051 |
| 1504 | Ga0500616_0002129 | 3300053153 | Bacteria | 17180 |
| 1505 | Ga0500616_0019916 | 3300053153 | Bacteria | 3774 |
| 1506 | Ga0500622_0000170 | 3300053156 | Bacteria | 70088 |
| 1507 | Ga0500633_0005215 | 3300053160 | Bacteria | 3063 |
| 1508 | Ga0500636_0039555 | 3300053177 | Bacteria | 2790 |
| 1509 | Ga0500645_000102 | 3300053730 | Bacteria | 67660 |
| 1510 | Ga0501084_0000521 | 3300054114 | Bacteria | 29417 |
| 1511 | Ga0501084_0018649 | 3300054114 | Bacteria | 5776 |
| 1512 | Ga0501084_0019959 | 3300054114 | Bacteria | 5586 |
| 1513 | Ga0501084_0022684 | 3300054114 | Bacteria | 5239 |
| 1514 | Ga0501084_0028373 | 3300054114 | Bacteria | 4678 |
| 1515 | Ga0501084_0028920 | 3300054114 | Bacteria | 4633 |
| 1516 | Ga0501084_0031629 | 3300054114 | Bacteria | 4423 |
| 1517 | Ga0501084_0049361 | 3300054114 | Bacteria | 3523 |
| 1518 | Ga0501084_0051500 | 3300054114 | Bacteria | 3446 |
| 1519 | Ga0501084_0099887 | 3300054114 | Bacteria | 2436 |
| 1520 | Ga0501084_0100522 | 3300054114 | Bacteria | 2428 |
| 1521 | Ga0501084_0158814 | 3300054114 | Bacteria | 1907 |
| 1522 | Ga0501082_0000032 | 3300060353 | Bacteria | 99261 |
| 1523 | Ga0501082_0001048 | 3300060353 | Bacteria | 24477 |
| 1524 | Ga0501082_0001819 | 3300060353 | Bacteria | 18791 |
| 1525 | Ga0501082_0002113 | 3300060353 | Bacteria | 17497 |
| 1526 | Ga0501082_0003499 | 3300060353 | Bacteria | 13702 |
| 1527 | Ga0501082_0004521 | 3300060353 | Bacteria | 12146 |
| 1528 | Ga0501082_0008508 | 3300060353 | Bacteria | 8847 |
| 1529 | Ga0501082_0013032 | 3300060353 | Bacteria | 7146 |
| 1530 | Ga0501082_0015627 | 3300060353 | Bacteria | 6533 |
| 1531 | Ga0501082_0015680 | 3300060353 | Bacteria | 6520 |
| 1532 | Ga0501082_0033328 | 3300060353 | Bacteria | 4444 |
| 1533 | Ga0501082_0040850 | 3300060353 | Bacteria | 3999 |
| 1534 | Ga0501082_0049060 | 3300060353 | Bacteria | 3640 |
| 1535 | Ga0501082_0155412 | 3300060353 | Bacteria | 1987 |
| 1536 | Ga0530510_0000034 | 3300061734 | Bacteria | 62610 |
| 1537 | Ga0530510_0000045 | 3300061734 | Bacteria | 56772 |
| 1538 | Ga0530510_0007968 | 3300061734 | Bacteria | 7392 |
| 1539 | Ga0530510_0008501 | 3300061734 | Bacteria | 7159 |
| 1540 | Ga0530510_0010050 | 3300061734 | Bacteria | 6638 |
| 1541 | Ga0530510_0023426 | 3300061734 | Bacteria | 4399 |
| 1542 | Ga0530510_0030671 | 3300061734 | Bacteria | 3863 |
| 1543 | 2509144830 | 2508501127 | Bacteria | 7037543 |
| 1544 | 2510133093 | 2510065019 | Bacteria | 6903379 |
| 1545 | 2510894451 | 2510461076 | Bacteria | 8618824 |
| 1546 | 2510899477 | 2510461076 | Bacteria | 8618824 |
| 1547 | 2511195827 | 2510917030 | Bacteria | 7460662 |
| 1548 | 2511389783 | 2511231027 | Bacteria | 5013807 |
| 1549 | 2512034014 | 2511231221 | Bacteria | 6846400 |
| 1550 | 2512931362 | 2512875016 | Bacteria | 6529530 |
| 1551 | 2512959192 | 2512875024 | Bacteria | 7195110 |
| 1552 | 2512970775 | 2512875026 | Bacteria | 6861065 |
| 1553 | 2513575107 | 2513237085 | Bacteria | 7695351 |
| 1554 | 2513591736 | 2513237087 | Bacteria | 5817514 |
| 1555 | 2513604182 | 2513237089 | Bacteria | 6553624 |
| 1556 | 2513635567 | 2513237093 | Bacteria | 7545552 |
| 1557 | 2513713491 | 2513237103 | Bacteria | 7647401 |
| 1558 | 2513985323 | 2513237156 | Bacteria | 6402557 |
| 1559 | 2514006469 | 2513237160 | Bacteria | 6650282 |
| 1560 | 2514021892 | 2513237162 | Bacteria | 7468464 |
| 1561 | 2514033770 | 2513237164 | Bacteria | 7563725 |
| 1562 | 2515112052 | 2515075009 | Bacteria | 7288508 |
| 1563 | 2515635523 | 2515154113 | Bacteria | 7807172 |
| 1564 | 2515660143 | 2515154116 | Bacteria | 7552979 |
| 1565 | 2515738793 | 2515154134 | Bacteria | 7220242 |
| 1566 | 2517035781 | 2516653077 | Bacteria | 7555578 |
| 1567 | 2517076185 | 2516653085 | Bacteria | 7346596 |
| 1568 | 2517094930 | 2517093000 | Bacteria | 7412387 |
| 1569 | 2517406576 | 2517287029 | Bacteria | 6905599 |
| 1570 | 2517570254 | 2517487022 | Bacteria | 7227575 |
| 1571 | 2523102911 | 2522572158 | Bacteria | 6514390 |
| 1572 | 2524001114 | 2523533628 | Bacteria | 4098242 |
| 1573 | 2535485092 | 2534681786 | Bacteria | 3308809 |
| 1574 | 2535520788 | 2534681796 | Bacteria | 7146037 |
| 1575 | 2585222534 | 2582581298 | Bacteria | 7315509 |
| 1576 | 2585402709 | 2582581867 | Bacteria | 7184437 |
| 1577 | 2585528341 | 2585427526 | Bacteria | 7258840 |
| 1578 | 2585545117 | 2585427529 | Bacteria | 7395659 |
| 1579 | 2597813124 | 2597489875 | Bacteria | 7010078 |
| 1580 | 2599101568 | 2597490356 | Bacteria | 7030811 |
| 1581 | 2599936636 | 2599185301 | Bacteria | 6161860 |
| 1582 | 2600194307 | 2599185352 | Bacteria | 7228948 |
| 1583 | 2643755235 | 2643221547 | Bacteria | 4740017 |
| 1584 | 2643803180 | 2643221557 | Bacteria | 7184309 |
| 1585 | 2644004336 | 2643221599 | Bacteria | 6292121 |
| 1586 | 2644063541 | 2643221610 | Bacteria | 7480339 |
| 1587 | 2644107368 | 2643221618 | Bacteria | 7717186 |
| 1588 | 2644150935 | 2643221626 | Bacteria | 8069654 |
| 1589 | 2644308763 | 2643221655 | Bacteria | 7722067 |
| 1590 | 2644335580 | 2643221659 | Bacteria | 7890716 |
| 1591 | 2644374825 | 2643221668 | Bacteria | 7306521 |
| 1592 | 2644414304 | 2643221675 | Bacteria | 7473456 |
| 1593 | 2644447832 | 2643221680 | Bacteria | 7473610 |
| 1594 | 2644539986 | 2643221698 | Bacteria | 7756764 |
| 1595 | 2644614704 | 2643221712 | Bacteria | 7729434 |
| 1596 | 2644676167 | 2643221723 | Bacteria | 7095460 |
| 1597 | 2644690305 | 2643221726 | Bacteria | 7455827 |
| 1598 | 2725952812 | 2724679232 | Bacteria | 7646494 |
| 1599 | 2738948857 | 2738541317 | Bacteria | 5340176 |
| 1600 | 2753359718 | 2751185800 | Bacteria | 5467370 |
| 1601 | 2753461960 | 2751185821 | Bacteria | 6189929 |
| 1602 | 2758641977 | 2758568016 | Bacteria | 5645291 |
| 1603 | 2765464695 | 2765235802 | Bacteria | 5618596 |
| 1604 | 2766062960 | 2765235942 | Bacteria | 7445910 |
| 1605 | 2770195372 | 2767802442 | Bacteria | 5747986 |
| 1606 | 2776258811 | 2775506901 | Bacteria | 9631051 |
| 1607 | 2776270686 | 2775506902 | Bacteria | 6208009 |
| 1608 | 2776280491 | 2775506904 | Bacteria | 5954060 |
| 1609 | 2792749370 | 2791355123 | Bacteria | 8049106 |
| 1610 | 2793280354 | 2791355253 | Bacteria | 5171699 |
| 1611 | 2793344131 | 2791355263 | Bacteria | 6872478 |
| 1612 | 2802719949 | 2802428858 | Bacteria | 6636079 |
| 1613 | 2802727118 | 2802428859 | Bacteria | 6667919 |
| 1614 | 2802731880 | 2802428860 | Bacteria | 6525526 |
| 1615 | 2802739211 | 2802428861 | Bacteria | 6534206 |
| 1616 | 2802745809 | 2802428862 | Bacteria | 6633353 |
| 1617 | 2802752411 | 2802428863 | Bacteria | 6410669 |
| 1618 | 2828307226 | 2828305725 | Bacteria | 4916900 |
| 1619 | 2837681390 | 2837678835 | Bacteria | 5252418 |
| 1620 | 2838681857 | 2838680041 | Bacteria | 6545511 |
| 1621 | 2838689258 | 2838686498 | Bacteria | 7807632 |
| 1622 | 2838696428 | 2838694306 | Bacteria | 6853137 |
| 1623 | 2838710332 | 2838707686 | Bacteria | 6619912 |
| 1624 | 2838730606 | 2838729681 | Bacteria | 7400765 |
| 1625 | 2838743547 | 2838742623 | Bacteria | 7396178 |
| 1626 | 2839996963 | 2839993093 | Bacteria | 5512535 |
| 1627 | 2840767483 | 2840764183 | Bacteria | 6358399 |
| 1628 | 2841739317 | 2841734538 | Bacteria | 6784580 |
| 1629 | 2841854777 | 2841851746 | Bacteria | 7532261 |
| 1630 | 2842078507 | 2842077413 | Bacteria | 6508645 |
| 1631 | 2842110715 | 2842110456 | Bacteria | 7656360 |
| 1632 | 2842118985 | 2842118031 | Bacteria | 7033875 |
| 1633 | 2842157640 | 2842156927 | Bacteria | 6894975 |
| 1634 | 2842164838 | 2842163707 | Bacteria | 6916235 |
| 1635 | 2842180775 | 2842180545 | Bacteria | 6888678 |
| 1636 | 2842222932 | 2842217011 | Bacteria | 7497767 |
| 1637 | 2842231167 | 2842229732 | Bacteria | 7475766 |
| 1638 | 2842239744 | 2842237096 | Bacteria | 6620661 |
| 1639 | 2842244726 | 2842243621 | Bacteria | 7421798 |
| 1640 | 2842258539 | 2842257432 | Bacteria | 7401195 |
| 1641 | 2842273278 | 2842271015 | Bacteria | 7807131 |
| 1642 | 2842292168 | 2842291075 | Bacteria | 7076806 |
| 1643 | 2842310060 | 2842304105 | Bacteria | 7023636 |
| 1644 | 2842336205 | 2842333319 | Bacteria | 8899485 |
| 1645 | 2842372423 | 2842370503 | Bacteria | 7038661 |
| 1646 | 2842378565 | 2842377471 | Bacteria | 7140707 |
| 1647 | 2842385494 | 2842384541 | Bacteria | 7057858 |
| 1648 | 2842695555 | 2842694124 | Bacteria | 4063419 |
| 1649 | 2842871880 | 2842871566 | Bacteria | 4827117 |
| 1650 | 2844166650 | 2844163670 | Bacteria | 7266046 |
| 1651 | 2844459387 | 2844454524 | Bacteria | 7952546 |
| 1652 | 2846953707 | 2846952575 | Bacteria | 6587527 |
| 1653 | 2848860109 | 2848858292 | Bacteria | 7391279 |
| 1654 | 2854912364 | 2854911287 | Bacteria | 5582813 |
| 1655 | 2856347398 | 2856342000 | Bacteria | 7176905 |
| 1656 | 2856369578 | 2856364286 | Bacteria | 6939991 |
| 1657 | 2857518498 | 2857516855 | Bacteria | 7787325 |
| 1658 | 2869167132 | 2869162929 | Bacteria | 6399702 |
| 1659 | 2869244729 | 2869242130 | Bacteria | 6609239 |
| 1660 | 2869286068 | 2869285874 | Bacteria | 6901219 |
| 1661 | 2871434501 | 2871429161 | Bacteria | 6547891 |
| 1662 | 2871479531 | 2871474448 | Bacteria | 6806570 |
| 1663 | 2874149705 | 2874146452 | Bacteria | 7533118 |
| 1664 | 2874157965 | 2874155637 | Bacteria | 6724144 |
| 1665 | 2876369423 | 2876363079 | Bacteria | 6544991 |
| 1666 | 2876416169 | 2876413966 | Bacteria | 6831344 |
| 1667 | 2878751634 | 2878745973 | Bacteria | 6867388 |
| 1668 | 2878792660 | 2878788777 | Bacteria | 6567085 |
| 1669 | 2882636400 | 2882632389 | Bacteria | 8154593 |
| 1670 | 2883293081 | 2883291878 | Bacteria | 5894118 |
| 1671 | 2883356081 | 2883354860 | Bacteria | 5865246 |
| 1672 | 2885317878 | 2885312484 | Bacteria | 6415165 |
| 1673 | 2888346930 | 2888343758 | Bacteria | 6611049 |
| 1674 | 2889793906 | 2889790730 | Bacteria | 5689708 |
| 1675 | 2889916876 | 2889914905 | Bacteria | 5702301 |
| 1676 | 2891052156 | 2891048133 | Bacteria | 4447501 |
| 1677 | 2894656059 | 2894652903 | Bacteria | 4587256 |
| 1678 | 2897804250 | 2897803580 | Bacteria | 7000062 |
| 1679 | 2903451459 | 2903448605 | Bacteria | 7357801 |
| 1680 | 2903504579 | 2903492973 | Bacteria | 13473544 |
| 1681 | 2903522970 | 2903521522 | Bacteria | 6525694 |
| 1682 | 2903534570 | 2903528002 | Bacteria | 6586099 |
| 1683 | 2904580688 | 2904578770 | Bacteria | 5302906 |
| 1684 | 2906314032 | 2906308376 | Bacteria | 6841989 |
| 1685 | 2906327198 | 2906321335 | Bacteria | 6579571 |
| 1686 | 2909044213 | 2909042592 | Bacteria | 6499737 |
| 1687 | 2913313730 | 2913308742 | Bacteria | 5350706 |
| 1688 | 2915653104 | 2915650412 | Bacteria | 4288180 |
| 1689 | 2915981360 | 2915980308 | Bacteria | 6624279 |
| 1690 | 2916064246 | 2916061851 | Bacteria | 6737736 |
| 1691 | 2916182489 | 2916178963 | Bacteria | 5265078 |
| 1692 | 2917557237 | 2917554339 | Bacteria | 4987857 |
| 1693 | 2919106420 | 2919100787 | Bacteria | 7710546 |
| 1694 | 2919121598 | 2919119836 | Bacteria | 5208557 |
| 1695 | 2919454248 | 2919450847 | Bacteria | 5631160 |
| 1696 | 2919501033 | 2919497567 | Bacteria | 4408621 |
| 1697 | 2920825132 | 2920822456 | Bacteria | 6897201 |
| 1698 | 2921252007 | 2921250672 | Bacteria | 6677771 |
| 1699 | 2924757214 | 2924754689 | Bacteria | 6774424 |
| 1700 | 2928523811 | 2928521798 | Bacteria | 4960112 |
| 1701 | 2933576579 | 2933570622 | Bacteria | 7023390 |
| 1702 | 2933586741 | 2933586486 | Bacteria | 7667493 |
| 1703 | 2935897715 | 2935894831 | Bacteria | 6620579 |
| 1704 | 2935904516 | 2935901341 | Bacteria | 7341747 |
| 1705 | 2936372953 | 2936367885 | Bacteria | 7324495 |
| 1706 | 2936381108 | 2936375103 | Bacteria | 6652732 |
| 1707 | 2936386727 | 2936381700 | Bacteria | 7006523 |
| 1708 | 2937030206 | 2937029754 | Bacteria | 6424026 |
| 1709 | 2937042586 | 2937036028 | Bacteria | 6846469 |
| 1710 | 2937080356 | 2937078374 | Bacteria | 6610289 |
| 1711 | 2937085535 | 2937084907 | Bacteria | 6618516 |
| 1712 | 2937815858 | 2937813078 | Bacteria | 7783518 |
| 1713 | 2937824594 | 2937822353 | Bacteria | 7290551 |
| 1714 | 2937838108 | 2937836603 | Bacteria | 6811263 |
| 1715 | 2937853053 | 2937848649 | Bacteria | 6983481 |
| 1716 | 2941502217 | 2941499720 | Bacteria | 7599444 |
| 1717 | 2954016096 | 2954011201 | Bacteria | 4762601 |
| 1718 | 2957376465 | 2957375807 | Bacteria | 6425588 |
| 1719 | 2957439825 | 2957437181 | Bacteria | 6568994 |
| 1720 | 2958078086 | 2958071322 | Bacteria | 6815895 |
| 1721 | 2958130467 | 2958130278 | Bacteria | 6897202 |
| 1722 | 2958184672 | 2958179912 | Bacteria | 6874908 |
| 1723 | 2960592005 | 2960591022 | Bacteria | 6622873 |
| 1724 | 2960631966 | 2960631154 | Bacteria | 6732508 |
| 1725 | 2960681541 | 2960680706 | Bacteria | 6624464 |
| 1726 | 2960698124 | 2960693952 | Bacteria | 6749742 |
| 1727 | 2961082839 | 2961077736 | Bacteria | 7079850 |
| 1728 | 2963647853 | 2963644680 | Bacteria | 6530403 |
| 1729 | 2967688888 | 2967686174 | Bacteria | 6678622 |
| 1730 | 2967729077 | 2967728569 | Bacteria | 6641507 |
| 1731 | 2968085992 | 2968083720 | Bacteria | 7351627 |
| 1732 | 2970030361 | 2970026789 | Bacteria | 6785236 |
| 1733 | 2970127034 | 2970122695 | Bacteria | 6625855 |
| 1734 | 2970146183 | 2970143518 | Bacteria | 6446480 |
| 1735 | 2970528728 | 2970524798 | Bacteria | 6840927 |
| 1736 | 2970539642 | 2970532167 | Bacteria | 6553173 |
| 1737 | 2970540752 | 2970540015 | Bacteria | 6977556 |
| 1738 | 2977534353 | 2977530762 | Bacteria | 6951399 |
| 1739 | 2977547720 | 2977544691 | Bacteria | 6875412 |
| 1740 | 2977846093 | 2977843712 | Bacteria | 6753583 |
| 1741 | 2977924356 | 2977922695 | Bacteria | 6956781 |
| 1742 | 2977991547 | 2977986579 | Bacteria | 6581278 |
| 1743 | 2989774216 | 2989771324 | Bacteria | 5605128 |
| 1744 | 3002144693 | 3002141150 | Bacteria | 5254435 |
| 1745 | 3004216090 | 3004211236 | Bacteria | 7417683 |
| 1746 | 3004223840 | 3004218560 | Bacteria | 7421728 |
| 1747 | 3004334205 | 3004334049 | Bacteria | 8449246 |
| 1748 | 3005409775 | 3005409236 | Bacteria | 7188837 |
| 1749 | 3005448187 | 3005445848 | Bacteria | 6906074 |
| 1750 | 3005454706 | 3005452660 | Bacteria | 5889319 |
| 1751 | 637074466 | 637000159 | Bacteria | 7596297 |
| 1752 | 639648323 | 639633055 | Bacteria | 7751309 |
| 1753 | 646813981 | 646564506 | Bacteria | 3192235 |
| 1754 | 8001848086 | 8001845381 | Bacteria | 5804942 |
| 1755 | 8002061074 | 8002060224 | Bacteria | 4026565 |
| 1756 | 8004001716 | 8003999396 | Bacteria | 7063185 |
| 1757 | 8004393522 | 8004387939 | Bacteria | 7049250 |
| 1758 | 8004401923 | 8004395343 | Bacteria | 6620908 |
| 1759 | 8004638287 | 8004633249 | Bacteria | 6723080 |
| 1760 | 8004720290 | 8004714634 | Bacteria | 6776161 |
| 1761 | 8005314303 | 8005307578 | Bacteria | 7395396 |
| 1762 | 8005378968 | 8005376324 | Bacteria | 6590079 |
| 1763 | 8005462710 | 8005460587 | Bacteria | 7157962 |
| 1764 | 8005546939 | 8005542996 | Bacteria | 7077758 |
| 1765 | 8005557947 | 8005556819 | Bacteria | 6908598 |
| 1766 | 8005569121 | 8005563573 | Bacteria | 7153261 |
| 1767 | 8005659105 | 8005658619 | Bacteria | 4500593 |
| 1768 | 8018168274 | 8018163183 | Bacteria | 7277977 |
| 1769 | 8023681121 | 8023680758 | Bacteria | 7729763 |
| 1770 | 8024485928 | 8024479707 | Bacteria | 6954785 |
| 1771 | 8045864652 | 8045864390 | Bacteria | 5043873 |
| 1772 | 8054004500 | 8054002106 | Bacteria | 7987183 |
| 1773 | 8054565854 | 8054563764 | Bacteria | 5592885 |
| 1774 | 8055620900 | 8055617313 | Bacteria | 7548464 |
| 1775 | 8057875300 | 8057874678 | Bacteria | 7494653 |
| 1776 | Ga0436365_1008765 | |||
| 1777 | 2214544948 | |||
| 1778 | ARcpr5oldR_c000012 | |||
| 1779 | ARSoilYngRDRAFT_c00099 | |||
| 1780 | ARcpr5yngRDRAFT_c000315 | |||
| 1781 | ARSoilOldRDRAFT_c000006 | |||
| 1782 | ARCol0oldRDRAFT_c00232 | |||
| 1783 | ARCol0yngRDRAFT_1000024 | |||
| 1784 | JGI24746J21847_1000004 | |||
| 1785 | JGI24740J21852_10006274 | |||
| 1786 | JGI24739J22299_10001737 | |||
| 1787 | JGI24738J21930_10000058 | |||
| 1788 | JGI24744J21845_10000137 | |||
| 1789 | JGI24035J26624_1000170 | |||
| 1790 | JGI24034J26672_10001946 | |||
| 1791 | JGI25158J39367_1000110 | |||
| 1792 | JGI25158J39367_1004702 | |||
| 1793 | JGI25152J39213_1006078 | |||
| 1794 | JGI25159J45721_1000040 | |||
| 1795 | JGI25159J45721_1000788 | |||
| 1796 | JGI25159J45721_1000966 | |||
| 1797 | JGI25153J46596_10002364 | |||
| 1798 | JGI25160J50197_1000001 | |||
| 1799 | JGI25160J50197_1000128 | |||
| 1800 | JGI25161J50226_1000001 | |||
| 1801 | JGI25161J50226_1000107 | |||
| 1802 | JGI25161J50226_1000885 | |||
| 1803 | Ga0007417J51691_1018129 | |||
| 1804 | Ga0006562J51391_1007616 | |||
| 1805 | JGI25404J52841_10000854 | |||
| 1806 | Ga0055542_1000519 | |||
| 1807 | Ga0055526_1004726 | |||
| 1808 | Ga0055536_1002507 | |||
| 1809 | Ga0055528_1001892 | |||
| 1810 | Ga0055528_1005580 | |||
| 1811 | Ga0055530_10000091 | |||
| 1812 | Ga0055531_10002140 | |||
| 1813 | Ga0055531_10011122 | |||
| 1814 | Ga0055531_10014104 | |||
| 1815 | JGI25405J52794_10000510 | |||
| 1816 | Ga0055543_1000003 | |||
| 1817 | Ga0055543_1000074 | |||
| 1818 | Ga0055543_1000130 | |||
| 1819 | Ga0065165_1000013 | |||
| 1820 | Ga0065165_1000068 | |||
| 1821 | Ga0065165_1000528 | |||
| 1822 | Ga0065716_1002004 | |||
| 1823 | Ga0065714_10070553 | |||
| 1824 | Ga0065704_10002972 | |||
| 1825 | Ga0065704_10016946 | |||
| 1826 | Ga0065712_10002527 | |||
| 1827 | Ga0065715_10009712 | |||
| 1828 | Ga0065707_10102140 | |||
| 1829 | Ga0070658_10007004 | |||
| 1830 | Ga0070676_10000425 | |||
| 1831 | Ga0070683_100000002 | |||
| 1832 | Ga0070683_100000363 | |||
| 1833 | Ga0070683_100077966 | |||
| 1834 | Ga0070683_100089208 | |||
| 1835 | Ga0070690_100000206 | |||
| 1836 | Ga0070690_100000527 | |||
| 1837 | Ga0070670_100178788 | |||
| 1838 | Ga0070677_10000454 | |||
| 1839 | Ga0068869_100000203 | |||
| 1840 | Ga0068869_100080970 | |||
| 1841 | Ga0070666_10029924 | |||
| 1842 | Ga0070666_10043938 | |||
| 1843 | Ga0070666_10064235 | |||
| 1844 | Ga0070680_100000120 | |||
| 1845 | Ga0070680_100006928 | |||
| 1846 | Ga0070682_100000328 | |||
| 1847 | Ga0070682_100000606 | |||
| 1848 | Ga0068868_100008027 | |||
| 1849 | Ga0068868_100029919 | |||
| 1850 | Ga0070660_100023629 | |||
| 1851 | Ga0070660_100031858 | |||
| 1852 | Ga0070660_100066062 | |||
| 1853 | Ga0070689_100002797 | |||
| 1854 | Ga0070689_100005434 | |||
| 1855 | Ga0070689_100005609 | |||
| 1856 | Ga0070689_100069221 | |||
| 1857 | Ga0070691_10002816 | |||
| 1858 | Ga0070687_100001134 | |||
| 1859 | Ga0070687_100013129 | |||
| 1860 | Ga0070661_100000765 | |||
| 1861 | Ga0070661_100003192 | |||
| 1862 | Ga0070661_100043968 | |||
| 1863 | Ga0070661_100062988 | |||
| 1864 | Ga0070692_10013057 | |||
| 1865 | Ga0070668_100000870 | |||
| 1866 | Ga0070668_100027666 | |||
| 1867 | Ga0070668_100049511 | |||
| 1868 | Ga0070669_100097449 | |||
| 1869 | Ga0070675_100017566 | |||
| 1870 | Ga0070675_100033460 | |||
| 1871 | Ga0070675_100047903 | |||
| 1872 | Ga0070671_100002158 | |||
| 1873 | Ga0070671_100044122 | |||
| 1874 | Ga0070671_100089467 | |||
| 1875 | Ga0070674_100007270 | |||
| 1876 | Ga0070673_100023147 | |||
| 1877 | Ga0070673_100041409 | |||
| 1878 | Ga0070688_100002533 | |||
| 1879 | Ga0070688_100033508 | |||
| 1880 | Ga0070659_100000350 | |||
| 1881 | Ga0070659_100002129 | |||
| 1882 | Ga0070667_100002810 | |||
| 1883 | Ga0070667_100087410 | |||
| 1884 | Ga0070709_10000567 | |||
| 1885 | Ga0070709_10039794 | |||
| 1886 | Ga0070714_100002396 | |||
| 1887 | Ga0070714_100013673 | |||
| 1888 | Ga0070713_100002955 | |||
| 1889 | Ga0070713_100007316 | |||
| 1890 | Ga0070710_10002324 | |||
| 1891 | Ga0070710_10017981 | |||
| 1892 | Ga0070701_10001117 | |||
| 1893 | Ga0070701_10005793 | |||
| 1894 | Ga0070711_100053889 | |||
| 1895 | Ga0070705_100000025 | |||
| 1896 | Ga0070705_100001171 | |||
| 1897 | Ga0070700_100000259 | |||
| 1898 | Ga0070700_100001124 | |||
| 1899 | Ga0070694_100007552 | |||
| 1900 | Ga0070663_100001017 | |||
| 1901 | Ga0070663_100006394 | |||
| 1902 | Ga0070678_100000662 | |||
| 1903 | Ga0070678_100001220 | |||
| 1904 | Ga0070662_100031146 | |||
| 1905 | Ga0070681_10002164 | |||
| 1906 | Ga0070681_10005944 | |||
| 1907 | Ga0070681_10008745 | |||
| 1908 | Ga0070681_10066756 | |||
| 1909 | Ga0070681_10200103 | |||
| 1910 | Ga0068867_100007166 | |||
| 1911 | Ga0068867_100036166 | |||
| 1912 | Ga0070685_10000890 | |||
| 1913 | Ga0070685_10001744 | |||
| 1914 | Ga0070685_10037201 | |||
| 1915 | Ga0070707_100006682 | |||
| 1916 | Ga0070698_100000572 | |||
| 1917 | Ga0070699_100001132 | |||
| 1918 | Ga0070699_100005476 | |||
| 1919 | Ga0070699_100015264 | |||
| 1920 | Ga0070679_100000963 | |||
| 1921 | Ga0070679_100003169 | |||
| 1922 | Ga0070679_100017034 | |||
| 1923 | Ga0070679_100071542 | |||
| 1924 | Ga0070679_100126956 | |||
| 1925 | Ga0070697_100018303 | |||
| 1926 | Ga0068853_100007711 | |||
| 1927 | Ga0070672_100000403 | |||
| 1928 | Ga0070672_100055907 | |||
| 1929 | Ga0070686_100003724 | |||
| 1930 | Ga0070686_100034761 | |||
| 1931 | Ga0070695_100000420 | |||
| 1932 | Ga0070695_100000450 | |||
| 1933 | Ga0070695_100007928 | |||
| 1934 | Ga0070696_100000311 | |||
| 1935 | Ga0070696_100018731 | |||
| 1936 | Ga0070693_100000031 | |||
| 1937 | Ga0070693_100002055 | |||
| 1938 | Ga0070665_100055479 | |||
| 1939 | Ga0070665_100072811 | |||
| 1940 | Ga0070704_100000166 | |||
| 1941 | Ga0070704_100004506 | |||
| 1942 | Ga0070704_100004779 | |||
| 1943 | Ga0070704_100040984 | |||
| 1944 | Ga0068855_100011542 | |||
| 1945 | Ga0068855_100013823 | |||
| 1946 | Ga0068855_100025729 | |||
| 1947 | Ga0068855_100029545 | |||
| 1948 | Ga0068855_100046538 | |||
| 1949 | Ga0068855_100048772 | |||
| 1950 | Ga0068855_100190949 | |||
| 1951 | Ga0070664_100007404 | |||
| 1952 | Ga0070664_100057158 | |||
| 1953 | Ga0068857_100002657 | |||
| 1954 | Ga0068857_100004052 | |||
| 1955 | Ga0068857_100007038 | |||
| 1956 | Ga0068854_100001346 | |||
| 1957 | Ga0068854_100030942 | |||
| 1958 | Ga0068856_100015010 | |||
| 1959 | Ga0068856_100020971 | |||
| 1960 | Ga0068856_100091694 | |||
| 1961 | Ga0068856_100118968 | |||
| 1962 | Ga0070702_100000076 | |||
| 1963 | Ga0070702_100000222 | |||
| 1964 | Ga0068852_100002780 | |||
| 1965 | Ga0068859_100004022 | |||
| 1966 | Ga0068859_100012283 | |||
| 1967 | Ga0068859_100102096 | |||
| 1968 | Ga0068864_100000746 | |||
| 1969 | Ga0068864_100001176 | |||
| 1970 | Ga0068864_100007658 | |||
| 1971 | Ga0068864_100025328 | |||
| 1972 | Ga0068866_10002716 | |||
| 1973 | Ga0068866_10011097 | |||
| 1974 | Ga0068861_100002192 | |||
| 1975 | Ga0068861_100002529 | |||
| 1976 | Ga0068861_100036694 | |||
| 1977 | Ga0068861_100091269 | |||
| 1978 | Ga0068870_10000355 | |||
| 1979 | Ga0068870_10006338 | |||
| 1980 | Ga0068863_100000150 | |||
| 1981 | Ga0068863_100002386 | |||
| 1982 | Ga0068863_100024551 | |||
| 1983 | Ga0068858_100012485 | |||
| 1984 | Ga0068858_100018691 | |||
| 1985 | Ga0068860_100016352 | |||
| 1986 | Ga0068860_100087347 | |||
| 1987 | Ga0068862_100001220 | |||
| 1988 | Ga0068862_100001588 | |||
| 1989 | Ga0068862_100002000 | |||
| 1990 | Ga0068862_100003882 | |||
| 1991 | Ga0068862_100034249 | |||
| 1992 | Ga0081455_10000185 | |||
| 1993 | Ga0081455_10006230 | |||
| 1994 | Ga0081455_10009218 | |||
| 1995 | Ga0081455_10011357 | |||
| 1996 | Ga0081455_10020738 | |||
| 1997 | Ga0081455_10021578 | |||
| 1998 | Ga0081455_10032363 | |||
| 1999 | Ga0081538_10001256 | |||
| 2000 | Ga0081538_10003566 | |||
| 2001 | Ga0081538_10014289 | |||
| 2002 | Ga0081538_10028869 | |||
| 2003 | Ga0081540_1000027 | |||
| 2004 | Ga0081540_1000500 | |||
| 2005 | Ga0081540_1000925 | |||
| 2006 | Ga0081540_1004017 | |||
| 2007 | Ga0081540_1014299 | |||
| 2008 | Ga0081540_1027801 | |||
| 2009 | Ga0081539_10001680 | |||
| 2010 | Ga0070717_10000870 | |||
| 2011 | Ga0070717_10006628 | |||
| 2012 | Ga0070717_10072365 | |||
| 2013 | Ga0075365_10032311 | |||
| 2014 | Ga0075363_100000191 | |||
| 2015 | Ga0075363_100004339 | |||
| 2016 | Ga0075364_10050939 | |||
| 2017 | Ga0075432_10004591 | |||
| 2018 | Ga0070715_10001413 | |||
| 2019 | Ga0070716_100041286 | |||
| 2020 | Ga0075367_10003973 | |||
| 2021 | Ga0075367_10070581 | |||
| 2022 | Ga0068871_100000512 | |||
| 2023 | Ga0068871_100022390 | |||
| 2024 | Ga0075428_100000205 | |||
| 2025 | Ga0075428_100013493 | |||
| 2026 | Ga0075428_100018446 | |||
| 2027 | Ga0075428_100060879 | |||
| 2028 | Ga0075428_100136255 | |||
| 2029 | Ga0075430_100007339 | |||
| 2030 | Ga0075430_100035723 | |||
| 2031 | Ga0075431_100000119 | |||
| 2032 | Ga0075431_100002115 | |||
| 2033 | Ga0075431_100002836 | |||
| 2034 | Ga0075431_100003819 | |||
| 2035 | Ga0075431_100011311 | |||
| 2036 | Ga0075431_100098097 | |||
| 2037 | Ga0075433_10000766 | |||
| 2038 | Ga0075433_10020904 | |||
| 2039 | Ga0075433_10030061 | |||
| 2040 | Ga0075434_100030914 | |||
| 2041 | Ga0075434_100037072 | |||
| 2042 | Ga0075434_100048266 | |||
| 2043 | Ga0075434_100082038 | |||
| 2044 | Ga0075429_100023992 | |||
| 2045 | Ga0068865_100000085 | |||
| 2046 | Ga0068865_100003897 | |||
| 2047 | Ga0075436_100012301 | |||
| 2048 | Ga0075436_100030360 | |||
| 2049 | Ga0075436_100036567 | |||
| 2050 | Ga0075436_100044603 | |||
| 2051 | Ga0075436_100070989 | |||
| 2052 | Ga0097620_100004022 | |||
| 2053 | Ga0097620_100012283 | |||
| 2054 | Ga0097620_100102102 | |||
| 2055 | Ga0079104_1012988 | |||
| 2056 | Ga0075435_100005823 | |||
| 2057 | Ga0075435_100038382 | |||
| 2058 | Ga0075435_100071859 | |||
| 2059 | Ga0075435_100102060 | |||
| 2060 | Ga0099795_10000399 | |||
| 2061 | Ga0099795_10007826 | |||
| 2062 | Ga0105240_10061096 | |||
| 2063 | Ga0105240_10079923 | |||
| 2064 | Ga0111539_10001586 | |||
| 2065 | Ga0111539_10002672 | |||
| 2066 | Ga0111539_10003892 | |||
| 2067 | Ga0111539_10027109 | |||
| 2068 | Ga0111539_10114005 | |||
| 2069 | Ga0111539_10128525 | |||
| 2070 | Ga0105245_10000235 | |||
| 2071 | Ga0105245_10002212 | |||
| 2072 | Ga0105245_10003656 | |||
| 2073 | Ga0105247_10003562 | |||
| 2074 | Ga0105247_10009146 | |||
| 2075 | Ga0105247_10014081 | |||
| 2076 | Ga0114129_10001232 | |||
| 2077 | Ga0114129_10004296 | |||
| 2078 | Ga0114129_10004982 | |||
| 2079 | Ga0114129_10010606 | |||
| 2080 | Ga0114129_10022620 | |||
| 2081 | Ga0114129_10072701 | |||
| 2082 | Ga0114129_10139267 | |||
| 2083 | Ga0114129_10145429 | |||
| 2084 | Ga0105243_10000699 | |||
| 2085 | Ga0105243_10002433 | |||
| 2086 | Ga0105241_10002051 | |||
| 2087 | Ga0105241_10054635 | |||
| 2088 | Ga0105241_10148425 | |||
| 2089 | Ga0105242_10000134 | |||
| 2090 | Ga0105242_10000187 | |||
| 2091 | Ga0105248_10002875 | |||
| 2092 | Ga0105248_10020430 | |||
| 2093 | Ga0105248_10075570 | |||
| 2094 | Ga0105248_10105852 | |||
| 2095 | Ga0105237_10000721 | |||
| 2096 | Ga0105237_10028441 | |||
| 2097 | Ga0105237_10081836 | |||
| 2098 | Ga0105238_10010548 | |||
| 2099 | Ga0105238_10015586 | |||
| 2100 | Ga0105238_10140785 | |||
| 2101 | Ga0105238_10226862 | |||
| 2102 | Ga0105249_10000325 | |||
| 2103 | Ga0105249_10002879 | |||
| 2104 | Ga0105249_10004088 | |||
| 2105 | Ga0099796_10000546 | |||
| 2106 | Ga0099796_10004916 | |||
| 2107 | Ga0099796_10004953 | |||
| 2108 | Ga0105239_10061461 | |||
| 2109 | Ga0105239_10113187 | |||
| 2110 | Ga0105239_10200166 | |||
| 2111 | Ga0105246_10000041 | |||
| 2112 | Ga0157371_10011541 | |||
| 2113 | Ga0157370_10072345 | |||
| 2114 | Ga0157369_10007903 | |||
| 2115 | Ga0171463_1003 | |||
| 2116 | Ga0157374_10006924 | |||
| 2117 | Ga0157378_10000434 | |||
| 2118 | Ga0157378_10002326 | |||
| 2119 | Ga0157378_10054673 | |||
| 2120 | Ga0157378_10121812 | |||
| 2121 | Ga0163162_10000973 | |||
| 2122 | Ga0163162_10003414 | |||
| 2123 | Ga0157372_10001290 | |||
| 2124 | Ga0157372_10011705 | |||
| 2125 | Ga0157372_10148634 | |||
| 2126 | Ga0157375_10000181 | |||
| 2127 | Ga0157375_10001982 | |||
| 2128 | Ga0157375_10022227 | |||
| 2129 | Ga0163163_10002557 | |||
| 2130 | Ga0163163_10111071 | |||
| 2131 | Ga0157380_10000893 | |||
| 2132 | Ga0182008_10044160 | |||
| 2133 | Ga0157377_10005582 | |||
| 2134 | Ga0157377_10035004 | |||
| 2135 | Ga0157379_10000364 | |||
| 2136 | Ga0157379_10049263 | |||
| 2137 | Ga0157376_10000142 | |||
| 2138 | Ga0157376_10000539 | |||
| 2139 | Ga0157376_10086973 | |||
| 2140 | Ga0183363_1295 | |||
| 2141 | Ga0163161_10000081 | |||
| 2142 | Ga0163161_10004604 | |||
| 2143 | Ga0163161_10092646 | |||
| 2144 | Ga0197907_10190156 | |||
| 2145 | Ga0206350_10429826 | |||
| 2146 | Ga0213873_10006007 | |||
| 2147 | Ga0213872_10000620 | |||
| 2148 | Ga0213872_10004301 | |||
| 2149 | Ga0213872_10008938 | |||
| 2150 | Ga0213872_10010374 | |||
| 2151 | Ga0213872_10022855 | |||
| 2152 | Ga0213872_10030390 | |||
| 2153 | Ga0213876_10000749 | |||
| 2154 | Ga0213876_10001133 | |||
| 2155 | Ga0213876_10017442 | |||
| 2156 | Ga0213875_10000175 | |||
| 2157 | Ga0213875_10001215 | |||
| 2158 | Ga0228711_1000008 | |||
| 2159 | Ga0228710_1000009 | |||
| 2160 | Ga0209760_100855 | |||
| 2161 | Ga0209436_100011 | |||
| 2162 | Ga0209437_100047 | |||
| 2163 | Ga0209437_100242 | |||
| 2164 | Ga0207425_1005009 | |||
| 2165 | Ga0209026_1000962 | |||
| 2166 | Ga0209677_103834 | |||
| 2167 | Ga0209148_1000128 | |||
| 2168 | Ga0209148_1000660 | |||
| 2169 | Ga0209129_1000244 | |||
| 2170 | Ga0209129_1000347 | |||
| 2171 | Ga0209129_1000642 | |||
| 2172 | Ga0209233_1000048 | |||
| 2173 | Ga0209233_1000069 | |||
| 2174 | Ga0209233_1002912 | |||
| 2175 | Ga0209233_1004867 | |||
| 2176 | Ga0207666_1000083 | |||
| 2177 | Ga0209455_1000174 | |||
| 2178 | Ga0209455_1001949 | |||
| 2179 | Ga0209673_1001566 | |||
| 2180 | Ga0209673_1002650 | |||
| 2181 | Ga0209673_1013596 | |||
| 2182 | Ga0209130_1000003 | |||
| 2183 | Ga0209130_1000034 | |||
| 2184 | Ga0209130_1000081 | |||
| 2185 | Ga0207673_1000016 | |||
| 2186 | Ga0209675_1000678 | |||
| 2187 | Ga0209676_1001813 | |||
| 2188 | Ga0209025_1002141 | |||
| 2189 | Ga0209025_1009219 | |||
| 2190 | Ga0209025_1043086 | |||
| 2191 | Ga0209564_1000013 | |||
| 2192 | Ga0209564_1000225 | |||
| 2193 | Ga0209564_1003031 | |||
| 2194 | Ga0209564_1003908 | |||
| 2195 | Ga0209758_1000118 | |||
| 2196 | Ga0209758_1000139 | |||
| 2197 | Ga0209758_1000463 | |||
| 2198 | Ga0209758_1001457 | |||
| 2199 | Ga0209758_1002020 | |||
| 2200 | Ga0209758_1002746 | |||
| 2201 | Ga0209758_1012312 | |||
| 2202 | Ga0209050_1000029 | |||
| 2203 | Ga0209050_1002022 | |||
| 2204 | Ga0209050_1002735 | |||
| 2205 | Ga0209256_1000442 | |||
| 2206 | Ga0209256_1001655 | |||
| 2207 | Ga0209256_1007486 | |||
| 2208 | Ga0207426_1000006 | |||
| 2209 | Ga0207426_1000008 | |||
| 2210 | Ga0207426_1000011 | |||
| 2211 | Ga0209051_1003289 | |||
| 2212 | Ga0209051_1003936 | |||
| 2213 | Ga0209257_1000271 | |||
| 2214 | Ga0209257_1000559 | |||
| 2215 | Ga0209257_1002648 | |||
| 2216 | Ga0207697_10000045 | |||
| 2217 | Ga0207682_10000046 | |||
| 2218 | Ga0207682_10000171 | |||
| 2219 | Ga0207710_10002314 | |||
| 2220 | Ga0207710_10007155 | |||
| 2221 | Ga0207710_10010128 | |||
| 2222 | Ga0207688_10000092 | |||
| 2223 | Ga0207688_10001093 | |||
| 2224 | Ga0207688_10026400 | |||
| 2225 | Ga0207680_10002071 | |||
| 2226 | Ga0207680_10022223 | |||
| 2227 | Ga0207647_10002086 | |||
| 2228 | Ga0207647_10027804 | |||
| 2229 | Ga0207685_10002312 | |||
| 2230 | Ga0207699_10003273 | |||
| 2231 | Ga0207645_10000275 | |||
| 2232 | Ga0207645_10001966 | |||
| 2233 | Ga0207645_10046566 | |||
| 2234 | Ga0207643_10000025 | |||
| 2235 | Ga0207643_10001083 | |||
| 2236 | Ga0207705_10001898 | |||
| 2237 | Ga0207705_10070957 | |||
| 2238 | Ga0207684_10007905 | |||
| 2239 | Ga0207654_10000936 | |||
| 2240 | Ga0207707_10003472 | |||
| 2241 | Ga0207707_10017968 | |||
| 2242 | Ga0207707_10025765 | |||
| 2243 | Ga0207707_10059251 | |||
| 2244 | Ga0207707_10062325 | |||
| 2245 | Ga0207707_10113062 | |||
| 2246 | Ga0207695_10001525 | |||
| 2247 | Ga0207695_10001672 | |||
| 2248 | Ga0207695_10020168 | |||
| 2249 | Ga0207695_10045418 | |||
| 2250 | Ga0207695_10126603 | |||
| 2251 | Ga0207671_10008391 | |||
| 2252 | Ga0207693_10000829 | |||
| 2253 | Ga0207693_10004304 | |||
| 2254 | Ga0207693_10011371 | |||
| 2255 | Ga0207693_10012320 | |||
| 2256 | Ga0207693_10017674 | |||
| 2257 | Ga0207663_10020705 | |||
| 2258 | Ga0207663_10020766 | |||
| 2259 | Ga0207660_10000131 | |||
| 2260 | Ga0207660_10001363 | |||
| 2261 | Ga0207660_10065532 | |||
| 2262 | Ga0207662_10000657 | |||
| 2263 | Ga0207662_10001580 | |||
| 2264 | Ga0207657_10000112 | |||
| 2265 | Ga0207657_10003184 | |||
| 2266 | Ga0207657_10013490 | |||
| 2267 | Ga0207657_10023488 | |||
| 2268 | Ga0207657_10054696 | |||
| 2269 | Ga0207649_10000048 | |||
| 2270 | Ga0207652_10003368 | |||
| 2271 | Ga0207652_10003790 | |||
| 2272 | Ga0207652_10014059 | |||
| 2273 | Ga0207652_10038068 | |||
| 2274 | Ga0207652_10086404 | |||
| 2275 | Ga0207652_10120492 | |||
| 2276 | Ga0207646_10048746 | |||
| 2277 | Ga0207681_10000131 | |||
| 2278 | Ga0207681_10013850 | |||
| 2279 | Ga0207694_10026887 | |||
| 2280 | Ga0207694_10057786 | |||
| 2281 | Ga0207694_10065703 | |||
| 2282 | Ga0207694_10081960 | |||
| 2283 | Ga0207650_10060458 | |||
| 2284 | Ga0207650_10113204 | |||
| 2285 | Ga0207659_10000040 | |||
| 2286 | Ga0207659_10010222 | |||
| 2287 | Ga0207659_10018709 | |||
| 2288 | Ga0207687_10000122 | |||
| 2289 | Ga0207687_10014550 | |||
| 2290 | Ga0207687_10018688 | |||
| 2291 | Ga0207687_10025052 | |||
| 2292 | Ga0207700_10000974 | |||
| 2293 | Ga0207700_10038862 | |||
| 2294 | Ga0207644_10002729 | |||
| 2295 | Ga0207644_10015860 | |||
| 2296 | Ga0207690_10000104 | |||
| 2297 | Ga0207690_10000512 | |||
| 2298 | Ga0207690_10009059 | |||
| 2299 | Ga0207690_10015332 | |||
| 2300 | Ga0207690_10040226 | |||
| 2301 | Ga0207706_10000311 | |||
| 2302 | Ga0207706_10001805 | |||
| 2303 | Ga0207706_10008103 | |||
| 2304 | Ga0207706_10151500 | |||
| 2305 | Ga0207686_10000377 | |||
| 2306 | Ga0207686_10028007 | |||
| 2307 | Ga0207709_10000585 | |||
| 2308 | Ga0207709_10008650 | |||
| 2309 | Ga0207709_10011384 | |||
| 2310 | Ga0207670_10007327 | |||
| 2311 | Ga0207670_10012130 | |||
| 2312 | Ga0207670_10023246 | |||
| 2313 | Ga0207669_10000102 | |||
| 2314 | Ga0207669_10003612 | |||
| 2315 | Ga0207669_10010809 | |||
| 2316 | Ga0207669_10019553 | |||
| 2317 | Ga0207669_10053870 | |||
| 2318 | Ga0207704_10000071 | |||
| 2319 | Ga0207665_10000542 | |||
| 2320 | Ga0207665_10005622 | |||
| 2321 | Ga0207665_10033292 | |||
| 2322 | Ga0207691_10000257 | |||
| 2323 | Ga0207691_10002528 | |||
| 2324 | Ga0207691_10023849 | |||
| 2325 | Ga0207691_10086071 | |||
| 2326 | Ga0207711_10014250 | |||
| 2327 | Ga0207711_10025808 | |||
| 2328 | Ga0207711_10098602 | |||
| 2329 | Ga0207711_10106957 | |||
| 2330 | Ga0207689_10000134 | |||
| 2331 | Ga0207689_10051943 | |||
| 2332 | Ga0207661_10000003 | |||
| 2333 | Ga0207661_10000204 | |||
| 2334 | Ga0207661_10071743 | |||
| 2335 | Ga0207679_10000090 | |||
| 2336 | Ga0207679_10004910 | |||
| 2337 | Ga0207679_10028035 | |||
| 2338 | Ga0207667_10001369 | |||
| 2339 | Ga0207667_10022115 | |||
| 2340 | Ga0207667_10057994 | |||
| 2341 | Ga0207667_10058443 | |||
| 2342 | Ga0207667_10071354 | |||
| 2343 | Ga0207667_10087144 | |||
| 2344 | Ga0207651_10000017 | |||
| 2345 | Ga0207651_10002790 | |||
| 2346 | Ga0207651_10016867 | |||
| 2347 | Ga0207651_10033854 | |||
| 2348 | Ga0207712_10000114 | |||
| 2349 | Ga0207712_10002157 | |||
| 2350 | Ga0207712_10011464 | |||
| 2351 | Ga0207712_10046176 | |||
| 2352 | Ga0207668_10000033 | |||
| 2353 | Ga0207668_10000139 | |||
| 2354 | Ga0207668_10004255 | |||
| 2355 | Ga0207668_10007278 | |||
| 2356 | Ga0207668_10029136 | |||
| 2357 | Ga0207668_10040338 | |||
| 2358 | Ga0207640_10000221 | |||
| 2359 | Ga0207658_10005120 | |||
| 2360 | Ga0207658_10008572 | |||
| 2361 | Ga0207658_10032185 | |||
| 2362 | Ga0207677_10000989 | |||
| 2363 | Ga0207677_10003410 | |||
| 2364 | Ga0207703_10037396 | |||
| 2365 | Ga0207703_10064191 | |||
| 2366 | Ga0207703_10122856 | |||
| 2367 | Ga0207639_10003962 | |||
| 2368 | Ga0207678_10000086 | |||
| 2369 | Ga0207678_10000131 | |||
| 2370 | Ga0207678_10005906 | |||
| 2371 | Ga0207678_10009376 | |||
| 2372 | Ga0207678_10015605 | |||
| 2373 | Ga0207708_10000192 | |||
| 2374 | Ga0207708_10000679 | |||
| 2375 | Ga0207708_10008198 | |||
| 2376 | Ga0207708_10019626 | |||
| 2377 | Ga0207708_10050405 | |||
| 2378 | Ga0207708_10148413 | |||
| 2379 | Ga0207702_10000198 | |||
| 2380 | Ga0207702_10008405 | |||
| 2381 | Ga0207702_10014635 | |||
| 2382 | Ga0207702_10053882 | |||
| 2383 | Ga0207641_10000246 | |||
| 2384 | Ga0207641_10022801 | |||
| 2385 | Ga0207641_10092917 | |||
| 2386 | Ga0207648_10000483 | |||
| 2387 | Ga0207648_10001913 | |||
| 2388 | Ga0207676_10000372 | |||
| 2389 | Ga0207676_10005821 | |||
| 2390 | Ga0207676_10018086 | |||
| 2391 | Ga0207674_10000355 | |||
| 2392 | Ga0207674_10003117 | |||
| 2393 | Ga0207674_10007248 | |||
| 2394 | Ga0207675_100000111 | |||
| 2395 | Ga0207675_100001557 | |||
| 2396 | Ga0207675_100004582 | |||
| 2397 | Ga0207683_10000512 | |||
| 2398 | Ga0207683_10006472 | |||
| 2399 | Ga0207683_10008939 | |||
| 2400 | Ga0207683_10010713 | |||
| 2401 | Ga0207683_10012332 | |||
| 2402 | Ga0207683_10018283 | |||
| 2403 | Ga0207683_10057924 | |||
| 2404 | Ga0207698_10000524 | |||
| 2405 | Ga0209281_1000106 | |||
| 2406 | Ga0209281_1000426 | |||
| 2407 | Ga0209981_1001049 | |||
| 2408 | Ga0209999_1002321 | |||
| 2409 | Ga0210002_1000804 | |||
| 2410 | Ga0209983_1003168 | |||
| 2411 | Ga0209282_1000024 | |||
| 2412 | Ga0209966_1002710 | |||
| 2413 | Ga0209813_10000820 | |||
| 2414 | Ga0209813_10003047 | |||
| 2415 | Ga0209974_10000322 | |||
| 2416 | Ga0207428_10000620 | |||
| 2417 | Ga0207428_10001181 | |||
| 2418 | Ga0207428_10011769 | |||
| 2419 | Ga0207428_10018259 | |||
| 2420 | Ga0207428_10030202 | |||
| 2421 | Ga0207428_10036079 | |||
| 2422 | Ga0268266_10001055 | |||
| 2423 | Ga0268266_10025775 | |||
| 2424 | Ga0268266_10026025 | |||
| 2425 | Ga0268266_10047366 | |||
| 2426 | Ga0268265_10000312 | |||
| 2427 | Ga0268265_10001908 | |||
| 2428 | Ga0268265_10105875 | |||
| 2429 | Ga0268264_10000412 | |||
| 2430 | Ga0268264_10002132 | |||
| 2431 | Ga0268264_10019365 | |||
| 2432 | Ga0268264_10109317 | |||
| 2433 | Ga0268264_10187505 | |||
| 2434 | Ga0265337_1000961 | |||
| 2435 | Ga0307515_10019424 | |||
| 2436 | Ga0265338_10036784 | |||
| 2437 | Ga0265338_10059255 | |||
| 2438 | Ga0265330_10012173 | |||
| 2439 | Ga0265330_10020649 | |||
| 2440 | Ga0265332_10014858 | |||
| 2441 | Ga0265332_10015002 | |||
| 2442 | Ga0265328_10013540 | |||
| 2443 | Ga0265320_10001466 | |||
| 2444 | Ga0265325_10000036 | |||
| 2445 | Ga0265325_10000464 | |||
| 2446 | Ga0265325_10006666 | |||
| 2447 | Ga0265325_10022638 | |||
| 2448 | Ga0265325_10033804 | |||
| 2449 | Ga0265325_10037137 | |||
| 2450 | Ga0265325_10045502 | |||
| 2451 | Ga0265325_10051647 | |||
| 2452 | Ga0265340_10000517 | |||
| 2453 | Ga0265340_10012309 | |||
| 2454 | Ga0265340_10015660 | |||
| 2455 | Ga0265339_10008913 | |||
| 2456 | Ga0265339_10017127 | |||
| 2457 | Ga0265339_10017213 | |||
| 2458 | Ga0265331_10000075 | |||
| 2459 | Ga0265331_10000078 | |||
| 2460 | Ga0265331_10001331 | |||
| 2461 | Ga0265331_10005666 | |||
| 2462 | Ga0265331_10008072 | |||
| 2463 | Ga0265331_10026655 | |||
| 2464 | Ga0265327_10000180 | |||
| 2465 | Ga0265327_10000553 | |||
| 2466 | Ga0265316_10017409 | |||
| 2467 | Ga0265316_10102058 | |||
| 2468 | Ga0265313_10000513 | |||
| 2469 | Ga0265313_10000638 | |||
| 2470 | Ga0265313_10003540 | |||
| 2471 | Ga0265313_10013706 | |||
| 2472 | Ga0307508_10042605 | |||
| 2473 | Ga0316575_10002263 | |||
| 2474 | Ga0316575_10002645 | |||
| 2475 | Ga0316575_10002783 | |||
| 2476 | Ga0316575_10004010 | |||
| 2477 | Ga0316575_10018408 | |||
| 2478 | Ga0316579_10001061 | |||
| 2479 | Ga0316579_10001551 | |||
| 2480 | Ga0316579_10004056 | |||
| 2481 | Ga0316579_10011064 | |||
| 2482 | Ga0316579_10011579 | |||
| 2483 | Ga0316579_10016860 | |||
| 2484 | Ga0265314_10000771 | |||
| 2485 | Ga0265314_10010382 | |||
| 2486 | Ga0265314_10032009 | |||
| 2487 | Ga0265342_10000360 | |||
| 2488 | Ga0265342_10000715 | |||
| 2489 | Ga0265342_10005336 | |||
| 2490 | Ga0265342_10047300 | |||
| 2491 | Ga0316576_10000198 | |||
| 2492 | Ga0316576_10005194 | |||
| 2493 | Ga0316576_10011388 | |||
| 2494 | Ga0316576_10122419 | |||
| 2495 | Ga0316578_10000077 | |||
| 2496 | Ga0316578_10005155 | |||
| 2497 | Ga0316578_10006984 | |||
| 2498 | Ga0316578_10014499 | |||
| 2499 | Ga0316578_10014887 | |||
| 2500 | Ga0316578_10019116 | |||
| 2501 | Ga0316578_10021684 | |||
| 2502 | Ga0316578_10050852 | |||
| 2503 | Ga0316578_10060071 | |||
| 2504 | Ga0307516_10000257 | |||
| 2505 | Ga0316577_10000871 | |||
| 2506 | Ga0316577_10001039 | |||
| 2507 | Ga0316577_10004396 | |||
| 2508 | Ga0316577_10061094 | |||
| 2509 | Ga0315914_1000012 | |||
| 2510 | Ga0307414_10077197 | |||
| 2511 | Ga0316583_10000473 | |||
| 2512 | Ga0316583_10001032 | |||
| 2513 | Ga0316583_10001042 | |||
| 2514 | Ga0316583_10007189 | |||
| 2515 | Ga0316583_10009989 | |||
| 2516 | Ga0316585_10000049 | |||
| 2517 | Ga0316585_10003164 | |||
| 2518 | Ga0316585_10004124 | |||
| 2519 | Ga0316585_10005790 | |||
| 2520 | Ga0316580_10001570 | |||
| 2521 | Ga0316580_10020181 | |||
| 2522 | Ga0315913_1000006 | |||
| 2523 | Ga0315915_1000010 | |||
| 2524 | Ga0316588_1005591 | |||
| 2525 | Ga0373930_0000084 | |||
| 2526 | Ga0373948_0000552 | |||
| 2527 | Ga0373948_0003692 | |||
| 2528 | Ga0373950_0000815 | |||
| 2529 | Ga0373959_0000425 | |||
| 2530 | Ga0373938_0000231 | |||
| 2531 | Ga0373938_0000567 | |||
| 2532 | Ga0373926_0011880 | |||
| 2533 | Ga0373928_0000206 | |||
| 2534 | Ga0373929_0000733 | |||
| 2535 | Ga0373940_0000021 | |||
| 2536 | Ga0373940_0009488 | |||
| 2537 | Ga0373949_0001483 | |||
| 2538 | Ga0373949_0006727 | |||
| 2539 | Ga0373951_0000265 | |||
| 2540 | Ga0373952_0000034 | |||
| 2541 | Ga0373952_0000042 | |||
| 2542 | Ga0373923_0005769 | |||
| 2543 | Ga0373923_0010174 | |||
| 2544 | Ga0373932_0000344 | |||
| 2545 | Ga0373932_0006490 | |||
| 2546 | Ga0373936_0000864 | |||
| 2547 | Ga0373939_0002998 | |||
| 2548 | Ga0373941_0000157 | |||
| 2549 | Ga0373945_0000731 | |||
| 2550 | Ga0373953_0010038 | |||
| 2551 | Ga0373953_0010454 | |||
| 2552 | Ga0373953_0013202 | |||
| 2553 | Ga0373954_0005581 | |||
| 2554 | Ga0373954_0009228 | |||
| 2555 | Ga0373956_0022433 | |||
| 2556 | Ga0373957_0001308 | |||
| 2557 | Ga0373960_0002888 | |||
| 2558 | Ga0373960_0006657 | |||
| 2559 | Ga0373943_0003877 | |||
| 2560 | Ga0373943_0010393 | |||
| 2561 | Ga0373943_0010994 | |||
| 2562 | Ga0373943_0068648 | |||
| 2563 | Ga0373955_0004247 | |||
| 2564 | Ga0373955_0025856 | |||
| 2565 | Ga0373955_0032828 | |||
| 2566 | Ga0373955_0045087 | |||
| 2567 | Ga0373961_0000304 | |||
| 2568 | Ga0373961_0010703 | |||
| 2569 | Ga0373962_0000142 | |||
| 2570 | Ga0373962_0000927 | |||
| 2571 | Ga0373962_0004411 | |||
| 2572 | Ga0316574_0003836 | |||
| 2573 | Ga0316574_0007168 | |||
| 2574 | Ga0316574_0012852 | |||
| 2575 | Ga0316574_0027465 | |||
| 2576 | Ga0316574_0077481 | |||
| 2577 | Ga0373924_0000412 | |||
| 2578 | Ga0373924_0013444 | |||
| 2579 | Ga0373931_0000765 | |||
| 2580 | Ga0373931_0002775 | |||
| 2581 | Ga0373931_0015851 | |||
| 2582 | Ga0373931_0039406 | |||
| 2583 | Ga0373931_0050482 | |||
| 2584 | Ga0373935_0000100 | |||
| 2585 | Ga0373927_0005863 | |||
| 2586 | Ga0373927_0038482 | |||
| 2587 | Ga0373927_0077725 | |||
| 2588 | Ga0373933_0001555 | |||
| 2589 | Ga0373933_0007191 | |||
| 2590 | Ga0373933_0011180 | |||
| 2591 | Ga0373937_0000028 | |||
| 2592 | Ga0373937_0006851 | |||
| 2593 | Ga0373937_0008559 | |||
| 2594 | Ga0373937_0009265 | |||
| 2595 | Ga0373937_0011718 | |||
| 2596 | Ga0373937_0012323 | |||
| 2597 | Ga0373937_0028626 | |||
| 2598 | Ga0373937_0092513 | |||
| 2599 | Ga0316582_0000522 | |||
| 2600 | Ga0316582_0001859 | |||
| 2601 | Ga0316582_0025562 | |||
| 2602 | Ga0316582_0026382 | |||
| 2603 | Ga0316582_0030685 | |||
| 2604 | Ga0316582_0041248 | |||
| 2605 | Ga0316582_0049370 | |||
| 2606 | Ga0316582_0053019 | |||
| 2607 | Ga0316582_0057998 | |||
| 2608 | Ga0316582_0062214 | |||
| 2609 | Ga0316584_0002243 | |||
| 2610 | Ga0316584_0006512 | |||
| 2611 | Ga0316584_0006565 | |||
| 2612 | Ga0316584_0007146 | |||
| 2613 | Ga0316584_0016129 | |||
| 2614 | Ga0316584_0017993 | |||
| 2615 | Ga0316584_0023952 | |||
| 2616 | Ga0316584_0027441 | |||
| 2617 | Ga0316584_0052086 | |||
| 2618 | Ga0316584_0065493 | |||
| 2619 | Ga0316584_0075582 | |||
| 2620 | Ga0316584_0122781 | |||
| 2621 | Ga0316584_0136554 | |||
| 2622 | Ga0373925_0000034 | |||
| 2623 | Ga0373925_0094579 | |||
| 2624 | Ga0395899_0001908 | |||
| 2625 | Ga0395900_0002494 | |||
| 2626 | Ga0395900_0002564 | |||
| 2627 | Ga0395900_0006623 | |||
| 2628 | Ga0395900_0025258 | |||
| 2629 | Ga0395900_0028120 | |||
| 2630 | Ga0395900_0040008 | |||
| 2631 | Ga0395898_0003555 | |||
| 2632 | Ga0395898_0013055 | |||
| 2633 | Ga0395898_0066968 | |||
| 2634 | Ga0395898_0124783 | |||
| 2635 | Ga0395905_0000736 | |||
| 2636 | Ga0395905_0001625 | |||
| 2637 | Ga0316581_0002447 | |||
| 2638 | Ga0316581_0013022 | |||
| 2639 | Ga0436364_0353649 | |||
| 2640 | Ga0436364_0377291 | |||
| 2641 | Ga0436364_0595239 | |||
| 2642 | Ga0436364_0631135 | |||
| 2643 | Ga0436364_0640611 | |||
| 2644 | Ga0436364_0953382 | |||
| 2645 | Ga0436364_1536187 | |||
| 2646 | Ga0395901_0000697 | |||
| 2647 | Ga0395901_0021620 | |||
| 2648 | Ga0395901_0026968 | |||
| 2649 | Ga0395901_0036300 | |||
| 2650 | Ga0395901_0044558 | |||
| 2651 | Ga0400484_16670 | |||
| 2652 | Ga0400484_31873 | |||
| 2653 | Ga0400490_02503 | |||
| 2654 | Ga0400490_03843 | |||
| 2655 | Ga0400490_09340 | |||
| 2656 | Ga0400490_33722 | |||
| 2657 | Ga0400490_38958 | |||
| 2658 | Ga0400491_03081 | |||
| 2659 | Ga0400491_12422 | |||
| 2660 | Ga0400485_05246 | |||
| 2661 | Ga0400488_12436 | |||
| 2662 | Ga0400488_21807 | |||
| 2663 | Ga0400488_27611 | |||
| 2664 | Ga0400488_42546 | |||
| 2665 | Ga0400486_05863 | |||
| 2666 | Ga0400486_16702 | |||
| 2667 | Ga0400486_24531 | |||
| 2668 | Ga0400483_070746 | |||
| 2669 | Ga0400483_083197 | |||
| 2670 | Ga0400483_150080 | |||
| 2671 | Ga0400483_183599 | |||
| 2672 | Ga0400489_06941 | |||
| 2673 | Ga0400489_08197 | |||
| 2674 | Ga0400489_26368 | |||
| 2675 | Ga0400489_81304 | |||
| 2676 | Ga0400489_86140 | |||
| 2677 | Ga0400487_39128 | |||
| 2678 | Ga0400487_56517 | |||
| 2679 | Ga0436365_0002039 | |||
| 2680 | Ga0436365_0693504 | |||
| 2681 | Ga0436365_0759336 | |||
| 2682 | Ga0436365_1225940 | |||
| 2683 | Ga0436365_1234367 | |||
| 2684 | Ga0436365_1931097 | |||
| 2685 | Ga0436360_0767836 | |||
| 2686 | Ga0436361_0005333 | |||
| 2687 | Ga0436361_0116753 | |||
| 2688 | Ga0436361_0195448 | |||
| 2689 | Ga0436361_0541048 | |||
| 2690 | Ga0436361_0549727 | |||
| 2691 | Ga0436361_0675194 | |||
| 2692 | Ga0436361_0874800 | |||
| 2693 | Ga0436361_0891718 | |||
| 2694 | Ga0436361_0980588 | |||
| 2695 | Ga0436361_1128479 | |||
| 2696 | Ga0436363_0752901 | |||
| 2697 | Ga0436363_0788307 | |||
| 2698 | Ga0436363_0913001 | |||
| 2699 | Ga0436362_1145055 | |||
| 2700 | Ga0451835_0953162 | |||
| 2701 | Ga0451839_0463122 | |||
| 2702 | Ga0451851_0257830 | |||
| 2703 | Ga0439464_0006129 | |||
| 2704 | Ga0451577_0000074 | |||
| 2705 | Ga0451577_0000149 | |||
| 2706 | Ga0451577_0001910 | |||
| 2707 | Ga0451577_0005601 | |||
| 2708 | Ga0451577_0025268 | |||
| 2709 | Ga0451577_0032984 | |||
| 2710 | Ga0451577_0053242 | |||
| 2711 | Ga0451577_0067235 | |||
| 2712 | Ga0453683_0000002 | |||
| 2713 | Ga0453683_0003375 | |||
| 2714 | Ga0453683_0004460 | |||
| 2715 | Ga0453683_0043120 | |||
| 2716 | Ga0466963_0003563 | |||
| 2717 | Ga0466963_0049606 | |||
| 2718 | Ga0453684_0000006 | |||
| 2719 | Ga0453684_0000031 | |||
| 2720 | Ga0453684_0000229 | |||
| 2721 | Ga0453684_0000443 | |||
| 2722 | Ga0453684_0000482 | |||
| 2723 | Ga0453684_0000494 | |||
| 2724 | Ga0453684_0002726 | |||
| 2725 | Ga0453684_0003278 | |||
| 2726 | Ga0453684_0007614 | |||
| 2727 | Ga0453684_0010417 | |||
| 2728 | Ga0453684_0011287 | |||
| 2729 | Ga0453684_0018479 | |||
| 2730 | Ga0453684_0061452 | |||
| 2731 | Ga0453684_0070131 | |||
| 2732 | Ga0453684_0123398 | |||
| 2733 | Ga0453684_0156179 | |||
| 2734 | Ga0466957_0002997 | |||
| 2735 | Ga0466957_0015363 | |||
| 2736 | Ga0466959_0102862 | |||
| 2737 | Ga0451576_0000056 | |||
| 2738 | Ga0451576_0000451 | |||
| 2739 | Ga0451576_0000758 | |||
| 2740 | Ga0451576_0003761 | |||
| 2741 | Ga0451576_0009975 | |||
| 2742 | Ga0451576_0014645 | |||
| 2743 | Ga0451576_0055178 | |||
| 2744 | Ga0451576_0127433 | |||
| 2745 | Ga0451576_0171240 | |||
| 2746 | Ga0495592_0000031 | |||
| 2747 | Ga0495592_0003656 | |||
| 2748 | Ga0495592_0031651 | |||
| 2749 | Ga0495603_0000184 | |||
| 2750 | Ga0495603_0043538 | |||
| 2751 | Ga0495629_0001240 | |||
| 2752 | Ga0495629_0002351 | |||
| 2753 | Ga0495629_0056213 | |||
| 2754 | Ga0495638_0021954 | |||
| 2755 | Ga0495641_0008505 | |||
| 2756 | Ga0495641_0060633 | |||
| 2757 | Ga0495651_0023405 | |||
| 2758 | Ga0495653_0000012 | |||
| 2759 | Ga0495653_0008313 | |||
| 2760 | Ga0495580_0001738 | |||
| 2761 | Ga0495580_0102890 | |||
| 2762 | Ga0495582_0000653 | |||
| 2763 | Ga0495582_0009413 | |||
| 2764 | Ga0495582_0047589 | |||
| 2765 | Ga0495639_0000606 | |||
| 2766 | Ga0495662_0011927 | |||
| 2767 | Ga0495662_0012795 | |||
| 2768 | Ga0495664_0000004 | |||
| 2769 | Ga0495664_0000684 | |||
| 2770 | Ga0495584_0014107 | |||
| 2771 | Ga0495585_0040228 | |||
| 2772 | Ga0495594_0001580 | |||
| 2773 | Ga0495607_0008161 | |||
| 2774 | Ga0495608_0000005 | |||
| 2775 | Ga0495608_0004875 | |||
| 2776 | Ga0495618_0000024 | |||
| 2777 | Ga0495620_0024740 | |||
| 2778 | Ga0495628_0000001 | |||
| 2779 | Ga0495628_0016177 | |||
| 2780 | Ga0495628_0016847 | |||
| 2781 | Ga0495630_0024733 | |||
| 2782 | Ga0495630_0125639 | |||
| 2783 | Ga0495643_0002255 | |||
| 2784 | Ga0495643_0010012 | |||
| 2785 | Ga0495643_0046437 | |||
| 2786 | Ga0495666_0019878 | |||
| 2787 | Ga0495652_0000002 | |||
| 2788 | Ga0495652_0026104 | |||
| 2789 | Ga0495652_0041153 | |||
| 2790 | Ga0495652_0057886 | |||
| 2791 | Ga0495652_0129965 | |||
| 2792 | Ga0495665_0008623 | |||
| 2793 | Ga0495665_0023480 | |||
| 2794 | Ga0495640_0000001 | |||
| 2795 | Ga0495640_0014571 | |||
| 2796 | Ga0495640_0016992 | |||
| 2797 | Ga0495640_0030510 | |||
| 2798 | Ga0495587_0000016 | |||
| 2799 | Ga0495587_0011558 | |||
| 2800 | Ga0495587_0023771 | |||
| 2801 | Ga0495587_0041329 | |||
| 2802 | Ga0495587_0043740 | |||
| 2803 | Ga0495598_0004096 | |||
| 2804 | Ga0495597_0005488 | |||
| 2805 | Ga0495645_0000002 | |||
| 2806 | Ga0495645_0033385 | |||
| 2807 | Ga0495622_0002546 | |||
| 2808 | Ga0495633_0017429 | |||
| 2809 | Ga0495667_0000007 | |||
| 2810 | Ga0495667_0001645 | |||
| 2811 | Ga0495667_0012483 | |||
| 2812 | Ga0495667_0030459 | |||
| 2813 | Ga0495667_0042240 | |||
| 2814 | Ga0495656_0045556 | |||
| 2815 | Ga0495634_0000003 | |||
| 2816 | Ga0495634_0062544 | |||
| 2817 | Ga0495625_0002323 | |||
| 2818 | Ga0495635_0000002 | |||
| 2819 | Ga0495635_0009880 | |||
| 2820 | Ga0495635_0020980 | |||
| 2821 | Ga0495635_0021013 | |||
| 2822 | Ga0495635_0038986 | |||
| 2823 | Ga0495588_0007684 | |||
| 2824 | Ga0495588_0017333 | |||
| 2825 | Ga0495588_0021342 | |||
| 2826 | Ga0495657_0000628 | |||
| 2827 | Ga0495657_0013418 | |||
| 2828 | Ga0495657_0025060 | |||
| 2829 | Ga0495599_0000005 | |||
| 2830 | Ga0495623_0000016 | |||
| 2831 | Ga0495623_0000629 | |||
| 2832 | Ga0495646_0000002 | |||
| 2833 | Ga0495646_0019857 | |||
| 2834 | Ga0495647_0004360 | |||
| 2835 | Ga0495658_0001645 | |||
| 2836 | Ga0495658_0052956 | |||
| 2837 | Ga0495613_0000075 | |||
| 2838 | Ga0495613_0006129 | |||
| 2839 | Ga0495613_0006324 | |||
| 2840 | Ga0495613_0028933 | |||
| 2841 | Ga0495670_0002382 | |||
| 2842 | Ga0495670_0026699 | |||
| 2843 | Ga0495600_0000279 | |||
| 2844 | Ga0495600_0003100 | |||
| 2845 | Ga0495600_0003563 | |||
| 2846 | Ga0495600_0050679 | |||
| 2847 | Ga0495581_0012339 | |||
| 2848 | Ga0495604_0000020 | |||
| 2849 | Ga0495604_0013017 | |||
| 2850 | Ga0495604_0014690 | |||
| 2851 | Ga0495604_0014747 | |||
| 2852 | Ga0495604_0032203 | |||
| 2853 | Ga0495604_0041289 | |||
| 2854 | Ga0495674_0000002 | |||
| 2855 | Ga0495674_0027563 | |||
| 2856 | Ga0495676_0022882 | |||
| 2857 | Ga0495676_0043295 | |||
| 2858 | Ga0495680_0001158 | |||
| 2859 | Ga0495680_0004994 | |||
| 2860 | Ga0495680_0018635 | |||
| 2861 | Ga0495680_0045333 | |||
| 2862 | Ga0495687_002979 | |||
| 2863 | Ga0495675_0000421 | |||
| 2864 | Ga0495675_0019971 | |||
| 2865 | Ga0495675_0042692 | |||
| 2866 | Ga0495684_0000017 | |||
| 2867 | Ga0495684_0005969 | |||
| 2868 | Ga0495686_0031844 | |||
| 2869 | Ga0495593_0001934 | |||
| 2870 | Ga0495593_0002939 | |||
| 2871 | Ga0495593_0007003 | |||
| 2872 | Ga0495602_0000040 | |||
| 2873 | Ga0495602_0010632 | |||
| 2874 | Ga0495602_0021510 | |||
| 2875 | Ga0495602_0091484 | |||
| 2876 | Ga0495614_0001218 | |||
| 2877 | Ga0496100_0003494 | |||
| 2878 | Ga0496101_0000632 | |||
| 2879 | Ga0496101_0003925 | |||
| 2880 | Ga0496101_0004328 | |||
| 2881 | Ga0496101_0030518 | |||
| 2882 | Ga0496101_0057906 | |||
| 2883 | Ga0496102_0003407 | |||
| 2884 | Ga0496102_0004162 | |||
| 2885 | Ga0496102_0006945 | |||
| 2886 | Ga0496102_0013514 | |||
| 2887 | Ga0496102_0021970 | |||
| 2888 | Ga0496102_0043051 | |||
| 2889 | Ga0496103_0000817 | |||
| 2890 | Ga0496103_0022568 | |||
| 2891 | Ga0496103_0053903 | |||
| 2892 | Ga0496104_0000055 | |||
| 2893 | Ga0496104_0000819 | |||
| 2894 | Ga0496104_0003719 | |||
| 2895 | Ga0496104_0009707 | |||
| 2896 | Ga0496104_0035201 | |||
| 2897 | Ga0496104_0039755 | |||
| 2898 | Ga0496104_0040773 | |||
| 2899 | Ga0496104_0047304 | |||
| 2900 | Ga0496104_0070290 | |||
| 2901 | Ga0496104_0108994 | |||
| 2902 | Ga0496105_0001352 | |||
| 2903 | Ga0496105_0001979 | |||
| 2904 | Ga0496105_0003022 | |||
| 2905 | Ga0496105_0003563 | |||
| 2906 | Ga0496105_0023369 | |||
| 2907 | Ga0496105_0036626 | |||
| 2908 | Ga0496105_0049968 | |||
| 2909 | Ga0496105_0074109 | |||
| 2910 | Ga0496106_0000038 | |||
| 2911 | Ga0496106_0000317 | |||
| 2912 | Ga0496106_0002333 | |||
| 2913 | Ga0496106_0004679 | |||
| 2914 | Ga0496106_0007191 | |||
| 2915 | Ga0496106_0010888 | |||
| 2916 | Ga0496106_0019230 | |||
| 2917 | Ga0496106_0043769 | |||
| 2918 | Ga0496106_0047722 | |||
| 2919 | Ga0496106_0100181 | |||
| 2920 | Ga0496107_0001599 | |||
| 2921 | Ga0496107_0006515 | |||
| 2922 | Ga0496107_0008440 | |||
| 2923 | Ga0496107_0013735 | |||
| 2924 | Ga0496107_0018740 | |||
| 2925 | Ga0496107_0032930 | |||
| 2926 | Ga0496108_0000333 | |||
| 2927 | Ga0496108_0000774 | |||
| 2928 | Ga0496108_0005307 | |||
| 2929 | Ga0496108_0009655 | |||
| 2930 | Ga0496108_0029948 | |||
| 2931 | Ga0496108_0038067 | |||
| 2932 | Ga0496108_0078303 | |||
| 2933 | Ga0496108_0084837 | |||
| 2934 | Ga0496108_0182672 | |||
| 2935 | Ga0496109_0000725 | |||
| 2936 | Ga0496109_0001051 | |||
| 2937 | Ga0496109_0001271 | |||
| 2938 | Ga0496109_0001849 | |||
| 2939 | Ga0496109_0061984 | |||
| 2940 | Ga0496109_0068880 | |||
| 2941 | Ga0496109_0068939 | |||
| 2942 | Ga0496109_0082300 | |||
| 2943 | Ga0496109_0103333 | |||
| 2944 | Ga0496109_0193492 | |||
| 2945 | Ga0496110_0000247 | |||
| 2946 | Ga0496110_0009317 | |||
| 2947 | Ga0496110_0043599 | |||
| 2948 | Ga0496110_0044345 | |||
| 2949 | Ga0496110_0057214 | |||
| 2950 | Ga0496110_0078306 | |||
| 2951 | Ga0496110_0193133 | |||
| 2952 | Ga0496111_0005481 | |||
| 2953 | Ga0496111_0131205 | |||
| 2954 | Ga0496112_0000650 | |||
| 2955 | Ga0496112_0007620 | |||
| 2956 | Ga0496112_0013272 | |||
| 2957 | Ga0496112_0015252 | |||
| 2958 | Ga0496112_0025299 | |||
| 2959 | Ga0496112_0030959 | |||
| 2960 | Ga0496112_0034454 | |||
| 2961 | Ga0496112_0056605 | |||
| 2962 | Ga0496112_0063718 | |||
| 2963 | Ga0496112_0070475 | |||
| 2964 | Ga0496112_0099202 | |||
| 2965 | Ga0496113_0000194 | |||
| 2966 | Ga0496113_0002472 | |||
| 2967 | Ga0496113_0017691 | |||
| 2968 | Ga0496113_0018724 | |||
| 2969 | Ga0496113_0020287 | |||
| 2970 | Ga0496113_0101077 | |||
| 2971 | Ga0496113_0193072 | |||
| 2972 | Ga0496114_0000528 | |||
| 2973 | Ga0496114_0007580 | |||
| 2974 | Ga0496114_0013565 | |||
| 2975 | Ga0496114_0014530 | |||
| 2976 | Ga0496114_0015647 | |||
| 2977 | Ga0496114_0017054 | |||
| 2978 | Ga0496114_0040713 | |||
| 2979 | Ga0496115_0000805 | |||
| 2980 | Ga0496115_0001826 | |||
| 2981 | Ga0496115_0018100 | |||
| 2982 | Ga0496115_0030454 | |||
| 2983 | Ga0496115_0034067 | |||
| 2984 | Ga0496115_0041163 | |||
| 2985 | Ga0496115_0048552 | |||
| 2986 | Ga0496115_0054688 | |||
| 2987 | Ga0496115_0069377 | |||
| 2988 | Ga0496116_0033274 | |||
| 2989 | Ga0496117_0040538 | |||
| 2990 | Ga0496118_0015279 | |||
| 2991 | Ga0496118_0047822 | |||
| 2992 | Ga0496119_0018666 | |||
| 2993 | Ga0496119_0020298 | |||
| 2994 | Ga0496120_0015388 | |||
| 2995 | Ga0496120_0017816 | |||
| 2996 | Ga0496121_0055198 | |||
| 2997 | Ga0496121_0065839 | |||
| 2998 | Ga0496122_0007420 | |||
| 2999 | Ga0496123_0024542 | |||
| 3000 | Ga0496124_0045487 | |||
| 3001 | Ga0496125_0028124 | |||
| 3002 | Ga0496125_0059330 | |||
| 3003 | Ga0496126_0049594 | |||
| 3004 | Ga0496126_0067816 | |||
| 3005 | Ga0501031_0004595 | |||
| 3006 | Ga0501031_0019545 | |||
| 3007 | Ga0501031_0025220 | |||
| 3008 | Ga0501032_0000057 | |||
| 3009 | Ga0501032_0013303 | |||
| 3010 | Ga0501032_0020752 | |||
| 3011 | Ga0501032_0031108 | |||
| 3012 | Ga0501033_0010978 | |||
| 3013 | Ga0501033_0022046 | |||
| 3014 | Ga0501033_0046006 | |||
| 3015 | Ga0501033_0081737 | |||
| 3016 | Ga0501034_0000001 | |||
| 3017 | Ga0501034_0000197 | |||
| 3018 | Ga0501034_0012498 | |||
| 3019 | Ga0501034_0013138 | |||
| 3020 | Ga0501034_0022589 | |||
| 3021 | Ga0501034_0039334 | |||
| 3022 | Ga0501034_0057397 | |||
| 3023 | Ga0501034_0072482 | |||
| 3024 | Ga0501036_0001853 | |||
| 3025 | Ga0501036_0003456 | |||
| 3026 | Ga0501036_0004036 | |||
| 3027 | Ga0501036_0006334 | |||
| 3028 | Ga0501036_0011132 | |||
| 3029 | Ga0501036_0017310 | |||
| 3030 | Ga0501036_0017721 | |||
| 3031 | Ga0501037_0002950 | |||
| 3032 | Ga0501037_0006072 | |||
| 3033 | Ga0501037_0010639 | |||
| 3034 | Ga0501037_0026383 | |||
| 3035 | Ga0501038_0001372 | |||
| 3036 | Ga0501038_0001640 | |||
| 3037 | Ga0501038_0015750 | |||
| 3038 | Ga0501038_0016511 | |||
| 3039 | Ga0501038_0032537 | |||
| 3040 | Ga0501038_0049711 | |||
| 3041 | Ga0501038_0077642 | |||
| 3042 | Ga0501038_0078050 | |||
| 3043 | Ga0501038_0109001 | |||
| 3044 | Ga0501039_0000001 | |||
| 3045 | Ga0501039_0000723 | |||
| 3046 | Ga0501039_0030818 | |||
| 3047 | Ga0501039_0114518 | |||
| 3048 | Ga0501040_0000492 | |||
| 3049 | Ga0501040_0003036 | |||
| 3050 | Ga0501040_0012450 | |||
| 3051 | Ga0501040_0110176 | |||
| 3052 | Ga0501041_0000249 | |||
| 3053 | Ga0501041_0025000 | |||
| 3054 | Ga0501041_0035034 | |||
| 3055 | Ga0501042_0023400 | |||
| 3056 | Ga0501042_0094475 | |||
| 3057 | Ga0501043_0003859 | |||
| 3058 | Ga0501043_0012502 | |||
| 3059 | Ga0501043_0022003 | |||
| 3060 | Ga0501043_0036364 | |||
| 3061 | Ga0501043_0069057 | |||
| 3062 | Ga0501043_0114973 | |||
| 3063 | Ga0501046_0001144 | |||
| 3064 | Ga0501046_0002082 | |||
| 3065 | Ga0501046_0006820 | |||
| 3066 | Ga0501046_0009657 | |||
| 3067 | Ga0501046_0012841 | |||
| 3068 | Ga0501046_0020221 | |||
| 3069 | Ga0501046_0067232 | |||
| 3070 | Ga0501047_0000186 | |||
| 3071 | Ga0501047_0004626 | |||
| 3072 | Ga0501047_0007571 | |||
| 3073 | Ga0501047_0008844 | |||
| 3074 | Ga0501047_0016780 | |||
| 3075 | Ga0501047_0065850 | |||
| 3076 | Ga0501048_0000754 | |||
| 3077 | Ga0501048_0001614 | |||
| 3078 | Ga0501048_0005050 | |||
| 3079 | Ga0501048_0010444 | |||
| 3080 | Ga0501048_0018769 | |||
| 3081 | Ga0501048_0064395 | |||
| 3082 | Ga0501067_0001373 | |||
| 3083 | Ga0501067_0001787 | |||
| 3084 | Ga0501067_0006481 | |||
| 3085 | Ga0501067_0016632 | |||
| 3086 | Ga0501067_0044779 | |||
| 3087 | Ga0501068_0002740 | |||
| 3088 | Ga0501068_0005934 | |||
| 3089 | Ga0501068_0010969 | |||
| 3090 | Ga0501068_0021180 | |||
| 3091 | Ga0501068_0027014 | |||
| 3092 | Ga0501068_0037228 | |||
| 3093 | Ga0501068_0055980 | |||
| 3094 | Ga0501069_0000649 | |||
| 3095 | Ga0501069_0071844 | |||
| 3096 | Ga0501070_0001518 | |||
| 3097 | Ga0501070_0005823 | |||
| 3098 | Ga0501070_0006155 | |||
| 3099 | Ga0501070_0022748 | |||
| 3100 | Ga0501070_0052449 | |||
| 3101 | Ga0501070_0064414 | |||
| 3102 | Ga0501070_0144593 | |||
| 3103 | Ga0501071_0000026 | |||
| 3104 | Ga0501071_0004990 | |||
| 3105 | Ga0501071_0008878 | |||
| 3106 | Ga0501071_0015552 | |||
| 3107 | Ga0501071_0025349 | |||
| 3108 | Ga0501071_0045239 | |||
| 3109 | Ga0501071_0067374 | |||
| 3110 | Ga0501071_0078474 | |||
| 3111 | Ga0501072_0000376 | |||
| 3112 | Ga0501072_0001954 | |||
| 3113 | Ga0501072_0003598 | |||
| 3114 | Ga0501072_0009338 | |||
| 3115 | Ga0501072_0011310 | |||
| 3116 | Ga0501072_0025207 | |||
| 3117 | Ga0501072_0030796 | |||
| 3118 | Ga0501073_0004401 | |||
| 3119 | Ga0501073_0026398 | |||
| 3120 | Ga0501073_0034265 | |||
| 3121 | Ga0501073_0056814 | |||
| 3122 | Ga0501074_0003816 | |||
| 3123 | Ga0501074_0008911 | |||
| 3124 | Ga0501074_0055765 | |||
| 3125 | Ga0501075_0000066 | |||
| 3126 | Ga0501075_0000177 | |||
| 3127 | Ga0501075_0001334 | |||
| 3128 | Ga0501075_0025663 | |||
| 3129 | Ga0501075_0049337 | |||
| 3130 | Ga0501075_0054088 | |||
| 3131 | Ga0501075_0073208 | |||
| 3132 | Ga0501075_0104219 | |||
| 3133 | Ga0501076_0000014 | |||
| 3134 | Ga0501076_0000017 | |||
| 3135 | Ga0501076_0025777 | |||
| 3136 | Ga0501076_0032698 | |||
| 3137 | Ga0501076_0036056 | |||
| 3138 | Ga0501076_0062665 | |||
| 3139 | Ga0501076_0085346 | |||
| 3140 | Ga0501077_0000762 | |||
| 3141 | Ga0501077_0041998 | |||
| 3142 | Ga0501079_0000198 | |||
| 3143 | Ga0501079_0002291 | |||
| 3144 | Ga0501079_0010985 | |||
| 3145 | Ga0501079_0023591 | |||
| 3146 | Ga0501079_0025843 | |||
| 3147 | Ga0501079_0037996 | |||
| 3148 | Ga0501079_0070833 | |||
| 3149 | Ga0501079_0137125 | |||
| 3150 | Ga0501080_0000299 | |||
| 3151 | Ga0501080_0003003 | |||
| 3152 | Ga0501080_0006266 | |||
| 3153 | Ga0501080_0016524 | |||
| 3154 | Ga0501080_0043429 | |||
| 3155 | Ga0501080_0054757 | |||
| 3156 | Ga0501080_0057543 | |||
| 3157 | Ga0501080_0066335 | |||
| 3158 | Ga0501080_0095297 | |||
| 3159 | Ga0501080_0100237 | |||
| 3160 | Ga0501080_0120368 | |||
| 3161 | Ga0501080_0186332 | |||
| 3162 | Ga0501081_0000011 | |||
| 3163 | Ga0501081_0006493 | |||
| 3164 | Ga0501081_0025161 | |||
| 3165 | Ga0501081_0042781 | |||
| 3166 | Ga0501083_0000302 | |||
| 3167 | Ga0501083_0001803 | |||
| 3168 | Ga0501083_0003405 | |||
| 3169 | Ga0501083_0022725 | |||
| 3170 | Ga0501083_0037571 | |||
| 3171 | Ga0501083_0045144 | |||
| 3172 | Ga0501035_0004131 | |||
| 3173 | Ga0501035_0005245 | |||
| 3174 | Ga0501035_0007363 | |||
| 3175 | Ga0501035_0045974 | |||
| 3176 | Ga0501035_0050619 | |||
| 3177 | Ga0501035_0133010 | |||
| 3178 | Ga0501044_0000351 | |||
| 3179 | Ga0501044_0000911 | |||
| 3180 | Ga0501044_0021553 | |||
| 3181 | Ga0501044_0025277 | |||
| 3182 | Ga0501044_0034803 | |||
| 3183 | Ga0501044_0115408 | |||
| 3184 | Ga0501045_0000024 | |||
| 3185 | Ga0501045_0004661 | |||
| 3186 | Ga0501045_0007737 | |||
| 3187 | Ga0501045_0011432 | |||
| 3188 | Ga0501045_0013216 | |||
| 3189 | nmdc:mga03683_30751_c1 | |||
| 3190 | nmdc:mga00v17_48769_c1 | |||
| 3191 | nmdc:mga00v17_8594_c1 | |||
| 3192 | nmdc:mga0yw44_17931_c1 | |||
| 3193 | nmdc:mga0yw44_2917_c1 | |||
| 3194 | nmdc:mga0yw44_59210_c1 | |||
| 3195 | nmdc:mga06z11_2386_c1 | |||
| 3196 | nmdc:mga06z11_5389_c1 | |||
| 3197 | nmdc:mga07m45_24460_c1 | |||
| 3198 | nmdc:mga05p37_109485_c1 | |||
| 3199 | nmdc:mga05p37_117960_c1 | |||
| 3200 | nmdc:mga05p37_1804_c1 | |||
| 3201 | nmdc:mga05p37_42716_c1 | |||
| 3202 | nmdc:mga05p37_4816_c1 | |||
| 3203 | nmdc:mga05p37_504_c1 | |||
| 3204 | nmdc:mga05p37_57442_c1 | |||
| 3205 | nmdc:mga05p37_58470_c1 | |||
| 3206 | nmdc:mga05p37_9789_c1 | |||
| 3207 | nmdc:mga09592_1129_c1 | |||
| 3208 | nmdc:mga09592_4406_c1 | |||
| 3209 | nmdc:mga09592_69026_c1 | |||
| 3210 | nmdc:mga09592_97511_c1 | |||
| 3211 | nmdc:mga0qj67_1353_c1 | |||
| 3212 | nmdc:mga0qj67_19786_c1 | |||
| 3213 | nmdc:mga0qj67_34384_c1 | |||
| 3214 | nmdc:mga06r32_4483_c1 | |||
| 3215 | nmdc:mga06r32_4623_c1 | |||
| 3216 | nmdc:mga06r32_64_c1 | |||
| 3217 | nmdc:mga06r32_79498_c1 | |||
| 3218 | nmdc:mga06r32_81008_c1 | |||
| 3219 | nmdc:mga08y16_110767_c1 | |||
| 3220 | nmdc:mga08y16_110927_c1 | |||
| 3221 | nmdc:mga08y16_131869_c1 | |||
| 3222 | nmdc:mga08y16_242035_c1 | |||
| 3223 | nmdc:mga08y16_2535_c1 | |||
| 3224 | nmdc:mga08y16_3182_c1 | |||
| 3225 | nmdc:mga08y16_329_c1 | |||
| 3226 | nmdc:mga08y16_74672_c1 | |||
| 3227 | nmdc:mga08y16_978_c1 | |||
| 3228 | nmdc:mga0n895_109653_c1 | |||
| 3229 | nmdc:mga0n895_156100_c1 | |||
| 3230 | nmdc:mga0n895_18884_c1 | |||
| 3231 | nmdc:mga0n895_1891_c1 | |||
| 3232 | nmdc:mga0n895_25009_c1 | |||
| 3233 | nmdc:mga0n895_296637_c1 | |||
| 3234 | nmdc:mga0n895_5225_c1 | |||
| 3235 | nmdc:mga0n895_8473_c1 | |||
| 3236 | nmdc:mga0rr50_10792_c1 | |||
| 3237 | nmdc:mga0rr50_30294_c1 | |||
| 3238 | nmdc:mga08x19_66_c1 | |||
| 3239 | nmdc:mga08x19_71624_c1 | |||
| 3240 | nmdc:mga0a205_205275_c1 | |||
| 3241 | nmdc:mga0a205_720_c1 | |||
| 3242 | nmdc:mga0a205_8828_c1 | |||
| 3243 | Ga0495601_0000018 | |||
| 3244 | Ga0495601_0000352 | |||
| 3245 | Ga0495601_0000411 | |||
| 3246 | Ga0495601_0000699 | |||
| 3247 | Ga0495601_0051389 | |||
| 3248 | Ga0495612_0000011 | |||
| 3249 | Ga0495612_0002427 | |||
| 3250 | Ga0495612_0004316 | |||
| 3251 | Ga0495595_0000016 | |||
| 3252 | Ga0495595_0006803 | |||
| 3253 | Ga0495595_0008161 | |||
| 3254 | Ga0495619_0000014 | |||
| 3255 | Ga0495619_0000085 | |||
| 3256 | Ga0495619_0000442 | |||
| 3257 | Ga0495619_0000536 | |||
| 3258 | Ga0495619_0001217 | |||
| 3259 | Ga0495619_0036059 | |||
| 3260 | Ga0495619_0061498 | |||
| 3261 | Ga0500643_001371 | |||
| 3262 | Ga0500644_0003061 | |||
| 3263 | Ga0500651_0007290 | |||
| 3264 | Ga0500651_0023699 | |||
| 3265 | Ga0500566_0031609 | |||
| 3266 | Ga0500641_0005527 | |||
| 3267 | Ga0500641_0007451 | |||
| 3268 | Ga0500556_0000033 | |||
| 3269 | Ga0500562_000165 | |||
| 3270 | Ga0500595_000024 | |||
| 3271 | Ga0500595_000485 | |||
| 3272 | Ga0500642_0000750 | |||
| 3273 | Ga0500642_0007045 | |||
| 3274 | Ga0500642_0007474 | |||
| 3275 | Ga0500652_001115 | |||
| 3276 | Ga0500559_0008307 | |||
| 3277 | Ga0500568_0006160 | |||
| 3278 | Ga0500616_0001013 | |||
| 3279 | Ga0500616_0002129 | |||
| 3280 | Ga0500616_0019916 | |||
| 3281 | Ga0500622_0000170 | |||
| 3282 | Ga0500633_0005215 | |||
| 3283 | Ga0500636_0039555 | |||
| 3284 | Ga0500645_000102 | |||
| 3285 | Ga0501084_0000521 | |||
| 3286 | Ga0501084_0018649 | |||
| 3287 | Ga0501084_0019959 | |||
| 3288 | Ga0501084_0022684 | |||
| 3289 | Ga0501084_0028373 | |||
| 3290 | Ga0501084_0028920 | |||
| 3291 | Ga0501084_0031629 | |||
| 3292 | Ga0501084_0049361 | |||
| 3293 | Ga0501084_0051500 | |||
| 3294 | Ga0501084_0099887 | |||
| 3295 | Ga0501084_0100522 | |||
| 3296 | Ga0501084_0158814 | |||
| 3297 | Ga0501082_0000032 | |||
| 3298 | Ga0501082_0001048 | |||
| 3299 | Ga0501082_0001819 | |||
| 3300 | Ga0501082_0002113 | |||
| 3301 | Ga0501082_0003499 | |||
| 3302 | Ga0501082_0004521 | |||
| 3303 | Ga0501082_0008508 | |||
| 3304 | Ga0501082_0013032 | |||
| 3305 | Ga0501082_0015627 | |||
| 3306 | Ga0501082_0015680 | |||
| 3307 | Ga0501082_0033328 | |||
| 3308 | Ga0501082_0040850 | |||
| 3309 | Ga0501082_0049060 | |||
| 3310 | Ga0501082_0155412 | |||
| 3311 | Ga0530510_0000034 | |||
| 3312 | Ga0530510_0000045 | |||
| 3313 | Ga0530510_0007968 | |||
| 3314 | Ga0530510_0008501 | |||
| 3315 | Ga0530510_0010050 | |||
| 3316 | Ga0530510_0023426 | |||
| 3317 | Ga0530510_0030671 | |||
| 3318 | 2509144830 | |||
| 3319 | 2510133093 | |||
| 3320 | 2510894451 | |||
| 3321 | 2510899477 | |||
| 3322 | 2511195827 | |||
| 3323 | 2511389783 | |||
| 3324 | 2512034014 | |||
| 3325 | 2512931362 | |||
| 3326 | 2512959192 | |||
| 3327 | 2512970775 | |||
| 3328 | 2513575107 | |||
| 3329 | 2513591736 | |||
| 3330 | 2513604182 | |||
| 3331 | 2513635567 | |||
| 3332 | 2513713491 | |||
| 3333 | 2513985323 | |||
| 3334 | 2514006469 | |||
| 3335 | 2514021892 | |||
| 3336 | 2514033770 | |||
| 3337 | 2515112052 | |||
| 3338 | 2515635523 | |||
| 3339 | 2515660143 | |||
| 3340 | 2515738793 | |||
| 3341 | 2517035781 | |||
| 3342 | 2517076185 | |||
| 3343 | 2517094930 | |||
| 3344 | 2517406576 | |||
| 3345 | 2517570254 | |||
| 3346 | 2523102911 | |||
| 3347 | 2524001114 | |||
| 3348 | 2535485092 | |||
| 3349 | 2535520788 | |||
| 3350 | 2585222534 | |||
| 3351 | 2585402709 | |||
| 3352 | 2585528341 | |||
| 3353 | 2585545117 | |||
| 3354 | 2597813124 | |||
| 3355 | 2599101568 | |||
| 3356 | 2599936636 | |||
| 3357 | 2600194307 | |||
| 3358 | 2643755235 | |||
| 3359 | 2643803180 | |||
| 3360 | 2644004336 | |||
| 3361 | 2644063541 | |||
| 3362 | 2644107368 | |||
| 3363 | 2644150935 | |||
| 3364 | 2644308763 | |||
| 3365 | 2644335580 | |||
| 3366 | 2644374825 | |||
| 3367 | 2644414304 | |||
| 3368 | 2644447832 | |||
| 3369 | 2644539986 | |||
| 3370 | 2644614704 | |||
| 3371 | 2644676167 | |||
| 3372 | 2644690305 | |||
| 3373 | 2725952812 | |||
| 3374 | 2738948857 | |||
| 3375 | 2753359718 | |||
| 3376 | 2753461960 | |||
| 3377 | 2758641977 | |||
| 3378 | 2765464695 | |||
| 3379 | 2766062960 | |||
| 3380 | 2770195372 | |||
| 3381 | 2776258811 | |||
| 3382 | 2776270686 | |||
| 3383 | 2776280491 | |||
| 3384 | 2792749370 | |||
| 3385 | 2793280354 | |||
| 3386 | 2793344131 | |||
| 3387 | 2802719949 | |||
| 3388 | 2802727118 | |||
| 3389 | 2802731880 | |||
| 3390 | 2802739211 | |||
| 3391 | 2802745809 | |||
| 3392 | 2802752411 | |||
| 3393 | 2828307226 | |||
| 3394 | 2837681390 | |||
| 3395 | 2838681857 | |||
| 3396 | 2838689258 | |||
| 3397 | 2838696428 | |||
| 3398 | 2838710332 | |||
| 3399 | 2838730606 | |||
| 3400 | 2838743547 | |||
| 3401 | 2839996963 | |||
| 3402 | 2840767483 | |||
| 3403 | 2841739317 | |||
| 3404 | 2841854777 | |||
| 3405 | 2842078507 | |||
| 3406 | 2842110715 | |||
| 3407 | 2842118985 | |||
| 3408 | 2842157640 | |||
| 3409 | 2842164838 | |||
| 3410 | 2842180775 | |||
| 3411 | 2842222932 | |||
| 3412 | 2842231167 | |||
| 3413 | 2842239744 | |||
| 3414 | 2842244726 | |||
| 3415 | 2842258539 | |||
| 3416 | 2842273278 | |||
| 3417 | 2842292168 | |||
| 3418 | 2842310060 | |||
| 3419 | 2842336205 | |||
| 3420 | 2842372423 | |||
| 3421 | 2842378565 | |||
| 3422 | 2842385494 | |||
| 3423 | 2842695555 | |||
| 3424 | 2842871880 | |||
| 3425 | 2844166650 | |||
| 3426 | 2844459387 | |||
| 3427 | 2846953707 | |||
| 3428 | 2848860109 | |||
| 3429 | 2854912364 | |||
| 3430 | 2856347398 | |||
| 3431 | 2856369578 | |||
| 3432 | 2857518498 | |||
| 3433 | 2869167132 | |||
| 3434 | 2869244729 | |||
| 3435 | 2869286068 | |||
| 3436 | 2871434501 | |||
| 3437 | 2871479531 | |||
| 3438 | 2874149705 | |||
| 3439 | 2874157965 | |||
| 3440 | 2876369423 | |||
| 3441 | 2876416169 | |||
| 3442 | 2878751634 | |||
| 3443 | 2878792660 | |||
| 3444 | 2882636400 | |||
| 3445 | 2883293081 | |||
| 3446 | 2883356081 | |||
| 3447 | 2885317878 | |||
| 3448 | 2888346930 | |||
| 3449 | 2889793906 | |||
| 3450 | 2889916876 | |||
| 3451 | 2891052156 | |||
| 3452 | 2894656059 | |||
| 3453 | 2897804250 | |||
| 3454 | 2903451459 | |||
| 3455 | 2903504579 | |||
| 3456 | 2903522970 | |||
| 3457 | 2903534570 | |||
| 3458 | 2904580688 | |||
| 3459 | 2906314032 | |||
| 3460 | 2906327198 | |||
| 3461 | 2909044213 | |||
| 3462 | 2913313730 | |||
| 3463 | 2915653104 | |||
| 3464 | 2915981360 | |||
| 3465 | 2916064246 | |||
| 3466 | 2916182489 | |||
| 3467 | 2917557237 | |||
| 3468 | 2919106420 | |||
| 3469 | 2919121598 | |||
| 3470 | 2919454248 | |||
| 3471 | 2919501033 | |||
| 3472 | 2920825132 | |||
| 3473 | 2921252007 | |||
| 3474 | 2924757214 | |||
| 3475 | 2928523811 | |||
| 3476 | 2933576579 | |||
| 3477 | 2933586741 | |||
| 3478 | 2935897715 | |||
| 3479 | 2935904516 | |||
| 3480 | 2936372953 | |||
| 3481 | 2936381108 | |||
| 3482 | 2936386727 | |||
| 3483 | 2937030206 | |||
| 3484 | 2937042586 | |||
| 3485 | 2937080356 | |||
| 3486 | 2937085535 | |||
| 3487 | 2937815858 | |||
| 3488 | 2937824594 | |||
| 3489 | 2937838108 | |||
| 3490 | 2937853053 | |||
| 3491 | 2941502217 | |||
| 3492 | 2954016096 | |||
| 3493 | 2957376465 | |||
| 3494 | 2957439825 | |||
| 3495 | 2958078086 | |||
| 3496 | 2958130467 | |||
| 3497 | 2958184672 | |||
| 3498 | 2960592005 | |||
| 3499 | 2960631966 | |||
| 3500 | 2960681541 | |||
| 3501 | 2960698124 | |||
| 3502 | 2961082839 | |||
| 3503 | 2963647853 | |||
| 3504 | 2967688888 | |||
| 3505 | 2967729077 | |||
| 3506 | 2968085992 | |||
| 3507 | 2970030361 | |||
| 3508 | 2970127034 | |||
| 3509 | 2970146183 | |||
| 3510 | 2970528728 | |||
| 3511 | 2970539642 | |||
| 3512 | 2970540752 | |||
| 3513 | 2977534353 | |||
| 3514 | 2977547720 | |||
| 3515 | 2977846093 | |||
| 3516 | 2977924356 | |||
| 3517 | 2977991547 | |||
| 3518 | 2989774216 | |||
| 3519 | 3002144693 | |||
| 3520 | 3004216090 | |||
| 3521 | 3004223840 | |||
| 3522 | 3004334205 | |||
| 3523 | 3005409775 | |||
| 3524 | 3005448187 | |||
| 3525 | 3005454706 | |||
| 3526 | 637074466 | |||
| 3527 | 639648323 | |||
| 3528 | 646813981 | |||
| 3529 | 8001848086 | |||
| 3530 | 8002061074 | |||
| 3531 | 8004001716 | |||
| 3532 | 8004393522 | |||
| 3533 | 8004401923 | |||
| 3534 | 8004638287 | |||
| 3535 | 8004720290 | |||
| 3536 | 8005314303 | |||
| 3537 | 8005378968 | |||
| 3538 | 8005462710 | |||
| 3539 | 8005546939 | |||
| 3540 | 8005557947 | |||
| 3541 | 8005569121 | |||
| 3542 | 8005659105 | |||
| 3543 | 8018168274 | |||
| 3544 | 8023681121 | |||
| 3545 | 8024485928 | |||
| 3546 | 8045864652 | |||
| 3547 | 8054004500 | |||
| 3548 | 8054565854 | |||
| 3549 | 8055620900 | |||
| 3550 | 8057875300 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7u25-assembly1.cif.gz_A | crystal structure of arabidopsis thaliana acetohydroxyacid synthase w574l mutant in complex with bispyribac-sodium | 0.9641 | 3 | 567 |
| 8et5-assembly1.cif.gz_A | crystal structure of arabidopsis thaliana acetohydroxyacid synthase s653t mutant in complex with amidosulfuron | 0.9618 | 3 | 567 |
| 6lpi-assembly3.cif.gz_C | crystal structure of ahas holo-enzyme | 0.9567 | 3 | 566 |
| 6lpi-assembly3.cif.gz_C | crystal structure of ahas holo-enzyme | 0.955 | 3 | 566 |
| 6lpi-assembly1.cif.gz_A | crystal structure of ahas holo-enzyme | 0.9529 | 3 | 566 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0DP89_1_170_3.40.50.970 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains | 0.9792 | 5 | 174 | 3.40.50.970 |
| af_P0DP89_182_327_3.40.50.1220 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain | 0.9785 | 191 | 332 | 3.40.50.1220 |
| af_D2DJQ3_61_255_3.40.50.970 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains | 0.9718 | 3 | 184 | 3.40.50.970 |
| af_P0DP89_1_170_3.40.50.970 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains | 0.9679 | 5 | 174 | 3.40.50.970 |
| af_O53554_1_171_3.40.50.970 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains | 0.966 | 5 | 171 | 3.40.50.970 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3D3WI84-F1-model_v4 | Acetolactate synthase 3 large subunit | 0.9946 | 196 | 297 |
GO:0000287
GO:0003984 GO:0005948 GO:0009097 GO:0009099 GO:0030976 GO:0050660 |
| AF-A0A355QQB0-F1-model_v4 | deleted | 0.9919 | 1 | 486 |
|
| AF-A0A0Q2UGK0-F1-model_v4 | Acetolactate synthase (EC 2.2.1.6) | 0.9909 | 1 | 586 |
GO:0000287
GO:0003984 GO:0005948 GO:0009097 GO:0009099 GO:0030976 GO:0050660 |
| AF-A0A529UW25-F1-model_v4 | deleted | 0.9908 | 3 | 158 |
|
| AF-A0A7C0XMZ8-F1-model_v4 | Acetolactate synthase (EC 2.2.1.6) | 0.9903 | 3 | 435 |
GO:0000287
GO:0003984 GO:0005948 GO:0009097 GO:0009099 GO:0030976 GO:0050660 |