F495663
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1776 | 626 | 3552 | 228 |
Family's Representative Sequence
| Representative Sequence | 3300003659|JGI25404J52841_10030344|JGI25404J52841_100303441 |
| Length | 281 |
| Sequence | MLRVPVMTRLFRYAPDFALRVINRLLCRTGSVLLIPRPDSGGHFKTSIDMAKDTTGRLHVTVKTGGKRKLSSKLWLERQLNDPYVAKAKRDGYRSRAAYKLIEMDDKYRFLKPGIAVVDLGAAPGGWSQIAAKRVGAVNGKGKVAAIDLLEMPEIPGVDFAQLDFLAEDAPEKLIAMMGGRADVVMSDMAANTTGHRKTDQLRIIGLVESAAAFAADVLNPGGTFLAKVFQSGADAELVAQLKRDFASVRHVKPASSRQDSSERYVLAMGFRGQPDRPIEP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 2 | 2010549000 | Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes | Metagenome | Endosphere |
| 3 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 4 | 3300000532 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled | Metagenome | Rhizosphere |
| 5 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 6 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 7 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 8 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 9 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 10 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 11 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 12 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 13 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 14 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 15 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 16 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 17 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 23 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 27 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 37 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 50 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 56 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 62 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 64 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 65 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 66 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 68 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 69 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 70 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 71 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 72 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 73 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 74 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 75 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 76 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 77 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 78 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 79 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 80 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 81 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 82 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 84 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 85 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 86 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 87 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 88 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 89 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 90 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 91 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 92 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 93 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 94 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 96 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 97 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 98 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 99 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 100 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 101 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 102 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 103 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 104 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 106 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 107 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 108 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 109 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 110 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 125 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 138 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 143 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 144 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 145 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 146 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 147 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 148 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 149 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 155 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 157 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 224 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 225 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 226 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 227 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 228 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 229 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 233 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 234 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 235 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 236 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 237 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 238 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 239 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 240 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 241 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 242 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 243 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 244 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 245 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 246 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 247 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 248 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 249 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 250 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 251 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 252 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 253 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 254 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 255 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 256 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 257 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 258 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 259 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 260 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 261 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 262 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 263 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 264 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 265 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 266 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 267 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 268 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 269 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 270 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 271 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 272 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 273 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 274 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 275 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 276 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 277 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 278 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 279 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 280 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 281 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 282 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 283 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 284 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 285 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 286 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 287 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 288 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 289 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 290 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 291 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 292 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 293 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 294 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 295 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 296 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 297 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 298 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 299 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 300 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 301 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 302 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 303 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 304 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 305 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 306 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 307 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 308 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 309 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 310 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 311 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 312 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 313 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 314 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 315 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 316 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 317 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 402 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 403 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 404 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 405 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 406 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 407 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 408 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 409 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 410 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 411 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 412 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 413 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 414 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 415 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 416 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 417 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 418 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 419 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 420 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 421 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 422 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 423 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 424 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 425 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 426 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 427 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 428 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 430 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 431 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 432 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 433 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 434 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 435 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 436 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 437 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 438 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 439 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 440 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 441 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 442 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 443 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 444 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 445 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 446 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 447 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 448 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 449 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 450 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 451 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 452 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 453 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 454 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 455 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 456 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 457 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 458 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 459 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 460 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 461 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 462 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 463 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 464 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 465 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 466 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 467 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 468 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 469 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 470 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 471 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 472 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 473 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 474 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 475 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 476 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 477 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 478 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 479 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 480 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 481 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 482 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 483 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 484 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 485 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 486 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 487 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 488 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 489 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 490 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 491 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 492 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 493 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 494 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 495 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 496 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 497 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 498 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 499 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 500 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 501 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 502 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 503 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 504 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 505 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 506 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 507 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 508 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 509 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 510 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 511 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 512 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 513 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 514 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 515 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 516 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 517 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 518 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 519 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 520 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 521 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 522 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 523 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 524 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 525 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 526 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 527 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 528 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 529 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 530 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 531 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 532 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 533 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 534 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 535 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 536 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 537 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 538 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 539 | 2791355199 | |||
| 540 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 541 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 542 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 543 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 544 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 545 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 546 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 547 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 548 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 549 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 550 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 551 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 552 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 553 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 554 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 555 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 556 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 557 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 558 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 559 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 560 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 561 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 562 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 563 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 564 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 565 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 566 | 2904699407 | |||
| 567 | 2906610324 | |||
| 568 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 569 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 570 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 571 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 572 | 2919450847 | Ancylobacter sp. 3268 | Isolate | Rhizosphere |
| 573 | 2922368715 | |||
| 574 | 2922425934 | |||
| 575 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 576 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 577 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 578 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 579 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 580 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 581 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 582 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 583 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 584 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 585 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 586 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 587 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 588 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 589 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 590 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 591 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 592 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 593 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 594 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 595 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 596 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 597 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 598 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 599 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 600 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 601 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 602 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 603 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 604 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 605 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 606 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 607 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 608 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 609 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 610 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 611 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 612 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 613 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 614 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 615 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 616 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 617 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 618 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 619 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 620 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 621 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 622 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 623 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 624 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 625 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 626 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.58 |
| Metatranscriptomes | 0.06 |
| Isolates | 5.36 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.09 |
| Nodule | 5.18 |
| Rhizoplane | 6.19 |
| Rhizosphere | 70.44 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25404J52841_10030344 | 3300003659 | Bacteria | 1158 |
| 2 | RicEn_C9014 | 2010549000 | Bacteria | 1771 |
| 3 | MBSR1b_contig_11443562 | 2162886012 | Bacteria | 983 |
| 4 | MBSR1b_contig_12173630 | 2162886012 | Bacteria | 998 |
| 5 | CNAas_1004010 | 3300000532 | Bacteria | 955 |
| 6 | JGI24740J21852_10015785 | 3300001979 | Bacteria | 2746 |
| 7 | JGI24739J22299_10029215 | 3300001989 | Bacteria | 1918 |
| 8 | JGI24737J22298_10006476 | 3300001990 | Bacteria | 3998 |
| 9 | JGI24735J21928_10007461 | 3300002067 | Bacteria | 3566 |
| 10 | JGI24744J21845_10042665 | 3300002077 | Bacteria | 846 |
| 11 | JGI25406J46586_10000047 | 3300003203 | Bacteria | 54770 |
| 12 | JGI25153J46596_10001251 | 3300003215 | Bacteria | 15286 |
| 13 | JGI25153J46596_10002613 | 3300003215 | Bacteria | 10304 |
| 14 | JGI25153J46596_10002759 | 3300003215 | Bacteria | 9992 |
| 15 | JGI25153J46596_10005940 | 3300003215 | Bacteria | 6291 |
| 16 | JGI25160J50197_1002757 | 3300003354 | Bacteria | 8051 |
| 17 | JGI25160J50197_1032891 | 3300003354 | Bacteria | 1312 |
| 18 | JGI25404J52841_10010459 | 3300003659 | Bacteria | 1995 |
| 19 | JGI25404J52841_10019235 | 3300003659 | Bacteria | 1479 |
| 20 | Ga0055531_10022839 | 3300003794 | Bacteria | 2368 |
| 21 | Ga0065165_1000231 | 3300005262 | Bacteria | 97237 |
| 22 | Ga0065165_1001895 | 3300005262 | Bacteria | 20125 |
| 23 | Ga0065712_10231883 | 3300005290 | Bacteria | 991 |
| 24 | Ga0065715_10160419 | 3300005293 | Bacteria | 1635 |
| 25 | Ga0070658_10165438 | 3300005327 | Bacteria | 1857 |
| 26 | Ga0070658_10194684 | 3300005327 | Bacteria | 1709 |
| 27 | Ga0070658_10207247 | 3300005327 | Bacteria | 1655 |
| 28 | Ga0070658_10344647 | 3300005327 | Bacteria | 1275 |
| 29 | Ga0070658_10370198 | 3300005327 | Bacteria | 1228 |
| 30 | Ga0070658_10637307 | 3300005327 | Bacteria | 924 |
| 31 | Ga0070676_10114075 | 3300005328 | Bacteria | 1687 |
| 32 | Ga0070676_10124974 | 3300005328 | Bacteria | 1620 |
| 33 | Ga0070676_10169066 | 3300005328 | Bacteria | 1412 |
| 34 | Ga0070676_10216748 | 3300005328 | Bacteria | 1262 |
| 35 | Ga0070676_10245939 | 3300005328 | Bacteria | 1192 |
| 36 | Ga0070683_100015898 | 3300005329 | Bacteria | 6621 |
| 37 | Ga0070683_100087298 | 3300005329 | Bacteria | 2925 |
| 38 | Ga0070683_100090477 | 3300005329 | Bacteria | 2873 |
| 39 | Ga0070670_100002084 | 3300005331 | Bacteria | 16387 |
| 40 | Ga0070670_100018067 | 3300005331 | Bacteria | 6052 |
| 41 | Ga0070670_100113796 | 3300005331 | Bacteria | 2333 |
| 42 | Ga0070670_100127870 | 3300005331 | Bacteria | 2193 |
| 43 | Ga0070670_100153040 | 3300005331 | Bacteria | 1996 |
| 44 | Ga0070670_100171499 | 3300005331 | Bacteria | 1882 |
| 45 | Ga0070677_10060360 | 3300005333 | Bacteria | 1562 |
| 46 | Ga0070677_10086571 | 3300005333 | Bacteria | 1354 |
| 47 | Ga0068869_100022270 | 3300005334 | Bacteria | 4364 |
| 48 | Ga0068869_100030572 | 3300005334 | Bacteria | 3782 |
| 49 | Ga0068869_100055456 | 3300005334 | Bacteria | 2888 |
| 50 | Ga0068869_100119055 | 3300005334 | Bacteria | 2017 |
| 51 | Ga0070666_10001973 | 3300005335 | Bacteria | 12500 |
| 52 | Ga0070680_100055713 | 3300005336 | Bacteria | 3231 |
| 53 | Ga0070680_100125785 | 3300005336 | Bacteria | 2142 |
| 54 | Ga0070680_100169644 | 3300005336 | Bacteria | 1836 |
| 55 | Ga0070680_100477499 | 3300005336 | Bacteria | 1065 |
| 56 | Ga0070682_100617722 | 3300005337 | Bacteria | 858 |
| 57 | Ga0068868_100025524 | 3300005338 | Bacteria | 4496 |
| 58 | Ga0068868_100109714 | 3300005338 | Bacteria | 2241 |
| 59 | Ga0068868_100197211 | 3300005338 | Bacteria | 1677 |
| 60 | Ga0068868_100254272 | 3300005338 | Bacteria | 1479 |
| 61 | Ga0068868_100590422 | 3300005338 | Bacteria | 983 |
| 62 | Ga0070689_100055865 | 3300005340 | Bacteria | 3060 |
| 63 | Ga0070689_100311686 | 3300005340 | Bacteria | 1312 |
| 64 | Ga0070687_100262463 | 3300005343 | Bacteria | 1079 |
| 65 | Ga0070661_100017395 | 3300005344 | Bacteria | 5100 |
| 66 | Ga0070661_100357733 | 3300005344 | Bacteria | 1147 |
| 67 | Ga0070661_100521967 | 3300005344 | Bacteria | 953 |
| 68 | Ga0070668_100002309 | 3300005347 | Bacteria | 14048 |
| 69 | Ga0070668_100048482 | 3300005347 | Bacteria | 3267 |
| 70 | Ga0070668_100051684 | 3300005347 | Bacteria | 3167 |
| 71 | Ga0070668_100054079 | 3300005347 | Bacteria | 3096 |
| 72 | Ga0070668_100066405 | 3300005347 | Bacteria | 2799 |
| 73 | Ga0070668_100086847 | 3300005347 | Bacteria | 2460 |
| 74 | Ga0070668_100138652 | 3300005347 | Bacteria | 1958 |
| 75 | Ga0070668_100154631 | 3300005347 | Bacteria | 1857 |
| 76 | Ga0070668_100194541 | 3300005347 | Bacteria | 1662 |
| 77 | Ga0070669_100012022 | 3300005353 | Bacteria | 6141 |
| 78 | Ga0070669_100086727 | 3300005353 | Bacteria | 2339 |
| 79 | Ga0070669_100305981 | 3300005353 | Bacteria | 1280 |
| 80 | Ga0070669_100309468 | 3300005353 | Bacteria | 1273 |
| 81 | Ga0070669_100727184 | 3300005353 | Bacteria | 840 |
| 82 | Ga0070675_100012309 | 3300005354 | Bacteria | 6704 |
| 83 | Ga0070675_100171402 | 3300005354 | Bacteria | 1872 |
| 84 | Ga0070675_100394506 | 3300005354 | Bacteria | 1234 |
| 85 | Ga0070675_100616539 | 3300005354 | Bacteria | 985 |
| 86 | Ga0070671_100081489 | 3300005355 | Bacteria | 2706 |
| 87 | Ga0070671_100256534 | 3300005355 | Bacteria | 1486 |
| 88 | Ga0070674_100058334 | 3300005356 | Bacteria | 2683 |
| 89 | Ga0070674_100066308 | 3300005356 | Bacteria | 2536 |
| 90 | Ga0070674_100093562 | 3300005356 | Bacteria | 2175 |
| 91 | Ga0070673_100033023 | 3300005364 | Bacteria | 3903 |
| 92 | Ga0070688_100042310 | 3300005365 | Bacteria | 2801 |
| 93 | Ga0070688_100089017 | 3300005365 | Bacteria | 2014 |
| 94 | Ga0070688_100345454 | 3300005365 | Bacteria | 1088 |
| 95 | Ga0070688_100347563 | 3300005365 | Bacteria | 1085 |
| 96 | Ga0070659_100053564 | 3300005366 | Bacteria | 3176 |
| 97 | Ga0070659_100086855 | 3300005366 | Bacteria | 2504 |
| 98 | Ga0070659_100173060 | 3300005366 | Bacteria | 1769 |
| 99 | Ga0070659_100248514 | 3300005366 | Bacteria | 1474 |
| 100 | Ga0070667_100000717 | 3300005367 | Bacteria | 31904 |
| 101 | Ga0070667_100002487 | 3300005367 | Bacteria | 16080 |
| 102 | Ga0070667_100066866 | 3300005367 | Bacteria | 3055 |
| 103 | Ga0070667_100123547 | 3300005367 | Bacteria | 2254 |
| 104 | Ga0070667_100243371 | 3300005367 | Bacteria | 1607 |
| 105 | Ga0070709_10022117 | 3300005434 | Bacteria | 3715 |
| 106 | Ga0070709_10073503 | 3300005434 | Bacteria | 2213 |
| 107 | Ga0070714_100094761 | 3300005435 | Bacteria | 2621 |
| 108 | Ga0070714_100119588 | 3300005435 | Bacteria | 2342 |
| 109 | Ga0070714_100134340 | 3300005435 | Bacteria | 2214 |
| 110 | Ga0070714_100269266 | 3300005435 | Bacteria | 1579 |
| 111 | Ga0070713_100012226 | 3300005436 | Bacteria | 6288 |
| 112 | Ga0070713_100017595 | 3300005436 | Bacteria | 5410 |
| 113 | Ga0070713_100031275 | 3300005436 | Bacteria | 4239 |
| 114 | Ga0070713_100056841 | 3300005436 | Bacteria | 3255 |
| 115 | Ga0070713_100322617 | 3300005436 | Bacteria | 1427 |
| 116 | Ga0070713_100438726 | 3300005436 | Bacteria | 1225 |
| 117 | Ga0070713_100439077 | 3300005436 | Bacteria | 1224 |
| 118 | Ga0070710_10001119 | 3300005437 | Bacteria | 12688 |
| 119 | Ga0070710_10008886 | 3300005437 | Bacteria | 4903 |
| 120 | Ga0070711_100002712 | 3300005439 | Bacteria | 10159 |
| 121 | Ga0070711_100009524 | 3300005439 | Bacteria | 5989 |
| 122 | Ga0070711_100010921 | 3300005439 | Bacteria | 5631 |
| 123 | Ga0070711_100011141 | 3300005439 | Bacteria | 5578 |
| 124 | Ga0070711_100745116 | 3300005439 | Bacteria | 827 |
| 125 | Ga0070711_100855811 | 3300005439 | Bacteria | 774 |
| 126 | Ga0070705_100232952 | 3300005440 | Bacteria | 1282 |
| 127 | Ga0070663_100015227 | 3300005455 | Bacteria | 4958 |
| 128 | Ga0070663_100051820 | 3300005455 | Bacteria | 2926 |
| 129 | Ga0070663_100062227 | 3300005455 | Bacteria | 2690 |
| 130 | Ga0070663_100152888 | 3300005455 | Bacteria | 1771 |
| 131 | Ga0070663_100164430 | 3300005455 | Bacteria | 1710 |
| 132 | Ga0070663_100213032 | 3300005455 | Bacteria | 1513 |
| 133 | Ga0070663_100324666 | 3300005455 | Bacteria | 1239 |
| 134 | Ga0070663_100357832 | 3300005455 | Bacteria | 1183 |
| 135 | Ga0070663_100383908 | 3300005455 | Bacteria | 1145 |
| 136 | Ga0070663_100569587 | 3300005455 | Bacteria | 949 |
| 137 | Ga0070678_100063529 | 3300005456 | Bacteria | 2732 |
| 138 | Ga0070678_100064365 | 3300005456 | Bacteria | 2717 |
| 139 | Ga0070678_100089137 | 3300005456 | Bacteria | 2360 |
| 140 | Ga0070678_100122526 | 3300005456 | Bacteria | 2053 |
| 141 | Ga0070678_100600104 | 3300005456 | Bacteria | 983 |
| 142 | Ga0070678_100609639 | 3300005456 | Bacteria | 975 |
| 143 | Ga0070662_100209541 | 3300005457 | Bacteria | 1550 |
| 144 | Ga0070662_100287692 | 3300005457 | Bacteria | 1331 |
| 145 | Ga0070662_100303939 | 3300005457 | Bacteria | 1297 |
| 146 | Ga0070662_100392978 | 3300005457 | Bacteria | 1143 |
| 147 | Ga0070662_100767566 | 3300005457 | Bacteria | 818 |
| 148 | Ga0070681_10042518 | 3300005458 | Bacteria | 4553 |
| 149 | Ga0070681_10520516 | 3300005458 | Bacteria | 1103 |
| 150 | Ga0068867_100002382 | 3300005459 | Bacteria | 13218 |
| 151 | Ga0068867_100106659 | 3300005459 | Bacteria | 2146 |
| 152 | Ga0068867_100110721 | 3300005459 | Bacteria | 2110 |
| 153 | Ga0068867_100184555 | 3300005459 | Bacteria | 1660 |
| 154 | Ga0068867_100497686 | 3300005459 | Bacteria | 1047 |
| 155 | Ga0070685_10058405 | 3300005466 | Bacteria | 2249 |
| 156 | Ga0070685_10263209 | 3300005466 | Bacteria | 1147 |
| 157 | Ga0070698_100299253 | 3300005471 | Bacteria | 1539 |
| 158 | Ga0070699_100064968 | 3300005518 | Bacteria | 3165 |
| 159 | Ga0070679_100691351 | 3300005530 | Bacteria | 963 |
| 160 | Ga0070684_100009002 | 3300005535 | Bacteria | 7843 |
| 161 | Ga0070684_100094774 | 3300005535 | Bacteria | 2659 |
| 162 | Ga0070684_100098651 | 3300005535 | Bacteria | 2606 |
| 163 | Ga0068853_100008769 | 3300005539 | Bacteria | 8134 |
| 164 | Ga0068853_100093792 | 3300005539 | Bacteria | 2643 |
| 165 | Ga0068853_100113245 | 3300005539 | Bacteria | 2412 |
| 166 | Ga0068853_100372887 | 3300005539 | Bacteria | 1332 |
| 167 | Ga0068853_100462143 | 3300005539 | Bacteria | 1195 |
| 168 | Ga0070672_100002140 | 3300005543 | Bacteria | 12464 |
| 169 | Ga0070672_100018833 | 3300005543 | Bacteria | 4999 |
| 170 | Ga0070672_100084879 | 3300005543 | Bacteria | 2544 |
| 171 | Ga0070672_100223410 | 3300005543 | Bacteria | 1580 |
| 172 | Ga0070672_100248799 | 3300005543 | Bacteria | 1497 |
| 173 | Ga0070695_100161572 | 3300005545 | Bacteria | 1573 |
| 174 | Ga0070693_100070672 | 3300005547 | Bacteria | 2054 |
| 175 | Ga0070693_100092518 | 3300005547 | Bacteria | 1826 |
| 176 | Ga0070693_100509863 | 3300005547 | Bacteria | 855 |
| 177 | Ga0070665_100010979 | 3300005548 | Bacteria | 9158 |
| 178 | Ga0070665_100025000 | 3300005548 | Bacteria | 6021 |
| 179 | Ga0070665_100033934 | 3300005548 | Bacteria | 5133 |
| 180 | Ga0070665_100051133 | 3300005548 | Bacteria | 4145 |
| 181 | Ga0070665_100116171 | 3300005548 | Bacteria | 2678 |
| 182 | Ga0070665_100290413 | 3300005548 | Bacteria | 1637 |
| 183 | Ga0070665_100902553 | 3300005548 | Bacteria | 896 |
| 184 | Ga0070704_100508401 | 3300005549 | Bacteria | 1047 |
| 185 | Ga0068855_100018065 | 3300005563 | Bacteria | 8475 |
| 186 | Ga0068855_100033896 | 3300005563 | Bacteria | 6091 |
| 187 | Ga0068855_100058388 | 3300005563 | Bacteria | 4519 |
| 188 | Ga0068855_100110620 | 3300005563 | Bacteria | 3153 |
| 189 | Ga0068855_100134302 | 3300005563 | Bacteria | 2823 |
| 190 | Ga0068855_100150475 | 3300005563 | Bacteria | 2647 |
| 191 | Ga0068855_100235716 | 3300005563 | Bacteria | 2047 |
| 192 | Ga0068855_100240817 | 3300005563 | Bacteria | 2022 |
| 193 | Ga0068855_100384354 | 3300005563 | Bacteria | 1541 |
| 194 | Ga0070664_100012841 | 3300005564 | Bacteria | 6813 |
| 195 | Ga0070664_100479462 | 3300005564 | Bacteria | 1144 |
| 196 | Ga0070664_100492018 | 3300005564 | Bacteria | 1130 |
| 197 | Ga0068857_100007461 | 3300005577 | Bacteria | 9412 |
| 198 | Ga0068857_100011475 | 3300005577 | Bacteria | 7708 |
| 199 | Ga0068857_100017624 | 3300005577 | Bacteria | 6261 |
| 200 | Ga0068857_100028310 | 3300005577 | Bacteria | 4944 |
| 201 | Ga0068854_100027763 | 3300005578 | Bacteria | 3904 |
| 202 | Ga0068854_100036078 | 3300005578 | Bacteria | 3464 |
| 203 | Ga0068854_100160752 | 3300005578 | Bacteria | 1739 |
| 204 | Ga0068854_100184747 | 3300005578 | Bacteria | 1630 |
| 205 | Ga0068854_100881687 | 3300005578 | Bacteria | 785 |
| 206 | Ga0068856_100000020 | 3300005614 | Bacteria | 146775 |
| 207 | Ga0068856_100018098 | 3300005614 | Bacteria | 6831 |
| 208 | Ga0068856_100026301 | 3300005614 | Bacteria | 5674 |
| 209 | Ga0068856_100040303 | 3300005614 | Bacteria | 4587 |
| 210 | Ga0068856_100077346 | 3300005614 | Bacteria | 3297 |
| 211 | Ga0068856_100146436 | 3300005614 | Bacteria | 2369 |
| 212 | Ga0068856_100242967 | 3300005614 | Bacteria | 1816 |
| 213 | Ga0068856_100469858 | 3300005614 | Bacteria | 1278 |
| 214 | Ga0068856_100861800 | 3300005614 | Bacteria | 925 |
| 215 | Ga0068856_100880146 | 3300005614 | Bacteria | 915 |
| 216 | Ga0070702_100132032 | 3300005615 | Bacteria | 1579 |
| 217 | Ga0068852_100013378 | 3300005616 | Bacteria | 6280 |
| 218 | Ga0068852_100031347 | 3300005616 | Bacteria | 4386 |
| 219 | Ga0068852_100038673 | 3300005616 | Bacteria | 4011 |
| 220 | Ga0068852_100180689 | 3300005616 | Bacteria | 1984 |
| 221 | Ga0068852_100184449 | 3300005616 | Bacteria | 1964 |
| 222 | Ga0068852_100733175 | 3300005616 | Bacteria | 1000 |
| 223 | Ga0068859_100003527 | 3300005617 | Bacteria | 15930 |
| 224 | Ga0068859_100006173 | 3300005617 | Bacteria | 12177 |
| 225 | Ga0068859_100072923 | 3300005617 | Bacteria | 3471 |
| 226 | Ga0068859_100144919 | 3300005617 | Bacteria | 2449 |
| 227 | Ga0068859_100306737 | 3300005617 | Bacteria | 1681 |
| 228 | Ga0068859_100351852 | 3300005617 | Bacteria | 1568 |
| 229 | Ga0068864_100004761 | 3300005618 | Bacteria | 11119 |
| 230 | Ga0068864_100150503 | 3300005618 | Bacteria | 2108 |
| 231 | Ga0068864_100261260 | 3300005618 | Bacteria | 1611 |
| 232 | Ga0068864_100629097 | 3300005618 | Bacteria | 1044 |
| 233 | Ga0068866_10122401 | 3300005718 | Bacteria | 1468 |
| 234 | Ga0068866_10122460 | 3300005718 | Bacteria | 1467 |
| 235 | Ga0068861_100016661 | 3300005719 | Bacteria | 5204 |
| 236 | Ga0068861_100038919 | 3300005719 | Bacteria | 3546 |
| 237 | Ga0068861_100196324 | 3300005719 | Bacteria | 1691 |
| 238 | Ga0068861_100387494 | 3300005719 | Bacteria | 1236 |
| 239 | Ga0068861_100433784 | 3300005719 | Bacteria | 1173 |
| 240 | Ga0068861_100741319 | 3300005719 | Bacteria | 917 |
| 241 | Ga0068851_10064709 | 3300005834 | Bacteria | 1880 |
| 242 | Ga0068870_10035764 | 3300005840 | Bacteria | 2551 |
| 243 | Ga0068863_100002512 | 3300005841 | Bacteria | 18221 |
| 244 | Ga0068863_100141628 | 3300005841 | Bacteria | 2298 |
| 245 | Ga0068863_100154091 | 3300005841 | Bacteria | 2200 |
| 246 | Ga0068863_100627486 | 3300005841 | Bacteria | 1065 |
| 247 | Ga0068863_100747614 | 3300005841 | Bacteria | 974 |
| 248 | Ga0068858_100015036 | 3300005842 | Bacteria | 7281 |
| 249 | Ga0068858_100015457 | 3300005842 | Bacteria | 7178 |
| 250 | Ga0068858_100071113 | 3300005842 | Bacteria | 3226 |
| 251 | Ga0068858_100238546 | 3300005842 | Bacteria | 1725 |
| 252 | Ga0068858_100314077 | 3300005842 | Bacteria | 1497 |
| 253 | Ga0068860_100004964 | 3300005843 | Bacteria | 13559 |
| 254 | Ga0068860_100016614 | 3300005843 | Bacteria | 7177 |
| 255 | Ga0068860_100134343 | 3300005843 | Bacteria | 2376 |
| 256 | Ga0068860_100186064 | 3300005843 | Bacteria | 2008 |
| 257 | Ga0068862_100053426 | 3300005844 | Bacteria | 3458 |
| 258 | Ga0068862_100136416 | 3300005844 | Bacteria | 2174 |
| 259 | Ga0068862_100151638 | 3300005844 | Bacteria | 2063 |
| 260 | Ga0068862_100281455 | 3300005844 | Bacteria | 1524 |
| 261 | Ga0068862_100622576 | 3300005844 | Bacteria | 1038 |
| 262 | Ga0081455_10011418 | 3300005937 | Bacteria | 8927 |
| 263 | Ga0081455_10015893 | 3300005937 | Bacteria | 7286 |
| 264 | Ga0081455_10019603 | 3300005937 | Bacteria | 6391 |
| 265 | Ga0081455_10107769 | 3300005937 | Bacteria | 2220 |
| 266 | Ga0081455_10185143 | 3300005937 | Bacteria | 1573 |
| 267 | Ga0081455_10256787 | 3300005937 | Bacteria | 1275 |
| 268 | Ga0081538_10020678 | 3300005981 | Bacteria | 4833 |
| 269 | Ga0081538_10035977 | 3300005981 | Bacteria | 3241 |
| 270 | Ga0081538_10088860 | 3300005981 | Bacteria | 1606 |
| 271 | Ga0081540_1002344 | 3300005983 | Bacteria | 15503 |
| 272 | Ga0081540_1002625 | 3300005983 | Bacteria | 14612 |
| 273 | Ga0081540_1002868 | 3300005983 | Bacteria | 13938 |
| 274 | Ga0081540_1003998 | 3300005983 | Bacteria | 11431 |
| 275 | Ga0081540_1004409 | 3300005983 | Bacteria | 10741 |
| 276 | Ga0081540_1009104 | 3300005983 | Bacteria | 6859 |
| 277 | Ga0081540_1011513 | 3300005983 | Bacteria | 5910 |
| 278 | Ga0081540_1011628 | 3300005983 | Bacteria | 5870 |
| 279 | Ga0081540_1079725 | 3300005983 | Bacteria | 1479 |
| 280 | Ga0081539_10000140 | 3300005985 | Bacteria | 166746 |
| 281 | Ga0081539_10002339 | 3300005985 | Bacteria | 27248 |
| 282 | Ga0081539_10013499 | 3300005985 | Bacteria | 6149 |
| 283 | Ga0081539_10216929 | 3300005985 | Bacteria | 873 |
| 284 | Ga0070717_10006527 | 3300006028 | Bacteria | 8585 |
| 285 | Ga0070717_10006998 | 3300006028 | Bacteria | 8347 |
| 286 | Ga0070717_10186429 | 3300006028 | Bacteria | 1811 |
| 287 | Ga0070717_10339744 | 3300006028 | Bacteria | 1341 |
| 288 | Ga0070717_10650840 | 3300006028 | Bacteria | 956 |
| 289 | Ga0075365_10011414 | 3300006038 | Bacteria | 5223 |
| 290 | Ga0075365_10029922 | 3300006038 | Bacteria | 3484 |
| 291 | Ga0075365_10130201 | 3300006038 | Bacteria | 1741 |
| 292 | Ga0075365_10157299 | 3300006038 | Bacteria | 1582 |
| 293 | Ga0075365_10163822 | 3300006038 | Bacteria | 1550 |
| 294 | Ga0075365_10383542 | 3300006038 | Bacteria | 991 |
| 295 | Ga0075368_10028834 | 3300006042 | Bacteria | 2145 |
| 296 | Ga0075363_100036824 | 3300006048 | Bacteria | 2567 |
| 297 | Ga0075364_10003703 | 3300006051 | Bacteria | 8724 |
| 298 | Ga0075364_10072947 | 3300006051 | Bacteria | 2262 |
| 299 | Ga0075364_10119027 | 3300006051 | Bacteria | 1767 |
| 300 | Ga0075364_10180568 | 3300006051 | Bacteria | 1428 |
| 301 | Ga0070715_10008241 | 3300006163 | Bacteria | 3625 |
| 302 | Ga0070716_100008528 | 3300006173 | Bacteria | 5090 |
| 303 | Ga0070716_100023937 | 3300006173 | Bacteria | 3246 |
| 304 | Ga0070716_100041086 | 3300006173 | Bacteria | 2575 |
| 305 | Ga0070716_100288551 | 3300006173 | Bacteria | 1136 |
| 306 | Ga0070712_100046680 | 3300006175 | Bacteria | 2995 |
| 307 | Ga0070712_100306568 | 3300006175 | Bacteria | 1287 |
| 308 | Ga0075362_10000936 | 3300006177 | Bacteria | 8910 |
| 309 | Ga0075362_10010211 | 3300006177 | Bacteria | 3659 |
| 310 | Ga0075367_10032354 | 3300006178 | Bacteria | 3009 |
| 311 | Ga0075367_10054501 | 3300006178 | Bacteria | 2371 |
| 312 | Ga0075367_10168671 | 3300006178 | Bacteria | 1363 |
| 313 | Ga0075367_10300260 | 3300006178 | Bacteria | 1011 |
| 314 | Ga0075367_10321027 | 3300006178 | Bacteria | 976 |
| 315 | Ga0075369_10027395 | 3300006186 | Bacteria | 2382 |
| 316 | Ga0075369_10042391 | 3300006186 | Bacteria | 1951 |
| 317 | Ga0075369_10103873 | 3300006186 | Bacteria | 1277 |
| 318 | Ga0075369_10124081 | 3300006186 | Bacteria | 1170 |
| 319 | Ga0075366_10018977 | 3300006195 | Bacteria | 3975 |
| 320 | Ga0075366_10083204 | 3300006195 | Bacteria | 1913 |
| 321 | Ga0075366_10084065 | 3300006195 | Bacteria | 1903 |
| 322 | Ga0097621_100005789 | 3300006237 | Bacteria | 8727 |
| 323 | Ga0075370_10040001 | 3300006353 | Bacteria | 2643 |
| 324 | Ga0075370_10053825 | 3300006353 | Bacteria | 2284 |
| 325 | Ga0075370_10166004 | 3300006353 | Bacteria | 1297 |
| 326 | Ga0075370_10234330 | 3300006353 | Bacteria | 1086 |
| 327 | Ga0068871_100000813 | 3300006358 | Bacteria | 20955 |
| 328 | Ga0068871_100130759 | 3300006358 | Bacteria | 2128 |
| 329 | Ga0068871_100219261 | 3300006358 | Bacteria | 1647 |
| 330 | Ga0068871_100272918 | 3300006358 | Bacteria | 1478 |
| 331 | Ga0075428_100703330 | 3300006844 | Bacteria | 1076 |
| 332 | Ga0075428_100833846 | 3300006844 | Bacteria | 979 |
| 333 | Ga0075430_100037645 | 3300006846 | Bacteria | 4100 |
| 334 | Ga0075431_100000053 | 3300006847 | Bacteria | 62977 |
| 335 | Ga0075431_100077710 | 3300006847 | Bacteria | 3426 |
| 336 | Ga0075433_10931035 | 3300006852 | Bacteria | 758 |
| 337 | Ga0075434_100008412 | 3300006871 | Bacteria | 9595 |
| 338 | Ga0075434_100443215 | 3300006871 | Bacteria | 1320 |
| 339 | Ga0075434_100487130 | 3300006871 | Bacteria | 1254 |
| 340 | Ga0075429_100004405 | 3300006880 | Bacteria | 12101 |
| 341 | Ga0068865_100055402 | 3300006881 | Bacteria | 2758 |
| 342 | Ga0068865_100079979 | 3300006881 | Bacteria | 2342 |
| 343 | Ga0068865_100136475 | 3300006881 | Bacteria | 1844 |
| 344 | Ga0068865_100220517 | 3300006881 | Bacteria | 1482 |
| 345 | Ga0097620_100003527 | 3300006931 | Bacteria | 15930 |
| 346 | Ga0097620_100006173 | 3300006931 | Bacteria | 12177 |
| 347 | Ga0097620_100072924 | 3300006931 | Bacteria | 3471 |
| 348 | Ga0097620_100144929 | 3300006931 | Bacteria | 2449 |
| 349 | Ga0097620_100306733 | 3300006931 | Bacteria | 1681 |
| 350 | Ga0097620_100351852 | 3300006931 | Bacteria | 1568 |
| 351 | Ga0097620_100369142 | 3300006931 | Bacteria | 1530 |
| 352 | Ga0099824_1027583 | 3300006942 | Bacteria | 2718 |
| 353 | Ga0099822_1018498 | 3300006943 | Bacteria | 7243 |
| 354 | Ga0099823_1041378 | 3300006944 | Bacteria | 3281 |
| 355 | Ga0075435_100106719 | 3300007076 | Bacteria | 2326 |
| 356 | Ga0075435_100175049 | 3300007076 | Bacteria | 1812 |
| 357 | Ga0075435_100592884 | 3300007076 | Bacteria | 961 |
| 358 | Ga0099795_10001696 | 3300007788 | Bacteria | 4893 |
| 359 | Ga0099795_10024080 | 3300007788 | Bacteria | 2026 |
| 360 | Ga0105244_10168463 | 3300009036 | Bacteria | 1043 |
| 361 | Ga0105250_10178674 | 3300009092 | Bacteria | 890 |
| 362 | Ga0105240_10024133 | 3300009093 | Bacteria | 8026 |
| 363 | Ga0105240_10024314 | 3300009093 | Bacteria | 7990 |
| 364 | Ga0105240_10036283 | 3300009093 | Bacteria | 6343 |
| 365 | Ga0105240_10056335 | 3300009093 | Bacteria | 4919 |
| 366 | Ga0105240_10259071 | 3300009093 | Bacteria | 2007 |
| 367 | Ga0105240_10477877 | 3300009093 | Bacteria | 1390 |
| 368 | Ga0105240_10719906 | 3300009093 | Bacteria | 1088 |
| 369 | Ga0111539_10001519 | 3300009094 | Bacteria | 30945 |
| 370 | Ga0111539_10482233 | 3300009094 | Bacteria | 1444 |
| 371 | Ga0105245_10127220 | 3300009098 | Bacteria | 2386 |
| 372 | Ga0105245_10206696 | 3300009098 | Bacteria | 1888 |
| 373 | Ga0105245_10268159 | 3300009098 | Bacteria | 1664 |
| 374 | Ga0105245_10449482 | 3300009098 | Bacteria | 1297 |
| 375 | Ga0105247_10047475 | 3300009101 | Bacteria | 2636 |
| 376 | Ga0105247_10068755 | 3300009101 | Bacteria | 2209 |
| 377 | Ga0105247_10085701 | 3300009101 | Bacteria | 1992 |
| 378 | Ga0105247_10270735 | 3300009101 | Bacteria | 1168 |
| 379 | Ga0105247_10349675 | 3300009101 | Bacteria | 1039 |
| 380 | Ga0105247_10448956 | 3300009101 | Bacteria | 929 |
| 381 | Ga0114129_10000237 | 3300009147 | Bacteria | 61463 |
| 382 | Ga0114129_10115255 | 3300009147 | Bacteria | 3704 |
| 383 | Ga0114129_10649821 | 3300009147 | Bacteria | 1361 |
| 384 | Ga0105243_10215572 | 3300009148 | Bacteria | 1693 |
| 385 | Ga0105243_10288253 | 3300009148 | Bacteria | 1482 |
| 386 | Ga0105243_10574995 | 3300009148 | Bacteria | 1081 |
| 387 | Ga0105243_10759037 | 3300009148 | Bacteria | 952 |
| 388 | Ga0105241_10005393 | 3300009174 | Bacteria | 9454 |
| 389 | Ga0105242_10415613 | 3300009176 | Bacteria | 1259 |
| 390 | Ga0105242_10910606 | 3300009176 | Bacteria | 880 |
| 391 | Ga0105248_10031493 | 3300009177 | Bacteria | 5928 |
| 392 | Ga0105248_10040960 | 3300009177 | Bacteria | 5194 |
| 393 | Ga0105248_10138684 | 3300009177 | Bacteria | 2743 |
| 394 | Ga0105248_10161950 | 3300009177 | Bacteria | 2523 |
| 395 | Ga0105248_10530924 | 3300009177 | Bacteria | 1327 |
| 396 | Ga0105248_10724907 | 3300009177 | Bacteria | 1122 |
| 397 | Ga0105248_10966468 | 3300009177 | Bacteria | 962 |
| 398 | Ga0105237_10032997 | 3300009545 | Bacteria | 5244 |
| 399 | Ga0105237_10039060 | 3300009545 | Bacteria | 4792 |
| 400 | Ga0105237_10049678 | 3300009545 | Bacteria | 4215 |
| 401 | Ga0105237_10060279 | 3300009545 | Bacteria | 3797 |
| 402 | Ga0105237_10131130 | 3300009545 | Bacteria | 2501 |
| 403 | Ga0105237_10326674 | 3300009545 | Bacteria | 1538 |
| 404 | Ga0105237_10544309 | 3300009545 | Bacteria | 1167 |
| 405 | Ga0105237_11291647 | 3300009545 | Bacteria | 736 |
| 406 | Ga0105238_10024393 | 3300009551 | Bacteria | 6165 |
| 407 | Ga0105238_10029388 | 3300009551 | Bacteria | 5600 |
| 408 | Ga0105238_10033691 | 3300009551 | Bacteria | 5211 |
| 409 | Ga0105238_10042528 | 3300009551 | Bacteria | 4600 |
| 410 | Ga0105238_11320721 | 3300009551 | Bacteria | 747 |
| 411 | Ga0105249_10104490 | 3300009553 | Bacteria | 2669 |
| 412 | Ga0105249_10177895 | 3300009553 | Bacteria | 2068 |
| 413 | Ga0105249_10572356 | 3300009553 | Bacteria | 1182 |
| 414 | Ga0099796_10098601 | 3300010159 | Bacteria | 1096 |
| 415 | Ga0099796_10165123 | 3300010159 | Bacteria | 880 |
| 416 | Ga0105239_10022985 | 3300010375 | Bacteria | 6874 |
| 417 | Ga0105239_10058272 | 3300010375 | Bacteria | 4238 |
| 418 | Ga0105239_10113597 | 3300010375 | Bacteria | 3003 |
| 419 | Ga0105239_10147331 | 3300010375 | Bacteria | 2626 |
| 420 | Ga0105239_10367642 | 3300010375 | Bacteria | 1625 |
| 421 | Ga0105239_10454692 | 3300010375 | Bacteria | 1453 |
| 422 | Ga0105239_10768292 | 3300010375 | Bacteria | 1103 |
| 423 | Ga0105239_11390993 | 3300010375 | Bacteria | 810 |
| 424 | Ga0105246_10045034 | 3300011119 | Bacteria | 3002 |
| 425 | Ga0105246_10501460 | 3300011119 | Bacteria | 1031 |
| 426 | Ga0105246_10734930 | 3300011119 | Bacteria | 869 |
| 427 | Ga0157373_10028400 | 3300013100 | Bacteria | 4035 |
| 428 | Ga0157370_10024117 | 3300013104 | Bacteria | 6030 |
| 429 | Ga0157370_10035604 | 3300013104 | Bacteria | 4836 |
| 430 | Ga0157370_10163274 | 3300013104 | Bacteria | 2072 |
| 431 | Ga0157369_10066878 | 3300013105 | Bacteria | 3866 |
| 432 | Ga0157369_10121671 | 3300013105 | Bacteria | 2769 |
| 433 | Ga0157369_10133599 | 3300013105 | Bacteria | 2628 |
| 434 | Ga0157369_10161906 | 3300013105 | Bacteria | 2362 |
| 435 | Ga0157374_10015540 | 3300013296 | Bacteria | 6677 |
| 436 | Ga0157374_10055850 | 3300013296 | Bacteria | 3686 |
| 437 | Ga0157374_10477331 | 3300013296 | Bacteria | 1250 |
| 438 | Ga0157374_11113050 | 3300013296 | Bacteria | 810 |
| 439 | Ga0157378_10040048 | 3300013297 | Bacteria | 4156 |
| 440 | Ga0157378_10222369 | 3300013297 | Bacteria | 1795 |
| 441 | Ga0157378_10223517 | 3300013297 | Bacteria | 1791 |
| 442 | Ga0163162_10010727 | 3300013306 | Bacteria | 8913 |
| 443 | Ga0163162_10099437 | 3300013306 | Bacteria | 3000 |
| 444 | Ga0163162_10207523 | 3300013306 | Bacteria | 2088 |
| 445 | Ga0163162_10321889 | 3300013306 | Bacteria | 1679 |
| 446 | Ga0163162_10464215 | 3300013306 | Bacteria | 1398 |
| 447 | Ga0163162_10828920 | 3300013306 | Bacteria | 1041 |
| 448 | Ga0157372_10021376 | 3300013307 | Bacteria | 6991 |
| 449 | Ga0157372_10051549 | 3300013307 | Bacteria | 4580 |
| 450 | Ga0157372_10140535 | 3300013307 | Bacteria | 2781 |
| 451 | Ga0157375_10013707 | 3300013308 | Bacteria | 7227 |
| 452 | Ga0157375_10087749 | 3300013308 | Bacteria | 3164 |
| 453 | Ga0157375_10225401 | 3300013308 | Bacteria | 2033 |
| 454 | Ga0157375_10298186 | 3300013308 | Bacteria | 1775 |
| 455 | Ga0157375_10367945 | 3300013308 | Bacteria | 1604 |
| 456 | Ga0157375_10373696 | 3300013308 | Bacteria | 1592 |
| 457 | Ga0163163_10044076 | 3300014325 | Bacteria | 4375 |
| 458 | Ga0163163_10056151 | 3300014325 | Bacteria | 3892 |
| 459 | Ga0163163_10202275 | 3300014325 | Bacteria | 2035 |
| 460 | Ga0163163_10453639 | 3300014325 | Bacteria | 1342 |
| 461 | Ga0163163_10629086 | 3300014325 | Bacteria | 1137 |
| 462 | Ga0163163_10672981 | 3300014325 | Bacteria | 1098 |
| 463 | Ga0157380_10035710 | 3300014326 | Bacteria | 3840 |
| 464 | Ga0157380_10136705 | 3300014326 | Bacteria | 2099 |
| 465 | Ga0157380_10143174 | 3300014326 | Bacteria | 2057 |
| 466 | Ga0157380_11240002 | 3300014326 | Bacteria | 791 |
| 467 | Ga0182008_10036255 | 3300014497 | Bacteria | 2468 |
| 468 | Ga0157377_10060620 | 3300014745 | Bacteria | 2160 |
| 469 | Ga0157377_10118916 | 3300014745 | Bacteria | 1599 |
| 470 | Ga0157379_10002865 | 3300014968 | Bacteria | 14544 |
| 471 | Ga0157379_10186976 | 3300014968 | Bacteria | 1872 |
| 472 | Ga0157376_10122766 | 3300014969 | Bacteria | 2305 |
| 473 | Ga0157376_10129606 | 3300014969 | Bacteria | 2249 |
| 474 | Ga0157376_11176721 | 3300014969 | Bacteria | 794 |
| 475 | Ga0163161_10025727 | 3300017792 | Bacteria | 4167 |
| 476 | Ga0163161_10026722 | 3300017792 | Bacteria | 4090 |
| 477 | Ga0163161_10125701 | 3300017792 | Bacteria | 1931 |
| 478 | Ga0214544_1000002 | 3300021320 | Bacteria | 753857 |
| 479 | Ga0214544_1034706 | 3300021320 | Bacteria | 1398 |
| 480 | Ga0214542_1000001 | 3300021321 | Bacteria | 1018696 |
| 481 | Ga0214542_1029424 | 3300021321 | Bacteria | 2249 |
| 482 | Ga0214545_1000001 | 3300021324 | Bacteria | 1092817 |
| 483 | Ga0214545_1021309 | 3300021324 | Bacteria | 4892 |
| 484 | Ga0214543_1000001 | 3300021327 | Bacteria | 776921 |
| 485 | Ga0214543_1038078 | 3300021327 | Bacteria | 1397 |
| 486 | Ga0213874_10022314 | 3300021377 | Bacteria | 1755 |
| 487 | Ga0213876_10073813 | 3300021384 | Bacteria | 1802 |
| 488 | Ga0213876_10252523 | 3300021384 | Bacteria | 937 |
| 489 | Ga0213871_10067354 | 3300021441 | Bacteria | 1006 |
| 490 | Ga0209563_101475 | 3300025230 | Bacteria | 6206 |
| 491 | Ga0209677_100463 | 3300025253 | Bacteria | 23384 |
| 492 | Ga0209148_1000428 | 3300025254 | Bacteria | 46613 |
| 493 | Ga0209233_1010958 | 3300025261 | Bacteria | 2689 |
| 494 | Ga0209233_1031691 | 3300025261 | Bacteria | 1231 |
| 495 | Ga0209455_1004564 | 3300025272 | Bacteria | 4493 |
| 496 | Ga0209455_1006717 | 3300025272 | Bacteria | 3360 |
| 497 | Ga0209564_1001578 | 3300025295 | Bacteria | 22285 |
| 498 | Ga0209564_1023388 | 3300025295 | Bacteria | 2149 |
| 499 | Ga0209564_1052192 | 3300025295 | Bacteria | 985 |
| 500 | Ga0209758_1000140 | 3300025297 | Bacteria | 174267 |
| 501 | Ga0209758_1000321 | 3300025297 | Bacteria | 92591 |
| 502 | Ga0209758_1001092 | 3300025297 | Bacteria | 35145 |
| 503 | Ga0209758_1002051 | 3300025297 | Bacteria | 21595 |
| 504 | Ga0209758_1002659 | 3300025297 | Bacteria | 17684 |
| 505 | Ga0209758_1003492 | 3300025297 | Bacteria | 14221 |
| 506 | Ga0209758_1003969 | 3300025297 | Bacteria | 12828 |
| 507 | Ga0209758_1094196 | 3300025297 | Bacteria | 869 |
| 508 | Ga0209256_1009946 | 3300025299 | Bacteria | 4075 |
| 509 | Ga0209256_1022829 | 3300025299 | Bacteria | 1883 |
| 510 | Ga0207426_1000278 | 3300025302 | Bacteria | 105775 |
| 511 | Ga0207426_1000378 | 3300025302 | Bacteria | 76958 |
| 512 | Ga0207426_1056124 | 3300025302 | Bacteria | 1151 |
| 513 | Ga0209257_1000522 | 3300025304 | Bacteria | 66723 |
| 514 | Ga0209257_1021097 | 3300025304 | Bacteria | 2379 |
| 515 | Ga0207697_10206400 | 3300025315 | Bacteria | 865 |
| 516 | Ga0207656_10010200 | 3300025321 | Bacteria | 3510 |
| 517 | Ga0207656_10058367 | 3300025321 | Bacteria | 1685 |
| 518 | Ga0207656_10295025 | 3300025321 | Bacteria | 802 |
| 519 | Ga0207682_10038991 | 3300025893 | Bacteria | 1930 |
| 520 | Ga0207692_10003515 | 3300025898 | Bacteria | 6131 |
| 521 | Ga0207692_10008195 | 3300025898 | Bacteria | 4318 |
| 522 | Ga0207692_10118299 | 3300025898 | Bacteria | 1480 |
| 523 | Ga0207692_10213076 | 3300025898 | Bacteria | 1142 |
| 524 | Ga0207642_10251749 | 3300025899 | Bacteria | 1003 |
| 525 | Ga0207710_10058668 | 3300025900 | Bacteria | 1741 |
| 526 | Ga0207710_10076259 | 3300025900 | Bacteria | 1547 |
| 527 | Ga0207710_10175442 | 3300025900 | Bacteria | 1049 |
| 528 | Ga0207710_10209946 | 3300025900 | Bacteria | 964 |
| 529 | Ga0207688_10046398 | 3300025901 | Bacteria | 2426 |
| 530 | Ga0207688_10133821 | 3300025901 | Bacteria | 1455 |
| 531 | Ga0207688_10292657 | 3300025901 | Bacteria | 994 |
| 532 | Ga0207680_10246835 | 3300025903 | Bacteria | 1232 |
| 533 | Ga0207647_10002921 | 3300025904 | Bacteria | 12870 |
| 534 | Ga0207647_10006624 | 3300025904 | Bacteria | 8415 |
| 535 | Ga0207647_10259957 | 3300025904 | Bacteria | 994 |
| 536 | Ga0207685_10000377 | 3300025905 | Bacteria | 7344 |
| 537 | Ga0207685_10008143 | 3300025905 | Bacteria | 2966 |
| 538 | Ga0207699_10003114 | 3300025906 | Bacteria | 7880 |
| 539 | Ga0207699_10012803 | 3300025906 | Bacteria | 4273 |
| 540 | Ga0207699_10038453 | 3300025906 | Bacteria | 2742 |
| 541 | Ga0207699_10111562 | 3300025906 | Bacteria | 1753 |
| 542 | Ga0207699_10301358 | 3300025906 | Bacteria | 1119 |
| 543 | Ga0207699_10422641 | 3300025906 | Bacteria | 952 |
| 544 | Ga0207645_10000286 | 3300025907 | Bacteria | 42134 |
| 545 | Ga0207645_10065338 | 3300025907 | Bacteria | 2325 |
| 546 | Ga0207645_10140801 | 3300025907 | Bacteria | 1572 |
| 547 | Ga0207645_10234887 | 3300025907 | Bacteria | 1211 |
| 548 | Ga0207645_10415922 | 3300025907 | Bacteria | 905 |
| 549 | Ga0207643_10054603 | 3300025908 | Bacteria | 2271 |
| 550 | Ga0207705_10056618 | 3300025909 | Bacteria | 2827 |
| 551 | Ga0207705_10195348 | 3300025909 | Bacteria | 1532 |
| 552 | Ga0207705_10212413 | 3300025909 | Bacteria | 1468 |
| 553 | Ga0207654_10001513 | 3300025911 | Bacteria | 12241 |
| 554 | Ga0207654_10037938 | 3300025911 | Bacteria | 2700 |
| 555 | Ga0207707_10031128 | 3300025912 | Bacteria | 4668 |
| 556 | Ga0207707_10165809 | 3300025912 | Bacteria | 1930 |
| 557 | Ga0207695_10000008 | 3300025913 | Bacteria | 1058268 |
| 558 | Ga0207695_10008039 | 3300025913 | Bacteria | 13279 |
| 559 | Ga0207695_10032881 | 3300025913 | Bacteria | 5670 |
| 560 | Ga0207695_10103578 | 3300025913 | Bacteria | 2837 |
| 561 | Ga0207695_10238633 | 3300025913 | Bacteria | 1720 |
| 562 | Ga0207695_10494828 | 3300025913 | Bacteria | 1105 |
| 563 | Ga0207671_10059849 | 3300025914 | Bacteria | 2825 |
| 564 | Ga0207671_10143691 | 3300025914 | Bacteria | 1840 |
| 565 | Ga0207671_10192469 | 3300025914 | Bacteria | 1591 |
| 566 | Ga0207671_10286962 | 3300025914 | Bacteria | 1299 |
| 567 | Ga0207693_10001875 | 3300025915 | Bacteria | 18415 |
| 568 | Ga0207693_10062244 | 3300025915 | Bacteria | 2924 |
| 569 | Ga0207663_10000347 | 3300025916 | Bacteria | 20128 |
| 570 | Ga0207663_10006159 | 3300025916 | Bacteria | 6109 |
| 571 | Ga0207663_10040094 | 3300025916 | Bacteria | 2844 |
| 572 | Ga0207663_10552055 | 3300025916 | Bacteria | 901 |
| 573 | Ga0207660_10047484 | 3300025917 | Bacteria | 3035 |
| 574 | Ga0207660_10145935 | 3300025917 | Bacteria | 1813 |
| 575 | Ga0207660_10251113 | 3300025917 | Bacteria | 1396 |
| 576 | Ga0207662_10247037 | 3300025918 | Bacteria | 1170 |
| 577 | Ga0207657_10005077 | 3300025919 | Bacteria | 13808 |
| 578 | Ga0207657_10106780 | 3300025919 | Bacteria | 2316 |
| 579 | Ga0207649_10028404 | 3300025920 | Bacteria | 3293 |
| 580 | Ga0207652_10062632 | 3300025921 | Bacteria | 3214 |
| 581 | Ga0207646_10158788 | 3300025922 | Bacteria | 2040 |
| 582 | Ga0207681_10139509 | 3300025923 | Bacteria | 1804 |
| 583 | Ga0207681_10233693 | 3300025923 | Bacteria | 1428 |
| 584 | Ga0207681_10629705 | 3300025923 | Bacteria | 888 |
| 585 | Ga0207694_10000050 | 3300025924 | Bacteria | 159920 |
| 586 | Ga0207694_10051007 | 3300025924 | Bacteria | 3207 |
| 587 | Ga0207694_10265609 | 3300025924 | Bacteria | 1407 |
| 588 | Ga0207694_10609281 | 3300025924 | Bacteria | 919 |
| 589 | Ga0207694_10688494 | 3300025924 | Bacteria | 862 |
| 590 | Ga0207650_10003178 | 3300025925 | Bacteria | 11313 |
| 591 | Ga0207650_10012180 | 3300025925 | Bacteria | 5930 |
| 592 | Ga0207650_10156021 | 3300025925 | Bacteria | 1805 |
| 593 | Ga0207659_10267604 | 3300025926 | Bacteria | 1393 |
| 594 | Ga0207659_10290995 | 3300025926 | Bacteria | 1338 |
| 595 | Ga0207659_10480952 | 3300025926 | Bacteria | 1049 |
| 596 | Ga0207659_10842822 | 3300025926 | Bacteria | 788 |
| 597 | Ga0207687_10014409 | 3300025927 | Bacteria | 5173 |
| 598 | Ga0207700_10050010 | 3300025928 | Bacteria | 3112 |
| 599 | Ga0207700_10085205 | 3300025928 | Bacteria | 2480 |
| 600 | Ga0207700_10108427 | 3300025928 | Bacteria | 2230 |
| 601 | Ga0207700_10197910 | 3300025928 | Bacteria | 1692 |
| 602 | Ga0207700_10258410 | 3300025928 | Bacteria | 1490 |
| 603 | Ga0207700_10382050 | 3300025928 | Bacteria | 1232 |
| 604 | Ga0207700_10616896 | 3300025928 | Bacteria | 966 |
| 605 | Ga0207664_10038049 | 3300025929 | Bacteria | 3728 |
| 606 | Ga0207664_10042856 | 3300025929 | Bacteria | 3536 |
| 607 | Ga0207664_10055666 | 3300025929 | Bacteria | 3139 |
| 608 | Ga0207664_10381822 | 3300025929 | Bacteria | 1251 |
| 609 | Ga0207664_10454659 | 3300025929 | Bacteria | 1143 |
| 610 | Ga0207664_10456802 | 3300025929 | Bacteria | 1140 |
| 611 | Ga0207644_10329061 | 3300025931 | Bacteria | 1237 |
| 612 | Ga0207644_10357530 | 3300025931 | Bacteria | 1187 |
| 613 | Ga0207644_10565787 | 3300025931 | Bacteria | 942 |
| 614 | Ga0207690_10017715 | 3300025932 | Bacteria | 4355 |
| 615 | Ga0207706_10153092 | 3300025933 | Bacteria | 2028 |
| 616 | Ga0207706_10184354 | 3300025933 | Bacteria | 1833 |
| 617 | Ga0207706_10199144 | 3300025933 | Bacteria | 1757 |
| 618 | Ga0207686_10117767 | 3300025934 | Bacteria | 1803 |
| 619 | Ga0207686_10209320 | 3300025934 | Bacteria | 1401 |
| 620 | Ga0207686_10581283 | 3300025934 | Bacteria | 879 |
| 621 | Ga0207709_10046579 | 3300025935 | Bacteria | 2632 |
| 622 | Ga0207709_10068250 | 3300025935 | Bacteria | 2247 |
| 623 | Ga0207709_10119999 | 3300025935 | Bacteria | 1774 |
| 624 | Ga0207709_10302752 | 3300025935 | Bacteria | 1189 |
| 625 | Ga0207669_10041586 | 3300025937 | Bacteria | 2676 |
| 626 | Ga0207669_10045750 | 3300025937 | Bacteria | 2581 |
| 627 | Ga0207704_10048167 | 3300025938 | Bacteria | 2553 |
| 628 | Ga0207704_10071978 | 3300025938 | Bacteria | 2196 |
| 629 | Ga0207704_10221602 | 3300025938 | Bacteria | 1400 |
| 630 | Ga0207665_10004695 | 3300025939 | Bacteria | 9077 |
| 631 | Ga0207665_10045722 | 3300025939 | Bacteria | 2932 |
| 632 | Ga0207665_10046684 | 3300025939 | Bacteria | 2902 |
| 633 | Ga0207665_10050708 | 3300025939 | Bacteria | 2791 |
| 634 | Ga0207665_10251103 | 3300025939 | Bacteria | 1307 |
| 635 | Ga0207691_10002154 | 3300025940 | Bacteria | 19269 |
| 636 | Ga0207691_10029841 | 3300025940 | Bacteria | 5100 |
| 637 | Ga0207691_10058642 | 3300025940 | Bacteria | 3501 |
| 638 | Ga0207691_10084522 | 3300025940 | Bacteria | 2849 |
| 639 | Ga0207711_10010545 | 3300025941 | Bacteria | 7679 |
| 640 | Ga0207711_10140089 | 3300025941 | Bacteria | 2175 |
| 641 | Ga0207689_10002835 | 3300025942 | Bacteria | 15995 |
| 642 | Ga0207689_10020120 | 3300025942 | Bacteria | 5621 |
| 643 | Ga0207689_10113433 | 3300025942 | Bacteria | 2228 |
| 644 | Ga0207689_10211358 | 3300025942 | Bacteria | 1603 |
| 645 | Ga0207661_10006587 | 3300025944 | Bacteria | 8212 |
| 646 | Ga0207661_10028199 | 3300025944 | Bacteria | 4297 |
| 647 | Ga0207679_10546139 | 3300025945 | Bacteria | 1039 |
| 648 | Ga0207667_10010367 | 3300025949 | Bacteria | 10892 |
| 649 | Ga0207667_10027376 | 3300025949 | Bacteria | 6206 |
| 650 | Ga0207667_10218483 | 3300025949 | Bacteria | 1953 |
| 651 | Ga0207667_10218581 | 3300025949 | Bacteria | 1952 |
| 652 | Ga0207667_10326769 | 3300025949 | Bacteria | 1566 |
| 653 | Ga0207667_10471107 | 3300025949 | Bacteria | 1275 |
| 654 | Ga0207667_10505540 | 3300025949 | Bacteria | 1225 |
| 655 | Ga0207651_10199118 | 3300025960 | Bacteria | 1604 |
| 656 | Ga0207651_10207367 | 3300025960 | Bacteria | 1575 |
| 657 | Ga0207651_10623584 | 3300025960 | Bacteria | 945 |
| 658 | Ga0207712_10019146 | 3300025961 | Bacteria | 4466 |
| 659 | Ga0207712_10083820 | 3300025961 | Bacteria | 2327 |
| 660 | Ga0207712_10087629 | 3300025961 | Bacteria | 2284 |
| 661 | Ga0207712_10122121 | 3300025961 | Bacteria | 1972 |
| 662 | Ga0207712_10395822 | 3300025961 | Bacteria | 1160 |
| 663 | Ga0207668_10014231 | 3300025972 | Bacteria | 4921 |
| 664 | Ga0207668_10019014 | 3300025972 | Bacteria | 4333 |
| 665 | Ga0207668_10039902 | 3300025972 | Bacteria | 3164 |
| 666 | Ga0207668_10067796 | 3300025972 | Bacteria | 2534 |
| 667 | Ga0207668_10122389 | 3300025972 | Bacteria | 1972 |
| 668 | Ga0207668_10137263 | 3300025972 | Bacteria | 1875 |
| 669 | Ga0207668_10249951 | 3300025972 | Bacteria | 1439 |
| 670 | Ga0207640_10014363 | 3300025981 | Bacteria | 4557 |
| 671 | Ga0207640_10037061 | 3300025981 | Bacteria | 3066 |
| 672 | Ga0207640_10154867 | 3300025981 | Bacteria | 1688 |
| 673 | Ga0207640_10218286 | 3300025981 | Bacteria | 1458 |
| 674 | Ga0207640_10384554 | 3300025981 | Bacteria | 1138 |
| 675 | Ga0207640_10534182 | 3300025981 | Bacteria | 982 |
| 676 | Ga0207640_10713744 | 3300025981 | Bacteria | 861 |
| 677 | Ga0207640_10766068 | 3300025981 | Bacteria | 833 |
| 678 | Ga0207640_10838526 | 3300025981 | Bacteria | 799 |
| 679 | Ga0207640_10840084 | 3300025981 | Bacteria | 798 |
| 680 | Ga0207658_10268735 | 3300025986 | Bacteria | 1456 |
| 681 | Ga0207658_10305149 | 3300025986 | Bacteria | 1373 |
| 682 | Ga0207658_10414578 | 3300025986 | Bacteria | 1186 |
| 683 | Ga0207658_10534524 | 3300025986 | Bacteria | 1048 |
| 684 | Ga0207677_10031302 | 3300026023 | Bacteria | 3407 |
| 685 | Ga0207677_10116413 | 3300026023 | Bacteria | 2001 |
| 686 | Ga0207677_10198274 | 3300026023 | Bacteria | 1593 |
| 687 | Ga0207677_10403231 | 3300026023 | Bacteria | 1160 |
| 688 | Ga0207703_10002330 | 3300026035 | Bacteria | 16564 |
| 689 | Ga0207703_10004196 | 3300026035 | Bacteria | 11883 |
| 690 | Ga0207703_10156350 | 3300026035 | Bacteria | 1993 |
| 691 | Ga0207703_10268096 | 3300026035 | Bacteria | 1546 |
| 692 | Ga0207703_10457078 | 3300026035 | Bacteria | 1194 |
| 693 | Ga0207703_10847928 | 3300026035 | Bacteria | 874 |
| 694 | Ga0207639_10061853 | 3300026041 | Bacteria | 2893 |
| 695 | Ga0207639_10132912 | 3300026041 | Bacteria | 2062 |
| 696 | Ga0207639_10146951 | 3300026041 | Bacteria | 1970 |
| 697 | Ga0207639_10327623 | 3300026041 | Bacteria | 1362 |
| 698 | Ga0207639_10355708 | 3300026041 | Bacteria | 1309 |
| 699 | Ga0207639_10396720 | 3300026041 | Bacteria | 1242 |
| 700 | Ga0207639_10817342 | 3300026041 | Bacteria | 869 |
| 701 | Ga0207678_10021023 | 3300026067 | Bacteria | 5720 |
| 702 | Ga0207678_10023027 | 3300026067 | Bacteria | 5451 |
| 703 | Ga0207678_10035512 | 3300026067 | Bacteria | 4340 |
| 704 | Ga0207678_10039077 | 3300026067 | Bacteria | 4119 |
| 705 | Ga0207678_10041697 | 3300026067 | Bacteria | 3979 |
| 706 | Ga0207678_10071839 | 3300026067 | Bacteria | 2967 |
| 707 | Ga0207678_10105366 | 3300026067 | Bacteria | 2406 |
| 708 | Ga0207678_10110819 | 3300026067 | Bacteria | 2341 |
| 709 | Ga0207678_10118932 | 3300026067 | Bacteria | 2255 |
| 710 | Ga0207678_10210459 | 3300026067 | Bacteria | 1663 |
| 711 | Ga0207678_10211814 | 3300026067 | Bacteria | 1658 |
| 712 | Ga0207708_10093201 | 3300026075 | Bacteria | 2325 |
| 713 | Ga0207708_10657469 | 3300026075 | Bacteria | 893 |
| 714 | Ga0207702_10000002 | 3300026078 | Bacteria | 491507 |
| 715 | Ga0207702_10000748 | 3300026078 | Bacteria | 34672 |
| 716 | Ga0207702_10031381 | 3300026078 | Bacteria | 4428 |
| 717 | Ga0207702_10049144 | 3300026078 | Bacteria | 3559 |
| 718 | Ga0207702_10394613 | 3300026078 | Bacteria | 1333 |
| 719 | Ga0207702_10570530 | 3300026078 | Bacteria | 1108 |
| 720 | Ga0207641_10003597 | 3300026088 | Bacteria | 13687 |
| 721 | Ga0207641_10007624 | 3300026088 | Bacteria | 8999 |
| 722 | Ga0207641_10138175 | 3300026088 | Bacteria | 2195 |
| 723 | Ga0207641_10235148 | 3300026088 | Bacteria | 1705 |
| 724 | Ga0207641_10507466 | 3300026088 | Bacteria | 1172 |
| 725 | Ga0207648_10023816 | 3300026089 | Bacteria | 5477 |
| 726 | Ga0207648_10059062 | 3300026089 | Bacteria | 3345 |
| 727 | Ga0207648_10116985 | 3300026089 | Bacteria | 2343 |
| 728 | Ga0207674_10000489 | 3300026116 | Bacteria | 52346 |
| 729 | Ga0207674_10003205 | 3300026116 | Bacteria | 20153 |
| 730 | Ga0207674_10003611 | 3300026116 | Bacteria | 18863 |
| 731 | Ga0207674_10014760 | 3300026116 | Bacteria | 8617 |
| 732 | Ga0207674_10023871 | 3300026116 | Bacteria | 6541 |
| 733 | Ga0207674_10729084 | 3300026116 | Bacteria | 957 |
| 734 | Ga0207675_100003215 | 3300026118 | Bacteria | 16023 |
| 735 | Ga0207675_100075023 | 3300026118 | Bacteria | 3165 |
| 736 | Ga0207675_100133243 | 3300026118 | Bacteria | 2357 |
| 737 | Ga0207675_100234843 | 3300026118 | Bacteria | 1770 |
| 738 | Ga0207675_100244660 | 3300026118 | Bacteria | 1734 |
| 739 | Ga0207675_100347420 | 3300026118 | Bacteria | 1453 |
| 740 | Ga0207675_100789871 | 3300026118 | Bacteria | 962 |
| 741 | Ga0207683_10002147 | 3300026121 | Bacteria | 17329 |
| 742 | Ga0207683_10007176 | 3300026121 | Bacteria | 9551 |
| 743 | Ga0207683_10014348 | 3300026121 | Bacteria | 6751 |
| 744 | Ga0207683_10018400 | 3300026121 | Bacteria | 5961 |
| 745 | Ga0207683_10195356 | 3300026121 | Bacteria | 1838 |
| 746 | Ga0207683_10321172 | 3300026121 | Bacteria | 1418 |
| 747 | Ga0207683_10367452 | 3300026121 | Bacteria | 1321 |
| 748 | Ga0207698_10022804 | 3300026142 | Bacteria | 4361 |
| 749 | Ga0207698_10047597 | 3300026142 | Bacteria | 3250 |
| 750 | Ga0207698_10104339 | 3300026142 | Bacteria | 2358 |
| 751 | Ga0207698_10138517 | 3300026142 | Bacteria | 2092 |
| 752 | Ga0207698_10220585 | 3300026142 | Bacteria | 1713 |
| 753 | Ga0209389_1000040 | 3300027296 | Bacteria | 124256 |
| 754 | Ga0209389_1000995 | 3300027296 | Bacteria | 18828 |
| 755 | Ga0209589_1000001 | 3300027357 | Bacteria | 794224 |
| 756 | Ga0209589_1000211 | 3300027357 | Bacteria | 69316 |
| 757 | Ga0209489_100001 | 3300027361 | Bacteria | 794224 |
| 758 | Ga0209489_100006 | 3300027361 | Bacteria | 475698 |
| 759 | Ga0209489_110930 | 3300027361 | Bacteria | 9725 |
| 760 | Ga0209700_100001 | 3300027363 | Bacteria | 794224 |
| 761 | Ga0209700_100005 | 3300027363 | Bacteria | 573969 |
| 762 | Ga0209813_10008974 | 3300027866 | Bacteria | 2543 |
| 763 | Ga0207428_10036206 | 3300027907 | Bacteria | 4028 |
| 764 | Ga0207428_10039542 | 3300027907 | Bacteria | 3830 |
| 765 | Ga0207428_10104190 | 3300027907 | Bacteria | 2190 |
| 766 | Ga0268266_10002320 | 3300028379 | Bacteria | 20625 |
| 767 | Ga0268266_10009271 | 3300028379 | Bacteria | 8682 |
| 768 | Ga0268266_10024042 | 3300028379 | Bacteria | 5185 |
| 769 | Ga0268266_10028180 | 3300028379 | Bacteria | 4775 |
| 770 | Ga0268266_10050458 | 3300028379 | Bacteria | 3570 |
| 771 | Ga0268266_10065849 | 3300028379 | Bacteria | 3132 |
| 772 | Ga0268266_10065947 | 3300028379 | Bacteria | 3130 |
| 773 | Ga0268266_10172149 | 3300028379 | Bacteria | 1966 |
| 774 | Ga0268266_10343609 | 3300028379 | Bacteria | 1401 |
| 775 | Ga0268266_10564449 | 3300028379 | Bacteria | 1091 |
| 776 | Ga0268266_10830937 | 3300028379 | Bacteria | 893 |
| 777 | Ga0268265_10036410 | 3300028380 | Bacteria | 3604 |
| 778 | Ga0268265_10209777 | 3300028380 | Bacteria | 1696 |
| 779 | Ga0268265_10472323 | 3300028380 | Bacteria | 1176 |
| 780 | Ga0268265_10746325 | 3300028380 | Bacteria | 949 |
| 781 | Ga0268264_10002930 | 3300028381 | Bacteria | 14828 |
| 782 | Ga0268264_10005853 | 3300028381 | Bacteria | 10411 |
| 783 | Ga0268264_10017488 | 3300028381 | Bacteria | 5871 |
| 784 | Ga0268264_10158642 | 3300028381 | Bacteria | 2035 |
| 785 | Ga0268264_10249367 | 3300028381 | Bacteria | 1648 |
| 786 | Ga0265337_1006749 | 3300028556 | Bacteria | 4374 |
| 787 | Ga0265334_10006955 | 3300028573 | Bacteria | 4858 |
| 788 | Ga0265323_10004409 | 3300028653 | Bacteria | 6068 |
| 789 | Ga0265322_10060032 | 3300028654 | Bacteria | 1079 |
| 790 | Ga0265336_10000763 | 3300028666 | Bacteria | 17052 |
| 791 | Ga0307517_10000249 | 3300028786 | Bacteria | 91911 |
| 792 | Ga0307517_10119002 | 3300028786 | Bacteria | 1963 |
| 793 | Ga0307515_10314902 | 3300028794 | Bacteria | 1236 |
| 794 | Ga0265338_10000665 | 3300028800 | Bacteria | 59449 |
| 795 | Ga0307511_10110325 | 3300030521 | Bacteria | 1754 |
| 796 | Ga0265330_10124828 | 3300031235 | Bacteria | 1096 |
| 797 | Ga0265332_10001409 | 3300031238 | Bacteria | 13560 |
| 798 | Ga0265332_10168113 | 3300031238 | Bacteria | 915 |
| 799 | Ga0265325_10012262 | 3300031241 | Bacteria | 4905 |
| 800 | Ga0265325_10030711 | 3300031241 | Bacteria | 2880 |
| 801 | Ga0265325_10165341 | 3300031241 | Bacteria | 1038 |
| 802 | Ga0265329_10071967 | 3300031242 | Bacteria | 1094 |
| 803 | Ga0265340_10005726 | 3300031247 | Bacteria | 6865 |
| 804 | Ga0265340_10008625 | 3300031247 | Bacteria | 5494 |
| 805 | Ga0265339_10003832 | 3300031249 | Bacteria | 10446 |
| 806 | Ga0265339_10052640 | 3300031249 | Bacteria | 2217 |
| 807 | Ga0265331_10062535 | 3300031250 | Bacteria | 1755 |
| 808 | Ga0265316_10061807 | 3300031344 | Bacteria | 2908 |
| 809 | Ga0265316_10087120 | 3300031344 | Bacteria | 2386 |
| 810 | Ga0307509_10125888 | 3300031507 | Bacteria | 2528 |
| 811 | Ga0307408_100318538 | 3300031548 | Bacteria | 1309 |
| 812 | Ga0307408_100779255 | 3300031548 | Bacteria | 866 |
| 813 | Ga0307508_10000018 | 3300031616 | Bacteria | 202701 |
| 814 | Ga0307508_10043906 | 3300031616 | Bacteria | 4002 |
| 815 | Ga0307508_10311566 | 3300031616 | Bacteria | 1166 |
| 816 | Ga0316575_10025725 | 3300031665 | Bacteria | 2284 |
| 817 | Ga0316579_10037283 | 3300031691 | Bacteria | 2246 |
| 818 | Ga0265314_10002567 | 3300031711 | Bacteria | 18413 |
| 819 | Ga0265314_10160306 | 3300031711 | Bacteria | 1370 |
| 820 | Ga0265314_10181164 | 3300031711 | Bacteria | 1262 |
| 821 | Ga0265342_10002171 | 3300031712 | Bacteria | 17254 |
| 822 | Ga0265342_10174163 | 3300031712 | Bacteria | 1182 |
| 823 | Ga0265342_10211170 | 3300031712 | Bacteria | 1049 |
| 824 | Ga0316576_10033029 | 3300031727 | Bacteria | 3681 |
| 825 | Ga0316578_10016515 | 3300031728 | Bacteria | 3997 |
| 826 | Ga0307516_10011331 | 3300031730 | Bacteria | 9703 |
| 827 | Ga0307516_10038640 | 3300031730 | Bacteria | 4761 |
| 828 | Ga0307516_10200912 | 3300031730 | Bacteria | 1713 |
| 829 | Ga0307516_10224017 | 3300031730 | Bacteria | 1588 |
| 830 | Ga0307405_10631678 | 3300031731 | Bacteria | 878 |
| 831 | Ga0307413_10031350 | 3300031824 | Bacteria | 2999 |
| 832 | Ga0307413_10800187 | 3300031824 | Bacteria | 792 |
| 833 | Ga0307410_10682828 | 3300031852 | Bacteria | 864 |
| 834 | Ga0307406_10255867 | 3300031901 | Bacteria | 1322 |
| 835 | Ga0307412_10429143 | 3300031911 | Bacteria | 1083 |
| 836 | Ga0307412_10595978 | 3300031911 | Bacteria | 935 |
| 837 | Ga0307416_100409035 | 3300032002 | Bacteria | 1397 |
| 838 | Ga0307415_100042679 | 3300032126 | Bacteria | 3020 |
| 839 | Ga0307507_10008461 | 3300033179 | Bacteria | 14216 |
| 840 | Ga0307510_10005775 | 3300033180 | Bacteria | 14749 |
| 841 | Ga0315911_1000006 | 3300033442 | Bacteria | 414563 |
| 842 | Ga0373950_0036482 | 3300034818 | Bacteria | 927 |
| 843 | Ga0373926_0034351 | 3300035083 | Bacteria | 1794 |
| 844 | Ga0373926_0069346 | 3300035083 | Bacteria | 1294 |
| 845 | Ga0373926_0089882 | 3300035083 | Bacteria | 1141 |
| 846 | Ga0373928_0021938 | 3300035084 | Bacteria | 1351 |
| 847 | Ga0373934_0024742 | 3300035086 | Bacteria | 2322 |
| 848 | Ga0373944_0027109 | 3300035089 | Bacteria | 1697 |
| 849 | Ga0373949_0069780 | 3300035090 | Bacteria | 919 |
| 850 | Ga0373932_0012711 | 3300035112 | Bacteria | 2079 |
| 851 | Ga0373936_0009212 | 3300035113 | Bacteria | 3720 |
| 852 | Ga0373936_0018528 | 3300035113 | Bacteria | 2690 |
| 853 | Ga0373936_0124171 | 3300035113 | Bacteria | 1105 |
| 854 | Ga0373953_0002178 | 3300035117 | Bacteria | 5860 |
| 855 | Ga0373953_0007285 | 3300035117 | Bacteria | 3699 |
| 856 | Ga0373953_0027450 | 3300035117 | Bacteria | 2188 |
| 857 | Ga0373953_0036308 | 3300035117 | Bacteria | 1940 |
| 858 | Ga0373954_0003365 | 3300035118 | Bacteria | 6768 |
| 859 | Ga0373954_0008989 | 3300035118 | Bacteria | 4396 |
| 860 | Ga0373954_0016863 | 3300035118 | Bacteria | 3276 |
| 861 | Ga0373956_0015008 | 3300035119 | Bacteria | 3239 |
| 862 | Ga0373956_0035180 | 3300035119 | Bacteria | 2208 |
| 863 | Ga0373956_0046623 | 3300035119 | Bacteria | 1937 |
| 864 | Ga0373956_0054647 | 3300035119 | Bacteria | 1799 |
| 865 | Ga0373957_0003026 | 3300035120 | Bacteria | 4886 |
| 866 | Ga0373957_0045277 | 3300035120 | Bacteria | 1667 |
| 867 | Ga0373943_0005981 | 3300035170 | Bacteria | 5462 |
| 868 | Ga0373943_0006361 | 3300035170 | Bacteria | 5307 |
| 869 | Ga0373943_0033391 | 3300035170 | Bacteria | 2451 |
| 870 | Ga0373946_0010792 | 3300035171 | Bacteria | 3392 |
| 871 | Ga0373946_0146071 | 3300035171 | Bacteria | 1100 |
| 872 | Ga0373955_0002466 | 3300035172 | Bacteria | 8083 |
| 873 | Ga0373955_0007820 | 3300035172 | Bacteria | 4932 |
| 874 | Ga0373955_0237654 | 3300035172 | Bacteria | 1091 |
| 875 | Ga0373955_0341937 | 3300035172 | Bacteria | 905 |
| 876 | Ga0373924_0002359 | 3300035410 | Bacteria | 6348 |
| 877 | Ga0373924_0012183 | 3300035410 | Bacteria | 3210 |
| 878 | Ga0373931_0007658 | 3300035691 | Bacteria | 5093 |
| 879 | Ga0373931_0098484 | 3300035691 | Bacteria | 1641 |
| 880 | Ga0373931_0148530 | 3300035691 | Bacteria | 1364 |
| 881 | Ga0373931_0171129 | 3300035691 | Bacteria | 1280 |
| 882 | Ga0373935_0001180 | 3300035692 | Bacteria | 14352 |
| 883 | Ga0373935_0033363 | 3300035692 | Bacteria | 3202 |
| 884 | Ga0373935_0049212 | 3300035692 | Bacteria | 2671 |
| 885 | Ga0373935_0130757 | 3300035692 | Bacteria | 1686 |
| 886 | Ga0373935_0382553 | 3300035692 | Bacteria | 1008 |
| 887 | Ga0373935_0658773 | 3300035692 | Bacteria | 768 |
| 888 | Ga0373927_0012626 | 3300035695 | Bacteria | 5619 |
| 889 | Ga0373927_0033690 | 3300035695 | Bacteria | 3334 |
| 890 | Ga0373927_0069279 | 3300035695 | Bacteria | 2283 |
| 891 | Ga0373927_0084027 | 3300035695 | Bacteria | 2064 |
| 892 | Ga0373927_0177471 | 3300035695 | Bacteria | 1397 |
| 893 | Ga0373927_0187584 | 3300035695 | Bacteria | 1356 |
| 894 | Ga0373933_0000787 | 3300035724 | Bacteria | 19357 |
| 895 | Ga0373933_0005811 | 3300035724 | Bacteria | 6711 |
| 896 | Ga0373933_0036459 | 3300035724 | Bacteria | 2878 |
| 897 | Ga0373933_0045514 | 3300035724 | Bacteria | 2602 |
| 898 | Ga0373947_0012125 | 3300035725 | Bacteria | 4935 |
| 899 | Ga0373947_0022984 | 3300035725 | Bacteria | 3623 |
| 900 | Ga0373947_0089676 | 3300035725 | Bacteria | 1915 |
| 901 | Ga0373937_0001814 | 3300036401 | Bacteria | 17923 |
| 902 | Ga0373937_0007938 | 3300036401 | Bacteria | 9201 |
| 903 | Ga0373937_0140323 | 3300036401 | Bacteria | 2260 |
| 904 | Ga0373937_0170675 | 3300036401 | Bacteria | 2041 |
| 905 | Ga0373937_0472782 | 3300036401 | Bacteria | 1190 |
| 906 | Ga0373937_0797525 | 3300036401 | Bacteria | 892 |
| 907 | Ga0372808_000933 | 3300036459 | Bacteria | 2749 |
| 908 | Ga0373925_0000353 | 3300037068 | Bacteria | 47782 |
| 909 | Ga0373925_0003087 | 3300037068 | Bacteria | 13072 |
| 910 | Ga0373925_0010490 | 3300037068 | Bacteria | 6720 |
| 911 | Ga0373925_0076221 | 3300037068 | Bacteria | 2543 |
| 912 | Ga0373925_0579725 | 3300037068 | Bacteria | 923 |
| 913 | Ga0395900_0023857 | 3300037418 | Bacteria | 6259 |
| 914 | Ga0395900_0169289 | 3300037418 | Bacteria | 2225 |
| 915 | Ga0395898_0019988 | 3300037466 | Bacteria | 6809 |
| 916 | Ga0395898_0192806 | 3300037466 | Bacteria | 1947 |
| 917 | Ga0395898_0275800 | 3300037466 | Bacteria | 1604 |
| 918 | Ga0395898_0417270 | 3300037466 | Bacteria | 1279 |
| 919 | Ga0395905_0008616 | 3300037471 | Bacteria | 10049 |
| 920 | Ga0395905_0014968 | 3300037471 | Bacteria | 7397 |
| 921 | Ga0395905_0030507 | 3300037471 | Bacteria | 5080 |
| 922 | Ga0436364_0479367 | 3300037853 | Bacteria | 1846 |
| 923 | Ga0395901_0002662 | 3300038443 | Bacteria | 18025 |
| 924 | Ga0395901_0183555 | 3300038443 | Bacteria | 2194 |
| 925 | Ga0395901_0353861 | 3300038443 | Bacteria | 1515 |
| 926 | Ga0436365_0174244 | 3300039437 | Bacteria | 1774 |
| 927 | Ga0436365_0647195 | 3300039437 | Bacteria | 1061 |
| 928 | Ga0436365_1394673 | 3300039437 | Bacteria | 3628 |
| 929 | Ga0436360_0136997 | 3300039438 | Bacteria | 1457 |
| 930 | Ga0436360_0173425 | 3300039438 | Bacteria | 5331 |
| 931 | Ga0436360_0809633 | 3300039438 | Bacteria | 1801 |
| 932 | Ga0436360_0865201 | 3300039438 | Bacteria | 1468 |
| 933 | Ga0436361_0265785 | 3300039447 | Bacteria | 1023 |
| 934 | Ga0436361_0314733 | 3300039447 | Bacteria | 864 |
| 935 | Ga0436361_0632415 | 3300039447 | Bacteria | 3816 |
| 936 | Ga0436363_1258628 | 3300039450 | Bacteria | 2108 |
| 937 | Ga0439461_0020278 | 3300041410 | Bacteria | 1315 |
| 938 | Ga0451793_0046002 | 3300041452 | Bacteria | 1678 |
| 939 | Ga0451807_2283239 | 3300041486 | Bacteria | 1089 |
| 940 | Ga0451843_0321225 | 3300041509 | Bacteria | 1232 |
| 941 | Ga0466972_0125525 | 3300044658 | Bacteria | 1209 |
| 942 | Ga0466965_0086603 | 3300044683 | Bacteria | 1589 |
| 943 | Ga0466966_0000426 | 3300044684 | Bacteria | 27052 |
| 944 | Ga0466961_0000208 | 3300044693 | Bacteria | 39439 |
| 945 | Ga0466961_0462223 | 3300044693 | Bacteria | 768 |
| 946 | Ga0466963_0137055 | 3300044694 | Bacteria | 1694 |
| 947 | Ga0466964_0141621 | 3300044706 | Bacteria | 1106 |
| 948 | Ga0466957_0364882 | 3300044842 | Bacteria | 982 |
| 949 | Ga0466957_0502789 | 3300044842 | Bacteria | 840 |
| 950 | Ga0466957_0621834 | 3300044842 | Bacteria | 757 |
| 951 | Ga0466960_0074350 | 3300044901 | Bacteria | 1698 |
| 952 | Ga0466959_0045855 | 3300045049 | Bacteria | 3218 |
| 953 | Ga0466959_0098879 | 3300045049 | Bacteria | 2090 |
| 954 | Ga0466959_0101222 | 3300045049 | Bacteria | 2062 |
| 955 | Ga0466959_0482341 | 3300045049 | Bacteria | 839 |
| 956 | Ga0451576_1590618 | 3300045051 | Bacteria | 678 |
| 957 | Ga0466967_0075695 | 3300045976 | Bacteria | 3026 |
| 958 | Ga0466967_0139641 | 3300045976 | Bacteria | 2256 |
| 959 | Ga0466967_0177573 | 3300045976 | Bacteria | 2006 |
| 960 | Ga0466967_0235164 | 3300045976 | Bacteria | 1746 |
| 961 | Ga0466967_0514130 | 3300045976 | Bacteria | 1176 |
| 962 | Ga0495617_024593 | 3300046452 | Bacteria | 2032 |
| 963 | Ga0495617_086636 | 3300046452 | Bacteria | 1024 |
| 964 | Ga0495592_0000284 | 3300046454 | Bacteria | 43567 |
| 965 | Ga0495592_0007940 | 3300046454 | Bacteria | 7959 |
| 966 | Ga0495592_0011449 | 3300046454 | Bacteria | 6712 |
| 967 | Ga0495592_0030145 | 3300046454 | Bacteria | 4102 |
| 968 | Ga0495592_0044849 | 3300046454 | Bacteria | 3302 |
| 969 | Ga0495603_0113001 | 3300046455 | Bacteria | 1583 |
| 970 | Ga0495603_0151587 | 3300046455 | Bacteria | 1346 |
| 971 | Ga0495590_0066882 | 3300046457 | Bacteria | 1259 |
| 972 | Ga0495629_0001471 | 3300046459 | Bacteria | 18583 |
| 973 | Ga0495629_0009818 | 3300046459 | Bacteria | 6983 |
| 974 | Ga0495629_0362317 | 3300046459 | Bacteria | 988 |
| 975 | Ga0495629_0418101 | 3300046459 | Bacteria | 910 |
| 976 | Ga0495638_0007580 | 3300046460 | Bacteria | 7764 |
| 977 | Ga0495638_0024650 | 3300046460 | Bacteria | 3918 |
| 978 | Ga0495638_0077447 | 3300046460 | Bacteria | 2024 |
| 979 | Ga0495641_0027053 | 3300046461 | Bacteria | 2793 |
| 980 | Ga0495651_0000528 | 3300046462 | Bacteria | 29605 |
| 981 | Ga0495651_0001055 | 3300046462 | Bacteria | 21307 |
| 982 | Ga0495651_0004953 | 3300046462 | Bacteria | 10171 |
| 983 | Ga0495651_0033861 | 3300046462 | Bacteria | 3983 |
| 984 | Ga0495651_0045105 | 3300046462 | Bacteria | 3416 |
| 985 | Ga0495651_0119535 | 3300046462 | Bacteria | 1938 |
| 986 | Ga0495651_0239621 | 3300046462 | Bacteria | 1245 |
| 987 | Ga0495653_0000330 | 3300046463 | Bacteria | 38640 |
| 988 | Ga0495653_0012854 | 3300046463 | Bacteria | 6833 |
| 989 | Ga0495653_0051880 | 3300046463 | Bacteria | 3146 |
| 990 | Ga0495653_0205184 | 3300046463 | Bacteria | 1335 |
| 991 | Ga0495650_0035581 | 3300046471 | Bacteria | 2191 |
| 992 | Ga0495650_0074621 | 3300046471 | Bacteria | 1322 |
| 993 | Ga0495580_0017647 | 3300046472 | Bacteria | 5331 |
| 994 | Ga0495580_0064783 | 3300046472 | Bacteria | 2561 |
| 995 | Ga0495582_0008676 | 3300046473 | Bacteria | 5606 |
| 996 | Ga0495582_0115587 | 3300046473 | Bacteria | 1509 |
| 997 | Ga0495582_0321055 | 3300046473 | Bacteria | 891 |
| 998 | Ga0495605_0079390 | 3300046474 | Bacteria | 1537 |
| 999 | Ga0495605_0123152 | 3300046474 | Bacteria | 1174 |
| 1000 | Ga0495639_0046055 | 3300046475 | Bacteria | 1974 |
| 1001 | Ga0495639_0197439 | 3300046475 | Bacteria | 984 |
| 1002 | Ga0495639_0207986 | 3300046475 | Bacteria | 959 |
| 1003 | Ga0495639_0261230 | 3300046475 | Bacteria | 858 |
| 1004 | Ga0495662_0003004 | 3300046476 | Bacteria | 8512 |
| 1005 | Ga0495662_0053996 | 3300046476 | Bacteria | 1941 |
| 1006 | Ga0495664_0000098 | 3300046477 | Bacteria | 43069 |
| 1007 | Ga0495664_0014192 | 3300046477 | Bacteria | 4513 |
| 1008 | Ga0495664_0026168 | 3300046477 | Bacteria | 3398 |
| 1009 | Ga0495664_0027596 | 3300046477 | Bacteria | 3311 |
| 1010 | Ga0495664_0326016 | 3300046477 | Bacteria | 926 |
| 1011 | Ga0495584_0108882 | 3300046491 | Bacteria | 1401 |
| 1012 | Ga0495585_0042306 | 3300046492 | Bacteria | 2552 |
| 1013 | Ga0495585_0042422 | 3300046492 | Bacteria | 2548 |
| 1014 | Ga0495594_0049107 | 3300046499 | Bacteria | 2319 |
| 1015 | Ga0495594_0127910 | 3300046499 | Bacteria | 1438 |
| 1016 | Ga0495607_0024171 | 3300046501 | Bacteria | 3792 |
| 1017 | Ga0495583_0063625 | 3300046506 | Bacteria | 1639 |
| 1018 | Ga0495606_0001663 | 3300046507 | Bacteria | 28893 |
| 1019 | Ga0495606_0078359 | 3300046507 | Bacteria | 2061 |
| 1020 | Ga0495606_0108452 | 3300046507 | Bacteria | 1678 |
| 1021 | Ga0495606_0111700 | 3300046507 | Bacteria | 1647 |
| 1022 | Ga0495606_0147278 | 3300046507 | Bacteria | 1385 |
| 1023 | Ga0495608_0000318 | 3300046511 | Bacteria | 33912 |
| 1024 | Ga0495608_0007280 | 3300046511 | Bacteria | 7824 |
| 1025 | Ga0495608_0007748 | 3300046511 | Bacteria | 7561 |
| 1026 | Ga0495608_0113918 | 3300046511 | Bacteria | 1737 |
| 1027 | Ga0495610_0028158 | 3300046512 | Bacteria | 2975 |
| 1028 | Ga0495616_0036121 | 3300046513 | Bacteria | 2552 |
| 1029 | Ga0495616_0065445 | 3300046513 | Bacteria | 1771 |
| 1030 | Ga0495618_0000235 | 3300046514 | Bacteria | 40243 |
| 1031 | Ga0495618_0005313 | 3300046514 | Bacteria | 7864 |
| 1032 | Ga0495618_0128394 | 3300046514 | Bacteria | 1623 |
| 1033 | Ga0495618_0308007 | 3300046514 | Bacteria | 983 |
| 1034 | Ga0495620_0024389 | 3300046515 | Bacteria | 2877 |
| 1035 | Ga0495620_0036962 | 3300046515 | Bacteria | 2180 |
| 1036 | Ga0495628_0001752 | 3300046516 | Bacteria | 19728 |
| 1037 | Ga0495628_0008728 | 3300046516 | Bacteria | 8672 |
| 1038 | Ga0495628_0123321 | 3300046516 | Bacteria | 1986 |
| 1039 | Ga0495628_0156019 | 3300046516 | Bacteria | 1736 |
| 1040 | Ga0495630_0002403 | 3300046517 | Bacteria | 12996 |
| 1041 | Ga0495630_0007077 | 3300046517 | Bacteria | 7992 |
| 1042 | Ga0495630_0535953 | 3300046517 | Bacteria | 898 |
| 1043 | Ga0495630_0574089 | 3300046517 | Bacteria | 865 |
| 1044 | Ga0495631_0047682 | 3300046518 | Bacteria | 1880 |
| 1045 | Ga0495632_0041732 | 3300046519 | Bacteria | 2304 |
| 1046 | Ga0495632_0047359 | 3300046519 | Bacteria | 2132 |
| 1047 | Ga0495637_0156129 | 3300046520 | Bacteria | 858 |
| 1048 | Ga0495643_0039228 | 3300046522 | Bacteria | 2590 |
| 1049 | Ga0495643_0091448 | 3300046522 | Bacteria | 1569 |
| 1050 | Ga0495643_0155892 | 3300046522 | Bacteria | 1127 |
| 1051 | Ga0495644_0134568 | 3300046523 | Bacteria | 942 |
| 1052 | Ga0495644_0221403 | 3300046523 | Bacteria | 732 |
| 1053 | Ga0495648_0002078 | 3300046524 | Bacteria | 18952 |
| 1054 | Ga0495648_0047321 | 3300046524 | Bacteria | 2659 |
| 1055 | Ga0495648_0057044 | 3300046524 | Bacteria | 2345 |
| 1056 | Ga0495648_0063629 | 3300046524 | Bacteria | 2177 |
| 1057 | Ga0495648_0099715 | 3300046524 | Bacteria | 1606 |
| 1058 | Ga0495666_0062522 | 3300046526 | Bacteria | 1778 |
| 1059 | Ga0495652_0000305 | 3300046529 | Bacteria | 58441 |
| 1060 | Ga0495652_0002427 | 3300046529 | Bacteria | 19218 |
| 1061 | Ga0495652_0007898 | 3300046529 | Bacteria | 9769 |
| 1062 | Ga0495652_0030776 | 3300046529 | Bacteria | 4704 |
| 1063 | Ga0495652_0071606 | 3300046529 | Bacteria | 2892 |
| 1064 | Ga0495652_0092860 | 3300046529 | Bacteria | 2465 |
| 1065 | Ga0495652_0112414 | 3300046529 | Bacteria | 2188 |
| 1066 | Ga0495654_0019069 | 3300046530 | Bacteria | 3589 |
| 1067 | Ga0495665_0083069 | 3300046531 | Bacteria | 1684 |
| 1068 | Ga0495665_0170711 | 3300046531 | Bacteria | 1132 |
| 1069 | Ga0495640_0000388 | 3300046533 | Bacteria | 31270 |
| 1070 | Ga0495640_0012229 | 3300046533 | Bacteria | 6568 |
| 1071 | Ga0495640_0020152 | 3300046533 | Bacteria | 4913 |
| 1072 | Ga0495640_0041579 | 3300046533 | Bacteria | 3211 |
| 1073 | Ga0495586_0146090 | 3300046535 | Bacteria | 1329 |
| 1074 | Ga0495587_0000249 | 3300046536 | Bacteria | 39283 |
| 1075 | Ga0495587_0018684 | 3300046536 | Bacteria | 4297 |
| 1076 | Ga0495587_0045874 | 3300046536 | Bacteria | 2596 |
| 1077 | Ga0495587_0068307 | 3300046536 | Bacteria | 2070 |
| 1078 | Ga0495609_0074972 | 3300046538 | Bacteria | 1483 |
| 1079 | Ga0495609_0121791 | 3300046538 | Bacteria | 1121 |
| 1080 | Ga0495597_0085522 | 3300046542 | Bacteria | 1344 |
| 1081 | Ga0495597_0235764 | 3300046542 | Bacteria | 723 |
| 1082 | Ga0495645_0007880 | 3300046543 | Bacteria | 7410 |
| 1083 | Ga0495645_0024231 | 3300046543 | Bacteria | 4402 |
| 1084 | Ga0495645_0164214 | 3300046543 | Bacteria | 1533 |
| 1085 | Ga0495622_0031960 | 3300046557 | Bacteria | 2458 |
| 1086 | Ga0495622_0057875 | 3300046557 | Bacteria | 1796 |
| 1087 | Ga0495622_0065013 | 3300046557 | Bacteria | 1686 |
| 1088 | Ga0495633_0022894 | 3300046558 | Bacteria | 3100 |
| 1089 | Ga0495667_0000195 | 3300046559 | Bacteria | 40983 |
| 1090 | Ga0495667_0005712 | 3300046559 | Bacteria | 8423 |
| 1091 | Ga0495667_0032617 | 3300046559 | Bacteria | 3489 |
| 1092 | Ga0495667_0123438 | 3300046559 | Bacteria | 1672 |
| 1093 | Ga0495656_0001218 | 3300046615 | Bacteria | 8383 |
| 1094 | Ga0495656_0008671 | 3300046615 | Bacteria | 3637 |
| 1095 | Ga0495668_0055643 | 3300046616 | Bacteria | 2184 |
| 1096 | Ga0495634_0003325 | 3300046642 | Bacteria | 12937 |
| 1097 | Ga0495634_0021235 | 3300046642 | Bacteria | 4592 |
| 1098 | Ga0495634_0135922 | 3300046642 | Bacteria | 1564 |
| 1099 | Ga0495611_0027315 | 3300046648 | Bacteria | 2494 |
| 1100 | Ga0495625_0088037 | 3300046660 | Bacteria | 2152 |
| 1101 | Ga0495625_0089466 | 3300046660 | Bacteria | 2131 |
| 1102 | Ga0495625_0122276 | 3300046660 | Bacteria | 1770 |
| 1103 | Ga0495625_0152008 | 3300046660 | Bacteria | 1556 |
| 1104 | Ga0495625_0446987 | 3300046660 | Bacteria | 799 |
| 1105 | Ga0495635_0000185 | 3300046663 | Bacteria | 39314 |
| 1106 | Ga0495635_0000873 | 3300046663 | Bacteria | 19766 |
| 1107 | Ga0495635_0001696 | 3300046663 | Bacteria | 14837 |
| 1108 | Ga0495635_0044031 | 3300046663 | Bacteria | 3079 |
| 1109 | Ga0495635_0056629 | 3300046663 | Bacteria | 2698 |
| 1110 | Ga0495659_0019391 | 3300046664 | Bacteria | 2276 |
| 1111 | Ga0495661_0280131 | 3300046665 | Bacteria | 841 |
| 1112 | Ga0495588_0013827 | 3300046674 | Bacteria | 3851 |
| 1113 | Ga0495588_0048497 | 3300046674 | Bacteria | 2182 |
| 1114 | Ga0495588_0068228 | 3300046674 | Bacteria | 1847 |
| 1115 | Ga0495588_0250205 | 3300046674 | Bacteria | 934 |
| 1116 | Ga0495657_0001331 | 3300046675 | Bacteria | 21493 |
| 1117 | Ga0495657_0011291 | 3300046675 | Bacteria | 6685 |
| 1118 | Ga0495657_0018550 | 3300046675 | Bacteria | 5029 |
| 1119 | Ga0495657_0047169 | 3300046675 | Bacteria | 2913 |
| 1120 | Ga0495599_0000168 | 3300046678 | Bacteria | 43232 |
| 1121 | Ga0495599_0102140 | 3300046678 | Bacteria | 1787 |
| 1122 | Ga0495623_0000586 | 3300046679 | Bacteria | 24285 |
| 1123 | Ga0495623_0001768 | 3300046679 | Bacteria | 14509 |
| 1124 | Ga0495623_0019551 | 3300046679 | Bacteria | 4376 |
| 1125 | Ga0495623_0262791 | 3300046679 | Bacteria | 966 |
| 1126 | Ga0495646_0000269 | 3300046680 | Bacteria | 26349 |
| 1127 | Ga0495646_0026347 | 3300046680 | Bacteria | 3651 |
| 1128 | Ga0495646_0056845 | 3300046680 | Bacteria | 2344 |
| 1129 | Ga0495646_0079456 | 3300046680 | Bacteria | 1915 |
| 1130 | Ga0495646_0131853 | 3300046680 | Bacteria | 1406 |
| 1131 | Ga0495647_0169018 | 3300046681 | Bacteria | 946 |
| 1132 | Ga0495658_0023364 | 3300046683 | Bacteria | 3281 |
| 1133 | Ga0495658_0378762 | 3300046683 | Bacteria | 901 |
| 1134 | Ga0495669_0015157 | 3300046684 | Bacteria | 3298 |
| 1135 | Ga0495669_0064405 | 3300046684 | Bacteria | 1663 |
| 1136 | Ga0495613_0030170 | 3300046689 | Bacteria | 4028 |
| 1137 | Ga0495613_0038119 | 3300046689 | Bacteria | 3563 |
| 1138 | Ga0495613_0062881 | 3300046689 | Bacteria | 2716 |
| 1139 | Ga0495624_0115553 | 3300046690 | Bacteria | 1649 |
| 1140 | Ga0495670_0072322 | 3300046691 | Bacteria | 1746 |
| 1141 | Ga0495671_0094426 | 3300046692 | Bacteria | 1463 |
| 1142 | Ga0495649_0005458 | 3300046694 | Bacteria | 8079 |
| 1143 | Ga0495600_0000210 | 3300046809 | Bacteria | 33567 |
| 1144 | Ga0495600_0001526 | 3300046809 | Bacteria | 12864 |
| 1145 | Ga0495600_0005587 | 3300046809 | Bacteria | 7594 |
| 1146 | Ga0495600_0021059 | 3300046809 | Bacteria | 4172 |
| 1147 | Ga0495600_0104375 | 3300046809 | Bacteria | 1847 |
| 1148 | Ga0495581_0031203 | 3300047315 | Bacteria | 3088 |
| 1149 | Ga0495581_0041352 | 3300047315 | Bacteria | 2668 |
| 1150 | Ga0495581_0075569 | 3300047315 | Bacteria | 1949 |
| 1151 | Ga0495604_0000003 | 3300047317 | Bacteria | 464246 |
| 1152 | Ga0495604_0002479 | 3300047317 | Bacteria | 14734 |
| 1153 | Ga0495604_0007137 | 3300047317 | Bacteria | 8852 |
| 1154 | Ga0495604_0009567 | 3300047317 | Bacteria | 7666 |
| 1155 | Ga0495674_0000006 | 3300047319 | Bacteria | 341772 |
| 1156 | Ga0495674_0016182 | 3300047319 | Bacteria | 6958 |
| 1157 | Ga0495674_0017727 | 3300047319 | Bacteria | 6630 |
| 1158 | Ga0495674_0029040 | 3300047319 | Bacteria | 5037 |
| 1159 | Ga0495674_0164354 | 3300047319 | Bacteria | 1856 |
| 1160 | Ga0495672_0028302 | 3300047320 | Bacteria | 3547 |
| 1161 | Ga0495672_0039931 | 3300047320 | Bacteria | 2850 |
| 1162 | Ga0495672_0125201 | 3300047320 | Bacteria | 1360 |
| 1163 | Ga0495672_0182365 | 3300047320 | Bacteria | 1062 |
| 1164 | Ga0495676_0035714 | 3300047321 | Bacteria | 4156 |
| 1165 | Ga0495676_0060030 | 3300047321 | Bacteria | 2983 |
| 1166 | Ga0495676_0190803 | 3300047321 | Bacteria | 1429 |
| 1167 | Ga0495680_0001799 | 3300047322 | Bacteria | 22686 |
| 1168 | Ga0495680_0005630 | 3300047322 | Bacteria | 11739 |
| 1169 | Ga0495680_0018123 | 3300047322 | Bacteria | 5987 |
| 1170 | Ga0495683_0047664 | 3300047323 | Bacteria | 2149 |
| 1171 | Ga0495683_0127160 | 3300047323 | Bacteria | 1205 |
| 1172 | Ga0495675_0000336 | 3300047444 | Bacteria | 33140 |
| 1173 | Ga0495675_0249065 | 3300047444 | Bacteria | 1067 |
| 1174 | Ga0495685_015331 | 3300047447 | Bacteria | 2613 |
| 1175 | Ga0495684_0000287 | 3300047471 | Bacteria | 40835 |
| 1176 | Ga0495684_0003082 | 3300047471 | Bacteria | 13101 |
| 1177 | Ga0495684_0008230 | 3300047471 | Bacteria | 8073 |
| 1178 | Ga0495684_0015851 | 3300047471 | Bacteria | 5801 |
| 1179 | Ga0495686_0048054 | 3300047472 | Bacteria | 2692 |
| 1180 | Ga0495686_0124666 | 3300047472 | Bacteria | 1532 |
| 1181 | Ga0495686_0128036 | 3300047472 | Bacteria | 1508 |
| 1182 | Ga0495593_0001718 | 3300047673 | Bacteria | 12967 |
| 1183 | Ga0495593_0009416 | 3300047673 | Bacteria | 5668 |
| 1184 | Ga0495593_0035007 | 3300047673 | Bacteria | 2728 |
| 1185 | Ga0495593_0146138 | 3300047673 | Bacteria | 1196 |
| 1186 | Ga0495593_0180805 | 3300047673 | Bacteria | 1062 |
| 1187 | Ga0495593_0274359 | 3300047673 | Bacteria | 844 |
| 1188 | Ga0495602_0000805 | 3300048088 | Bacteria | 29994 |
| 1189 | Ga0495602_0018072 | 3300048088 | Bacteria | 7052 |
| 1190 | Ga0495602_0020674 | 3300048088 | Bacteria | 6501 |
| 1191 | Ga0495602_0058307 | 3300048088 | Bacteria | 3380 |
| 1192 | Ga0495602_0378188 | 3300048088 | Bacteria | 1015 |
| 1193 | Ga0495626_0067186 | 3300048091 | Bacteria | 1620 |
| 1194 | Ga0496100_0002779 | 3300048903 | Bacteria | 8952 |
| 1195 | Ga0496100_0029522 | 3300048903 | Bacteria | 3393 |
| 1196 | Ga0496100_0258192 | 3300048903 | Bacteria | 1291 |
| 1197 | Ga0496100_0486855 | 3300048903 | Bacteria | 949 |
| 1198 | Ga0496100_0560611 | 3300048903 | Bacteria | 884 |
| 1199 | Ga0496101_0001894 | 3300048904 | Bacteria | 12631 |
| 1200 | Ga0496101_0054385 | 3300048904 | Bacteria | 2890 |
| 1201 | Ga0496101_0056797 | 3300048904 | Bacteria | 2830 |
| 1202 | Ga0496101_0093616 | 3300048904 | Bacteria | 2238 |
| 1203 | Ga0496102_0002765 | 3300048905 | Bacteria | 14959 |
| 1204 | Ga0496102_0040716 | 3300048905 | Bacteria | 4205 |
| 1205 | Ga0496102_0065153 | 3300048905 | Bacteria | 3339 |
| 1206 | Ga0496102_0081657 | 3300048905 | Bacteria | 2980 |
| 1207 | Ga0496102_0377152 | 3300048905 | Bacteria | 1335 |
| 1208 | Ga0496102_0689565 | 3300048905 | Bacteria | 944 |
| 1209 | Ga0496103_0052822 | 3300048906 | Bacteria | 2517 |
| 1210 | Ga0496103_0079512 | 3300048906 | Bacteria | 2060 |
| 1211 | Ga0496103_0408764 | 3300048906 | Bacteria | 872 |
| 1212 | Ga0496104_0005950 | 3300048907 | Bacteria | 10682 |
| 1213 | Ga0496104_0039293 | 3300048907 | Bacteria | 4430 |
| 1214 | Ga0496104_0194817 | 3300048907 | Bacteria | 1938 |
| 1215 | Ga0496104_0200572 | 3300048907 | Bacteria | 1907 |
| 1216 | Ga0496104_0400700 | 3300048907 | Bacteria | 1284 |
| 1217 | Ga0496104_0636854 | 3300048907 | Bacteria | 975 |
| 1218 | Ga0496104_0821197 | 3300048907 | Bacteria | 835 |
| 1219 | Ga0496105_0004948 | 3300048908 | Bacteria | 10075 |
| 1220 | Ga0496105_0014178 | 3300048908 | Bacteria | 6343 |
| 1221 | Ga0496105_0038159 | 3300048908 | Bacteria | 3957 |
| 1222 | Ga0496105_0041386 | 3300048908 | Bacteria | 3797 |
| 1223 | Ga0496105_0053835 | 3300048908 | Bacteria | 3324 |
| 1224 | Ga0496105_0082441 | 3300048908 | Bacteria | 2656 |
| 1225 | Ga0496105_0201843 | 3300048908 | Bacteria | 1623 |
| 1226 | Ga0496106_0000587 | 3300048909 | Bacteria | 25963 |
| 1227 | Ga0496106_0005552 | 3300048909 | Bacteria | 9339 |
| 1228 | Ga0496106_0019620 | 3300048909 | Bacteria | 5015 |
| 1229 | Ga0496106_0051907 | 3300048909 | Bacteria | 3092 |
| 1230 | Ga0496106_0053721 | 3300048909 | Bacteria | 3043 |
| 1231 | Ga0496106_0219417 | 3300048909 | Bacteria | 1516 |
| 1232 | Ga0496106_0649360 | 3300048909 | Bacteria | 843 |
| 1233 | Ga0496107_0003023 | 3300048910 | Bacteria | 11146 |
| 1234 | Ga0496107_0021695 | 3300048910 | Bacteria | 4538 |
| 1235 | Ga0496107_0024155 | 3300048910 | Bacteria | 4299 |
| 1236 | Ga0496107_0024903 | 3300048910 | Bacteria | 4235 |
| 1237 | Ga0496107_0074497 | 3300048910 | Bacteria | 2470 |
| 1238 | Ga0496107_0080438 | 3300048910 | Bacteria | 2376 |
| 1239 | Ga0496107_0209770 | 3300048910 | Bacteria | 1448 |
| 1240 | Ga0496107_0564105 | 3300048910 | Bacteria | 843 |
| 1241 | Ga0496108_0000517 | 3300048911 | Bacteria | 30206 |
| 1242 | Ga0496108_0002253 | 3300048911 | Bacteria | 15443 |
| 1243 | Ga0496108_0034446 | 3300048911 | Bacteria | 4208 |
| 1244 | Ga0496108_0044050 | 3300048911 | Bacteria | 3726 |
| 1245 | Ga0496108_0046015 | 3300048911 | Bacteria | 3645 |
| 1246 | Ga0496108_0132909 | 3300048911 | Bacteria | 2139 |
| 1247 | Ga0496108_0457925 | 3300048911 | Bacteria | 1114 |
| 1248 | Ga0496109_0000814 | 3300048912 | Bacteria | 26012 |
| 1249 | Ga0496109_0049567 | 3300048912 | Bacteria | 3823 |
| 1250 | Ga0496109_0066388 | 3300048912 | Bacteria | 3303 |
| 1251 | Ga0496109_0159112 | 3300048912 | Bacteria | 2116 |
| 1252 | Ga0496109_0368696 | 3300048912 | Bacteria | 1356 |
| 1253 | Ga0496109_0537074 | 3300048912 | Bacteria | 1103 |
| 1254 | Ga0496109_0644880 | 3300048912 | Bacteria | 996 |
| 1255 | Ga0496109_0774993 | 3300048912 | Bacteria | 897 |
| 1256 | Ga0496110_0016915 | 3300048913 | Bacteria | 6096 |
| 1257 | Ga0496110_0026206 | 3300048913 | Bacteria | 4986 |
| 1258 | Ga0496110_0053094 | 3300048913 | Bacteria | 3562 |
| 1259 | Ga0496110_0067178 | 3300048913 | Bacteria | 3172 |
| 1260 | Ga0496110_0149899 | 3300048913 | Bacteria | 2111 |
| 1261 | Ga0496110_0177020 | 3300048913 | Bacteria | 1936 |
| 1262 | Ga0496111_0009126 | 3300048914 | Bacteria | 6601 |
| 1263 | Ga0496111_0046808 | 3300048914 | Bacteria | 3115 |
| 1264 | Ga0496111_0123406 | 3300048914 | Bacteria | 1914 |
| 1265 | Ga0496111_0139025 | 3300048914 | Bacteria | 1799 |
| 1266 | Ga0496111_0175646 | 3300048914 | Bacteria | 1592 |
| 1267 | Ga0496111_0367624 | 3300048914 | Bacteria | 1064 |
| 1268 | Ga0496112_0000004 | 3300048915 | Bacteria | 553294 |
| 1269 | Ga0496112_0000218 | 3300048915 | Bacteria | 37059 |
| 1270 | Ga0496112_0016917 | 3300048915 | Bacteria | 6843 |
| 1271 | Ga0496112_0037102 | 3300048915 | Bacteria | 4758 |
| 1272 | Ga0496112_0043290 | 3300048915 | Bacteria | 4408 |
| 1273 | Ga0496112_0044258 | 3300048915 | Bacteria | 4362 |
| 1274 | Ga0496112_0068208 | 3300048915 | Bacteria | 3512 |
| 1275 | Ga0496112_0128423 | 3300048915 | Bacteria | 2505 |
| 1276 | Ga0496112_0145582 | 3300048915 | Bacteria | 2338 |
| 1277 | Ga0496112_0163031 | 3300048915 | Bacteria | 2195 |
| 1278 | Ga0496112_0286820 | 3300048915 | Bacteria | 1592 |
| 1279 | Ga0496112_0655136 | 3300048915 | Bacteria | 979 |
| 1280 | Ga0496113_0003899 | 3300048916 | Bacteria | 9040 |
| 1281 | Ga0496113_0025279 | 3300048916 | Bacteria | 4231 |
| 1282 | Ga0496113_0029742 | 3300048916 | Bacteria | 3948 |
| 1283 | Ga0496113_0058245 | 3300048916 | Bacteria | 2906 |
| 1284 | Ga0496113_0060028 | 3300048916 | Bacteria | 2866 |
| 1285 | Ga0496113_0163310 | 3300048916 | Bacteria | 1761 |
| 1286 | Ga0496113_0275455 | 3300048916 | Bacteria | 1345 |
| 1287 | Ga0496113_0305047 | 3300048916 | Bacteria | 1275 |
| 1288 | Ga0496113_0612111 | 3300048916 | Bacteria | 872 |
| 1289 | Ga0496114_0009279 | 3300048917 | Bacteria | 7805 |
| 1290 | Ga0496114_0035386 | 3300048917 | Bacteria | 4123 |
| 1291 | Ga0496114_0100069 | 3300048917 | Bacteria | 2473 |
| 1292 | Ga0496114_0191204 | 3300048917 | Bacteria | 1791 |
| 1293 | Ga0496114_0210520 | 3300048917 | Bacteria | 1705 |
| 1294 | Ga0496114_0308589 | 3300048917 | Bacteria | 1397 |
| 1295 | Ga0496115_0018582 | 3300048918 | Bacteria | 5341 |
| 1296 | Ga0496115_0023272 | 3300048918 | Bacteria | 4806 |
| 1297 | Ga0496115_0155365 | 3300048918 | Bacteria | 1890 |
| 1298 | Ga0496115_0347336 | 3300048918 | Bacteria | 1210 |
| 1299 | Ga0496115_0410117 | 3300048918 | Bacteria | 1098 |
| 1300 | Ga0496115_0540866 | 3300048918 | Bacteria | 932 |
| 1301 | Ga0496116_0017544 | 3300048919 | Bacteria | 5549 |
| 1302 | Ga0496116_0023210 | 3300048919 | Bacteria | 4626 |
| 1303 | Ga0496116_0040863 | 3300048919 | Bacteria | 3188 |
| 1304 | Ga0496117_0011613 | 3300048920 | Bacteria | 7871 |
| 1305 | Ga0496117_0103657 | 3300048920 | Bacteria | 1792 |
| 1306 | Ga0496117_0214359 | 3300048920 | Bacteria | 1077 |
| 1307 | Ga0496117_0295281 | 3300048920 | Bacteria | 861 |
| 1308 | Ga0496118_0004793 | 3300048921 | Bacteria | 15797 |
| 1309 | Ga0496118_0045464 | 3300048921 | Bacteria | 3427 |
| 1310 | Ga0496118_0056547 | 3300048921 | Bacteria | 2948 |
| 1311 | Ga0496118_0062107 | 3300048921 | Bacteria | 2761 |
| 1312 | Ga0496118_0070914 | 3300048921 | Bacteria | 2512 |
| 1313 | Ga0496118_0071819 | 3300048921 | Bacteria | 2489 |
| 1314 | Ga0496118_0265931 | 3300048921 | Bacteria | 964 |
| 1315 | Ga0496119_0002647 | 3300048922 | Bacteria | 19399 |
| 1316 | Ga0496119_0009808 | 3300048922 | Bacteria | 8146 |
| 1317 | Ga0496119_0028133 | 3300048922 | Bacteria | 3845 |
| 1318 | Ga0496119_0125808 | 3300048922 | Bacteria | 1403 |
| 1319 | Ga0496120_0019815 | 3300048923 | Bacteria | 4291 |
| 1320 | Ga0496120_0038353 | 3300048923 | Bacteria | 2835 |
| 1321 | Ga0496120_0187901 | 3300048923 | Bacteria | 1009 |
| 1322 | Ga0496120_0199312 | 3300048923 | Bacteria | 970 |
| 1323 | Ga0496121_0000458 | 3300048924 | Bacteria | 80207 |
| 1324 | Ga0496121_0001749 | 3300048924 | Bacteria | 35439 |
| 1325 | Ga0496121_0002564 | 3300048924 | Bacteria | 27512 |
| 1326 | Ga0496121_0006706 | 3300048924 | Bacteria | 14144 |
| 1327 | Ga0496121_0019210 | 3300048924 | Bacteria | 6845 |
| 1328 | Ga0496121_0030046 | 3300048924 | Bacteria | 5002 |
| 1329 | Ga0496121_0037369 | 3300048924 | Bacteria | 4314 |
| 1330 | Ga0496121_0039959 | 3300048924 | Bacteria | 4124 |
| 1331 | Ga0496121_0060123 | 3300048924 | Bacteria | 3128 |
| 1332 | Ga0496121_0100872 | 3300048924 | Bacteria | 2227 |
| 1333 | Ga0496121_0102319 | 3300048924 | Bacteria | 2207 |
| 1334 | Ga0496121_0110683 | 3300048924 | Bacteria | 2095 |
| 1335 | Ga0496121_0137910 | 3300048924 | Bacteria | 1814 |
| 1336 | Ga0496121_0143496 | 3300048924 | Bacteria | 1768 |
| 1337 | Ga0496121_0461321 | 3300048924 | Bacteria | 816 |
| 1338 | Ga0496122_0005205 | 3300048925 | Bacteria | 15617 |
| 1339 | Ga0496122_0089726 | 3300048925 | Bacteria | 2100 |
| 1340 | Ga0496122_0151155 | 3300048925 | Bacteria | 1433 |
| 1341 | Ga0496123_0001216 | 3300048926 | Bacteria | 37600 |
| 1342 | Ga0496123_0056943 | 3300048926 | Bacteria | 2549 |
| 1343 | Ga0496123_0136293 | 3300048926 | Bacteria | 1350 |
| 1344 | Ga0496124_0004472 | 3300048927 | Bacteria | 16313 |
| 1345 | Ga0496124_0049471 | 3300048927 | Bacteria | 3586 |
| 1346 | Ga0496124_0135267 | 3300048927 | Bacteria | 1952 |
| 1347 | Ga0496124_0318172 | 3300048927 | Bacteria | 1115 |
| 1348 | Ga0496124_0331410 | 3300048927 | Bacteria | 1085 |
| 1349 | Ga0496124_0401643 | 3300048927 | Bacteria | 951 |
| 1350 | Ga0496125_0007066 | 3300048928 | Bacteria | 11990 |
| 1351 | Ga0496125_0028317 | 3300048928 | Bacteria | 5064 |
| 1352 | Ga0496125_0035050 | 3300048928 | Bacteria | 4411 |
| 1353 | Ga0496125_0063116 | 3300048928 | Bacteria | 2956 |
| 1354 | Ga0496125_0130191 | 3300048928 | Bacteria | 1773 |
| 1355 | Ga0496125_0163747 | 3300048928 | Bacteria | 1506 |
| 1356 | Ga0496125_0347958 | 3300048928 | Bacteria | 886 |
| 1357 | Ga0496125_0379986 | 3300048928 | Bacteria | 833 |
| 1358 | Ga0496126_0003477 | 3300048929 | Bacteria | 19884 |
| 1359 | Ga0496126_0009236 | 3300048929 | Bacteria | 10511 |
| 1360 | Ga0496126_0014283 | 3300048929 | Bacteria | 8034 |
| 1361 | Ga0496126_0022627 | 3300048929 | Bacteria | 6109 |
| 1362 | Ga0496126_0022855 | 3300048929 | Bacteria | 6071 |
| 1363 | Ga0496126_0031475 | 3300048929 | Bacteria | 5011 |
| 1364 | Ga0496126_0039174 | 3300048929 | Bacteria | 4400 |
| 1365 | Ga0496126_0082444 | 3300048929 | Bacteria | 2841 |
| 1366 | Ga0496126_0083970 | 3300048929 | Bacteria | 2810 |
| 1367 | Ga0496126_0091207 | 3300048929 | Bacteria | 2680 |
| 1368 | Ga0496126_0161207 | 3300048929 | Bacteria | 1916 |
| 1369 | Ga0496126_0170985 | 3300048929 | Bacteria | 1851 |
| 1370 | Ga0496126_0178540 | 3300048929 | Bacteria | 1805 |
| 1371 | Ga0496126_0273764 | 3300048929 | Bacteria | 1400 |
| 1372 | Ga0496126_0396835 | 3300048929 | Bacteria | 1120 |
| 1373 | Ga0496126_0729716 | 3300048929 | Bacteria | 767 |
| 1374 | Ga0496126_0737877 | 3300048929 | Bacteria | 762 |
| 1375 | Ga0496126_0739013 | 3300048929 | Bacteria | 761 |
| 1376 | Ga0495682_0103925 | 3300049460 | Bacteria | 1019 |
| 1377 | Ga0501031_0002252 | 3300049568 | Bacteria | 12217 |
| 1378 | Ga0501031_0004417 | 3300049568 | Bacteria | 9113 |
| 1379 | Ga0501031_0104072 | 3300049568 | Bacteria | 1852 |
| 1380 | Ga0501032_0001822 | 3300049569 | Bacteria | 16845 |
| 1381 | Ga0501032_0010877 | 3300049569 | Bacteria | 6545 |
| 1382 | Ga0501032_0048106 | 3300049569 | Bacteria | 2879 |
| 1383 | Ga0501032_0073698 | 3300049569 | Bacteria | 2274 |
| 1384 | Ga0501033_0000108 | 3300049570 | Bacteria | 79903 |
| 1385 | Ga0501033_0000827 | 3300049570 | Bacteria | 28243 |
| 1386 | Ga0501033_0005609 | 3300049570 | Bacteria | 9915 |
| 1387 | Ga0501033_0008341 | 3300049570 | Bacteria | 8023 |
| 1388 | Ga0501033_0020768 | 3300049570 | Bacteria | 4961 |
| 1389 | Ga0501033_0192451 | 3300049570 | Bacteria | 1459 |
| 1390 | Ga0501034_0002449 | 3300049571 | Bacteria | 22384 |
| 1391 | Ga0501034_0041720 | 3300049571 | Bacteria | 4643 |
| 1392 | Ga0501034_0050134 | 3300049571 | Bacteria | 4211 |
| 1393 | Ga0501034_0097719 | 3300049571 | Bacteria | 2932 |
| 1394 | Ga0501034_0107244 | 3300049571 | Bacteria | 2785 |
| 1395 | Ga0501034_0251907 | 3300049571 | Bacteria | 1710 |
| 1396 | Ga0501036_0000149 | 3300049572 | Bacteria | 45598 |
| 1397 | Ga0501036_0017788 | 3300049572 | Bacteria | 5952 |
| 1398 | Ga0501036_0020595 | 3300049572 | Bacteria | 5539 |
| 1399 | Ga0501036_0025415 | 3300049572 | Bacteria | 4995 |
| 1400 | Ga0501036_0159903 | 3300049572 | Bacteria | 1899 |
| 1401 | Ga0501036_0281244 | 3300049572 | Bacteria | 1392 |
| 1402 | Ga0501037_0000153 | 3300049573 | Bacteria | 64239 |
| 1403 | Ga0501037_0000888 | 3300049573 | Bacteria | 22320 |
| 1404 | Ga0501037_0023604 | 3300049573 | Bacteria | 4547 |
| 1405 | Ga0501037_0039773 | 3300049573 | Bacteria | 3460 |
| 1406 | Ga0501037_0043447 | 3300049573 | Bacteria | 3302 |
| 1407 | Ga0501038_0000138 | 3300049574 | Bacteria | 62493 |
| 1408 | Ga0501038_0000999 | 3300049574 | Bacteria | 25463 |
| 1409 | Ga0501038_0001121 | 3300049574 | Bacteria | 24319 |
| 1410 | Ga0501038_0012358 | 3300049574 | Bacteria | 7802 |
| 1411 | Ga0501038_0026754 | 3300049574 | Bacteria | 5135 |
| 1412 | Ga0501038_0028683 | 3300049574 | Bacteria | 4943 |
| 1413 | Ga0501038_0041649 | 3300049574 | Bacteria | 4004 |
| 1414 | Ga0501038_0054303 | 3300049574 | Bacteria | 3446 |
| 1415 | Ga0501038_0378460 | 3300049574 | Bacteria | 1098 |
| 1416 | Ga0501039_0000842 | 3300049575 | Bacteria | 22166 |
| 1417 | Ga0501039_0006162 | 3300049575 | Bacteria | 9108 |
| 1418 | Ga0501039_0050475 | 3300049575 | Bacteria | 3218 |
| 1419 | Ga0501039_0343199 | 3300049575 | Bacteria | 1173 |
| 1420 | Ga0501040_0015506 | 3300049576 | Bacteria | 5036 |
| 1421 | Ga0501041_0120074 | 3300049577 | Bacteria | 1633 |
| 1422 | Ga0501041_0287448 | 3300049577 | Bacteria | 1035 |
| 1423 | Ga0501042_0001932 | 3300049578 | Bacteria | 12476 |
| 1424 | Ga0501042_0088976 | 3300049578 | Bacteria | 2215 |
| 1425 | Ga0501043_0000085 | 3300049579 | Bacteria | 83544 |
| 1426 | Ga0501043_0013390 | 3300049579 | Bacteria | 6414 |
| 1427 | Ga0501043_0019654 | 3300049579 | Bacteria | 5303 |
| 1428 | Ga0501043_0081607 | 3300049579 | Bacteria | 2541 |
| 1429 | Ga0501043_0170027 | 3300049579 | Bacteria | 1700 |
| 1430 | Ga0501046_0000267 | 3300049580 | Bacteria | 53185 |
| 1431 | Ga0501046_0003985 | 3300049580 | Bacteria | 13484 |
| 1432 | Ga0501046_0033529 | 3300049580 | Bacteria | 4147 |
| 1433 | Ga0501046_0155285 | 3300049580 | Bacteria | 1724 |
| 1434 | Ga0501047_0001785 | 3300049581 | Bacteria | 20809 |
| 1435 | Ga0501047_0008455 | 3300049581 | Bacteria | 9713 |
| 1436 | Ga0501047_0021518 | 3300049581 | Bacteria | 6194 |
| 1437 | Ga0501047_0027991 | 3300049581 | Bacteria | 5431 |
| 1438 | Ga0501047_0041733 | 3300049581 | Bacteria | 4432 |
| 1439 | Ga0501047_0214787 | 3300049581 | Bacteria | 1780 |
| 1440 | Ga0501047_0535426 | 3300049581 | Bacteria | 996 |
| 1441 | Ga0501048_0000396 | 3300049582 | Bacteria | 30302 |
| 1442 | Ga0501048_0012509 | 3300049582 | Bacteria | 6315 |
| 1443 | Ga0501048_0111842 | 3300049582 | Bacteria | 1929 |
| 1444 | Ga0501048_0182347 | 3300049582 | Bacteria | 1488 |
| 1445 | Ga0501067_0000104 | 3300049583 | Bacteria | 48290 |
| 1446 | Ga0501067_0006729 | 3300049583 | Bacteria | 6375 |
| 1447 | Ga0501067_0048309 | 3300049583 | Bacteria | 2360 |
| 1448 | Ga0501067_0147050 | 3300049583 | Bacteria | 1313 |
| 1449 | Ga0501067_0244749 | 3300049583 | Bacteria | 998 |
| 1450 | Ga0501068_0002865 | 3300049584 | Bacteria | 9179 |
| 1451 | Ga0501068_0003450 | 3300049584 | Bacteria | 8510 |
| 1452 | Ga0501068_0018698 | 3300049584 | Bacteria | 4014 |
| 1453 | Ga0501069_0019419 | 3300049585 | Bacteria | 3675 |
| 1454 | Ga0501069_0045971 | 3300049585 | Bacteria | 2420 |
| 1455 | Ga0501069_0053275 | 3300049585 | Bacteria | 2253 |
| 1456 | Ga0501070_0002230 | 3300049586 | Bacteria | 17026 |
| 1457 | Ga0501070_0008793 | 3300049586 | Bacteria | 8538 |
| 1458 | Ga0501070_0009392 | 3300049586 | Bacteria | 8267 |
| 1459 | Ga0501070_0024791 | 3300049586 | Bacteria | 5031 |
| 1460 | Ga0501070_0334147 | 3300049586 | Bacteria | 1231 |
| 1461 | Ga0501071_0028989 | 3300049587 | Bacteria | 3904 |
| 1462 | Ga0501071_0204566 | 3300049587 | Bacteria | 1484 |
| 1463 | Ga0501071_0464840 | 3300049587 | Bacteria | 969 |
| 1464 | Ga0501072_0019143 | 3300049588 | Bacteria | 5288 |
| 1465 | Ga0501072_0032885 | 3300049588 | Bacteria | 4062 |
| 1466 | Ga0501072_0316549 | 3300049588 | Bacteria | 1240 |
| 1467 | Ga0501072_0624194 | 3300049588 | Bacteria | 849 |
| 1468 | Ga0501073_0000221 | 3300049589 | Bacteria | 37338 |
| 1469 | Ga0501073_0018870 | 3300049589 | Bacteria | 4985 |
| 1470 | Ga0501073_0020114 | 3300049589 | Bacteria | 4813 |
| 1471 | Ga0501073_0066091 | 3300049589 | Bacteria | 2521 |
| 1472 | Ga0501073_0436788 | 3300049589 | Bacteria | 905 |
| 1473 | Ga0501074_0001821 | 3300049590 | Bacteria | 14590 |
| 1474 | Ga0501074_0008617 | 3300049590 | Bacteria | 7385 |
| 1475 | Ga0501075_0038557 | 3300049591 | Bacteria | 3573 |
| 1476 | Ga0501075_0304417 | 3300049591 | Bacteria | 1215 |
| 1477 | Ga0501075_0369424 | 3300049591 | Bacteria | 1093 |
| 1478 | Ga0501076_0011550 | 3300049592 | Bacteria | 6585 |
| 1479 | Ga0501076_0037661 | 3300049592 | Bacteria | 3794 |
| 1480 | Ga0501076_0617934 | 3300049592 | Bacteria | 894 |
| 1481 | Ga0501077_0050144 | 3300049593 | Bacteria | 2653 |
| 1482 | Ga0501079_0007983 | 3300049741 | Bacteria | 8021 |
| 1483 | Ga0501079_0011689 | 3300049741 | Bacteria | 6706 |
| 1484 | Ga0501079_0019790 | 3300049741 | Bacteria | 5143 |
| 1485 | Ga0501079_0141817 | 3300049741 | Bacteria | 1872 |
| 1486 | Ga0501080_0013906 | 3300049742 | Bacteria | 7408 |
| 1487 | Ga0501080_0015912 | 3300049742 | Bacteria | 6938 |
| 1488 | Ga0501080_0024958 | 3300049742 | Bacteria | 5544 |
| 1489 | Ga0501080_0053279 | 3300049742 | Bacteria | 3766 |
| 1490 | Ga0501080_0139921 | 3300049742 | Bacteria | 2238 |
| 1491 | Ga0501080_0164236 | 3300049742 | Bacteria | 2049 |
| 1492 | Ga0501083_0000087 | 3300049744 | Bacteria | 62691 |
| 1493 | Ga0501083_0018512 | 3300049744 | Bacteria | 4853 |
| 1494 | Ga0501083_0127008 | 3300049744 | Bacteria | 1672 |
| 1495 | Ga0501083_0211671 | 3300049744 | Bacteria | 1264 |
| 1496 | Ga0501035_0000223 | 3300049822 | Bacteria | 67732 |
| 1497 | Ga0501035_0009850 | 3300049822 | Bacteria | 8874 |
| 1498 | Ga0501035_0019488 | 3300049822 | Bacteria | 6236 |
| 1499 | Ga0501035_0021012 | 3300049822 | Bacteria | 6000 |
| 1500 | Ga0501035_0036839 | 3300049822 | Bacteria | 4432 |
| 1501 | Ga0501035_0065366 | 3300049822 | Bacteria | 3231 |
| 1502 | Ga0501035_0101224 | 3300049822 | Bacteria | 2528 |
| 1503 | Ga0501044_0000369 | 3300049823 | Bacteria | 56363 |
| 1504 | Ga0501044_0029450 | 3300049823 | Bacteria | 5789 |
| 1505 | Ga0501044_0082994 | 3300049823 | Bacteria | 3241 |
| 1506 | Ga0501044_0096443 | 3300049823 | Bacteria | 2978 |
| 1507 | Ga0501044_0123956 | 3300049823 | Bacteria | 2582 |
| 1508 | Ga0501044_0151796 | 3300049823 | Bacteria | 2298 |
| 1509 | Ga0501044_0278393 | 3300049823 | Bacteria | 1607 |
| 1510 | Ga0501044_0353486 | 3300049823 | Bacteria | 1388 |
| 1511 | Ga0501045_0003158 | 3300049824 | Bacteria | 11262 |
| 1512 | Ga0501045_0185869 | 3300049824 | Bacteria | 1548 |
| 1513 | nmdc:mga03683_58016_c1 | 3300050489 | Bacteria | 1631 |
| 1514 | nmdc:mga03n38_5599_c1 | 3300050490 | Bacteria | 4292 |
| 1515 | nmdc:mga03n38_866_c1 | 3300050490 | Bacteria | 8124 |
| 1516 | nmdc:mga00v17_14094_c1 | 3300050491 | Bacteria | 4456 |
| 1517 | nmdc:mga00v17_167231_c1 | 3300050491 | Bacteria | 1417 |
| 1518 | nmdc:mga00v17_364542_c1 | 3300050491 | Bacteria | 939 |
| 1519 | nmdc:mga0yw44_156649_c1 | 3300050492 | Bacteria | 1489 |
| 1520 | nmdc:mga0yw44_204888_c1 | 3300050492 | Bacteria | 1304 |
| 1521 | nmdc:mga0yw44_2331_c1 | 3300050492 | Bacteria | 8037 |
| 1522 | nmdc:mga0yw44_242690_c1 | 3300050492 | Bacteria | 1198 |
| 1523 | nmdc:mga0yw44_331786_c1 | 3300050492 | Bacteria | 1022 |
| 1524 | nmdc:mga0yw44_34263_c1 | 3300050492 | Bacteria | 2974 |
| 1525 | nmdc:mga0k408_18012_c1 | 3300050493 | Bacteria | 3937 |
| 1526 | nmdc:mga0k408_238953_c1 | 3300050493 | Bacteria | 1085 |
| 1527 | nmdc:mga06z11_103129_c1 | 3300050494 | Bacteria | 1568 |
| 1528 | nmdc:mga06z11_55066_c1 | 3300050494 | Bacteria | 2053 |
| 1529 | nmdc:mga06z11_85073_c1 | 3300050494 | Bacteria | 1705 |
| 1530 | nmdc:mga04h51_12842_c1 | 3300050495 | Bacteria | 2360 |
| 1531 | nmdc:mga07m45_158907_c1 | 3300050496 | Bacteria | 1312 |
| 1532 | nmdc:mga07m45_8361_c1 | 3300050496 | Bacteria | 5316 |
| 1533 | nmdc:mga07m45_93596_c1 | 3300050496 | Bacteria | 1723 |
| 1534 | nmdc:mga05p37_555_c1 | 3300050507 | Bacteria | 41098 |
| 1535 | nmdc:mga05p37_63752_c1 | 3300050507 | Bacteria | 4535 |
| 1536 | nmdc:mga05p37_824366_c1 | 3300050507 | Bacteria | 1011 |
| 1537 | nmdc:mga09592_24376_c1 | 3300050508 | Bacteria | 5003 |
| 1538 | nmdc:mga0qj67_382736_c1 | 3300050509 | Bacteria | 1136 |
| 1539 | nmdc:mga06r32_187410_c1 | 3300050510 | Bacteria | 2056 |
| 1540 | nmdc:mga06r32_76341_c1 | 3300050510 | Bacteria | 3254 |
| 1541 | nmdc:mga08y16_134_c1 | 3300050511 | Bacteria | 64270 |
| 1542 | nmdc:mga08y16_527942_c1 | 3300050511 | Bacteria | 1196 |
| 1543 | nmdc:mga08y16_83711_c1 | 3300050511 | Bacteria | 3325 |
| 1544 | nmdc:mga0n895_107862_c1 | 3300050512 | Bacteria | 2799 |
| 1545 | nmdc:mga0n895_168242_c1 | 3300050512 | Bacteria | 2224 |
| 1546 | nmdc:mga0n895_281199_c1 | 3300050512 | Bacteria | 1687 |
| 1547 | nmdc:mga0n895_371837_c1 | 3300050512 | Bacteria | 1447 |
| 1548 | nmdc:mga0rr50_23433_c1 | 3300050513 | Bacteria | 4257 |
| 1549 | nmdc:mga0rr50_289107_c1 | 3300050513 | Bacteria | 1369 |
| 1550 | nmdc:mga0sz30_176696_c1 | 3300050516 | Bacteria | 947 |
| 1551 | nmdc:mga0sz30_38397_c1 | 3300050516 | Bacteria | 2006 |
| 1552 | Ga0495601_0000004 | 3300053077 | Bacteria | 449178 |
| 1553 | Ga0495601_0074263 | 3300053077 | Bacteria | 2175 |
| 1554 | Ga0495601_0241907 | 3300053077 | Bacteria | 1178 |
| 1555 | Ga0495612_0000008 | 3300053078 | Bacteria | 232633 |
| 1556 | Ga0495612_0012354 | 3300053078 | Bacteria | 3442 |
| 1557 | Ga0500635_0021603 | 3300053080 | Bacteria | 1984 |
| 1558 | Ga0495595_0000299 | 3300053084 | Bacteria | 19235 |
| 1559 | Ga0495595_0002435 | 3300053084 | Bacteria | 7270 |
| 1560 | Ga0495619_0000410 | 3300053085 | Bacteria | 29131 |
| 1561 | Ga0495619_0002051 | 3300053085 | Bacteria | 13376 |
| 1562 | Ga0495619_0107032 | 3300053085 | Bacteria | 1907 |
| 1563 | Ga0495619_0274955 | 3300053085 | Bacteria | 1167 |
| 1564 | Ga0500643_000035 | 3300053087 | Bacteria | 184794 |
| 1565 | Ga0500643_002043 | 3300053087 | Bacteria | 10818 |
| 1566 | Ga0500643_095135 | 3300053087 | Bacteria | 810 |
| 1567 | Ga0500583_0340185 | 3300053092 | Bacteria | 728 |
| 1568 | Ga0500651_0014239 | 3300053093 | Bacteria | 4864 |
| 1569 | Ga0500651_0019792 | 3300053093 | Bacteria | 4187 |
| 1570 | Ga0500651_0089411 | 3300053093 | Bacteria | 1898 |
| 1571 | Ga0500651_0097142 | 3300053093 | Bacteria | 1810 |
| 1572 | Ga0500566_0000006 | 3300053094 | Bacteria | 153632 |
| 1573 | Ga0500566_0003025 | 3300053094 | Bacteria | 10054 |
| 1574 | Ga0500566_0007070 | 3300053094 | Bacteria | 6646 |
| 1575 | Ga0500566_0020464 | 3300053094 | Bacteria | 3889 |
| 1576 | Ga0500566_0050700 | 3300053094 | Bacteria | 2376 |
| 1577 | Ga0500566_0122820 | 3300053094 | Bacteria | 1398 |
| 1578 | Ga0500640_000606 | 3300053095 | Bacteria | 9307 |
| 1579 | Ga0500641_0002166 | 3300053096 | Bacteria | 6961 |
| 1580 | Ga0500641_0009735 | 3300053096 | Bacteria | 3459 |
| 1581 | Ga0500641_0023876 | 3300053096 | Bacteria | 2355 |
| 1582 | Ga0500641_0064774 | 3300053096 | Bacteria | 1528 |
| 1583 | Ga0500650_0027948 | 3300053098 | Bacteria | 2541 |
| 1584 | Ga0500650_0094324 | 3300053098 | Bacteria | 1401 |
| 1585 | Ga0500555_006179 | 3300053103 | Bacteria | 3399 |
| 1586 | Ga0500555_077440 | 3300053103 | Bacteria | 869 |
| 1587 | Ga0500556_0000030 | 3300053104 | Bacteria | 165098 |
| 1588 | Ga0500556_0000734 | 3300053104 | Bacteria | 19756 |
| 1589 | Ga0500557_000004 | 3300053105 | Bacteria | 202318 |
| 1590 | Ga0500569_008206 | 3300053109 | Bacteria | 2379 |
| 1591 | Ga0500572_000132 | 3300053111 | Bacteria | 25301 |
| 1592 | Ga0500572_000296 | 3300053111 | Bacteria | 17781 |
| 1593 | Ga0500591_007207 | 3300053115 | Bacteria | 5111 |
| 1594 | Ga0500592_001857 | 3300053116 | Bacteria | 3405 |
| 1595 | Ga0500594_0015247 | 3300053118 | Bacteria | 1852 |
| 1596 | Ga0500594_0058113 | 3300053118 | Bacteria | 1108 |
| 1597 | Ga0500595_000306 | 3300053119 | Bacteria | 32239 |
| 1598 | Ga0500595_001509 | 3300053119 | Bacteria | 12362 |
| 1599 | Ga0500595_002915 | 3300053119 | Bacteria | 8182 |
| 1600 | Ga0500595_014140 | 3300053119 | Bacteria | 3035 |
| 1601 | Ga0500595_022512 | 3300053119 | Bacteria | 2229 |
| 1602 | Ga0500595_025262 | 3300053119 | Bacteria | 2062 |
| 1603 | Ga0500595_084980 | 3300053119 | Bacteria | 922 |
| 1604 | Ga0500607_055375 | 3300053121 | Bacteria | 2097 |
| 1605 | Ga0500608_045969 | 3300053122 | Bacteria | 2097 |
| 1606 | Ga0500614_001796 | 3300053123 | Bacteria | 4975 |
| 1607 | Ga0500614_034971 | 3300053123 | Bacteria | 1249 |
| 1608 | Ga0500642_0000080 | 3300053130 | Bacteria | 52024 |
| 1609 | Ga0500642_0000302 | 3300053130 | Bacteria | 17637 |
| 1610 | Ga0500642_0059969 | 3300053130 | Bacteria | 1705 |
| 1611 | Ga0500642_0145080 | 3300053130 | Bacteria | 1114 |
| 1612 | Ga0500652_001386 | 3300053131 | Bacteria | 7563 |
| 1613 | Ga0500652_061353 | 3300053131 | Bacteria | 1548 |
| 1614 | Ga0500655_021935 | 3300053133 | Bacteria | 1200 |
| 1615 | Ga0500658_0191389 | 3300053134 | Bacteria | 934 |
| 1616 | Ga0500559_0000591 | 3300053136 | Bacteria | 24715 |
| 1617 | Ga0500559_0000850 | 3300053136 | Bacteria | 19692 |
| 1618 | Ga0500559_0001859 | 3300053136 | Bacteria | 11495 |
| 1619 | Ga0500559_0067160 | 3300053136 | Bacteria | 1609 |
| 1620 | Ga0500559_0102365 | 3300053136 | Bacteria | 1320 |
| 1621 | Ga0500559_0228383 | 3300053136 | Bacteria | 877 |
| 1622 | Ga0500568_0000978 | 3300053139 | Bacteria | 19672 |
| 1623 | Ga0500568_0014177 | 3300053139 | Bacteria | 3608 |
| 1624 | Ga0500568_0014813 | 3300053139 | Bacteria | 3508 |
| 1625 | Ga0500568_0023458 | 3300053139 | Bacteria | 2624 |
| 1626 | Ga0500568_0110948 | 3300053139 | Bacteria | 1025 |
| 1627 | Ga0500568_0162847 | 3300053139 | Bacteria | 823 |
| 1628 | Ga0500588_0059060 | 3300053146 | Bacteria | 1223 |
| 1629 | Ga0500588_0060830 | 3300053146 | Bacteria | 1210 |
| 1630 | Ga0500588_0128155 | 3300053146 | Bacteria | 901 |
| 1631 | Ga0500603_000125 | 3300053150 | Bacteria | 18162 |
| 1632 | Ga0500603_016027 | 3300053150 | Bacteria | 1773 |
| 1633 | Ga0500603_021405 | 3300053150 | Bacteria | 1590 |
| 1634 | Ga0500603_049058 | 3300053150 | Bacteria | 1150 |
| 1635 | Ga0500604_0004650 | 3300053151 | Bacteria | 3636 |
| 1636 | Ga0500604_0035375 | 3300053151 | Bacteria | 1486 |
| 1637 | Ga0500604_0048977 | 3300053151 | Bacteria | 1299 |
| 1638 | Ga0500616_0000252 | 3300053153 | Bacteria | 83060 |
| 1639 | Ga0500616_0000696 | 3300053153 | Bacteria | 39234 |
| 1640 | Ga0500616_0015478 | 3300053153 | Bacteria | 4360 |
| 1641 | Ga0500616_0055865 | 3300053153 | Bacteria | 2062 |
| 1642 | Ga0500620_001207 | 3300053155 | Bacteria | 4624 |
| 1643 | Ga0500622_0002597 | 3300053156 | Bacteria | 12869 |
| 1644 | Ga0500622_0003061 | 3300053156 | Bacteria | 11537 |
| 1645 | Ga0500622_0088897 | 3300053156 | Bacteria | 1536 |
| 1646 | Ga0500627_0219046 | 3300053158 | Bacteria | 850 |
| 1647 | Ga0500627_0279057 | 3300053158 | Bacteria | 734 |
| 1648 | Ga0500630_029525 | 3300053159 | Bacteria | 2697 |
| 1649 | Ga0500634_0007858 | 3300053161 | Bacteria | 5295 |
| 1650 | Ga0500634_0119245 | 3300053161 | Bacteria | 1287 |
| 1651 | Ga0500638_001134 | 3300053162 | Bacteria | 7959 |
| 1652 | Ga0500638_032065 | 3300053162 | Bacteria | 2536 |
| 1653 | Ga0500638_045989 | 3300053162 | Bacteria | 2117 |
| 1654 | Ga0500638_104409 | 3300053162 | Bacteria | 1317 |
| 1655 | Ga0500639_000016 | 3300053163 | Bacteria | 118099 |
| 1656 | Ga0500639_043671 | 3300053163 | Bacteria | 2349 |
| 1657 | Ga0500639_197036 | 3300053163 | Bacteria | 870 |
| 1658 | Ga0500636_0000066 | 3300053177 | Bacteria | 51367 |
| 1659 | Ga0500636_0000534 | 3300053177 | Bacteria | 20700 |
| 1660 | Ga0500636_0006053 | 3300053177 | Bacteria | 6941 |
| 1661 | Ga0500636_0046789 | 3300053177 | Bacteria | 2550 |
| 1662 | Ga0500637_0001307 | 3300053178 | Bacteria | 10481 |
| 1663 | Ga0500637_0095998 | 3300053178 | Bacteria | 1717 |
| 1664 | Ga0500576_039982 | 3300053725 | Bacteria | 2114 |
| 1665 | Ga0500625_000123 | 3300053729 | Bacteria | 15150 |
| 1666 | Ga0500645_015900 | 3300053730 | Bacteria | 2378 |
| 1667 | Ga0500645_051528 | 3300053730 | Bacteria | 1200 |
| 1668 | Ga0500599_009161 | 3300053736 | Bacteria | 1293 |
| 1669 | Ga0500601_000139 | 3300053737 | Bacteria | 14822 |
| 1670 | Ga0500601_002260 | 3300053737 | Bacteria | 2070 |
| 1671 | Ga0501084_0005685 | 3300054114 | Bacteria | 10240 |
| 1672 | Ga0501084_0020558 | 3300054114 | Bacteria | 5505 |
| 1673 | Ga0501084_0220459 | 3300054114 | Bacteria | 1600 |
| 1674 | Ga0501082_0000799 | 3300060353 | Bacteria | 27707 |
| 1675 | Ga0501082_0028947 | 3300060353 | Bacteria | 4771 |
| 1676 | Ga0501082_0797946 | 3300060353 | Bacteria | 826 |
| 1677 | 2513657908 | 2513237096 | Bacteria | 8722461 |
| 1678 | 2513855604 | 2513237137 | Bacteria | 9558895 |
| 1679 | 2513890243 | 2513237141 | Bacteria | 8496279 |
| 1680 | 2513919999 | 2513237145 | Bacteria | 8979722 |
| 1681 | 2515627145 | 2515154112 | Bacteria | 8294334 |
| 1682 | 2517892149 | 2517572143 | Bacteria | 9484767 |
| 1683 | 2524465746 | 2524023210 | Bacteria | 9029266 |
| 1684 | 2524534250 | 2524023228 | Bacteria | 10118060 |
| 1685 | 2528853891 | 2528768022 | Bacteria | 10457665 |
| 1686 | 2603859677 | 2602042107 | Bacteria | 6226103 |
| 1687 | 2644288849 | 2643221651 | Bacteria | 4798932 |
| 1688 | 2793062744 | 2791355196 | Bacteria | 7323613 |
| 1689 | 2793082406 | |||
| 1690 | 2805915107 | 2802429603 | Bacteria | 8777136 |
| 1691 | 2824604119 | 2824600985 | Bacteria | 8488197 |
| 1692 | 2824610388 | 2824609381 | Bacteria | 8672835 |
| 1693 | 2824659417 | 2824653114 | Bacteria | 8493680 |
| 1694 | 2824668831 | 2824661429 | Bacteria | 9877870 |
| 1695 | 2824703873 | 2824696289 | Bacteria | 8335049 |
| 1696 | 2824733312 | 2824732956 | Bacteria | 7810675 |
| 1697 | 2842040035 | 2842038055 | Bacteria | 8002051 |
| 1698 | 2842047020 | 2842045827 | Bacteria | 8006841 |
| 1699 | 2847946795 | 2847939898 | Bacteria | 8606328 |
| 1700 | 2857528924 | 2857524615 | Bacteria | 6615449 |
| 1701 | 2874598281 | 2874590934 | Bacteria | 8299676 |
| 1702 | 2874627570 | 2874620515 | Bacteria | 8290088 |
| 1703 | 2874652663 | 2874645413 | Bacteria | 8214782 |
| 1704 | 2876778241 | 2876771140 | Bacteria | 8287509 |
| 1705 | 2876825890 | 2876818435 | Bacteria | 8274608 |
| 1706 | 2879082035 | 2879074833 | Bacteria | 8279565 |
| 1707 | 2879104879 | 2879099564 | Bacteria | 10442239 |
| 1708 | 2879135157 | 2879127579 | Bacteria | 8294491 |
| 1709 | 2879145484 | 2879142872 | Bacteria | 8267021 |
| 1710 | 2885382753 | 2885374607 | Bacteria | 8927485 |
| 1711 | 2885386791 | 2885383462 | Bacteria | 9473874 |
| 1712 | 2888424763 | 2888419890 | Bacteria | 7857137 |
| 1713 | 2893070381 | 2893066018 | Bacteria | 6158120 |
| 1714 | 2903771796 | 2903768456 | Bacteria | 9749579 |
| 1715 | 2904673110 | 2904666416 | Bacteria | 8226587 |
| 1716 | 2904702293 | |||
| 1717 | 2906617277 | |||
| 1718 | 2906643332 | 2906635258 | Bacteria | 8601019 |
| 1719 | 2906662538 | 2906660503 | Bacteria | 8595048 |
| 1720 | 2908742432 | 2908739725 | Bacteria | 8628932 |
| 1721 | 2919076324 | 2919073203 | Bacteria | 6531949 |
| 1722 | 2919454503 | 2919450847 | Bacteria | 5631160 |
| 1723 | 2922374675 | |||
| 1724 | 2922430550 | |||
| 1725 | 2929621765 | 2929615660 | Bacteria | 9193770 |
| 1726 | 2929629928 | 2929624759 | Bacteria | 9339455 |
| 1727 | 2932788617 | 2932784394 | Bacteria | 9704911 |
| 1728 | 2932817200 | 2932809354 | Bacteria | 9135765 |
| 1729 | 2932825211 | 2932818245 | Bacteria | 9955613 |
| 1730 | 2932830265 | 2932828146 | Bacteria | 9745859 |
| 1731 | 2933583959 | 2933577622 | Bacteria | 9116884 |
| 1732 | 2935622509 | 2935616580 | Bacteria | 9032984 |
| 1733 | 2935642114 | 2935638405 | Bacteria | 10015038 |
| 1734 | 2935672502 | 2935665750 | Bacteria | 9571747 |
| 1735 | 2935676033 | 2935675223 | Bacteria | 9928132 |
| 1736 | 2935686025 | 2935684952 | Bacteria | 9590419 |
| 1737 | 2935697731 | 2935694250 | Bacteria | 9291695 |
| 1738 | 2935705865 | 2935703347 | Bacteria | 10242284 |
| 1739 | 2935714577 | 2935713505 | Bacteria | 9608509 |
| 1740 | 2935725196 | 2935722832 | Bacteria | 9608746 |
| 1741 | 2935732444 | 2935732158 | Bacteria | 9706831 |
| 1742 | 2935741823 | 2935741537 | Bacteria | 9707219 |
| 1743 | 2935751990 | 2935750917 | Bacteria | 9590372 |
| 1744 | 2935765247 | 2935760218 | Bacteria | 9817913 |
| 1745 | 2935802862 | 2935801545 | Bacteria | 9301974 |
| 1746 | 2935813306 | 2935810662 | Bacteria | 9401221 |
| 1747 | 2935830281 | 2935827899 | Bacteria | 10038562 |
| 1748 | 2935838178 | 2935837841 | Bacteria | 9454360 |
| 1749 | 2935860758 | 2935855204 | Bacteria | 9035059 |
| 1750 | 2935872269 | 2935864058 | Bacteria | 9784707 |
| 1751 | 2935878676 | 2935873716 | Bacteria | 9632195 |
| 1752 | 2935978639 | 2935975950 | Bacteria | 8347125 |
| 1753 | 2935994928 | 2935992306 | Bacteria | 9802711 |
| 1754 | 2936003571 | 2936002035 | Bacteria | 9362176 |
| 1755 | 2936042255 | 2936037263 | Bacteria | 9446081 |
| 1756 | 2940557207 | 2940556831 | Bacteria | 9590747 |
| 1757 | 2941539155 | 2941538514 | Bacteria | 9402094 |
| 1758 | 3005510550 | 3005506211 | Bacteria | 6943378 |
| 1759 | 3005715132 | 3005710791 | Bacteria | 7622528 |
| 1760 | 8006940422 | 8006933436 | Bacteria | 10410654 |
| 1761 | 8006980110 | 8006973647 | Bacteria | 10679141 |
| 1762 | 8016522043 | 8016511872 | Bacteria | 9921665 |
| 1763 | 8017063625 | 8017057580 | Bacteria | 10023680 |
| 1764 | 8019556304 | 8019555841 | Bacteria | 9642137 |
| 1765 | 8019569011 | 8019565922 | Bacteria | 9639779 |
| 1766 | 8019582951 | 8019576017 | Bacteria | 10049540 |
| 1767 | 8019590750 | 8019586578 | Bacteria | 10212056 |
| 1768 | 8019600603 | 8019597564 | Bacteria | 10041141 |
| 1769 | 8019617943 | 8019608314 | Bacteria | 10042931 |
| 1770 | 8019628436 | 8019619141 | Bacteria | 9218857 |
| 1771 | 8019645530 | 8019638758 | Bacteria | 9062356 |
| 1772 | 8019671598 | 8019668869 | Bacteria | 8791617 |
| 1773 | 8019684503 | 8019678201 | Bacteria | 8863603 |
| 1774 | 8055746069 | 8055742211 | Bacteria | 9226248 |
| 1775 | 8056687374 | 8056681323 | Bacteria | 8472857 |
| 1776 | 8056691283 | 8056689827 | Bacteria | 6712655 |
| 1777 | JGI25404J52841_10030344 | |||
| 1778 | RicEn_C9014 | |||
| 1779 | MBSR1b_contig_11443562 | |||
| 1780 | MBSR1b_contig_12173630 | |||
| 1781 | CNAas_1004010 | |||
| 1782 | JGI24740J21852_10015785 | |||
| 1783 | JGI24739J22299_10029215 | |||
| 1784 | JGI24737J22298_10006476 | |||
| 1785 | JGI24735J21928_10007461 | |||
| 1786 | JGI24744J21845_10042665 | |||
| 1787 | JGI25406J46586_10000047 | |||
| 1788 | JGI25153J46596_10001251 | |||
| 1789 | JGI25153J46596_10002613 | |||
| 1790 | JGI25153J46596_10002759 | |||
| 1791 | JGI25153J46596_10005940 | |||
| 1792 | JGI25160J50197_1002757 | |||
| 1793 | JGI25160J50197_1032891 | |||
| 1794 | JGI25404J52841_10010459 | |||
| 1795 | JGI25404J52841_10019235 | |||
| 1796 | Ga0055531_10022839 | |||
| 1797 | Ga0065165_1000231 | |||
| 1798 | Ga0065165_1001895 | |||
| 1799 | Ga0065712_10231883 | |||
| 1800 | Ga0065715_10160419 | |||
| 1801 | Ga0070658_10165438 | |||
| 1802 | Ga0070658_10194684 | |||
| 1803 | Ga0070658_10207247 | |||
| 1804 | Ga0070658_10344647 | |||
| 1805 | Ga0070658_10370198 | |||
| 1806 | Ga0070658_10637307 | |||
| 1807 | Ga0070676_10114075 | |||
| 1808 | Ga0070676_10124974 | |||
| 1809 | Ga0070676_10169066 | |||
| 1810 | Ga0070676_10216748 | |||
| 1811 | Ga0070676_10245939 | |||
| 1812 | Ga0070683_100015898 | |||
| 1813 | Ga0070683_100087298 | |||
| 1814 | Ga0070683_100090477 | |||
| 1815 | Ga0070670_100002084 | |||
| 1816 | Ga0070670_100018067 | |||
| 1817 | Ga0070670_100113796 | |||
| 1818 | Ga0070670_100127870 | |||
| 1819 | Ga0070670_100153040 | |||
| 1820 | Ga0070670_100171499 | |||
| 1821 | Ga0070677_10060360 | |||
| 1822 | Ga0070677_10086571 | |||
| 1823 | Ga0068869_100022270 | |||
| 1824 | Ga0068869_100030572 | |||
| 1825 | Ga0068869_100055456 | |||
| 1826 | Ga0068869_100119055 | |||
| 1827 | Ga0070666_10001973 | |||
| 1828 | Ga0070680_100055713 | |||
| 1829 | Ga0070680_100125785 | |||
| 1830 | Ga0070680_100169644 | |||
| 1831 | Ga0070680_100477499 | |||
| 1832 | Ga0070682_100617722 | |||
| 1833 | Ga0068868_100025524 | |||
| 1834 | Ga0068868_100109714 | |||
| 1835 | Ga0068868_100197211 | |||
| 1836 | Ga0068868_100254272 | |||
| 1837 | Ga0068868_100590422 | |||
| 1838 | Ga0070689_100055865 | |||
| 1839 | Ga0070689_100311686 | |||
| 1840 | Ga0070687_100262463 | |||
| 1841 | Ga0070661_100017395 | |||
| 1842 | Ga0070661_100357733 | |||
| 1843 | Ga0070661_100521967 | |||
| 1844 | Ga0070668_100002309 | |||
| 1845 | Ga0070668_100048482 | |||
| 1846 | Ga0070668_100051684 | |||
| 1847 | Ga0070668_100054079 | |||
| 1848 | Ga0070668_100066405 | |||
| 1849 | Ga0070668_100086847 | |||
| 1850 | Ga0070668_100138652 | |||
| 1851 | Ga0070668_100154631 | |||
| 1852 | Ga0070668_100194541 | |||
| 1853 | Ga0070669_100012022 | |||
| 1854 | Ga0070669_100086727 | |||
| 1855 | Ga0070669_100305981 | |||
| 1856 | Ga0070669_100309468 | |||
| 1857 | Ga0070669_100727184 | |||
| 1858 | Ga0070675_100012309 | |||
| 1859 | Ga0070675_100171402 | |||
| 1860 | Ga0070675_100394506 | |||
| 1861 | Ga0070675_100616539 | |||
| 1862 | Ga0070671_100081489 | |||
| 1863 | Ga0070671_100256534 | |||
| 1864 | Ga0070674_100058334 | |||
| 1865 | Ga0070674_100066308 | |||
| 1866 | Ga0070674_100093562 | |||
| 1867 | Ga0070673_100033023 | |||
| 1868 | Ga0070688_100042310 | |||
| 1869 | Ga0070688_100089017 | |||
| 1870 | Ga0070688_100345454 | |||
| 1871 | Ga0070688_100347563 | |||
| 1872 | Ga0070659_100053564 | |||
| 1873 | Ga0070659_100086855 | |||
| 1874 | Ga0070659_100173060 | |||
| 1875 | Ga0070659_100248514 | |||
| 1876 | Ga0070667_100000717 | |||
| 1877 | Ga0070667_100002487 | |||
| 1878 | Ga0070667_100066866 | |||
| 1879 | Ga0070667_100123547 | |||
| 1880 | Ga0070667_100243371 | |||
| 1881 | Ga0070709_10022117 | |||
| 1882 | Ga0070709_10073503 | |||
| 1883 | Ga0070714_100094761 | |||
| 1884 | Ga0070714_100119588 | |||
| 1885 | Ga0070714_100134340 | |||
| 1886 | Ga0070714_100269266 | |||
| 1887 | Ga0070713_100012226 | |||
| 1888 | Ga0070713_100017595 | |||
| 1889 | Ga0070713_100031275 | |||
| 1890 | Ga0070713_100056841 | |||
| 1891 | Ga0070713_100322617 | |||
| 1892 | Ga0070713_100438726 | |||
| 1893 | Ga0070713_100439077 | |||
| 1894 | Ga0070710_10001119 | |||
| 1895 | Ga0070710_10008886 | |||
| 1896 | Ga0070711_100002712 | |||
| 1897 | Ga0070711_100009524 | |||
| 1898 | Ga0070711_100010921 | |||
| 1899 | Ga0070711_100011141 | |||
| 1900 | Ga0070711_100745116 | |||
| 1901 | Ga0070711_100855811 | |||
| 1902 | Ga0070705_100232952 | |||
| 1903 | Ga0070663_100015227 | |||
| 1904 | Ga0070663_100051820 | |||
| 1905 | Ga0070663_100062227 | |||
| 1906 | Ga0070663_100152888 | |||
| 1907 | Ga0070663_100164430 | |||
| 1908 | Ga0070663_100213032 | |||
| 1909 | Ga0070663_100324666 | |||
| 1910 | Ga0070663_100357832 | |||
| 1911 | Ga0070663_100383908 | |||
| 1912 | Ga0070663_100569587 | |||
| 1913 | Ga0070678_100063529 | |||
| 1914 | Ga0070678_100064365 | |||
| 1915 | Ga0070678_100089137 | |||
| 1916 | Ga0070678_100122526 | |||
| 1917 | Ga0070678_100600104 | |||
| 1918 | Ga0070678_100609639 | |||
| 1919 | Ga0070662_100209541 | |||
| 1920 | Ga0070662_100287692 | |||
| 1921 | Ga0070662_100303939 | |||
| 1922 | Ga0070662_100392978 | |||
| 1923 | Ga0070662_100767566 | |||
| 1924 | Ga0070681_10042518 | |||
| 1925 | Ga0070681_10520516 | |||
| 1926 | Ga0068867_100002382 | |||
| 1927 | Ga0068867_100106659 | |||
| 1928 | Ga0068867_100110721 | |||
| 1929 | Ga0068867_100184555 | |||
| 1930 | Ga0068867_100497686 | |||
| 1931 | Ga0070685_10058405 | |||
| 1932 | Ga0070685_10263209 | |||
| 1933 | Ga0070698_100299253 | |||
| 1934 | Ga0070699_100064968 | |||
| 1935 | Ga0070679_100691351 | |||
| 1936 | Ga0070684_100009002 | |||
| 1937 | Ga0070684_100094774 | |||
| 1938 | Ga0070684_100098651 | |||
| 1939 | Ga0068853_100008769 | |||
| 1940 | Ga0068853_100093792 | |||
| 1941 | Ga0068853_100113245 | |||
| 1942 | Ga0068853_100372887 | |||
| 1943 | Ga0068853_100462143 | |||
| 1944 | Ga0070672_100002140 | |||
| 1945 | Ga0070672_100018833 | |||
| 1946 | Ga0070672_100084879 | |||
| 1947 | Ga0070672_100223410 | |||
| 1948 | Ga0070672_100248799 | |||
| 1949 | Ga0070695_100161572 | |||
| 1950 | Ga0070693_100070672 | |||
| 1951 | Ga0070693_100092518 | |||
| 1952 | Ga0070693_100509863 | |||
| 1953 | Ga0070665_100010979 | |||
| 1954 | Ga0070665_100025000 | |||
| 1955 | Ga0070665_100033934 | |||
| 1956 | Ga0070665_100051133 | |||
| 1957 | Ga0070665_100116171 | |||
| 1958 | Ga0070665_100290413 | |||
| 1959 | Ga0070665_100902553 | |||
| 1960 | Ga0070704_100508401 | |||
| 1961 | Ga0068855_100018065 | |||
| 1962 | Ga0068855_100033896 | |||
| 1963 | Ga0068855_100058388 | |||
| 1964 | Ga0068855_100110620 | |||
| 1965 | Ga0068855_100134302 | |||
| 1966 | Ga0068855_100150475 | |||
| 1967 | Ga0068855_100235716 | |||
| 1968 | Ga0068855_100240817 | |||
| 1969 | Ga0068855_100384354 | |||
| 1970 | Ga0070664_100012841 | |||
| 1971 | Ga0070664_100479462 | |||
| 1972 | Ga0070664_100492018 | |||
| 1973 | Ga0068857_100007461 | |||
| 1974 | Ga0068857_100011475 | |||
| 1975 | Ga0068857_100017624 | |||
| 1976 | Ga0068857_100028310 | |||
| 1977 | Ga0068854_100027763 | |||
| 1978 | Ga0068854_100036078 | |||
| 1979 | Ga0068854_100160752 | |||
| 1980 | Ga0068854_100184747 | |||
| 1981 | Ga0068854_100881687 | |||
| 1982 | Ga0068856_100000020 | |||
| 1983 | Ga0068856_100018098 | |||
| 1984 | Ga0068856_100026301 | |||
| 1985 | Ga0068856_100040303 | |||
| 1986 | Ga0068856_100077346 | |||
| 1987 | Ga0068856_100146436 | |||
| 1988 | Ga0068856_100242967 | |||
| 1989 | Ga0068856_100469858 | |||
| 1990 | Ga0068856_100861800 | |||
| 1991 | Ga0068856_100880146 | |||
| 1992 | Ga0070702_100132032 | |||
| 1993 | Ga0068852_100013378 | |||
| 1994 | Ga0068852_100031347 | |||
| 1995 | Ga0068852_100038673 | |||
| 1996 | Ga0068852_100180689 | |||
| 1997 | Ga0068852_100184449 | |||
| 1998 | Ga0068852_100733175 | |||
| 1999 | Ga0068859_100003527 | |||
| 2000 | Ga0068859_100006173 | |||
| 2001 | Ga0068859_100072923 | |||
| 2002 | Ga0068859_100144919 | |||
| 2003 | Ga0068859_100306737 | |||
| 2004 | Ga0068859_100351852 | |||
| 2005 | Ga0068864_100004761 | |||
| 2006 | Ga0068864_100150503 | |||
| 2007 | Ga0068864_100261260 | |||
| 2008 | Ga0068864_100629097 | |||
| 2009 | Ga0068866_10122401 | |||
| 2010 | Ga0068866_10122460 | |||
| 2011 | Ga0068861_100016661 | |||
| 2012 | Ga0068861_100038919 | |||
| 2013 | Ga0068861_100196324 | |||
| 2014 | Ga0068861_100387494 | |||
| 2015 | Ga0068861_100433784 | |||
| 2016 | Ga0068861_100741319 | |||
| 2017 | Ga0068851_10064709 | |||
| 2018 | Ga0068870_10035764 | |||
| 2019 | Ga0068863_100002512 | |||
| 2020 | Ga0068863_100141628 | |||
| 2021 | Ga0068863_100154091 | |||
| 2022 | Ga0068863_100627486 | |||
| 2023 | Ga0068863_100747614 | |||
| 2024 | Ga0068858_100015036 | |||
| 2025 | Ga0068858_100015457 | |||
| 2026 | Ga0068858_100071113 | |||
| 2027 | Ga0068858_100238546 | |||
| 2028 | Ga0068858_100314077 | |||
| 2029 | Ga0068860_100004964 | |||
| 2030 | Ga0068860_100016614 | |||
| 2031 | Ga0068860_100134343 | |||
| 2032 | Ga0068860_100186064 | |||
| 2033 | Ga0068862_100053426 | |||
| 2034 | Ga0068862_100136416 | |||
| 2035 | Ga0068862_100151638 | |||
| 2036 | Ga0068862_100281455 | |||
| 2037 | Ga0068862_100622576 | |||
| 2038 | Ga0081455_10011418 | |||
| 2039 | Ga0081455_10015893 | |||
| 2040 | Ga0081455_10019603 | |||
| 2041 | Ga0081455_10107769 | |||
| 2042 | Ga0081455_10185143 | |||
| 2043 | Ga0081455_10256787 | |||
| 2044 | Ga0081538_10020678 | |||
| 2045 | Ga0081538_10035977 | |||
| 2046 | Ga0081538_10088860 | |||
| 2047 | Ga0081540_1002344 | |||
| 2048 | Ga0081540_1002625 | |||
| 2049 | Ga0081540_1002868 | |||
| 2050 | Ga0081540_1003998 | |||
| 2051 | Ga0081540_1004409 | |||
| 2052 | Ga0081540_1009104 | |||
| 2053 | Ga0081540_1011513 | |||
| 2054 | Ga0081540_1011628 | |||
| 2055 | Ga0081540_1079725 | |||
| 2056 | Ga0081539_10000140 | |||
| 2057 | Ga0081539_10002339 | |||
| 2058 | Ga0081539_10013499 | |||
| 2059 | Ga0081539_10216929 | |||
| 2060 | Ga0070717_10006527 | |||
| 2061 | Ga0070717_10006998 | |||
| 2062 | Ga0070717_10186429 | |||
| 2063 | Ga0070717_10339744 | |||
| 2064 | Ga0070717_10650840 | |||
| 2065 | Ga0075365_10011414 | |||
| 2066 | Ga0075365_10029922 | |||
| 2067 | Ga0075365_10130201 | |||
| 2068 | Ga0075365_10157299 | |||
| 2069 | Ga0075365_10163822 | |||
| 2070 | Ga0075365_10383542 | |||
| 2071 | Ga0075368_10028834 | |||
| 2072 | Ga0075363_100036824 | |||
| 2073 | Ga0075364_10003703 | |||
| 2074 | Ga0075364_10072947 | |||
| 2075 | Ga0075364_10119027 | |||
| 2076 | Ga0075364_10180568 | |||
| 2077 | Ga0070715_10008241 | |||
| 2078 | Ga0070716_100008528 | |||
| 2079 | Ga0070716_100023937 | |||
| 2080 | Ga0070716_100041086 | |||
| 2081 | Ga0070716_100288551 | |||
| 2082 | Ga0070712_100046680 | |||
| 2083 | Ga0070712_100306568 | |||
| 2084 | Ga0075362_10000936 | |||
| 2085 | Ga0075362_10010211 | |||
| 2086 | Ga0075367_10032354 | |||
| 2087 | Ga0075367_10054501 | |||
| 2088 | Ga0075367_10168671 | |||
| 2089 | Ga0075367_10300260 | |||
| 2090 | Ga0075367_10321027 | |||
| 2091 | Ga0075369_10027395 | |||
| 2092 | Ga0075369_10042391 | |||
| 2093 | Ga0075369_10103873 | |||
| 2094 | Ga0075369_10124081 | |||
| 2095 | Ga0075366_10018977 | |||
| 2096 | Ga0075366_10083204 | |||
| 2097 | Ga0075366_10084065 | |||
| 2098 | Ga0097621_100005789 | |||
| 2099 | Ga0075370_10040001 | |||
| 2100 | Ga0075370_10053825 | |||
| 2101 | Ga0075370_10166004 | |||
| 2102 | Ga0075370_10234330 | |||
| 2103 | Ga0068871_100000813 | |||
| 2104 | Ga0068871_100130759 | |||
| 2105 | Ga0068871_100219261 | |||
| 2106 | Ga0068871_100272918 | |||
| 2107 | Ga0075428_100703330 | |||
| 2108 | Ga0075428_100833846 | |||
| 2109 | Ga0075430_100037645 | |||
| 2110 | Ga0075431_100000053 | |||
| 2111 | Ga0075431_100077710 | |||
| 2112 | Ga0075433_10931035 | |||
| 2113 | Ga0075434_100008412 | |||
| 2114 | Ga0075434_100443215 | |||
| 2115 | Ga0075434_100487130 | |||
| 2116 | Ga0075429_100004405 | |||
| 2117 | Ga0068865_100055402 | |||
| 2118 | Ga0068865_100079979 | |||
| 2119 | Ga0068865_100136475 | |||
| 2120 | Ga0068865_100220517 | |||
| 2121 | Ga0097620_100003527 | |||
| 2122 | Ga0097620_100006173 | |||
| 2123 | Ga0097620_100072924 | |||
| 2124 | Ga0097620_100144929 | |||
| 2125 | Ga0097620_100306733 | |||
| 2126 | Ga0097620_100351852 | |||
| 2127 | Ga0097620_100369142 | |||
| 2128 | Ga0099824_1027583 | |||
| 2129 | Ga0099822_1018498 | |||
| 2130 | Ga0099823_1041378 | |||
| 2131 | Ga0075435_100106719 | |||
| 2132 | Ga0075435_100175049 | |||
| 2133 | Ga0075435_100592884 | |||
| 2134 | Ga0099795_10001696 | |||
| 2135 | Ga0099795_10024080 | |||
| 2136 | Ga0105244_10168463 | |||
| 2137 | Ga0105250_10178674 | |||
| 2138 | Ga0105240_10024133 | |||
| 2139 | Ga0105240_10024314 | |||
| 2140 | Ga0105240_10036283 | |||
| 2141 | Ga0105240_10056335 | |||
| 2142 | Ga0105240_10259071 | |||
| 2143 | Ga0105240_10477877 | |||
| 2144 | Ga0105240_10719906 | |||
| 2145 | Ga0111539_10001519 | |||
| 2146 | Ga0111539_10482233 | |||
| 2147 | Ga0105245_10127220 | |||
| 2148 | Ga0105245_10206696 | |||
| 2149 | Ga0105245_10268159 | |||
| 2150 | Ga0105245_10449482 | |||
| 2151 | Ga0105247_10047475 | |||
| 2152 | Ga0105247_10068755 | |||
| 2153 | Ga0105247_10085701 | |||
| 2154 | Ga0105247_10270735 | |||
| 2155 | Ga0105247_10349675 | |||
| 2156 | Ga0105247_10448956 | |||
| 2157 | Ga0114129_10000237 | |||
| 2158 | Ga0114129_10115255 | |||
| 2159 | Ga0114129_10649821 | |||
| 2160 | Ga0105243_10215572 | |||
| 2161 | Ga0105243_10288253 | |||
| 2162 | Ga0105243_10574995 | |||
| 2163 | Ga0105243_10759037 | |||
| 2164 | Ga0105241_10005393 | |||
| 2165 | Ga0105242_10415613 | |||
| 2166 | Ga0105242_10910606 | |||
| 2167 | Ga0105248_10031493 | |||
| 2168 | Ga0105248_10040960 | |||
| 2169 | Ga0105248_10138684 | |||
| 2170 | Ga0105248_10161950 | |||
| 2171 | Ga0105248_10530924 | |||
| 2172 | Ga0105248_10724907 | |||
| 2173 | Ga0105248_10966468 | |||
| 2174 | Ga0105237_10032997 | |||
| 2175 | Ga0105237_10039060 | |||
| 2176 | Ga0105237_10049678 | |||
| 2177 | Ga0105237_10060279 | |||
| 2178 | Ga0105237_10131130 | |||
| 2179 | Ga0105237_10326674 | |||
| 2180 | Ga0105237_10544309 | |||
| 2181 | Ga0105237_11291647 | |||
| 2182 | Ga0105238_10024393 | |||
| 2183 | Ga0105238_10029388 | |||
| 2184 | Ga0105238_10033691 | |||
| 2185 | Ga0105238_10042528 | |||
| 2186 | Ga0105238_11320721 | |||
| 2187 | Ga0105249_10104490 | |||
| 2188 | Ga0105249_10177895 | |||
| 2189 | Ga0105249_10572356 | |||
| 2190 | Ga0099796_10098601 | |||
| 2191 | Ga0099796_10165123 | |||
| 2192 | Ga0105239_10022985 | |||
| 2193 | Ga0105239_10058272 | |||
| 2194 | Ga0105239_10113597 | |||
| 2195 | Ga0105239_10147331 | |||
| 2196 | Ga0105239_10367642 | |||
| 2197 | Ga0105239_10454692 | |||
| 2198 | Ga0105239_10768292 | |||
| 2199 | Ga0105239_11390993 | |||
| 2200 | Ga0105246_10045034 | |||
| 2201 | Ga0105246_10501460 | |||
| 2202 | Ga0105246_10734930 | |||
| 2203 | Ga0157373_10028400 | |||
| 2204 | Ga0157370_10024117 | |||
| 2205 | Ga0157370_10035604 | |||
| 2206 | Ga0157370_10163274 | |||
| 2207 | Ga0157369_10066878 | |||
| 2208 | Ga0157369_10121671 | |||
| 2209 | Ga0157369_10133599 | |||
| 2210 | Ga0157369_10161906 | |||
| 2211 | Ga0157374_10015540 | |||
| 2212 | Ga0157374_10055850 | |||
| 2213 | Ga0157374_10477331 | |||
| 2214 | Ga0157374_11113050 | |||
| 2215 | Ga0157378_10040048 | |||
| 2216 | Ga0157378_10222369 | |||
| 2217 | Ga0157378_10223517 | |||
| 2218 | Ga0163162_10010727 | |||
| 2219 | Ga0163162_10099437 | |||
| 2220 | Ga0163162_10207523 | |||
| 2221 | Ga0163162_10321889 | |||
| 2222 | Ga0163162_10464215 | |||
| 2223 | Ga0163162_10828920 | |||
| 2224 | Ga0157372_10021376 | |||
| 2225 | Ga0157372_10051549 | |||
| 2226 | Ga0157372_10140535 | |||
| 2227 | Ga0157375_10013707 | |||
| 2228 | Ga0157375_10087749 | |||
| 2229 | Ga0157375_10225401 | |||
| 2230 | Ga0157375_10298186 | |||
| 2231 | Ga0157375_10367945 | |||
| 2232 | Ga0157375_10373696 | |||
| 2233 | Ga0163163_10044076 | |||
| 2234 | Ga0163163_10056151 | |||
| 2235 | Ga0163163_10202275 | |||
| 2236 | Ga0163163_10453639 | |||
| 2237 | Ga0163163_10629086 | |||
| 2238 | Ga0163163_10672981 | |||
| 2239 | Ga0157380_10035710 | |||
| 2240 | Ga0157380_10136705 | |||
| 2241 | Ga0157380_10143174 | |||
| 2242 | Ga0157380_11240002 | |||
| 2243 | Ga0182008_10036255 | |||
| 2244 | Ga0157377_10060620 | |||
| 2245 | Ga0157377_10118916 | |||
| 2246 | Ga0157379_10002865 | |||
| 2247 | Ga0157379_10186976 | |||
| 2248 | Ga0157376_10122766 | |||
| 2249 | Ga0157376_10129606 | |||
| 2250 | Ga0157376_11176721 | |||
| 2251 | Ga0163161_10025727 | |||
| 2252 | Ga0163161_10026722 | |||
| 2253 | Ga0163161_10125701 | |||
| 2254 | Ga0214544_1000002 | |||
| 2255 | Ga0214544_1034706 | |||
| 2256 | Ga0214542_1000001 | |||
| 2257 | Ga0214542_1029424 | |||
| 2258 | Ga0214545_1000001 | |||
| 2259 | Ga0214545_1021309 | |||
| 2260 | Ga0214543_1000001 | |||
| 2261 | Ga0214543_1038078 | |||
| 2262 | Ga0213874_10022314 | |||
| 2263 | Ga0213876_10073813 | |||
| 2264 | Ga0213876_10252523 | |||
| 2265 | Ga0213871_10067354 | |||
| 2266 | Ga0209563_101475 | |||
| 2267 | Ga0209677_100463 | |||
| 2268 | Ga0209148_1000428 | |||
| 2269 | Ga0209233_1010958 | |||
| 2270 | Ga0209233_1031691 | |||
| 2271 | Ga0209455_1004564 | |||
| 2272 | Ga0209455_1006717 | |||
| 2273 | Ga0209564_1001578 | |||
| 2274 | Ga0209564_1023388 | |||
| 2275 | Ga0209564_1052192 | |||
| 2276 | Ga0209758_1000140 | |||
| 2277 | Ga0209758_1000321 | |||
| 2278 | Ga0209758_1001092 | |||
| 2279 | Ga0209758_1002051 | |||
| 2280 | Ga0209758_1002659 | |||
| 2281 | Ga0209758_1003492 | |||
| 2282 | Ga0209758_1003969 | |||
| 2283 | Ga0209758_1094196 | |||
| 2284 | Ga0209256_1009946 | |||
| 2285 | Ga0209256_1022829 | |||
| 2286 | Ga0207426_1000278 | |||
| 2287 | Ga0207426_1000378 | |||
| 2288 | Ga0207426_1056124 | |||
| 2289 | Ga0209257_1000522 | |||
| 2290 | Ga0209257_1021097 | |||
| 2291 | Ga0207697_10206400 | |||
| 2292 | Ga0207656_10010200 | |||
| 2293 | Ga0207656_10058367 | |||
| 2294 | Ga0207656_10295025 | |||
| 2295 | Ga0207682_10038991 | |||
| 2296 | Ga0207692_10003515 | |||
| 2297 | Ga0207692_10008195 | |||
| 2298 | Ga0207692_10118299 | |||
| 2299 | Ga0207692_10213076 | |||
| 2300 | Ga0207642_10251749 | |||
| 2301 | Ga0207710_10058668 | |||
| 2302 | Ga0207710_10076259 | |||
| 2303 | Ga0207710_10175442 | |||
| 2304 | Ga0207710_10209946 | |||
| 2305 | Ga0207688_10046398 | |||
| 2306 | Ga0207688_10133821 | |||
| 2307 | Ga0207688_10292657 | |||
| 2308 | Ga0207680_10246835 | |||
| 2309 | Ga0207647_10002921 | |||
| 2310 | Ga0207647_10006624 | |||
| 2311 | Ga0207647_10259957 | |||
| 2312 | Ga0207685_10000377 | |||
| 2313 | Ga0207685_10008143 | |||
| 2314 | Ga0207699_10003114 | |||
| 2315 | Ga0207699_10012803 | |||
| 2316 | Ga0207699_10038453 | |||
| 2317 | Ga0207699_10111562 | |||
| 2318 | Ga0207699_10301358 | |||
| 2319 | Ga0207699_10422641 | |||
| 2320 | Ga0207645_10000286 | |||
| 2321 | Ga0207645_10065338 | |||
| 2322 | Ga0207645_10140801 | |||
| 2323 | Ga0207645_10234887 | |||
| 2324 | Ga0207645_10415922 | |||
| 2325 | Ga0207643_10054603 | |||
| 2326 | Ga0207705_10056618 | |||
| 2327 | Ga0207705_10195348 | |||
| 2328 | Ga0207705_10212413 | |||
| 2329 | Ga0207654_10001513 | |||
| 2330 | Ga0207654_10037938 | |||
| 2331 | Ga0207707_10031128 | |||
| 2332 | Ga0207707_10165809 | |||
| 2333 | Ga0207695_10000008 | |||
| 2334 | Ga0207695_10008039 | |||
| 2335 | Ga0207695_10032881 | |||
| 2336 | Ga0207695_10103578 | |||
| 2337 | Ga0207695_10238633 | |||
| 2338 | Ga0207695_10494828 | |||
| 2339 | Ga0207671_10059849 | |||
| 2340 | Ga0207671_10143691 | |||
| 2341 | Ga0207671_10192469 | |||
| 2342 | Ga0207671_10286962 | |||
| 2343 | Ga0207693_10001875 | |||
| 2344 | Ga0207693_10062244 | |||
| 2345 | Ga0207663_10000347 | |||
| 2346 | Ga0207663_10006159 | |||
| 2347 | Ga0207663_10040094 | |||
| 2348 | Ga0207663_10552055 | |||
| 2349 | Ga0207660_10047484 | |||
| 2350 | Ga0207660_10145935 | |||
| 2351 | Ga0207660_10251113 | |||
| 2352 | Ga0207662_10247037 | |||
| 2353 | Ga0207657_10005077 | |||
| 2354 | Ga0207657_10106780 | |||
| 2355 | Ga0207649_10028404 | |||
| 2356 | Ga0207652_10062632 | |||
| 2357 | Ga0207646_10158788 | |||
| 2358 | Ga0207681_10139509 | |||
| 2359 | Ga0207681_10233693 | |||
| 2360 | Ga0207681_10629705 | |||
| 2361 | Ga0207694_10000050 | |||
| 2362 | Ga0207694_10051007 | |||
| 2363 | Ga0207694_10265609 | |||
| 2364 | Ga0207694_10609281 | |||
| 2365 | Ga0207694_10688494 | |||
| 2366 | Ga0207650_10003178 | |||
| 2367 | Ga0207650_10012180 | |||
| 2368 | Ga0207650_10156021 | |||
| 2369 | Ga0207659_10267604 | |||
| 2370 | Ga0207659_10290995 | |||
| 2371 | Ga0207659_10480952 | |||
| 2372 | Ga0207659_10842822 | |||
| 2373 | Ga0207687_10014409 | |||
| 2374 | Ga0207700_10050010 | |||
| 2375 | Ga0207700_10085205 | |||
| 2376 | Ga0207700_10108427 | |||
| 2377 | Ga0207700_10197910 | |||
| 2378 | Ga0207700_10258410 | |||
| 2379 | Ga0207700_10382050 | |||
| 2380 | Ga0207700_10616896 | |||
| 2381 | Ga0207664_10038049 | |||
| 2382 | Ga0207664_10042856 | |||
| 2383 | Ga0207664_10055666 | |||
| 2384 | Ga0207664_10381822 | |||
| 2385 | Ga0207664_10454659 | |||
| 2386 | Ga0207664_10456802 | |||
| 2387 | Ga0207644_10329061 | |||
| 2388 | Ga0207644_10357530 | |||
| 2389 | Ga0207644_10565787 | |||
| 2390 | Ga0207690_10017715 | |||
| 2391 | Ga0207706_10153092 | |||
| 2392 | Ga0207706_10184354 | |||
| 2393 | Ga0207706_10199144 | |||
| 2394 | Ga0207686_10117767 | |||
| 2395 | Ga0207686_10209320 | |||
| 2396 | Ga0207686_10581283 | |||
| 2397 | Ga0207709_10046579 | |||
| 2398 | Ga0207709_10068250 | |||
| 2399 | Ga0207709_10119999 | |||
| 2400 | Ga0207709_10302752 | |||
| 2401 | Ga0207669_10041586 | |||
| 2402 | Ga0207669_10045750 | |||
| 2403 | Ga0207704_10048167 | |||
| 2404 | Ga0207704_10071978 | |||
| 2405 | Ga0207704_10221602 | |||
| 2406 | Ga0207665_10004695 | |||
| 2407 | Ga0207665_10045722 | |||
| 2408 | Ga0207665_10046684 | |||
| 2409 | Ga0207665_10050708 | |||
| 2410 | Ga0207665_10251103 | |||
| 2411 | Ga0207691_10002154 | |||
| 2412 | Ga0207691_10029841 | |||
| 2413 | Ga0207691_10058642 | |||
| 2414 | Ga0207691_10084522 | |||
| 2415 | Ga0207711_10010545 | |||
| 2416 | Ga0207711_10140089 | |||
| 2417 | Ga0207689_10002835 | |||
| 2418 | Ga0207689_10020120 | |||
| 2419 | Ga0207689_10113433 | |||
| 2420 | Ga0207689_10211358 | |||
| 2421 | Ga0207661_10006587 | |||
| 2422 | Ga0207661_10028199 | |||
| 2423 | Ga0207679_10546139 | |||
| 2424 | Ga0207667_10010367 | |||
| 2425 | Ga0207667_10027376 | |||
| 2426 | Ga0207667_10218483 | |||
| 2427 | Ga0207667_10218581 | |||
| 2428 | Ga0207667_10326769 | |||
| 2429 | Ga0207667_10471107 | |||
| 2430 | Ga0207667_10505540 | |||
| 2431 | Ga0207651_10199118 | |||
| 2432 | Ga0207651_10207367 | |||
| 2433 | Ga0207651_10623584 | |||
| 2434 | Ga0207712_10019146 | |||
| 2435 | Ga0207712_10083820 | |||
| 2436 | Ga0207712_10087629 | |||
| 2437 | Ga0207712_10122121 | |||
| 2438 | Ga0207712_10395822 | |||
| 2439 | Ga0207668_10014231 | |||
| 2440 | Ga0207668_10019014 | |||
| 2441 | Ga0207668_10039902 | |||
| 2442 | Ga0207668_10067796 | |||
| 2443 | Ga0207668_10122389 | |||
| 2444 | Ga0207668_10137263 | |||
| 2445 | Ga0207668_10249951 | |||
| 2446 | Ga0207640_10014363 | |||
| 2447 | Ga0207640_10037061 | |||
| 2448 | Ga0207640_10154867 | |||
| 2449 | Ga0207640_10218286 | |||
| 2450 | Ga0207640_10384554 | |||
| 2451 | Ga0207640_10534182 | |||
| 2452 | Ga0207640_10713744 | |||
| 2453 | Ga0207640_10766068 | |||
| 2454 | Ga0207640_10838526 | |||
| 2455 | Ga0207640_10840084 | |||
| 2456 | Ga0207658_10268735 | |||
| 2457 | Ga0207658_10305149 | |||
| 2458 | Ga0207658_10414578 | |||
| 2459 | Ga0207658_10534524 | |||
| 2460 | Ga0207677_10031302 | |||
| 2461 | Ga0207677_10116413 | |||
| 2462 | Ga0207677_10198274 | |||
| 2463 | Ga0207677_10403231 | |||
| 2464 | Ga0207703_10002330 | |||
| 2465 | Ga0207703_10004196 | |||
| 2466 | Ga0207703_10156350 | |||
| 2467 | Ga0207703_10268096 | |||
| 2468 | Ga0207703_10457078 | |||
| 2469 | Ga0207703_10847928 | |||
| 2470 | Ga0207639_10061853 | |||
| 2471 | Ga0207639_10132912 | |||
| 2472 | Ga0207639_10146951 | |||
| 2473 | Ga0207639_10327623 | |||
| 2474 | Ga0207639_10355708 | |||
| 2475 | Ga0207639_10396720 | |||
| 2476 | Ga0207639_10817342 | |||
| 2477 | Ga0207678_10021023 | |||
| 2478 | Ga0207678_10023027 | |||
| 2479 | Ga0207678_10035512 | |||
| 2480 | Ga0207678_10039077 | |||
| 2481 | Ga0207678_10041697 | |||
| 2482 | Ga0207678_10071839 | |||
| 2483 | Ga0207678_10105366 | |||
| 2484 | Ga0207678_10110819 | |||
| 2485 | Ga0207678_10118932 | |||
| 2486 | Ga0207678_10210459 | |||
| 2487 | Ga0207678_10211814 | |||
| 2488 | Ga0207708_10093201 | |||
| 2489 | Ga0207708_10657469 | |||
| 2490 | Ga0207702_10000002 | |||
| 2491 | Ga0207702_10000748 | |||
| 2492 | Ga0207702_10031381 | |||
| 2493 | Ga0207702_10049144 | |||
| 2494 | Ga0207702_10394613 | |||
| 2495 | Ga0207702_10570530 | |||
| 2496 | Ga0207641_10003597 | |||
| 2497 | Ga0207641_10007624 | |||
| 2498 | Ga0207641_10138175 | |||
| 2499 | Ga0207641_10235148 | |||
| 2500 | Ga0207641_10507466 | |||
| 2501 | Ga0207648_10023816 | |||
| 2502 | Ga0207648_10059062 | |||
| 2503 | Ga0207648_10116985 | |||
| 2504 | Ga0207674_10000489 | |||
| 2505 | Ga0207674_10003205 | |||
| 2506 | Ga0207674_10003611 | |||
| 2507 | Ga0207674_10014760 | |||
| 2508 | Ga0207674_10023871 | |||
| 2509 | Ga0207674_10729084 | |||
| 2510 | Ga0207675_100003215 | |||
| 2511 | Ga0207675_100075023 | |||
| 2512 | Ga0207675_100133243 | |||
| 2513 | Ga0207675_100234843 | |||
| 2514 | Ga0207675_100244660 | |||
| 2515 | Ga0207675_100347420 | |||
| 2516 | Ga0207675_100789871 | |||
| 2517 | Ga0207683_10002147 | |||
| 2518 | Ga0207683_10007176 | |||
| 2519 | Ga0207683_10014348 | |||
| 2520 | Ga0207683_10018400 | |||
| 2521 | Ga0207683_10195356 | |||
| 2522 | Ga0207683_10321172 | |||
| 2523 | Ga0207683_10367452 | |||
| 2524 | Ga0207698_10022804 | |||
| 2525 | Ga0207698_10047597 | |||
| 2526 | Ga0207698_10104339 | |||
| 2527 | Ga0207698_10138517 | |||
| 2528 | Ga0207698_10220585 | |||
| 2529 | Ga0209389_1000040 | |||
| 2530 | Ga0209389_1000995 | |||
| 2531 | Ga0209589_1000001 | |||
| 2532 | Ga0209589_1000211 | |||
| 2533 | Ga0209489_100001 | |||
| 2534 | Ga0209489_100006 | |||
| 2535 | Ga0209489_110930 | |||
| 2536 | Ga0209700_100001 | |||
| 2537 | Ga0209700_100005 | |||
| 2538 | Ga0209813_10008974 | |||
| 2539 | Ga0207428_10036206 | |||
| 2540 | Ga0207428_10039542 | |||
| 2541 | Ga0207428_10104190 | |||
| 2542 | Ga0268266_10002320 | |||
| 2543 | Ga0268266_10009271 | |||
| 2544 | Ga0268266_10024042 | |||
| 2545 | Ga0268266_10028180 | |||
| 2546 | Ga0268266_10050458 | |||
| 2547 | Ga0268266_10065849 | |||
| 2548 | Ga0268266_10065947 | |||
| 2549 | Ga0268266_10172149 | |||
| 2550 | Ga0268266_10343609 | |||
| 2551 | Ga0268266_10564449 | |||
| 2552 | Ga0268266_10830937 | |||
| 2553 | Ga0268265_10036410 | |||
| 2554 | Ga0268265_10209777 | |||
| 2555 | Ga0268265_10472323 | |||
| 2556 | Ga0268265_10746325 | |||
| 2557 | Ga0268264_10002930 | |||
| 2558 | Ga0268264_10005853 | |||
| 2559 | Ga0268264_10017488 | |||
| 2560 | Ga0268264_10158642 | |||
| 2561 | Ga0268264_10249367 | |||
| 2562 | Ga0265337_1006749 | |||
| 2563 | Ga0265334_10006955 | |||
| 2564 | Ga0265323_10004409 | |||
| 2565 | Ga0265322_10060032 | |||
| 2566 | Ga0265336_10000763 | |||
| 2567 | Ga0307517_10000249 | |||
| 2568 | Ga0307517_10119002 | |||
| 2569 | Ga0307515_10314902 | |||
| 2570 | Ga0265338_10000665 | |||
| 2571 | Ga0307511_10110325 | |||
| 2572 | Ga0265330_10124828 | |||
| 2573 | Ga0265332_10001409 | |||
| 2574 | Ga0265332_10168113 | |||
| 2575 | Ga0265325_10012262 | |||
| 2576 | Ga0265325_10030711 | |||
| 2577 | Ga0265325_10165341 | |||
| 2578 | Ga0265329_10071967 | |||
| 2579 | Ga0265340_10005726 | |||
| 2580 | Ga0265340_10008625 | |||
| 2581 | Ga0265339_10003832 | |||
| 2582 | Ga0265339_10052640 | |||
| 2583 | Ga0265331_10062535 | |||
| 2584 | Ga0265316_10061807 | |||
| 2585 | Ga0265316_10087120 | |||
| 2586 | Ga0307509_10125888 | |||
| 2587 | Ga0307408_100318538 | |||
| 2588 | Ga0307408_100779255 | |||
| 2589 | Ga0307508_10000018 | |||
| 2590 | Ga0307508_10043906 | |||
| 2591 | Ga0307508_10311566 | |||
| 2592 | Ga0316575_10025725 | |||
| 2593 | Ga0316579_10037283 | |||
| 2594 | Ga0265314_10002567 | |||
| 2595 | Ga0265314_10160306 | |||
| 2596 | Ga0265314_10181164 | |||
| 2597 | Ga0265342_10002171 | |||
| 2598 | Ga0265342_10174163 | |||
| 2599 | Ga0265342_10211170 | |||
| 2600 | Ga0316576_10033029 | |||
| 2601 | Ga0316578_10016515 | |||
| 2602 | Ga0307516_10011331 | |||
| 2603 | Ga0307516_10038640 | |||
| 2604 | Ga0307516_10200912 | |||
| 2605 | Ga0307516_10224017 | |||
| 2606 | Ga0307405_10631678 | |||
| 2607 | Ga0307413_10031350 | |||
| 2608 | Ga0307413_10800187 | |||
| 2609 | Ga0307410_10682828 | |||
| 2610 | Ga0307406_10255867 | |||
| 2611 | Ga0307412_10429143 | |||
| 2612 | Ga0307412_10595978 | |||
| 2613 | Ga0307416_100409035 | |||
| 2614 | Ga0307415_100042679 | |||
| 2615 | Ga0307507_10008461 | |||
| 2616 | Ga0307510_10005775 | |||
| 2617 | Ga0315911_1000006 | |||
| 2618 | Ga0373950_0036482 | |||
| 2619 | Ga0373926_0034351 | |||
| 2620 | Ga0373926_0069346 | |||
| 2621 | Ga0373926_0089882 | |||
| 2622 | Ga0373928_0021938 | |||
| 2623 | Ga0373934_0024742 | |||
| 2624 | Ga0373944_0027109 | |||
| 2625 | Ga0373949_0069780 | |||
| 2626 | Ga0373932_0012711 | |||
| 2627 | Ga0373936_0009212 | |||
| 2628 | Ga0373936_0018528 | |||
| 2629 | Ga0373936_0124171 | |||
| 2630 | Ga0373953_0002178 | |||
| 2631 | Ga0373953_0007285 | |||
| 2632 | Ga0373953_0027450 | |||
| 2633 | Ga0373953_0036308 | |||
| 2634 | Ga0373954_0003365 | |||
| 2635 | Ga0373954_0008989 | |||
| 2636 | Ga0373954_0016863 | |||
| 2637 | Ga0373956_0015008 | |||
| 2638 | Ga0373956_0035180 | |||
| 2639 | Ga0373956_0046623 | |||
| 2640 | Ga0373956_0054647 | |||
| 2641 | Ga0373957_0003026 | |||
| 2642 | Ga0373957_0045277 | |||
| 2643 | Ga0373943_0005981 | |||
| 2644 | Ga0373943_0006361 | |||
| 2645 | Ga0373943_0033391 | |||
| 2646 | Ga0373946_0010792 | |||
| 2647 | Ga0373946_0146071 | |||
| 2648 | Ga0373955_0002466 | |||
| 2649 | Ga0373955_0007820 | |||
| 2650 | Ga0373955_0237654 | |||
| 2651 | Ga0373955_0341937 | |||
| 2652 | Ga0373924_0002359 | |||
| 2653 | Ga0373924_0012183 | |||
| 2654 | Ga0373931_0007658 | |||
| 2655 | Ga0373931_0098484 | |||
| 2656 | Ga0373931_0148530 | |||
| 2657 | Ga0373931_0171129 | |||
| 2658 | Ga0373935_0001180 | |||
| 2659 | Ga0373935_0033363 | |||
| 2660 | Ga0373935_0049212 | |||
| 2661 | Ga0373935_0130757 | |||
| 2662 | Ga0373935_0382553 | |||
| 2663 | Ga0373935_0658773 | |||
| 2664 | Ga0373927_0012626 | |||
| 2665 | Ga0373927_0033690 | |||
| 2666 | Ga0373927_0069279 | |||
| 2667 | Ga0373927_0084027 | |||
| 2668 | Ga0373927_0177471 | |||
| 2669 | Ga0373927_0187584 | |||
| 2670 | Ga0373933_0000787 | |||
| 2671 | Ga0373933_0005811 | |||
| 2672 | Ga0373933_0036459 | |||
| 2673 | Ga0373933_0045514 | |||
| 2674 | Ga0373947_0012125 | |||
| 2675 | Ga0373947_0022984 | |||
| 2676 | Ga0373947_0089676 | |||
| 2677 | Ga0373937_0001814 | |||
| 2678 | Ga0373937_0007938 | |||
| 2679 | Ga0373937_0140323 | |||
| 2680 | Ga0373937_0170675 | |||
| 2681 | Ga0373937_0472782 | |||
| 2682 | Ga0373937_0797525 | |||
| 2683 | Ga0372808_000933 | |||
| 2684 | Ga0373925_0000353 | |||
| 2685 | Ga0373925_0003087 | |||
| 2686 | Ga0373925_0010490 | |||
| 2687 | Ga0373925_0076221 | |||
| 2688 | Ga0373925_0579725 | |||
| 2689 | Ga0395900_0023857 | |||
| 2690 | Ga0395900_0169289 | |||
| 2691 | Ga0395898_0019988 | |||
| 2692 | Ga0395898_0192806 | |||
| 2693 | Ga0395898_0275800 | |||
| 2694 | Ga0395898_0417270 | |||
| 2695 | Ga0395905_0008616 | |||
| 2696 | Ga0395905_0014968 | |||
| 2697 | Ga0395905_0030507 | |||
| 2698 | Ga0436364_0479367 | |||
| 2699 | Ga0395901_0002662 | |||
| 2700 | Ga0395901_0183555 | |||
| 2701 | Ga0395901_0353861 | |||
| 2702 | Ga0436365_0174244 | |||
| 2703 | Ga0436365_0647195 | |||
| 2704 | Ga0436365_1394673 | |||
| 2705 | Ga0436360_0136997 | |||
| 2706 | Ga0436360_0173425 | |||
| 2707 | Ga0436360_0809633 | |||
| 2708 | Ga0436360_0865201 | |||
| 2709 | Ga0436361_0265785 | |||
| 2710 | Ga0436361_0314733 | |||
| 2711 | Ga0436361_0632415 | |||
| 2712 | Ga0436363_1258628 | |||
| 2713 | Ga0439461_0020278 | |||
| 2714 | Ga0451793_0046002 | |||
| 2715 | Ga0451807_2283239 | |||
| 2716 | Ga0451843_0321225 | |||
| 2717 | Ga0466972_0125525 | |||
| 2718 | Ga0466965_0086603 | |||
| 2719 | Ga0466966_0000426 | |||
| 2720 | Ga0466961_0000208 | |||
| 2721 | Ga0466961_0462223 | |||
| 2722 | Ga0466963_0137055 | |||
| 2723 | Ga0466964_0141621 | |||
| 2724 | Ga0466957_0364882 | |||
| 2725 | Ga0466957_0502789 | |||
| 2726 | Ga0466957_0621834 | |||
| 2727 | Ga0466960_0074350 | |||
| 2728 | Ga0466959_0045855 | |||
| 2729 | Ga0466959_0098879 | |||
| 2730 | Ga0466959_0101222 | |||
| 2731 | Ga0466959_0482341 | |||
| 2732 | Ga0451576_1590618 | |||
| 2733 | Ga0466967_0075695 | |||
| 2734 | Ga0466967_0139641 | |||
| 2735 | Ga0466967_0177573 | |||
| 2736 | Ga0466967_0235164 | |||
| 2737 | Ga0466967_0514130 | |||
| 2738 | Ga0495617_024593 | |||
| 2739 | Ga0495617_086636 | |||
| 2740 | Ga0495592_0000284 | |||
| 2741 | Ga0495592_0007940 | |||
| 2742 | Ga0495592_0011449 | |||
| 2743 | Ga0495592_0030145 | |||
| 2744 | Ga0495592_0044849 | |||
| 2745 | Ga0495603_0113001 | |||
| 2746 | Ga0495603_0151587 | |||
| 2747 | Ga0495590_0066882 | |||
| 2748 | Ga0495629_0001471 | |||
| 2749 | Ga0495629_0009818 | |||
| 2750 | Ga0495629_0362317 | |||
| 2751 | Ga0495629_0418101 | |||
| 2752 | Ga0495638_0007580 | |||
| 2753 | Ga0495638_0024650 | |||
| 2754 | Ga0495638_0077447 | |||
| 2755 | Ga0495641_0027053 | |||
| 2756 | Ga0495651_0000528 | |||
| 2757 | Ga0495651_0001055 | |||
| 2758 | Ga0495651_0004953 | |||
| 2759 | Ga0495651_0033861 | |||
| 2760 | Ga0495651_0045105 | |||
| 2761 | Ga0495651_0119535 | |||
| 2762 | Ga0495651_0239621 | |||
| 2763 | Ga0495653_0000330 | |||
| 2764 | Ga0495653_0012854 | |||
| 2765 | Ga0495653_0051880 | |||
| 2766 | Ga0495653_0205184 | |||
| 2767 | Ga0495650_0035581 | |||
| 2768 | Ga0495650_0074621 | |||
| 2769 | Ga0495580_0017647 | |||
| 2770 | Ga0495580_0064783 | |||
| 2771 | Ga0495582_0008676 | |||
| 2772 | Ga0495582_0115587 | |||
| 2773 | Ga0495582_0321055 | |||
| 2774 | Ga0495605_0079390 | |||
| 2775 | Ga0495605_0123152 | |||
| 2776 | Ga0495639_0046055 | |||
| 2777 | Ga0495639_0197439 | |||
| 2778 | Ga0495639_0207986 | |||
| 2779 | Ga0495639_0261230 | |||
| 2780 | Ga0495662_0003004 | |||
| 2781 | Ga0495662_0053996 | |||
| 2782 | Ga0495664_0000098 | |||
| 2783 | Ga0495664_0014192 | |||
| 2784 | Ga0495664_0026168 | |||
| 2785 | Ga0495664_0027596 | |||
| 2786 | Ga0495664_0326016 | |||
| 2787 | Ga0495584_0108882 | |||
| 2788 | Ga0495585_0042306 | |||
| 2789 | Ga0495585_0042422 | |||
| 2790 | Ga0495594_0049107 | |||
| 2791 | Ga0495594_0127910 | |||
| 2792 | Ga0495607_0024171 | |||
| 2793 | Ga0495583_0063625 | |||
| 2794 | Ga0495606_0001663 | |||
| 2795 | Ga0495606_0078359 | |||
| 2796 | Ga0495606_0108452 | |||
| 2797 | Ga0495606_0111700 | |||
| 2798 | Ga0495606_0147278 | |||
| 2799 | Ga0495608_0000318 | |||
| 2800 | Ga0495608_0007280 | |||
| 2801 | Ga0495608_0007748 | |||
| 2802 | Ga0495608_0113918 | |||
| 2803 | Ga0495610_0028158 | |||
| 2804 | Ga0495616_0036121 | |||
| 2805 | Ga0495616_0065445 | |||
| 2806 | Ga0495618_0000235 | |||
| 2807 | Ga0495618_0005313 | |||
| 2808 | Ga0495618_0128394 | |||
| 2809 | Ga0495618_0308007 | |||
| 2810 | Ga0495620_0024389 | |||
| 2811 | Ga0495620_0036962 | |||
| 2812 | Ga0495628_0001752 | |||
| 2813 | Ga0495628_0008728 | |||
| 2814 | Ga0495628_0123321 | |||
| 2815 | Ga0495628_0156019 | |||
| 2816 | Ga0495630_0002403 | |||
| 2817 | Ga0495630_0007077 | |||
| 2818 | Ga0495630_0535953 | |||
| 2819 | Ga0495630_0574089 | |||
| 2820 | Ga0495631_0047682 | |||
| 2821 | Ga0495632_0041732 | |||
| 2822 | Ga0495632_0047359 | |||
| 2823 | Ga0495637_0156129 | |||
| 2824 | Ga0495643_0039228 | |||
| 2825 | Ga0495643_0091448 | |||
| 2826 | Ga0495643_0155892 | |||
| 2827 | Ga0495644_0134568 | |||
| 2828 | Ga0495644_0221403 | |||
| 2829 | Ga0495648_0002078 | |||
| 2830 | Ga0495648_0047321 | |||
| 2831 | Ga0495648_0057044 | |||
| 2832 | Ga0495648_0063629 | |||
| 2833 | Ga0495648_0099715 | |||
| 2834 | Ga0495666_0062522 | |||
| 2835 | Ga0495652_0000305 | |||
| 2836 | Ga0495652_0002427 | |||
| 2837 | Ga0495652_0007898 | |||
| 2838 | Ga0495652_0030776 | |||
| 2839 | Ga0495652_0071606 | |||
| 2840 | Ga0495652_0092860 | |||
| 2841 | Ga0495652_0112414 | |||
| 2842 | Ga0495654_0019069 | |||
| 2843 | Ga0495665_0083069 | |||
| 2844 | Ga0495665_0170711 | |||
| 2845 | Ga0495640_0000388 | |||
| 2846 | Ga0495640_0012229 | |||
| 2847 | Ga0495640_0020152 | |||
| 2848 | Ga0495640_0041579 | |||
| 2849 | Ga0495586_0146090 | |||
| 2850 | Ga0495587_0000249 | |||
| 2851 | Ga0495587_0018684 | |||
| 2852 | Ga0495587_0045874 | |||
| 2853 | Ga0495587_0068307 | |||
| 2854 | Ga0495609_0074972 | |||
| 2855 | Ga0495609_0121791 | |||
| 2856 | Ga0495597_0085522 | |||
| 2857 | Ga0495597_0235764 | |||
| 2858 | Ga0495645_0007880 | |||
| 2859 | Ga0495645_0024231 | |||
| 2860 | Ga0495645_0164214 | |||
| 2861 | Ga0495622_0031960 | |||
| 2862 | Ga0495622_0057875 | |||
| 2863 | Ga0495622_0065013 | |||
| 2864 | Ga0495633_0022894 | |||
| 2865 | Ga0495667_0000195 | |||
| 2866 | Ga0495667_0005712 | |||
| 2867 | Ga0495667_0032617 | |||
| 2868 | Ga0495667_0123438 | |||
| 2869 | Ga0495656_0001218 | |||
| 2870 | Ga0495656_0008671 | |||
| 2871 | Ga0495668_0055643 | |||
| 2872 | Ga0495634_0003325 | |||
| 2873 | Ga0495634_0021235 | |||
| 2874 | Ga0495634_0135922 | |||
| 2875 | Ga0495611_0027315 | |||
| 2876 | Ga0495625_0088037 | |||
| 2877 | Ga0495625_0089466 | |||
| 2878 | Ga0495625_0122276 | |||
| 2879 | Ga0495625_0152008 | |||
| 2880 | Ga0495625_0446987 | |||
| 2881 | Ga0495635_0000185 | |||
| 2882 | Ga0495635_0000873 | |||
| 2883 | Ga0495635_0001696 | |||
| 2884 | Ga0495635_0044031 | |||
| 2885 | Ga0495635_0056629 | |||
| 2886 | Ga0495659_0019391 | |||
| 2887 | Ga0495661_0280131 | |||
| 2888 | Ga0495588_0013827 | |||
| 2889 | Ga0495588_0048497 | |||
| 2890 | Ga0495588_0068228 | |||
| 2891 | Ga0495588_0250205 | |||
| 2892 | Ga0495657_0001331 | |||
| 2893 | Ga0495657_0011291 | |||
| 2894 | Ga0495657_0018550 | |||
| 2895 | Ga0495657_0047169 | |||
| 2896 | Ga0495599_0000168 | |||
| 2897 | Ga0495599_0102140 | |||
| 2898 | Ga0495623_0000586 | |||
| 2899 | Ga0495623_0001768 | |||
| 2900 | Ga0495623_0019551 | |||
| 2901 | Ga0495623_0262791 | |||
| 2902 | Ga0495646_0000269 | |||
| 2903 | Ga0495646_0026347 | |||
| 2904 | Ga0495646_0056845 | |||
| 2905 | Ga0495646_0079456 | |||
| 2906 | Ga0495646_0131853 | |||
| 2907 | Ga0495647_0169018 | |||
| 2908 | Ga0495658_0023364 | |||
| 2909 | Ga0495658_0378762 | |||
| 2910 | Ga0495669_0015157 | |||
| 2911 | Ga0495669_0064405 | |||
| 2912 | Ga0495613_0030170 | |||
| 2913 | Ga0495613_0038119 | |||
| 2914 | Ga0495613_0062881 | |||
| 2915 | Ga0495624_0115553 | |||
| 2916 | Ga0495670_0072322 | |||
| 2917 | Ga0495671_0094426 | |||
| 2918 | Ga0495649_0005458 | |||
| 2919 | Ga0495600_0000210 | |||
| 2920 | Ga0495600_0001526 | |||
| 2921 | Ga0495600_0005587 | |||
| 2922 | Ga0495600_0021059 | |||
| 2923 | Ga0495600_0104375 | |||
| 2924 | Ga0495581_0031203 | |||
| 2925 | Ga0495581_0041352 | |||
| 2926 | Ga0495581_0075569 | |||
| 2927 | Ga0495604_0000003 | |||
| 2928 | Ga0495604_0002479 | |||
| 2929 | Ga0495604_0007137 | |||
| 2930 | Ga0495604_0009567 | |||
| 2931 | Ga0495674_0000006 | |||
| 2932 | Ga0495674_0016182 | |||
| 2933 | Ga0495674_0017727 | |||
| 2934 | Ga0495674_0029040 | |||
| 2935 | Ga0495674_0164354 | |||
| 2936 | Ga0495672_0028302 | |||
| 2937 | Ga0495672_0039931 | |||
| 2938 | Ga0495672_0125201 | |||
| 2939 | Ga0495672_0182365 | |||
| 2940 | Ga0495676_0035714 | |||
| 2941 | Ga0495676_0060030 | |||
| 2942 | Ga0495676_0190803 | |||
| 2943 | Ga0495680_0001799 | |||
| 2944 | Ga0495680_0005630 | |||
| 2945 | Ga0495680_0018123 | |||
| 2946 | Ga0495683_0047664 | |||
| 2947 | Ga0495683_0127160 | |||
| 2948 | Ga0495675_0000336 | |||
| 2949 | Ga0495675_0249065 | |||
| 2950 | Ga0495685_015331 | |||
| 2951 | Ga0495684_0000287 | |||
| 2952 | Ga0495684_0003082 | |||
| 2953 | Ga0495684_0008230 | |||
| 2954 | Ga0495684_0015851 | |||
| 2955 | Ga0495686_0048054 | |||
| 2956 | Ga0495686_0124666 | |||
| 2957 | Ga0495686_0128036 | |||
| 2958 | Ga0495593_0001718 | |||
| 2959 | Ga0495593_0009416 | |||
| 2960 | Ga0495593_0035007 | |||
| 2961 | Ga0495593_0146138 | |||
| 2962 | Ga0495593_0180805 | |||
| 2963 | Ga0495593_0274359 | |||
| 2964 | Ga0495602_0000805 | |||
| 2965 | Ga0495602_0018072 | |||
| 2966 | Ga0495602_0020674 | |||
| 2967 | Ga0495602_0058307 | |||
| 2968 | Ga0495602_0378188 | |||
| 2969 | Ga0495626_0067186 | |||
| 2970 | Ga0496100_0002779 | |||
| 2971 | Ga0496100_0029522 | |||
| 2972 | Ga0496100_0258192 | |||
| 2973 | Ga0496100_0486855 | |||
| 2974 | Ga0496100_0560611 | |||
| 2975 | Ga0496101_0001894 | |||
| 2976 | Ga0496101_0054385 | |||
| 2977 | Ga0496101_0056797 | |||
| 2978 | Ga0496101_0093616 | |||
| 2979 | Ga0496102_0002765 | |||
| 2980 | Ga0496102_0040716 | |||
| 2981 | Ga0496102_0065153 | |||
| 2982 | Ga0496102_0081657 | |||
| 2983 | Ga0496102_0377152 | |||
| 2984 | Ga0496102_0689565 | |||
| 2985 | Ga0496103_0052822 | |||
| 2986 | Ga0496103_0079512 | |||
| 2987 | Ga0496103_0408764 | |||
| 2988 | Ga0496104_0005950 | |||
| 2989 | Ga0496104_0039293 | |||
| 2990 | Ga0496104_0194817 | |||
| 2991 | Ga0496104_0200572 | |||
| 2992 | Ga0496104_0400700 | |||
| 2993 | Ga0496104_0636854 | |||
| 2994 | Ga0496104_0821197 | |||
| 2995 | Ga0496105_0004948 | |||
| 2996 | Ga0496105_0014178 | |||
| 2997 | Ga0496105_0038159 | |||
| 2998 | Ga0496105_0041386 | |||
| 2999 | Ga0496105_0053835 | |||
| 3000 | Ga0496105_0082441 | |||
| 3001 | Ga0496105_0201843 | |||
| 3002 | Ga0496106_0000587 | |||
| 3003 | Ga0496106_0005552 | |||
| 3004 | Ga0496106_0019620 | |||
| 3005 | Ga0496106_0051907 | |||
| 3006 | Ga0496106_0053721 | |||
| 3007 | Ga0496106_0219417 | |||
| 3008 | Ga0496106_0649360 | |||
| 3009 | Ga0496107_0003023 | |||
| 3010 | Ga0496107_0021695 | |||
| 3011 | Ga0496107_0024155 | |||
| 3012 | Ga0496107_0024903 | |||
| 3013 | Ga0496107_0074497 | |||
| 3014 | Ga0496107_0080438 | |||
| 3015 | Ga0496107_0209770 | |||
| 3016 | Ga0496107_0564105 | |||
| 3017 | Ga0496108_0000517 | |||
| 3018 | Ga0496108_0002253 | |||
| 3019 | Ga0496108_0034446 | |||
| 3020 | Ga0496108_0044050 | |||
| 3021 | Ga0496108_0046015 | |||
| 3022 | Ga0496108_0132909 | |||
| 3023 | Ga0496108_0457925 | |||
| 3024 | Ga0496109_0000814 | |||
| 3025 | Ga0496109_0049567 | |||
| 3026 | Ga0496109_0066388 | |||
| 3027 | Ga0496109_0159112 | |||
| 3028 | Ga0496109_0368696 | |||
| 3029 | Ga0496109_0537074 | |||
| 3030 | Ga0496109_0644880 | |||
| 3031 | Ga0496109_0774993 | |||
| 3032 | Ga0496110_0016915 | |||
| 3033 | Ga0496110_0026206 | |||
| 3034 | Ga0496110_0053094 | |||
| 3035 | Ga0496110_0067178 | |||
| 3036 | Ga0496110_0149899 | |||
| 3037 | Ga0496110_0177020 | |||
| 3038 | Ga0496111_0009126 | |||
| 3039 | Ga0496111_0046808 | |||
| 3040 | Ga0496111_0123406 | |||
| 3041 | Ga0496111_0139025 | |||
| 3042 | Ga0496111_0175646 | |||
| 3043 | Ga0496111_0367624 | |||
| 3044 | Ga0496112_0000004 | |||
| 3045 | Ga0496112_0000218 | |||
| 3046 | Ga0496112_0016917 | |||
| 3047 | Ga0496112_0037102 | |||
| 3048 | Ga0496112_0043290 | |||
| 3049 | Ga0496112_0044258 | |||
| 3050 | Ga0496112_0068208 | |||
| 3051 | Ga0496112_0128423 | |||
| 3052 | Ga0496112_0145582 | |||
| 3053 | Ga0496112_0163031 | |||
| 3054 | Ga0496112_0286820 | |||
| 3055 | Ga0496112_0655136 | |||
| 3056 | Ga0496113_0003899 | |||
| 3057 | Ga0496113_0025279 | |||
| 3058 | Ga0496113_0029742 | |||
| 3059 | Ga0496113_0058245 | |||
| 3060 | Ga0496113_0060028 | |||
| 3061 | Ga0496113_0163310 | |||
| 3062 | Ga0496113_0275455 | |||
| 3063 | Ga0496113_0305047 | |||
| 3064 | Ga0496113_0612111 | |||
| 3065 | Ga0496114_0009279 | |||
| 3066 | Ga0496114_0035386 | |||
| 3067 | Ga0496114_0100069 | |||
| 3068 | Ga0496114_0191204 | |||
| 3069 | Ga0496114_0210520 | |||
| 3070 | Ga0496114_0308589 | |||
| 3071 | Ga0496115_0018582 | |||
| 3072 | Ga0496115_0023272 | |||
| 3073 | Ga0496115_0155365 | |||
| 3074 | Ga0496115_0347336 | |||
| 3075 | Ga0496115_0410117 | |||
| 3076 | Ga0496115_0540866 | |||
| 3077 | Ga0496116_0017544 | |||
| 3078 | Ga0496116_0023210 | |||
| 3079 | Ga0496116_0040863 | |||
| 3080 | Ga0496117_0011613 | |||
| 3081 | Ga0496117_0103657 | |||
| 3082 | Ga0496117_0214359 | |||
| 3083 | Ga0496117_0295281 | |||
| 3084 | Ga0496118_0004793 | |||
| 3085 | Ga0496118_0045464 | |||
| 3086 | Ga0496118_0056547 | |||
| 3087 | Ga0496118_0062107 | |||
| 3088 | Ga0496118_0070914 | |||
| 3089 | Ga0496118_0071819 | |||
| 3090 | Ga0496118_0265931 | |||
| 3091 | Ga0496119_0002647 | |||
| 3092 | Ga0496119_0009808 | |||
| 3093 | Ga0496119_0028133 | |||
| 3094 | Ga0496119_0125808 | |||
| 3095 | Ga0496120_0019815 | |||
| 3096 | Ga0496120_0038353 | |||
| 3097 | Ga0496120_0187901 | |||
| 3098 | Ga0496120_0199312 | |||
| 3099 | Ga0496121_0000458 | |||
| 3100 | Ga0496121_0001749 | |||
| 3101 | Ga0496121_0002564 | |||
| 3102 | Ga0496121_0006706 | |||
| 3103 | Ga0496121_0019210 | |||
| 3104 | Ga0496121_0030046 | |||
| 3105 | Ga0496121_0037369 | |||
| 3106 | Ga0496121_0039959 | |||
| 3107 | Ga0496121_0060123 | |||
| 3108 | Ga0496121_0100872 | |||
| 3109 | Ga0496121_0102319 | |||
| 3110 | Ga0496121_0110683 | |||
| 3111 | Ga0496121_0137910 | |||
| 3112 | Ga0496121_0143496 | |||
| 3113 | Ga0496121_0461321 | |||
| 3114 | Ga0496122_0005205 | |||
| 3115 | Ga0496122_0089726 | |||
| 3116 | Ga0496122_0151155 | |||
| 3117 | Ga0496123_0001216 | |||
| 3118 | Ga0496123_0056943 | |||
| 3119 | Ga0496123_0136293 | |||
| 3120 | Ga0496124_0004472 | |||
| 3121 | Ga0496124_0049471 | |||
| 3122 | Ga0496124_0135267 | |||
| 3123 | Ga0496124_0318172 | |||
| 3124 | Ga0496124_0331410 | |||
| 3125 | Ga0496124_0401643 | |||
| 3126 | Ga0496125_0007066 | |||
| 3127 | Ga0496125_0028317 | |||
| 3128 | Ga0496125_0035050 | |||
| 3129 | Ga0496125_0063116 | |||
| 3130 | Ga0496125_0130191 | |||
| 3131 | Ga0496125_0163747 | |||
| 3132 | Ga0496125_0347958 | |||
| 3133 | Ga0496125_0379986 | |||
| 3134 | Ga0496126_0003477 | |||
| 3135 | Ga0496126_0009236 | |||
| 3136 | Ga0496126_0014283 | |||
| 3137 | Ga0496126_0022627 | |||
| 3138 | Ga0496126_0022855 | |||
| 3139 | Ga0496126_0031475 | |||
| 3140 | Ga0496126_0039174 | |||
| 3141 | Ga0496126_0082444 | |||
| 3142 | Ga0496126_0083970 | |||
| 3143 | Ga0496126_0091207 | |||
| 3144 | Ga0496126_0161207 | |||
| 3145 | Ga0496126_0170985 | |||
| 3146 | Ga0496126_0178540 | |||
| 3147 | Ga0496126_0273764 | |||
| 3148 | Ga0496126_0396835 | |||
| 3149 | Ga0496126_0729716 | |||
| 3150 | Ga0496126_0737877 | |||
| 3151 | Ga0496126_0739013 | |||
| 3152 | Ga0495682_0103925 | |||
| 3153 | Ga0501031_0002252 | |||
| 3154 | Ga0501031_0004417 | |||
| 3155 | Ga0501031_0104072 | |||
| 3156 | Ga0501032_0001822 | |||
| 3157 | Ga0501032_0010877 | |||
| 3158 | Ga0501032_0048106 | |||
| 3159 | Ga0501032_0073698 | |||
| 3160 | Ga0501033_0000108 | |||
| 3161 | Ga0501033_0000827 | |||
| 3162 | Ga0501033_0005609 | |||
| 3163 | Ga0501033_0008341 | |||
| 3164 | Ga0501033_0020768 | |||
| 3165 | Ga0501033_0192451 | |||
| 3166 | Ga0501034_0002449 | |||
| 3167 | Ga0501034_0041720 | |||
| 3168 | Ga0501034_0050134 | |||
| 3169 | Ga0501034_0097719 | |||
| 3170 | Ga0501034_0107244 | |||
| 3171 | Ga0501034_0251907 | |||
| 3172 | Ga0501036_0000149 | |||
| 3173 | Ga0501036_0017788 | |||
| 3174 | Ga0501036_0020595 | |||
| 3175 | Ga0501036_0025415 | |||
| 3176 | Ga0501036_0159903 | |||
| 3177 | Ga0501036_0281244 | |||
| 3178 | Ga0501037_0000153 | |||
| 3179 | Ga0501037_0000888 | |||
| 3180 | Ga0501037_0023604 | |||
| 3181 | Ga0501037_0039773 | |||
| 3182 | Ga0501037_0043447 | |||
| 3183 | Ga0501038_0000138 | |||
| 3184 | Ga0501038_0000999 | |||
| 3185 | Ga0501038_0001121 | |||
| 3186 | Ga0501038_0012358 | |||
| 3187 | Ga0501038_0026754 | |||
| 3188 | Ga0501038_0028683 | |||
| 3189 | Ga0501038_0041649 | |||
| 3190 | Ga0501038_0054303 | |||
| 3191 | Ga0501038_0378460 | |||
| 3192 | Ga0501039_0000842 | |||
| 3193 | Ga0501039_0006162 | |||
| 3194 | Ga0501039_0050475 | |||
| 3195 | Ga0501039_0343199 | |||
| 3196 | Ga0501040_0015506 | |||
| 3197 | Ga0501041_0120074 | |||
| 3198 | Ga0501041_0287448 | |||
| 3199 | Ga0501042_0001932 | |||
| 3200 | Ga0501042_0088976 | |||
| 3201 | Ga0501043_0000085 | |||
| 3202 | Ga0501043_0013390 | |||
| 3203 | Ga0501043_0019654 | |||
| 3204 | Ga0501043_0081607 | |||
| 3205 | Ga0501043_0170027 | |||
| 3206 | Ga0501046_0000267 | |||
| 3207 | Ga0501046_0003985 | |||
| 3208 | Ga0501046_0033529 | |||
| 3209 | Ga0501046_0155285 | |||
| 3210 | Ga0501047_0001785 | |||
| 3211 | Ga0501047_0008455 | |||
| 3212 | Ga0501047_0021518 | |||
| 3213 | Ga0501047_0027991 | |||
| 3214 | Ga0501047_0041733 | |||
| 3215 | Ga0501047_0214787 | |||
| 3216 | Ga0501047_0535426 | |||
| 3217 | Ga0501048_0000396 | |||
| 3218 | Ga0501048_0012509 | |||
| 3219 | Ga0501048_0111842 | |||
| 3220 | Ga0501048_0182347 | |||
| 3221 | Ga0501067_0000104 | |||
| 3222 | Ga0501067_0006729 | |||
| 3223 | Ga0501067_0048309 | |||
| 3224 | Ga0501067_0147050 | |||
| 3225 | Ga0501067_0244749 | |||
| 3226 | Ga0501068_0002865 | |||
| 3227 | Ga0501068_0003450 | |||
| 3228 | Ga0501068_0018698 | |||
| 3229 | Ga0501069_0019419 | |||
| 3230 | Ga0501069_0045971 | |||
| 3231 | Ga0501069_0053275 | |||
| 3232 | Ga0501070_0002230 | |||
| 3233 | Ga0501070_0008793 | |||
| 3234 | Ga0501070_0009392 | |||
| 3235 | Ga0501070_0024791 | |||
| 3236 | Ga0501070_0334147 | |||
| 3237 | Ga0501071_0028989 | |||
| 3238 | Ga0501071_0204566 | |||
| 3239 | Ga0501071_0464840 | |||
| 3240 | Ga0501072_0019143 | |||
| 3241 | Ga0501072_0032885 | |||
| 3242 | Ga0501072_0316549 | |||
| 3243 | Ga0501072_0624194 | |||
| 3244 | Ga0501073_0000221 | |||
| 3245 | Ga0501073_0018870 | |||
| 3246 | Ga0501073_0020114 | |||
| 3247 | Ga0501073_0066091 | |||
| 3248 | Ga0501073_0436788 | |||
| 3249 | Ga0501074_0001821 | |||
| 3250 | Ga0501074_0008617 | |||
| 3251 | Ga0501075_0038557 | |||
| 3252 | Ga0501075_0304417 | |||
| 3253 | Ga0501075_0369424 | |||
| 3254 | Ga0501076_0011550 | |||
| 3255 | Ga0501076_0037661 | |||
| 3256 | Ga0501076_0617934 | |||
| 3257 | Ga0501077_0050144 | |||
| 3258 | Ga0501079_0007983 | |||
| 3259 | Ga0501079_0011689 | |||
| 3260 | Ga0501079_0019790 | |||
| 3261 | Ga0501079_0141817 | |||
| 3262 | Ga0501080_0013906 | |||
| 3263 | Ga0501080_0015912 | |||
| 3264 | Ga0501080_0024958 | |||
| 3265 | Ga0501080_0053279 | |||
| 3266 | Ga0501080_0139921 | |||
| 3267 | Ga0501080_0164236 | |||
| 3268 | Ga0501083_0000087 | |||
| 3269 | Ga0501083_0018512 | |||
| 3270 | Ga0501083_0127008 | |||
| 3271 | Ga0501083_0211671 | |||
| 3272 | Ga0501035_0000223 | |||
| 3273 | Ga0501035_0009850 | |||
| 3274 | Ga0501035_0019488 | |||
| 3275 | Ga0501035_0021012 | |||
| 3276 | Ga0501035_0036839 | |||
| 3277 | Ga0501035_0065366 | |||
| 3278 | Ga0501035_0101224 | |||
| 3279 | Ga0501044_0000369 | |||
| 3280 | Ga0501044_0029450 | |||
| 3281 | Ga0501044_0082994 | |||
| 3282 | Ga0501044_0096443 | |||
| 3283 | Ga0501044_0123956 | |||
| 3284 | Ga0501044_0151796 | |||
| 3285 | Ga0501044_0278393 | |||
| 3286 | Ga0501044_0353486 | |||
| 3287 | Ga0501045_0003158 | |||
| 3288 | Ga0501045_0185869 | |||
| 3289 | nmdc:mga03683_58016_c1 | |||
| 3290 | nmdc:mga03n38_5599_c1 | |||
| 3291 | nmdc:mga03n38_866_c1 | |||
| 3292 | nmdc:mga00v17_14094_c1 | |||
| 3293 | nmdc:mga00v17_167231_c1 | |||
| 3294 | nmdc:mga00v17_364542_c1 | |||
| 3295 | nmdc:mga0yw44_156649_c1 | |||
| 3296 | nmdc:mga0yw44_204888_c1 | |||
| 3297 | nmdc:mga0yw44_2331_c1 | |||
| 3298 | nmdc:mga0yw44_242690_c1 | |||
| 3299 | nmdc:mga0yw44_331786_c1 | |||
| 3300 | nmdc:mga0yw44_34263_c1 | |||
| 3301 | nmdc:mga0k408_18012_c1 | |||
| 3302 | nmdc:mga0k408_238953_c1 | |||
| 3303 | nmdc:mga06z11_103129_c1 | |||
| 3304 | nmdc:mga06z11_55066_c1 | |||
| 3305 | nmdc:mga06z11_85073_c1 | |||
| 3306 | nmdc:mga04h51_12842_c1 | |||
| 3307 | nmdc:mga07m45_158907_c1 | |||
| 3308 | nmdc:mga07m45_8361_c1 | |||
| 3309 | nmdc:mga07m45_93596_c1 | |||
| 3310 | nmdc:mga05p37_555_c1 | |||
| 3311 | nmdc:mga05p37_63752_c1 | |||
| 3312 | nmdc:mga05p37_824366_c1 | |||
| 3313 | nmdc:mga09592_24376_c1 | |||
| 3314 | nmdc:mga0qj67_382736_c1 | |||
| 3315 | nmdc:mga06r32_187410_c1 | |||
| 3316 | nmdc:mga06r32_76341_c1 | |||
| 3317 | nmdc:mga08y16_134_c1 | |||
| 3318 | nmdc:mga08y16_527942_c1 | |||
| 3319 | nmdc:mga08y16_83711_c1 | |||
| 3320 | nmdc:mga0n895_107862_c1 | |||
| 3321 | nmdc:mga0n895_168242_c1 | |||
| 3322 | nmdc:mga0n895_281199_c1 | |||
| 3323 | nmdc:mga0n895_371837_c1 | |||
| 3324 | nmdc:mga0rr50_23433_c1 | |||
| 3325 | nmdc:mga0rr50_289107_c1 | |||
| 3326 | nmdc:mga0sz30_176696_c1 | |||
| 3327 | nmdc:mga0sz30_38397_c1 | |||
| 3328 | Ga0495601_0000004 | |||
| 3329 | Ga0495601_0074263 | |||
| 3330 | Ga0495601_0241907 | |||
| 3331 | Ga0495612_0000008 | |||
| 3332 | Ga0495612_0012354 | |||
| 3333 | Ga0500635_0021603 | |||
| 3334 | Ga0495595_0000299 | |||
| 3335 | Ga0495595_0002435 | |||
| 3336 | Ga0495619_0000410 | |||
| 3337 | Ga0495619_0002051 | |||
| 3338 | Ga0495619_0107032 | |||
| 3339 | Ga0495619_0274955 | |||
| 3340 | Ga0500643_000035 | |||
| 3341 | Ga0500643_002043 | |||
| 3342 | Ga0500643_095135 | |||
| 3343 | Ga0500583_0340185 | |||
| 3344 | Ga0500651_0014239 | |||
| 3345 | Ga0500651_0019792 | |||
| 3346 | Ga0500651_0089411 | |||
| 3347 | Ga0500651_0097142 | |||
| 3348 | Ga0500566_0000006 | |||
| 3349 | Ga0500566_0003025 | |||
| 3350 | Ga0500566_0007070 | |||
| 3351 | Ga0500566_0020464 | |||
| 3352 | Ga0500566_0050700 | |||
| 3353 | Ga0500566_0122820 | |||
| 3354 | Ga0500640_000606 | |||
| 3355 | Ga0500641_0002166 | |||
| 3356 | Ga0500641_0009735 | |||
| 3357 | Ga0500641_0023876 | |||
| 3358 | Ga0500641_0064774 | |||
| 3359 | Ga0500650_0027948 | |||
| 3360 | Ga0500650_0094324 | |||
| 3361 | Ga0500555_006179 | |||
| 3362 | Ga0500555_077440 | |||
| 3363 | Ga0500556_0000030 | |||
| 3364 | Ga0500556_0000734 | |||
| 3365 | Ga0500557_000004 | |||
| 3366 | Ga0500569_008206 | |||
| 3367 | Ga0500572_000132 | |||
| 3368 | Ga0500572_000296 | |||
| 3369 | Ga0500591_007207 | |||
| 3370 | Ga0500592_001857 | |||
| 3371 | Ga0500594_0015247 | |||
| 3372 | Ga0500594_0058113 | |||
| 3373 | Ga0500595_000306 | |||
| 3374 | Ga0500595_001509 | |||
| 3375 | Ga0500595_002915 | |||
| 3376 | Ga0500595_014140 | |||
| 3377 | Ga0500595_022512 | |||
| 3378 | Ga0500595_025262 | |||
| 3379 | Ga0500595_084980 | |||
| 3380 | Ga0500607_055375 | |||
| 3381 | Ga0500608_045969 | |||
| 3382 | Ga0500614_001796 | |||
| 3383 | Ga0500614_034971 | |||
| 3384 | Ga0500642_0000080 | |||
| 3385 | Ga0500642_0000302 | |||
| 3386 | Ga0500642_0059969 | |||
| 3387 | Ga0500642_0145080 | |||
| 3388 | Ga0500652_001386 | |||
| 3389 | Ga0500652_061353 | |||
| 3390 | Ga0500655_021935 | |||
| 3391 | Ga0500658_0191389 | |||
| 3392 | Ga0500559_0000591 | |||
| 3393 | Ga0500559_0000850 | |||
| 3394 | Ga0500559_0001859 | |||
| 3395 | Ga0500559_0067160 | |||
| 3396 | Ga0500559_0102365 | |||
| 3397 | Ga0500559_0228383 | |||
| 3398 | Ga0500568_0000978 | |||
| 3399 | Ga0500568_0014177 | |||
| 3400 | Ga0500568_0014813 | |||
| 3401 | Ga0500568_0023458 | |||
| 3402 | Ga0500568_0110948 | |||
| 3403 | Ga0500568_0162847 | |||
| 3404 | Ga0500588_0059060 | |||
| 3405 | Ga0500588_0060830 | |||
| 3406 | Ga0500588_0128155 | |||
| 3407 | Ga0500603_000125 | |||
| 3408 | Ga0500603_016027 | |||
| 3409 | Ga0500603_021405 | |||
| 3410 | Ga0500603_049058 | |||
| 3411 | Ga0500604_0004650 | |||
| 3412 | Ga0500604_0035375 | |||
| 3413 | Ga0500604_0048977 | |||
| 3414 | Ga0500616_0000252 | |||
| 3415 | Ga0500616_0000696 | |||
| 3416 | Ga0500616_0015478 | |||
| 3417 | Ga0500616_0055865 | |||
| 3418 | Ga0500620_001207 | |||
| 3419 | Ga0500622_0002597 | |||
| 3420 | Ga0500622_0003061 | |||
| 3421 | Ga0500622_0088897 | |||
| 3422 | Ga0500627_0219046 | |||
| 3423 | Ga0500627_0279057 | |||
| 3424 | Ga0500630_029525 | |||
| 3425 | Ga0500634_0007858 | |||
| 3426 | Ga0500634_0119245 | |||
| 3427 | Ga0500638_001134 | |||
| 3428 | Ga0500638_032065 | |||
| 3429 | Ga0500638_045989 | |||
| 3430 | Ga0500638_104409 | |||
| 3431 | Ga0500639_000016 | |||
| 3432 | Ga0500639_043671 | |||
| 3433 | Ga0500639_197036 | |||
| 3434 | Ga0500636_0000066 | |||
| 3435 | Ga0500636_0000534 | |||
| 3436 | Ga0500636_0006053 | |||
| 3437 | Ga0500636_0046789 | |||
| 3438 | Ga0500637_0001307 | |||
| 3439 | Ga0500637_0095998 | |||
| 3440 | Ga0500576_039982 | |||
| 3441 | Ga0500625_000123 | |||
| 3442 | Ga0500645_015900 | |||
| 3443 | Ga0500645_051528 | |||
| 3444 | Ga0500599_009161 | |||
| 3445 | Ga0500601_000139 | |||
| 3446 | Ga0500601_002260 | |||
| 3447 | Ga0501084_0005685 | |||
| 3448 | Ga0501084_0020558 | |||
| 3449 | Ga0501084_0220459 | |||
| 3450 | Ga0501082_0000799 | |||
| 3451 | Ga0501082_0028947 | |||
| 3452 | Ga0501082_0797946 | |||
| 3453 | 2513657908 | |||
| 3454 | 2513855604 | |||
| 3455 | 2513890243 | |||
| 3456 | 2513919999 | |||
| 3457 | 2515627145 | |||
| 3458 | 2517892149 | |||
| 3459 | 2524465746 | |||
| 3460 | 2524534250 | |||
| 3461 | 2528853891 | |||
| 3462 | 2603859677 | |||
| 3463 | 2644288849 | |||
| 3464 | 2793062744 | |||
| 3465 | 2793082406 | |||
| 3466 | 2805915107 | |||
| 3467 | 2824604119 | |||
| 3468 | 2824610388 | |||
| 3469 | 2824659417 | |||
| 3470 | 2824668831 | |||
| 3471 | 2824703873 | |||
| 3472 | 2824733312 | |||
| 3473 | 2842040035 | |||
| 3474 | 2842047020 | |||
| 3475 | 2847946795 | |||
| 3476 | 2857528924 | |||
| 3477 | 2874598281 | |||
| 3478 | 2874627570 | |||
| 3479 | 2874652663 | |||
| 3480 | 2876778241 | |||
| 3481 | 2876825890 | |||
| 3482 | 2879082035 | |||
| 3483 | 2879104879 | |||
| 3484 | 2879135157 | |||
| 3485 | 2879145484 | |||
| 3486 | 2885382753 | |||
| 3487 | 2885386791 | |||
| 3488 | 2888424763 | |||
| 3489 | 2893070381 | |||
| 3490 | 2903771796 | |||
| 3491 | 2904673110 | |||
| 3492 | 2904702293 | |||
| 3493 | 2906617277 | |||
| 3494 | 2906643332 | |||
| 3495 | 2906662538 | |||
| 3496 | 2908742432 | |||
| 3497 | 2919076324 | |||
| 3498 | 2919454503 | |||
| 3499 | 2922374675 | |||
| 3500 | 2922430550 | |||
| 3501 | 2929621765 | |||
| 3502 | 2929629928 | |||
| 3503 | 2932788617 | |||
| 3504 | 2932817200 | |||
| 3505 | 2932825211 | |||
| 3506 | 2932830265 | |||
| 3507 | 2933583959 | |||
| 3508 | 2935622509 | |||
| 3509 | 2935642114 | |||
| 3510 | 2935672502 | |||
| 3511 | 2935676033 | |||
| 3512 | 2935686025 | |||
| 3513 | 2935697731 | |||
| 3514 | 2935705865 | |||
| 3515 | 2935714577 | |||
| 3516 | 2935725196 | |||
| 3517 | 2935732444 | |||
| 3518 | 2935741823 | |||
| 3519 | 2935751990 | |||
| 3520 | 2935765247 | |||
| 3521 | 2935802862 | |||
| 3522 | 2935813306 | |||
| 3523 | 2935830281 | |||
| 3524 | 2935838178 | |||
| 3525 | 2935860758 | |||
| 3526 | 2935872269 | |||
| 3527 | 2935878676 | |||
| 3528 | 2935978639 | |||
| 3529 | 2935994928 | |||
| 3530 | 2936003571 | |||
| 3531 | 2936042255 | |||
| 3532 | 2940557207 | |||
| 3533 | 2941539155 | |||
| 3534 | 3005510550 | |||
| 3535 | 3005715132 | |||
| 3536 | 8006940422 | |||
| 3537 | 8006980110 | |||
| 3538 | 8016522043 | |||
| 3539 | 8017063625 | |||
| 3540 | 8019556304 | |||
| 3541 | 8019569011 | |||
| 3542 | 8019582951 | |||
| 3543 | 8019590750 | |||
| 3544 | 8019600603 | |||
| 3545 | 8019617943 | |||
| 3546 | 8019628436 | |||
| 3547 | 8019645530 | |||
| 3548 | 8019671598 | |||
| 3549 | 8019684503 | |||
| 3550 | 8055746069 | |||
| 3551 | 8056687374 | |||
| 3552 | 8056691283 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7o9m-assembly1.cif.gz_n | human mitochondrial ribosome large subunit assembly intermediate with mterf4-nsun4, mrm2, mtg1 and the malsu module | 0.9571 | 17 | 223 |
| 7o9k-assembly1.cif.gz_n | human mitochondrial ribosome large subunit assembly intermediate with mterf4-nsun4, mrm2, mtg1, the malsu module, gtpbp5 and mtef-tu | 0.9528 | 44 | 223 |
| 8ia0-assembly1.cif.gz_CS | cryo-em structure of a chaetomium thermophilum pre-60s ribosomal subunit - state puf6 | 0.9274 | 33 | 226 |
| 8i9v-assembly1.cif.gz_CS | cryo-em structure of a chaetomium thermophilum pre-60s ribosomal subunit - state dbp10-2 | 0.9261 | 33 | 226 |
| 1ej0-assembly1.cif.gz_A | ftsj rna methyltransferase complexed with s-adenosylmethionine, mercury derivative | 0.9235 | 45 | 223 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P78860_27_218_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9389 | 44 | 223 | 3.40.50.150 |
| af_Q58771_22_215_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9382 | 44 | 226 | 3.40.50.150 |
| af_Q9VDT6_58_249_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9376 | 44 | 226 | 3.40.50.150 |
| af_Q4CQP4_20_264_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9286 | 44 | 222 | 3.40.50.150 |
| af_O62251_31_214_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9268 | 44 | 223 | 3.40.50.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3S5IZV3-F1-model_v4 | Ribosomal RNA large subunit methyltransferase E (EC 2.1.1.166) (23S rRNA Um2552 methyltransferase) (rRNA (uridine-2'-O-)-methyltransferase) | 0.9755 | 48 | 223 |
GO:0008650
|
| AF-A0A1B3NIC8-F1-model_v4 | Ribosomal RNA large subunit methyltransferase E (EC 2.1.1.166) (23S rRNA Um2552 methyltransferase) (rRNA (uridine-2'-O-)-methyltransferase) | 0.9732 | 9 | 226 |
GO:0005737
GO:0008650 |
| AF-A0A0K6HEM9-F1-model_v4 | deleted | 0.9731 | 8 | 226 |
|
| AF-E0THU5-F1-model_v4 | Ribosomal RNA large subunit methyltransferase E (EC 2.1.1.166) (23S rRNA Um2552 methyltransferase) (rRNA (uridine-2'-O-)-methyltransferase) | 0.9726 | 9 | 225 |
GO:0005737
GO:0008650 |
| AF-Q0AQH3-F1-model_v4 | Ribosomal RNA large subunit methyltransferase E (EC 2.1.1.166) (23S rRNA Um2552 methyltransferase) (rRNA (uridine-2'-O-)-methyltransferase) | 0.9724 | 9 | 223 |
GO:0005737
GO:0008650 |