F495663

General Info

Members Datasets Scaffolds Average Seq Length
1776 626 3552 228

Family's Representative Sequence

Representative Sequence 3300003659|JGI25404J52841_10030344|JGI25404J52841_100303441
Length 281
Sequence MLRVPVMTRLFRYAPDFALRVINRLLCRTGSVLLIPRPDSGGHFKTSIDMAKDTTGRLHVTVKTGGKRKLSSKLWLERQLNDPYVAKAKRDGYRSRAAYKLIEMDDKYRFLKPGIAVVDLGAAPGGWSQIAAKRVGAVNGKGKVAAIDLLEMPEIPGVDFAQLDFLAEDAPEKLIAMMGGRADVVMSDMAANTTGHRKTDQLRIIGLVESAAAFAADVLNPGGTFLAKVFQSGADAELVAQLKRDFASVRHVKPASSRQDSSERYVLAMGFRGQPDRPIEP

Samples

Sample ID Description Type Environment
1 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
2 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
3 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
4 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
7 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
8 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
9 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
10 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
11 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
12 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
13 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
14 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
15 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
16 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
24 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
25 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
28 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
40 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
41 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
42 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
43 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
44 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
45 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
46 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
47 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
48 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
49 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
50 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
51 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
52 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
53 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
54 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
55 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
56 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
57 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
58 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
67 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
70 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
71 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
72 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
73 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
74 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
75 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
76 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
77 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
78 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
79 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
80 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
81 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
82 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
83 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
84 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
85 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
86 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
87 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
88 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
89 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
90 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
91 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
92 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
93 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
94 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
96 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
97 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
98 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
99 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
100 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
101 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
102 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
103 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
104 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
105 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
106 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
107 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
108 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
109 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
110 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
111 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
112 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
113 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
114 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
115 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
116 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
117 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
118 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
119 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
120 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
121 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
122 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
123 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
124 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
125 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
126 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
127 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
128 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
129 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
130 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
131 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
132 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
133 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
134 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
135 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
136 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
137 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
138 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
139 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
140 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
141 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
142 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
143 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
144 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
145 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
146 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
147 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
148 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
149 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
153 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
155 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
156 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
157 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
158 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
159 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
224 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
225 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
226 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
227 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
228 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
229 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
233 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
234 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
235 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
236 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
237 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
238 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
239 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
240 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
241 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
242 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
243 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
244 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
245 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
246 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
247 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
248 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
249 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
250 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
251 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
252 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
253 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
254 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
255 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
256 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
257 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
258 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
259 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
260 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
261 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
262 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
263 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
264 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
265 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
266 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
267 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
268 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
269 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
270 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
271 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
272 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
273 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
274 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
275 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
276 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
277 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
278 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
279 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
280 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
281 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
282 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
283 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
284 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
285 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
286 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
287 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
288 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
289 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
290 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
291 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
292 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
293 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
294 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
295 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
296 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
297 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
298 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
299 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
300 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
301 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
302 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
303 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
304 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
305 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
306 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
307 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
308 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
309 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
310 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
311 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
312 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
313 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
314 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
315 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
316 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
317 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
318 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
319 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
320 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
321 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
322 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
323 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
324 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
325 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
326 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
327 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
328 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
329 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
330 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
331 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
332 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
333 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
334 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
335 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
336 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
337 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
338 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
339 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
340 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
341 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
342 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
343 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
344 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
345 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
346 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
347 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
348 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
349 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
350 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
351 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
352 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
353 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
354 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
355 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
356 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
357 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
358 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
359 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
360 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
361 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
362 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
363 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
364 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
365 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
366 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
367 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
368 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
369 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
370 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
371 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
372 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
373 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
374 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
375 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
376 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
377 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
378 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
379 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
380 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
381 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
382 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
383 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
384 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
385 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
386 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
387 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
388 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
389 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
390 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
391 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
392 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
393 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
394 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
395 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
396 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
397 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
398 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
399 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
400 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
401 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
402 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
403 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
404 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
405 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
406 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
407 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
408 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
409 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
410 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
411 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
412 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
413 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
414 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
415 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
416 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
417 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
418 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
419 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
420 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
421 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
422 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
423 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
424 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
425 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
426 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
427 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
428 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
429 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
430 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
431 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
432 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
433 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
434 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
435 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
436 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
437 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
438 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
439 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
440 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
441 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
442 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
443 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
444 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
445 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
446 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
447 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
448 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
449 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
450 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
451 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
452 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
453 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
454 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
455 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
456 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
457 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
458 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
459 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
460 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
461 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
462 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
463 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
464 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
465 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
466 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
467 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
468 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
469 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
470 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
471 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
472 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
473 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
474 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
475 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
476 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
477 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
478 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
479 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
480 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
481 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
482 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
483 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
484 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
485 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
486 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
487 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
488 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
489 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
490 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
491 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
492 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
493 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
494 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
495 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
496 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
497 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
498 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
499 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
500 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
501 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
502 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
503 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
504 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
505 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
506 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
507 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
508 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
509 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
510 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
511 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
512 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
513 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
514 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
515 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
516 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
517 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
518 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
519 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
520 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
521 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
522 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
523 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
524 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
525 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
526 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
527 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
528 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
529 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
530 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
531 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
532 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
533 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
534 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
535 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
536 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
537 2643221651 Afipia sp. Root123D2 Isolate Unclassified
538 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
539 2791355199
540 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
541 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
542 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
543 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
544 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
545 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
546 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
547 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
548 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
549 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
550 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
551 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
552 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
553 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
554 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
555 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
556 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
557 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
558 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
559 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
560 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
561 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
562 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
563 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
564 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
565 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
566 2904699407
567 2906610324
568 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
569 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
570 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
571 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
572 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
573 2922368715
574 2922425934
575 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
576 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
577 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
578 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
579 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
580 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
581 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
582 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
583 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
584 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
585 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
586 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
587 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
588 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
589 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
590 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
591 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
592 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
593 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
594 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
595 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
596 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
597 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
598 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
599 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
600 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
601 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
602 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
603 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
604 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
605 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
606 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
607 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
608 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
609 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
610 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
611 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
612 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
613 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
614 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
615 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
616 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
617 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
618 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
619 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
620 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
621 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
622 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
623 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
624 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
625 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
626 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.58
Metatranscriptomes 0.06
Isolates 5.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.09
Nodule 5.18
Rhizoplane 6.19
Rhizosphere 70.44
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25404J52841_10030344 3300003659 Bacteria 1158
2 RicEn_C9014 2010549000 Bacteria 1771
3 MBSR1b_contig_11443562 2162886012 Bacteria 983
4 MBSR1b_contig_12173630 2162886012 Bacteria 998
5 CNAas_1004010 3300000532 Bacteria 955
6 JGI24740J21852_10015785 3300001979 Bacteria 2746
7 JGI24739J22299_10029215 3300001989 Bacteria 1918
8 JGI24737J22298_10006476 3300001990 Bacteria 3998
9 JGI24735J21928_10007461 3300002067 Bacteria 3566
10 JGI24744J21845_10042665 3300002077 Bacteria 846
11 JGI25406J46586_10000047 3300003203 Bacteria 54770
12 JGI25153J46596_10001251 3300003215 Bacteria 15286
13 JGI25153J46596_10002613 3300003215 Bacteria 10304
14 JGI25153J46596_10002759 3300003215 Bacteria 9992
15 JGI25153J46596_10005940 3300003215 Bacteria 6291
16 JGI25160J50197_1002757 3300003354 Bacteria 8051
17 JGI25160J50197_1032891 3300003354 Bacteria 1312
18 JGI25404J52841_10010459 3300003659 Bacteria 1995
19 JGI25404J52841_10019235 3300003659 Bacteria 1479
20 Ga0055531_10022839 3300003794 Bacteria 2368
21 Ga0065165_1000231 3300005262 Bacteria 97237
22 Ga0065165_1001895 3300005262 Bacteria 20125
23 Ga0065712_10231883 3300005290 Bacteria 991
24 Ga0065715_10160419 3300005293 Bacteria 1635
25 Ga0070658_10165438 3300005327 Bacteria 1857
26 Ga0070658_10194684 3300005327 Bacteria 1709
27 Ga0070658_10207247 3300005327 Bacteria 1655
28 Ga0070658_10344647 3300005327 Bacteria 1275
29 Ga0070658_10370198 3300005327 Bacteria 1228
30 Ga0070658_10637307 3300005327 Bacteria 924
31 Ga0070676_10114075 3300005328 Bacteria 1687
32 Ga0070676_10124974 3300005328 Bacteria 1620
33 Ga0070676_10169066 3300005328 Bacteria 1412
34 Ga0070676_10216748 3300005328 Bacteria 1262
35 Ga0070676_10245939 3300005328 Bacteria 1192
36 Ga0070683_100015898 3300005329 Bacteria 6621
37 Ga0070683_100087298 3300005329 Bacteria 2925
38 Ga0070683_100090477 3300005329 Bacteria 2873
39 Ga0070670_100002084 3300005331 Bacteria 16387
40 Ga0070670_100018067 3300005331 Bacteria 6052
41 Ga0070670_100113796 3300005331 Bacteria 2333
42 Ga0070670_100127870 3300005331 Bacteria 2193
43 Ga0070670_100153040 3300005331 Bacteria 1996
44 Ga0070670_100171499 3300005331 Bacteria 1882
45 Ga0070677_10060360 3300005333 Bacteria 1562
46 Ga0070677_10086571 3300005333 Bacteria 1354
47 Ga0068869_100022270 3300005334 Bacteria 4364
48 Ga0068869_100030572 3300005334 Bacteria 3782
49 Ga0068869_100055456 3300005334 Bacteria 2888
50 Ga0068869_100119055 3300005334 Bacteria 2017
51 Ga0070666_10001973 3300005335 Bacteria 12500
52 Ga0070680_100055713 3300005336 Bacteria 3231
53 Ga0070680_100125785 3300005336 Bacteria 2142
54 Ga0070680_100169644 3300005336 Bacteria 1836
55 Ga0070680_100477499 3300005336 Bacteria 1065
56 Ga0070682_100617722 3300005337 Bacteria 858
57 Ga0068868_100025524 3300005338 Bacteria 4496
58 Ga0068868_100109714 3300005338 Bacteria 2241
59 Ga0068868_100197211 3300005338 Bacteria 1677
60 Ga0068868_100254272 3300005338 Bacteria 1479
61 Ga0068868_100590422 3300005338 Bacteria 983
62 Ga0070689_100055865 3300005340 Bacteria 3060
63 Ga0070689_100311686 3300005340 Bacteria 1312
64 Ga0070687_100262463 3300005343 Bacteria 1079
65 Ga0070661_100017395 3300005344 Bacteria 5100
66 Ga0070661_100357733 3300005344 Bacteria 1147
67 Ga0070661_100521967 3300005344 Bacteria 953
68 Ga0070668_100002309 3300005347 Bacteria 14048
69 Ga0070668_100048482 3300005347 Bacteria 3267
70 Ga0070668_100051684 3300005347 Bacteria 3167
71 Ga0070668_100054079 3300005347 Bacteria 3096
72 Ga0070668_100066405 3300005347 Bacteria 2799
73 Ga0070668_100086847 3300005347 Bacteria 2460
74 Ga0070668_100138652 3300005347 Bacteria 1958
75 Ga0070668_100154631 3300005347 Bacteria 1857
76 Ga0070668_100194541 3300005347 Bacteria 1662
77 Ga0070669_100012022 3300005353 Bacteria 6141
78 Ga0070669_100086727 3300005353 Bacteria 2339
79 Ga0070669_100305981 3300005353 Bacteria 1280
80 Ga0070669_100309468 3300005353 Bacteria 1273
81 Ga0070669_100727184 3300005353 Bacteria 840
82 Ga0070675_100012309 3300005354 Bacteria 6704
83 Ga0070675_100171402 3300005354 Bacteria 1872
84 Ga0070675_100394506 3300005354 Bacteria 1234
85 Ga0070675_100616539 3300005354 Bacteria 985
86 Ga0070671_100081489 3300005355 Bacteria 2706
87 Ga0070671_100256534 3300005355 Bacteria 1486
88 Ga0070674_100058334 3300005356 Bacteria 2683
89 Ga0070674_100066308 3300005356 Bacteria 2536
90 Ga0070674_100093562 3300005356 Bacteria 2175
91 Ga0070673_100033023 3300005364 Bacteria 3903
92 Ga0070688_100042310 3300005365 Bacteria 2801
93 Ga0070688_100089017 3300005365 Bacteria 2014
94 Ga0070688_100345454 3300005365 Bacteria 1088
95 Ga0070688_100347563 3300005365 Bacteria 1085
96 Ga0070659_100053564 3300005366 Bacteria 3176
97 Ga0070659_100086855 3300005366 Bacteria 2504
98 Ga0070659_100173060 3300005366 Bacteria 1769
99 Ga0070659_100248514 3300005366 Bacteria 1474
100 Ga0070667_100000717 3300005367 Bacteria 31904
101 Ga0070667_100002487 3300005367 Bacteria 16080
102 Ga0070667_100066866 3300005367 Bacteria 3055
103 Ga0070667_100123547 3300005367 Bacteria 2254
104 Ga0070667_100243371 3300005367 Bacteria 1607
105 Ga0070709_10022117 3300005434 Bacteria 3715
106 Ga0070709_10073503 3300005434 Bacteria 2213
107 Ga0070714_100094761 3300005435 Bacteria 2621
108 Ga0070714_100119588 3300005435 Bacteria 2342
109 Ga0070714_100134340 3300005435 Bacteria 2214
110 Ga0070714_100269266 3300005435 Bacteria 1579
111 Ga0070713_100012226 3300005436 Bacteria 6288
112 Ga0070713_100017595 3300005436 Bacteria 5410
113 Ga0070713_100031275 3300005436 Bacteria 4239
114 Ga0070713_100056841 3300005436 Bacteria 3255
115 Ga0070713_100322617 3300005436 Bacteria 1427
116 Ga0070713_100438726 3300005436 Bacteria 1225
117 Ga0070713_100439077 3300005436 Bacteria 1224
118 Ga0070710_10001119 3300005437 Bacteria 12688
119 Ga0070710_10008886 3300005437 Bacteria 4903
120 Ga0070711_100002712 3300005439 Bacteria 10159
121 Ga0070711_100009524 3300005439 Bacteria 5989
122 Ga0070711_100010921 3300005439 Bacteria 5631
123 Ga0070711_100011141 3300005439 Bacteria 5578
124 Ga0070711_100745116 3300005439 Bacteria 827
125 Ga0070711_100855811 3300005439 Bacteria 774
126 Ga0070705_100232952 3300005440 Bacteria 1282
127 Ga0070663_100015227 3300005455 Bacteria 4958
128 Ga0070663_100051820 3300005455 Bacteria 2926
129 Ga0070663_100062227 3300005455 Bacteria 2690
130 Ga0070663_100152888 3300005455 Bacteria 1771
131 Ga0070663_100164430 3300005455 Bacteria 1710
132 Ga0070663_100213032 3300005455 Bacteria 1513
133 Ga0070663_100324666 3300005455 Bacteria 1239
134 Ga0070663_100357832 3300005455 Bacteria 1183
135 Ga0070663_100383908 3300005455 Bacteria 1145
136 Ga0070663_100569587 3300005455 Bacteria 949
137 Ga0070678_100063529 3300005456 Bacteria 2732
138 Ga0070678_100064365 3300005456 Bacteria 2717
139 Ga0070678_100089137 3300005456 Bacteria 2360
140 Ga0070678_100122526 3300005456 Bacteria 2053
141 Ga0070678_100600104 3300005456 Bacteria 983
142 Ga0070678_100609639 3300005456 Bacteria 975
143 Ga0070662_100209541 3300005457 Bacteria 1550
144 Ga0070662_100287692 3300005457 Bacteria 1331
145 Ga0070662_100303939 3300005457 Bacteria 1297
146 Ga0070662_100392978 3300005457 Bacteria 1143
147 Ga0070662_100767566 3300005457 Bacteria 818
148 Ga0070681_10042518 3300005458 Bacteria 4553
149 Ga0070681_10520516 3300005458 Bacteria 1103
150 Ga0068867_100002382 3300005459 Bacteria 13218
151 Ga0068867_100106659 3300005459 Bacteria 2146
152 Ga0068867_100110721 3300005459 Bacteria 2110
153 Ga0068867_100184555 3300005459 Bacteria 1660
154 Ga0068867_100497686 3300005459 Bacteria 1047
155 Ga0070685_10058405 3300005466 Bacteria 2249
156 Ga0070685_10263209 3300005466 Bacteria 1147
157 Ga0070698_100299253 3300005471 Bacteria 1539
158 Ga0070699_100064968 3300005518 Bacteria 3165
159 Ga0070679_100691351 3300005530 Bacteria 963
160 Ga0070684_100009002 3300005535 Bacteria 7843
161 Ga0070684_100094774 3300005535 Bacteria 2659
162 Ga0070684_100098651 3300005535 Bacteria 2606
163 Ga0068853_100008769 3300005539 Bacteria 8134
164 Ga0068853_100093792 3300005539 Bacteria 2643
165 Ga0068853_100113245 3300005539 Bacteria 2412
166 Ga0068853_100372887 3300005539 Bacteria 1332
167 Ga0068853_100462143 3300005539 Bacteria 1195
168 Ga0070672_100002140 3300005543 Bacteria 12464
169 Ga0070672_100018833 3300005543 Bacteria 4999
170 Ga0070672_100084879 3300005543 Bacteria 2544
171 Ga0070672_100223410 3300005543 Bacteria 1580
172 Ga0070672_100248799 3300005543 Bacteria 1497
173 Ga0070695_100161572 3300005545 Bacteria 1573
174 Ga0070693_100070672 3300005547 Bacteria 2054
175 Ga0070693_100092518 3300005547 Bacteria 1826
176 Ga0070693_100509863 3300005547 Bacteria 855
177 Ga0070665_100010979 3300005548 Bacteria 9158
178 Ga0070665_100025000 3300005548 Bacteria 6021
179 Ga0070665_100033934 3300005548 Bacteria 5133
180 Ga0070665_100051133 3300005548 Bacteria 4145
181 Ga0070665_100116171 3300005548 Bacteria 2678
182 Ga0070665_100290413 3300005548 Bacteria 1637
183 Ga0070665_100902553 3300005548 Bacteria 896
184 Ga0070704_100508401 3300005549 Bacteria 1047
185 Ga0068855_100018065 3300005563 Bacteria 8475
186 Ga0068855_100033896 3300005563 Bacteria 6091
187 Ga0068855_100058388 3300005563 Bacteria 4519
188 Ga0068855_100110620 3300005563 Bacteria 3153
189 Ga0068855_100134302 3300005563 Bacteria 2823
190 Ga0068855_100150475 3300005563 Bacteria 2647
191 Ga0068855_100235716 3300005563 Bacteria 2047
192 Ga0068855_100240817 3300005563 Bacteria 2022
193 Ga0068855_100384354 3300005563 Bacteria 1541
194 Ga0070664_100012841 3300005564 Bacteria 6813
195 Ga0070664_100479462 3300005564 Bacteria 1144
196 Ga0070664_100492018 3300005564 Bacteria 1130
197 Ga0068857_100007461 3300005577 Bacteria 9412
198 Ga0068857_100011475 3300005577 Bacteria 7708
199 Ga0068857_100017624 3300005577 Bacteria 6261
200 Ga0068857_100028310 3300005577 Bacteria 4944
201 Ga0068854_100027763 3300005578 Bacteria 3904
202 Ga0068854_100036078 3300005578 Bacteria 3464
203 Ga0068854_100160752 3300005578 Bacteria 1739
204 Ga0068854_100184747 3300005578 Bacteria 1630
205 Ga0068854_100881687 3300005578 Bacteria 785
206 Ga0068856_100000020 3300005614 Bacteria 146775
207 Ga0068856_100018098 3300005614 Bacteria 6831
208 Ga0068856_100026301 3300005614 Bacteria 5674
209 Ga0068856_100040303 3300005614 Bacteria 4587
210 Ga0068856_100077346 3300005614 Bacteria 3297
211 Ga0068856_100146436 3300005614 Bacteria 2369
212 Ga0068856_100242967 3300005614 Bacteria 1816
213 Ga0068856_100469858 3300005614 Bacteria 1278
214 Ga0068856_100861800 3300005614 Bacteria 925
215 Ga0068856_100880146 3300005614 Bacteria 915
216 Ga0070702_100132032 3300005615 Bacteria 1579
217 Ga0068852_100013378 3300005616 Bacteria 6280
218 Ga0068852_100031347 3300005616 Bacteria 4386
219 Ga0068852_100038673 3300005616 Bacteria 4011
220 Ga0068852_100180689 3300005616 Bacteria 1984
221 Ga0068852_100184449 3300005616 Bacteria 1964
222 Ga0068852_100733175 3300005616 Bacteria 1000
223 Ga0068859_100003527 3300005617 Bacteria 15930
224 Ga0068859_100006173 3300005617 Bacteria 12177
225 Ga0068859_100072923 3300005617 Bacteria 3471
226 Ga0068859_100144919 3300005617 Bacteria 2449
227 Ga0068859_100306737 3300005617 Bacteria 1681
228 Ga0068859_100351852 3300005617 Bacteria 1568
229 Ga0068864_100004761 3300005618 Bacteria 11119
230 Ga0068864_100150503 3300005618 Bacteria 2108
231 Ga0068864_100261260 3300005618 Bacteria 1611
232 Ga0068864_100629097 3300005618 Bacteria 1044
233 Ga0068866_10122401 3300005718 Bacteria 1468
234 Ga0068866_10122460 3300005718 Bacteria 1467
235 Ga0068861_100016661 3300005719 Bacteria 5204
236 Ga0068861_100038919 3300005719 Bacteria 3546
237 Ga0068861_100196324 3300005719 Bacteria 1691
238 Ga0068861_100387494 3300005719 Bacteria 1236
239 Ga0068861_100433784 3300005719 Bacteria 1173
240 Ga0068861_100741319 3300005719 Bacteria 917
241 Ga0068851_10064709 3300005834 Bacteria 1880
242 Ga0068870_10035764 3300005840 Bacteria 2551
243 Ga0068863_100002512 3300005841 Bacteria 18221
244 Ga0068863_100141628 3300005841 Bacteria 2298
245 Ga0068863_100154091 3300005841 Bacteria 2200
246 Ga0068863_100627486 3300005841 Bacteria 1065
247 Ga0068863_100747614 3300005841 Bacteria 974
248 Ga0068858_100015036 3300005842 Bacteria 7281
249 Ga0068858_100015457 3300005842 Bacteria 7178
250 Ga0068858_100071113 3300005842 Bacteria 3226
251 Ga0068858_100238546 3300005842 Bacteria 1725
252 Ga0068858_100314077 3300005842 Bacteria 1497
253 Ga0068860_100004964 3300005843 Bacteria 13559
254 Ga0068860_100016614 3300005843 Bacteria 7177
255 Ga0068860_100134343 3300005843 Bacteria 2376
256 Ga0068860_100186064 3300005843 Bacteria 2008
257 Ga0068862_100053426 3300005844 Bacteria 3458
258 Ga0068862_100136416 3300005844 Bacteria 2174
259 Ga0068862_100151638 3300005844 Bacteria 2063
260 Ga0068862_100281455 3300005844 Bacteria 1524
261 Ga0068862_100622576 3300005844 Bacteria 1038
262 Ga0081455_10011418 3300005937 Bacteria 8927
263 Ga0081455_10015893 3300005937 Bacteria 7286
264 Ga0081455_10019603 3300005937 Bacteria 6391
265 Ga0081455_10107769 3300005937 Bacteria 2220
266 Ga0081455_10185143 3300005937 Bacteria 1573
267 Ga0081455_10256787 3300005937 Bacteria 1275
268 Ga0081538_10020678 3300005981 Bacteria 4833
269 Ga0081538_10035977 3300005981 Bacteria 3241
270 Ga0081538_10088860 3300005981 Bacteria 1606
271 Ga0081540_1002344 3300005983 Bacteria 15503
272 Ga0081540_1002625 3300005983 Bacteria 14612
273 Ga0081540_1002868 3300005983 Bacteria 13938
274 Ga0081540_1003998 3300005983 Bacteria 11431
275 Ga0081540_1004409 3300005983 Bacteria 10741
276 Ga0081540_1009104 3300005983 Bacteria 6859
277 Ga0081540_1011513 3300005983 Bacteria 5910
278 Ga0081540_1011628 3300005983 Bacteria 5870
279 Ga0081540_1079725 3300005983 Bacteria 1479
280 Ga0081539_10000140 3300005985 Bacteria 166746
281 Ga0081539_10002339 3300005985 Bacteria 27248
282 Ga0081539_10013499 3300005985 Bacteria 6149
283 Ga0081539_10216929 3300005985 Bacteria 873
284 Ga0070717_10006527 3300006028 Bacteria 8585
285 Ga0070717_10006998 3300006028 Bacteria 8347
286 Ga0070717_10186429 3300006028 Bacteria 1811
287 Ga0070717_10339744 3300006028 Bacteria 1341
288 Ga0070717_10650840 3300006028 Bacteria 956
289 Ga0075365_10011414 3300006038 Bacteria 5223
290 Ga0075365_10029922 3300006038 Bacteria 3484
291 Ga0075365_10130201 3300006038 Bacteria 1741
292 Ga0075365_10157299 3300006038 Bacteria 1582
293 Ga0075365_10163822 3300006038 Bacteria 1550
294 Ga0075365_10383542 3300006038 Bacteria 991
295 Ga0075368_10028834 3300006042 Bacteria 2145
296 Ga0075363_100036824 3300006048 Bacteria 2567
297 Ga0075364_10003703 3300006051 Bacteria 8724
298 Ga0075364_10072947 3300006051 Bacteria 2262
299 Ga0075364_10119027 3300006051 Bacteria 1767
300 Ga0075364_10180568 3300006051 Bacteria 1428
301 Ga0070715_10008241 3300006163 Bacteria 3625
302 Ga0070716_100008528 3300006173 Bacteria 5090
303 Ga0070716_100023937 3300006173 Bacteria 3246
304 Ga0070716_100041086 3300006173 Bacteria 2575
305 Ga0070716_100288551 3300006173 Bacteria 1136
306 Ga0070712_100046680 3300006175 Bacteria 2995
307 Ga0070712_100306568 3300006175 Bacteria 1287
308 Ga0075362_10000936 3300006177 Bacteria 8910
309 Ga0075362_10010211 3300006177 Bacteria 3659
310 Ga0075367_10032354 3300006178 Bacteria 3009
311 Ga0075367_10054501 3300006178 Bacteria 2371
312 Ga0075367_10168671 3300006178 Bacteria 1363
313 Ga0075367_10300260 3300006178 Bacteria 1011
314 Ga0075367_10321027 3300006178 Bacteria 976
315 Ga0075369_10027395 3300006186 Bacteria 2382
316 Ga0075369_10042391 3300006186 Bacteria 1951
317 Ga0075369_10103873 3300006186 Bacteria 1277
318 Ga0075369_10124081 3300006186 Bacteria 1170
319 Ga0075366_10018977 3300006195 Bacteria 3975
320 Ga0075366_10083204 3300006195 Bacteria 1913
321 Ga0075366_10084065 3300006195 Bacteria 1903
322 Ga0097621_100005789 3300006237 Bacteria 8727
323 Ga0075370_10040001 3300006353 Bacteria 2643
324 Ga0075370_10053825 3300006353 Bacteria 2284
325 Ga0075370_10166004 3300006353 Bacteria 1297
326 Ga0075370_10234330 3300006353 Bacteria 1086
327 Ga0068871_100000813 3300006358 Bacteria 20955
328 Ga0068871_100130759 3300006358 Bacteria 2128
329 Ga0068871_100219261 3300006358 Bacteria 1647
330 Ga0068871_100272918 3300006358 Bacteria 1478
331 Ga0075428_100703330 3300006844 Bacteria 1076
332 Ga0075428_100833846 3300006844 Bacteria 979
333 Ga0075430_100037645 3300006846 Bacteria 4100
334 Ga0075431_100000053 3300006847 Bacteria 62977
335 Ga0075431_100077710 3300006847 Bacteria 3426
336 Ga0075433_10931035 3300006852 Bacteria 758
337 Ga0075434_100008412 3300006871 Bacteria 9595
338 Ga0075434_100443215 3300006871 Bacteria 1320
339 Ga0075434_100487130 3300006871 Bacteria 1254
340 Ga0075429_100004405 3300006880 Bacteria 12101
341 Ga0068865_100055402 3300006881 Bacteria 2758
342 Ga0068865_100079979 3300006881 Bacteria 2342
343 Ga0068865_100136475 3300006881 Bacteria 1844
344 Ga0068865_100220517 3300006881 Bacteria 1482
345 Ga0097620_100003527 3300006931 Bacteria 15930
346 Ga0097620_100006173 3300006931 Bacteria 12177
347 Ga0097620_100072924 3300006931 Bacteria 3471
348 Ga0097620_100144929 3300006931 Bacteria 2449
349 Ga0097620_100306733 3300006931 Bacteria 1681
350 Ga0097620_100351852 3300006931 Bacteria 1568
351 Ga0097620_100369142 3300006931 Bacteria 1530
352 Ga0099824_1027583 3300006942 Bacteria 2718
353 Ga0099822_1018498 3300006943 Bacteria 7243
354 Ga0099823_1041378 3300006944 Bacteria 3281
355 Ga0075435_100106719 3300007076 Bacteria 2326
356 Ga0075435_100175049 3300007076 Bacteria 1812
357 Ga0075435_100592884 3300007076 Bacteria 961
358 Ga0099795_10001696 3300007788 Bacteria 4893
359 Ga0099795_10024080 3300007788 Bacteria 2026
360 Ga0105244_10168463 3300009036 Bacteria 1043
361 Ga0105250_10178674 3300009092 Bacteria 890
362 Ga0105240_10024133 3300009093 Bacteria 8026
363 Ga0105240_10024314 3300009093 Bacteria 7990
364 Ga0105240_10036283 3300009093 Bacteria 6343
365 Ga0105240_10056335 3300009093 Bacteria 4919
366 Ga0105240_10259071 3300009093 Bacteria 2007
367 Ga0105240_10477877 3300009093 Bacteria 1390
368 Ga0105240_10719906 3300009093 Bacteria 1088
369 Ga0111539_10001519 3300009094 Bacteria 30945
370 Ga0111539_10482233 3300009094 Bacteria 1444
371 Ga0105245_10127220 3300009098 Bacteria 2386
372 Ga0105245_10206696 3300009098 Bacteria 1888
373 Ga0105245_10268159 3300009098 Bacteria 1664
374 Ga0105245_10449482 3300009098 Bacteria 1297
375 Ga0105247_10047475 3300009101 Bacteria 2636
376 Ga0105247_10068755 3300009101 Bacteria 2209
377 Ga0105247_10085701 3300009101 Bacteria 1992
378 Ga0105247_10270735 3300009101 Bacteria 1168
379 Ga0105247_10349675 3300009101 Bacteria 1039
380 Ga0105247_10448956 3300009101 Bacteria 929
381 Ga0114129_10000237 3300009147 Bacteria 61463
382 Ga0114129_10115255 3300009147 Bacteria 3704
383 Ga0114129_10649821 3300009147 Bacteria 1361
384 Ga0105243_10215572 3300009148 Bacteria 1693
385 Ga0105243_10288253 3300009148 Bacteria 1482
386 Ga0105243_10574995 3300009148 Bacteria 1081
387 Ga0105243_10759037 3300009148 Bacteria 952
388 Ga0105241_10005393 3300009174 Bacteria 9454
389 Ga0105242_10415613 3300009176 Bacteria 1259
390 Ga0105242_10910606 3300009176 Bacteria 880
391 Ga0105248_10031493 3300009177 Bacteria 5928
392 Ga0105248_10040960 3300009177 Bacteria 5194
393 Ga0105248_10138684 3300009177 Bacteria 2743
394 Ga0105248_10161950 3300009177 Bacteria 2523
395 Ga0105248_10530924 3300009177 Bacteria 1327
396 Ga0105248_10724907 3300009177 Bacteria 1122
397 Ga0105248_10966468 3300009177 Bacteria 962
398 Ga0105237_10032997 3300009545 Bacteria 5244
399 Ga0105237_10039060 3300009545 Bacteria 4792
400 Ga0105237_10049678 3300009545 Bacteria 4215
401 Ga0105237_10060279 3300009545 Bacteria 3797
402 Ga0105237_10131130 3300009545 Bacteria 2501
403 Ga0105237_10326674 3300009545 Bacteria 1538
404 Ga0105237_10544309 3300009545 Bacteria 1167
405 Ga0105237_11291647 3300009545 Bacteria 736
406 Ga0105238_10024393 3300009551 Bacteria 6165
407 Ga0105238_10029388 3300009551 Bacteria 5600
408 Ga0105238_10033691 3300009551 Bacteria 5211
409 Ga0105238_10042528 3300009551 Bacteria 4600
410 Ga0105238_11320721 3300009551 Bacteria 747
411 Ga0105249_10104490 3300009553 Bacteria 2669
412 Ga0105249_10177895 3300009553 Bacteria 2068
413 Ga0105249_10572356 3300009553 Bacteria 1182
414 Ga0099796_10098601 3300010159 Bacteria 1096
415 Ga0099796_10165123 3300010159 Bacteria 880
416 Ga0105239_10022985 3300010375 Bacteria 6874
417 Ga0105239_10058272 3300010375 Bacteria 4238
418 Ga0105239_10113597 3300010375 Bacteria 3003
419 Ga0105239_10147331 3300010375 Bacteria 2626
420 Ga0105239_10367642 3300010375 Bacteria 1625
421 Ga0105239_10454692 3300010375 Bacteria 1453
422 Ga0105239_10768292 3300010375 Bacteria 1103
423 Ga0105239_11390993 3300010375 Bacteria 810
424 Ga0105246_10045034 3300011119 Bacteria 3002
425 Ga0105246_10501460 3300011119 Bacteria 1031
426 Ga0105246_10734930 3300011119 Bacteria 869
427 Ga0157373_10028400 3300013100 Bacteria 4035
428 Ga0157370_10024117 3300013104 Bacteria 6030
429 Ga0157370_10035604 3300013104 Bacteria 4836
430 Ga0157370_10163274 3300013104 Bacteria 2072
431 Ga0157369_10066878 3300013105 Bacteria 3866
432 Ga0157369_10121671 3300013105 Bacteria 2769
433 Ga0157369_10133599 3300013105 Bacteria 2628
434 Ga0157369_10161906 3300013105 Bacteria 2362
435 Ga0157374_10015540 3300013296 Bacteria 6677
436 Ga0157374_10055850 3300013296 Bacteria 3686
437 Ga0157374_10477331 3300013296 Bacteria 1250
438 Ga0157374_11113050 3300013296 Bacteria 810
439 Ga0157378_10040048 3300013297 Bacteria 4156
440 Ga0157378_10222369 3300013297 Bacteria 1795
441 Ga0157378_10223517 3300013297 Bacteria 1791
442 Ga0163162_10010727 3300013306 Bacteria 8913
443 Ga0163162_10099437 3300013306 Bacteria 3000
444 Ga0163162_10207523 3300013306 Bacteria 2088
445 Ga0163162_10321889 3300013306 Bacteria 1679
446 Ga0163162_10464215 3300013306 Bacteria 1398
447 Ga0163162_10828920 3300013306 Bacteria 1041
448 Ga0157372_10021376 3300013307 Bacteria 6991
449 Ga0157372_10051549 3300013307 Bacteria 4580
450 Ga0157372_10140535 3300013307 Bacteria 2781
451 Ga0157375_10013707 3300013308 Bacteria 7227
452 Ga0157375_10087749 3300013308 Bacteria 3164
453 Ga0157375_10225401 3300013308 Bacteria 2033
454 Ga0157375_10298186 3300013308 Bacteria 1775
455 Ga0157375_10367945 3300013308 Bacteria 1604
456 Ga0157375_10373696 3300013308 Bacteria 1592
457 Ga0163163_10044076 3300014325 Bacteria 4375
458 Ga0163163_10056151 3300014325 Bacteria 3892
459 Ga0163163_10202275 3300014325 Bacteria 2035
460 Ga0163163_10453639 3300014325 Bacteria 1342
461 Ga0163163_10629086 3300014325 Bacteria 1137
462 Ga0163163_10672981 3300014325 Bacteria 1098
463 Ga0157380_10035710 3300014326 Bacteria 3840
464 Ga0157380_10136705 3300014326 Bacteria 2099
465 Ga0157380_10143174 3300014326 Bacteria 2057
466 Ga0157380_11240002 3300014326 Bacteria 791
467 Ga0182008_10036255 3300014497 Bacteria 2468
468 Ga0157377_10060620 3300014745 Bacteria 2160
469 Ga0157377_10118916 3300014745 Bacteria 1599
470 Ga0157379_10002865 3300014968 Bacteria 14544
471 Ga0157379_10186976 3300014968 Bacteria 1872
472 Ga0157376_10122766 3300014969 Bacteria 2305
473 Ga0157376_10129606 3300014969 Bacteria 2249
474 Ga0157376_11176721 3300014969 Bacteria 794
475 Ga0163161_10025727 3300017792 Bacteria 4167
476 Ga0163161_10026722 3300017792 Bacteria 4090
477 Ga0163161_10125701 3300017792 Bacteria 1931
478 Ga0214544_1000002 3300021320 Bacteria 753857
479 Ga0214544_1034706 3300021320 Bacteria 1398
480 Ga0214542_1000001 3300021321 Bacteria 1018696
481 Ga0214542_1029424 3300021321 Bacteria 2249
482 Ga0214545_1000001 3300021324 Bacteria 1092817
483 Ga0214545_1021309 3300021324 Bacteria 4892
484 Ga0214543_1000001 3300021327 Bacteria 776921
485 Ga0214543_1038078 3300021327 Bacteria 1397
486 Ga0213874_10022314 3300021377 Bacteria 1755
487 Ga0213876_10073813 3300021384 Bacteria 1802
488 Ga0213876_10252523 3300021384 Bacteria 937
489 Ga0213871_10067354 3300021441 Bacteria 1006
490 Ga0209563_101475 3300025230 Bacteria 6206
491 Ga0209677_100463 3300025253 Bacteria 23384
492 Ga0209148_1000428 3300025254 Bacteria 46613
493 Ga0209233_1010958 3300025261 Bacteria 2689
494 Ga0209233_1031691 3300025261 Bacteria 1231
495 Ga0209455_1004564 3300025272 Bacteria 4493
496 Ga0209455_1006717 3300025272 Bacteria 3360
497 Ga0209564_1001578 3300025295 Bacteria 22285
498 Ga0209564_1023388 3300025295 Bacteria 2149
499 Ga0209564_1052192 3300025295 Bacteria 985
500 Ga0209758_1000140 3300025297 Bacteria 174267
501 Ga0209758_1000321 3300025297 Bacteria 92591
502 Ga0209758_1001092 3300025297 Bacteria 35145
503 Ga0209758_1002051 3300025297 Bacteria 21595
504 Ga0209758_1002659 3300025297 Bacteria 17684
505 Ga0209758_1003492 3300025297 Bacteria 14221
506 Ga0209758_1003969 3300025297 Bacteria 12828
507 Ga0209758_1094196 3300025297 Bacteria 869
508 Ga0209256_1009946 3300025299 Bacteria 4075
509 Ga0209256_1022829 3300025299 Bacteria 1883
510 Ga0207426_1000278 3300025302 Bacteria 105775
511 Ga0207426_1000378 3300025302 Bacteria 76958
512 Ga0207426_1056124 3300025302 Bacteria 1151
513 Ga0209257_1000522 3300025304 Bacteria 66723
514 Ga0209257_1021097 3300025304 Bacteria 2379
515 Ga0207697_10206400 3300025315 Bacteria 865
516 Ga0207656_10010200 3300025321 Bacteria 3510
517 Ga0207656_10058367 3300025321 Bacteria 1685
518 Ga0207656_10295025 3300025321 Bacteria 802
519 Ga0207682_10038991 3300025893 Bacteria 1930
520 Ga0207692_10003515 3300025898 Bacteria 6131
521 Ga0207692_10008195 3300025898 Bacteria 4318
522 Ga0207692_10118299 3300025898 Bacteria 1480
523 Ga0207692_10213076 3300025898 Bacteria 1142
524 Ga0207642_10251749 3300025899 Bacteria 1003
525 Ga0207710_10058668 3300025900 Bacteria 1741
526 Ga0207710_10076259 3300025900 Bacteria 1547
527 Ga0207710_10175442 3300025900 Bacteria 1049
528 Ga0207710_10209946 3300025900 Bacteria 964
529 Ga0207688_10046398 3300025901 Bacteria 2426
530 Ga0207688_10133821 3300025901 Bacteria 1455
531 Ga0207688_10292657 3300025901 Bacteria 994
532 Ga0207680_10246835 3300025903 Bacteria 1232
533 Ga0207647_10002921 3300025904 Bacteria 12870
534 Ga0207647_10006624 3300025904 Bacteria 8415
535 Ga0207647_10259957 3300025904 Bacteria 994
536 Ga0207685_10000377 3300025905 Bacteria 7344
537 Ga0207685_10008143 3300025905 Bacteria 2966
538 Ga0207699_10003114 3300025906 Bacteria 7880
539 Ga0207699_10012803 3300025906 Bacteria 4273
540 Ga0207699_10038453 3300025906 Bacteria 2742
541 Ga0207699_10111562 3300025906 Bacteria 1753
542 Ga0207699_10301358 3300025906 Bacteria 1119
543 Ga0207699_10422641 3300025906 Bacteria 952
544 Ga0207645_10000286 3300025907 Bacteria 42134
545 Ga0207645_10065338 3300025907 Bacteria 2325
546 Ga0207645_10140801 3300025907 Bacteria 1572
547 Ga0207645_10234887 3300025907 Bacteria 1211
548 Ga0207645_10415922 3300025907 Bacteria 905
549 Ga0207643_10054603 3300025908 Bacteria 2271
550 Ga0207705_10056618 3300025909 Bacteria 2827
551 Ga0207705_10195348 3300025909 Bacteria 1532
552 Ga0207705_10212413 3300025909 Bacteria 1468
553 Ga0207654_10001513 3300025911 Bacteria 12241
554 Ga0207654_10037938 3300025911 Bacteria 2700
555 Ga0207707_10031128 3300025912 Bacteria 4668
556 Ga0207707_10165809 3300025912 Bacteria 1930
557 Ga0207695_10000008 3300025913 Bacteria 1058268
558 Ga0207695_10008039 3300025913 Bacteria 13279
559 Ga0207695_10032881 3300025913 Bacteria 5670
560 Ga0207695_10103578 3300025913 Bacteria 2837
561 Ga0207695_10238633 3300025913 Bacteria 1720
562 Ga0207695_10494828 3300025913 Bacteria 1105
563 Ga0207671_10059849 3300025914 Bacteria 2825
564 Ga0207671_10143691 3300025914 Bacteria 1840
565 Ga0207671_10192469 3300025914 Bacteria 1591
566 Ga0207671_10286962 3300025914 Bacteria 1299
567 Ga0207693_10001875 3300025915 Bacteria 18415
568 Ga0207693_10062244 3300025915 Bacteria 2924
569 Ga0207663_10000347 3300025916 Bacteria 20128
570 Ga0207663_10006159 3300025916 Bacteria 6109
571 Ga0207663_10040094 3300025916 Bacteria 2844
572 Ga0207663_10552055 3300025916 Bacteria 901
573 Ga0207660_10047484 3300025917 Bacteria 3035
574 Ga0207660_10145935 3300025917 Bacteria 1813
575 Ga0207660_10251113 3300025917 Bacteria 1396
576 Ga0207662_10247037 3300025918 Bacteria 1170
577 Ga0207657_10005077 3300025919 Bacteria 13808
578 Ga0207657_10106780 3300025919 Bacteria 2316
579 Ga0207649_10028404 3300025920 Bacteria 3293
580 Ga0207652_10062632 3300025921 Bacteria 3214
581 Ga0207646_10158788 3300025922 Bacteria 2040
582 Ga0207681_10139509 3300025923 Bacteria 1804
583 Ga0207681_10233693 3300025923 Bacteria 1428
584 Ga0207681_10629705 3300025923 Bacteria 888
585 Ga0207694_10000050 3300025924 Bacteria 159920
586 Ga0207694_10051007 3300025924 Bacteria 3207
587 Ga0207694_10265609 3300025924 Bacteria 1407
588 Ga0207694_10609281 3300025924 Bacteria 919
589 Ga0207694_10688494 3300025924 Bacteria 862
590 Ga0207650_10003178 3300025925 Bacteria 11313
591 Ga0207650_10012180 3300025925 Bacteria 5930
592 Ga0207650_10156021 3300025925 Bacteria 1805
593 Ga0207659_10267604 3300025926 Bacteria 1393
594 Ga0207659_10290995 3300025926 Bacteria 1338
595 Ga0207659_10480952 3300025926 Bacteria 1049
596 Ga0207659_10842822 3300025926 Bacteria 788
597 Ga0207687_10014409 3300025927 Bacteria 5173
598 Ga0207700_10050010 3300025928 Bacteria 3112
599 Ga0207700_10085205 3300025928 Bacteria 2480
600 Ga0207700_10108427 3300025928 Bacteria 2230
601 Ga0207700_10197910 3300025928 Bacteria 1692
602 Ga0207700_10258410 3300025928 Bacteria 1490
603 Ga0207700_10382050 3300025928 Bacteria 1232
604 Ga0207700_10616896 3300025928 Bacteria 966
605 Ga0207664_10038049 3300025929 Bacteria 3728
606 Ga0207664_10042856 3300025929 Bacteria 3536
607 Ga0207664_10055666 3300025929 Bacteria 3139
608 Ga0207664_10381822 3300025929 Bacteria 1251
609 Ga0207664_10454659 3300025929 Bacteria 1143
610 Ga0207664_10456802 3300025929 Bacteria 1140
611 Ga0207644_10329061 3300025931 Bacteria 1237
612 Ga0207644_10357530 3300025931 Bacteria 1187
613 Ga0207644_10565787 3300025931 Bacteria 942
614 Ga0207690_10017715 3300025932 Bacteria 4355
615 Ga0207706_10153092 3300025933 Bacteria 2028
616 Ga0207706_10184354 3300025933 Bacteria 1833
617 Ga0207706_10199144 3300025933 Bacteria 1757
618 Ga0207686_10117767 3300025934 Bacteria 1803
619 Ga0207686_10209320 3300025934 Bacteria 1401
620 Ga0207686_10581283 3300025934 Bacteria 879
621 Ga0207709_10046579 3300025935 Bacteria 2632
622 Ga0207709_10068250 3300025935 Bacteria 2247
623 Ga0207709_10119999 3300025935 Bacteria 1774
624 Ga0207709_10302752 3300025935 Bacteria 1189
625 Ga0207669_10041586 3300025937 Bacteria 2676
626 Ga0207669_10045750 3300025937 Bacteria 2581
627 Ga0207704_10048167 3300025938 Bacteria 2553
628 Ga0207704_10071978 3300025938 Bacteria 2196
629 Ga0207704_10221602 3300025938 Bacteria 1400
630 Ga0207665_10004695 3300025939 Bacteria 9077
631 Ga0207665_10045722 3300025939 Bacteria 2932
632 Ga0207665_10046684 3300025939 Bacteria 2902
633 Ga0207665_10050708 3300025939 Bacteria 2791
634 Ga0207665_10251103 3300025939 Bacteria 1307
635 Ga0207691_10002154 3300025940 Bacteria 19269
636 Ga0207691_10029841 3300025940 Bacteria 5100
637 Ga0207691_10058642 3300025940 Bacteria 3501
638 Ga0207691_10084522 3300025940 Bacteria 2849
639 Ga0207711_10010545 3300025941 Bacteria 7679
640 Ga0207711_10140089 3300025941 Bacteria 2175
641 Ga0207689_10002835 3300025942 Bacteria 15995
642 Ga0207689_10020120 3300025942 Bacteria 5621
643 Ga0207689_10113433 3300025942 Bacteria 2228
644 Ga0207689_10211358 3300025942 Bacteria 1603
645 Ga0207661_10006587 3300025944 Bacteria 8212
646 Ga0207661_10028199 3300025944 Bacteria 4297
647 Ga0207679_10546139 3300025945 Bacteria 1039
648 Ga0207667_10010367 3300025949 Bacteria 10892
649 Ga0207667_10027376 3300025949 Bacteria 6206
650 Ga0207667_10218483 3300025949 Bacteria 1953
651 Ga0207667_10218581 3300025949 Bacteria 1952
652 Ga0207667_10326769 3300025949 Bacteria 1566
653 Ga0207667_10471107 3300025949 Bacteria 1275
654 Ga0207667_10505540 3300025949 Bacteria 1225
655 Ga0207651_10199118 3300025960 Bacteria 1604
656 Ga0207651_10207367 3300025960 Bacteria 1575
657 Ga0207651_10623584 3300025960 Bacteria 945
658 Ga0207712_10019146 3300025961 Bacteria 4466
659 Ga0207712_10083820 3300025961 Bacteria 2327
660 Ga0207712_10087629 3300025961 Bacteria 2284
661 Ga0207712_10122121 3300025961 Bacteria 1972
662 Ga0207712_10395822 3300025961 Bacteria 1160
663 Ga0207668_10014231 3300025972 Bacteria 4921
664 Ga0207668_10019014 3300025972 Bacteria 4333
665 Ga0207668_10039902 3300025972 Bacteria 3164
666 Ga0207668_10067796 3300025972 Bacteria 2534
667 Ga0207668_10122389 3300025972 Bacteria 1972
668 Ga0207668_10137263 3300025972 Bacteria 1875
669 Ga0207668_10249951 3300025972 Bacteria 1439
670 Ga0207640_10014363 3300025981 Bacteria 4557
671 Ga0207640_10037061 3300025981 Bacteria 3066
672 Ga0207640_10154867 3300025981 Bacteria 1688
673 Ga0207640_10218286 3300025981 Bacteria 1458
674 Ga0207640_10384554 3300025981 Bacteria 1138
675 Ga0207640_10534182 3300025981 Bacteria 982
676 Ga0207640_10713744 3300025981 Bacteria 861
677 Ga0207640_10766068 3300025981 Bacteria 833
678 Ga0207640_10838526 3300025981 Bacteria 799
679 Ga0207640_10840084 3300025981 Bacteria 798
680 Ga0207658_10268735 3300025986 Bacteria 1456
681 Ga0207658_10305149 3300025986 Bacteria 1373
682 Ga0207658_10414578 3300025986 Bacteria 1186
683 Ga0207658_10534524 3300025986 Bacteria 1048
684 Ga0207677_10031302 3300026023 Bacteria 3407
685 Ga0207677_10116413 3300026023 Bacteria 2001
686 Ga0207677_10198274 3300026023 Bacteria 1593
687 Ga0207677_10403231 3300026023 Bacteria 1160
688 Ga0207703_10002330 3300026035 Bacteria 16564
689 Ga0207703_10004196 3300026035 Bacteria 11883
690 Ga0207703_10156350 3300026035 Bacteria 1993
691 Ga0207703_10268096 3300026035 Bacteria 1546
692 Ga0207703_10457078 3300026035 Bacteria 1194
693 Ga0207703_10847928 3300026035 Bacteria 874
694 Ga0207639_10061853 3300026041 Bacteria 2893
695 Ga0207639_10132912 3300026041 Bacteria 2062
696 Ga0207639_10146951 3300026041 Bacteria 1970
697 Ga0207639_10327623 3300026041 Bacteria 1362
698 Ga0207639_10355708 3300026041 Bacteria 1309
699 Ga0207639_10396720 3300026041 Bacteria 1242
700 Ga0207639_10817342 3300026041 Bacteria 869
701 Ga0207678_10021023 3300026067 Bacteria 5720
702 Ga0207678_10023027 3300026067 Bacteria 5451
703 Ga0207678_10035512 3300026067 Bacteria 4340
704 Ga0207678_10039077 3300026067 Bacteria 4119
705 Ga0207678_10041697 3300026067 Bacteria 3979
706 Ga0207678_10071839 3300026067 Bacteria 2967
707 Ga0207678_10105366 3300026067 Bacteria 2406
708 Ga0207678_10110819 3300026067 Bacteria 2341
709 Ga0207678_10118932 3300026067 Bacteria 2255
710 Ga0207678_10210459 3300026067 Bacteria 1663
711 Ga0207678_10211814 3300026067 Bacteria 1658
712 Ga0207708_10093201 3300026075 Bacteria 2325
713 Ga0207708_10657469 3300026075 Bacteria 893
714 Ga0207702_10000002 3300026078 Bacteria 491507
715 Ga0207702_10000748 3300026078 Bacteria 34672
716 Ga0207702_10031381 3300026078 Bacteria 4428
717 Ga0207702_10049144 3300026078 Bacteria 3559
718 Ga0207702_10394613 3300026078 Bacteria 1333
719 Ga0207702_10570530 3300026078 Bacteria 1108
720 Ga0207641_10003597 3300026088 Bacteria 13687
721 Ga0207641_10007624 3300026088 Bacteria 8999
722 Ga0207641_10138175 3300026088 Bacteria 2195
723 Ga0207641_10235148 3300026088 Bacteria 1705
724 Ga0207641_10507466 3300026088 Bacteria 1172
725 Ga0207648_10023816 3300026089 Bacteria 5477
726 Ga0207648_10059062 3300026089 Bacteria 3345
727 Ga0207648_10116985 3300026089 Bacteria 2343
728 Ga0207674_10000489 3300026116 Bacteria 52346
729 Ga0207674_10003205 3300026116 Bacteria 20153
730 Ga0207674_10003611 3300026116 Bacteria 18863
731 Ga0207674_10014760 3300026116 Bacteria 8617
732 Ga0207674_10023871 3300026116 Bacteria 6541
733 Ga0207674_10729084 3300026116 Bacteria 957
734 Ga0207675_100003215 3300026118 Bacteria 16023
735 Ga0207675_100075023 3300026118 Bacteria 3165
736 Ga0207675_100133243 3300026118 Bacteria 2357
737 Ga0207675_100234843 3300026118 Bacteria 1770
738 Ga0207675_100244660 3300026118 Bacteria 1734
739 Ga0207675_100347420 3300026118 Bacteria 1453
740 Ga0207675_100789871 3300026118 Bacteria 962
741 Ga0207683_10002147 3300026121 Bacteria 17329
742 Ga0207683_10007176 3300026121 Bacteria 9551
743 Ga0207683_10014348 3300026121 Bacteria 6751
744 Ga0207683_10018400 3300026121 Bacteria 5961
745 Ga0207683_10195356 3300026121 Bacteria 1838
746 Ga0207683_10321172 3300026121 Bacteria 1418
747 Ga0207683_10367452 3300026121 Bacteria 1321
748 Ga0207698_10022804 3300026142 Bacteria 4361
749 Ga0207698_10047597 3300026142 Bacteria 3250
750 Ga0207698_10104339 3300026142 Bacteria 2358
751 Ga0207698_10138517 3300026142 Bacteria 2092
752 Ga0207698_10220585 3300026142 Bacteria 1713
753 Ga0209389_1000040 3300027296 Bacteria 124256
754 Ga0209389_1000995 3300027296 Bacteria 18828
755 Ga0209589_1000001 3300027357 Bacteria 794224
756 Ga0209589_1000211 3300027357 Bacteria 69316
757 Ga0209489_100001 3300027361 Bacteria 794224
758 Ga0209489_100006 3300027361 Bacteria 475698
759 Ga0209489_110930 3300027361 Bacteria 9725
760 Ga0209700_100001 3300027363 Bacteria 794224
761 Ga0209700_100005 3300027363 Bacteria 573969
762 Ga0209813_10008974 3300027866 Bacteria 2543
763 Ga0207428_10036206 3300027907 Bacteria 4028
764 Ga0207428_10039542 3300027907 Bacteria 3830
765 Ga0207428_10104190 3300027907 Bacteria 2190
766 Ga0268266_10002320 3300028379 Bacteria 20625
767 Ga0268266_10009271 3300028379 Bacteria 8682
768 Ga0268266_10024042 3300028379 Bacteria 5185
769 Ga0268266_10028180 3300028379 Bacteria 4775
770 Ga0268266_10050458 3300028379 Bacteria 3570
771 Ga0268266_10065849 3300028379 Bacteria 3132
772 Ga0268266_10065947 3300028379 Bacteria 3130
773 Ga0268266_10172149 3300028379 Bacteria 1966
774 Ga0268266_10343609 3300028379 Bacteria 1401
775 Ga0268266_10564449 3300028379 Bacteria 1091
776 Ga0268266_10830937 3300028379 Bacteria 893
777 Ga0268265_10036410 3300028380 Bacteria 3604
778 Ga0268265_10209777 3300028380 Bacteria 1696
779 Ga0268265_10472323 3300028380 Bacteria 1176
780 Ga0268265_10746325 3300028380 Bacteria 949
781 Ga0268264_10002930 3300028381 Bacteria 14828
782 Ga0268264_10005853 3300028381 Bacteria 10411
783 Ga0268264_10017488 3300028381 Bacteria 5871
784 Ga0268264_10158642 3300028381 Bacteria 2035
785 Ga0268264_10249367 3300028381 Bacteria 1648
786 Ga0265337_1006749 3300028556 Bacteria 4374
787 Ga0265334_10006955 3300028573 Bacteria 4858
788 Ga0265323_10004409 3300028653 Bacteria 6068
789 Ga0265322_10060032 3300028654 Bacteria 1079
790 Ga0265336_10000763 3300028666 Bacteria 17052
791 Ga0307517_10000249 3300028786 Bacteria 91911
792 Ga0307517_10119002 3300028786 Bacteria 1963
793 Ga0307515_10314902 3300028794 Bacteria 1236
794 Ga0265338_10000665 3300028800 Bacteria 59449
795 Ga0307511_10110325 3300030521 Bacteria 1754
796 Ga0265330_10124828 3300031235 Bacteria 1096
797 Ga0265332_10001409 3300031238 Bacteria 13560
798 Ga0265332_10168113 3300031238 Bacteria 915
799 Ga0265325_10012262 3300031241 Bacteria 4905
800 Ga0265325_10030711 3300031241 Bacteria 2880
801 Ga0265325_10165341 3300031241 Bacteria 1038
802 Ga0265329_10071967 3300031242 Bacteria 1094
803 Ga0265340_10005726 3300031247 Bacteria 6865
804 Ga0265340_10008625 3300031247 Bacteria 5494
805 Ga0265339_10003832 3300031249 Bacteria 10446
806 Ga0265339_10052640 3300031249 Bacteria 2217
807 Ga0265331_10062535 3300031250 Bacteria 1755
808 Ga0265316_10061807 3300031344 Bacteria 2908
809 Ga0265316_10087120 3300031344 Bacteria 2386
810 Ga0307509_10125888 3300031507 Bacteria 2528
811 Ga0307408_100318538 3300031548 Bacteria 1309
812 Ga0307408_100779255 3300031548 Bacteria 866
813 Ga0307508_10000018 3300031616 Bacteria 202701
814 Ga0307508_10043906 3300031616 Bacteria 4002
815 Ga0307508_10311566 3300031616 Bacteria 1166
816 Ga0316575_10025725 3300031665 Bacteria 2284
817 Ga0316579_10037283 3300031691 Bacteria 2246
818 Ga0265314_10002567 3300031711 Bacteria 18413
819 Ga0265314_10160306 3300031711 Bacteria 1370
820 Ga0265314_10181164 3300031711 Bacteria 1262
821 Ga0265342_10002171 3300031712 Bacteria 17254
822 Ga0265342_10174163 3300031712 Bacteria 1182
823 Ga0265342_10211170 3300031712 Bacteria 1049
824 Ga0316576_10033029 3300031727 Bacteria 3681
825 Ga0316578_10016515 3300031728 Bacteria 3997
826 Ga0307516_10011331 3300031730 Bacteria 9703
827 Ga0307516_10038640 3300031730 Bacteria 4761
828 Ga0307516_10200912 3300031730 Bacteria 1713
829 Ga0307516_10224017 3300031730 Bacteria 1588
830 Ga0307405_10631678 3300031731 Bacteria 878
831 Ga0307413_10031350 3300031824 Bacteria 2999
832 Ga0307413_10800187 3300031824 Bacteria 792
833 Ga0307410_10682828 3300031852 Bacteria 864
834 Ga0307406_10255867 3300031901 Bacteria 1322
835 Ga0307412_10429143 3300031911 Bacteria 1083
836 Ga0307412_10595978 3300031911 Bacteria 935
837 Ga0307416_100409035 3300032002 Bacteria 1397
838 Ga0307415_100042679 3300032126 Bacteria 3020
839 Ga0307507_10008461 3300033179 Bacteria 14216
840 Ga0307510_10005775 3300033180 Bacteria 14749
841 Ga0315911_1000006 3300033442 Bacteria 414563
842 Ga0373950_0036482 3300034818 Bacteria 927
843 Ga0373926_0034351 3300035083 Bacteria 1794
844 Ga0373926_0069346 3300035083 Bacteria 1294
845 Ga0373926_0089882 3300035083 Bacteria 1141
846 Ga0373928_0021938 3300035084 Bacteria 1351
847 Ga0373934_0024742 3300035086 Bacteria 2322
848 Ga0373944_0027109 3300035089 Bacteria 1697
849 Ga0373949_0069780 3300035090 Bacteria 919
850 Ga0373932_0012711 3300035112 Bacteria 2079
851 Ga0373936_0009212 3300035113 Bacteria 3720
852 Ga0373936_0018528 3300035113 Bacteria 2690
853 Ga0373936_0124171 3300035113 Bacteria 1105
854 Ga0373953_0002178 3300035117 Bacteria 5860
855 Ga0373953_0007285 3300035117 Bacteria 3699
856 Ga0373953_0027450 3300035117 Bacteria 2188
857 Ga0373953_0036308 3300035117 Bacteria 1940
858 Ga0373954_0003365 3300035118 Bacteria 6768
859 Ga0373954_0008989 3300035118 Bacteria 4396
860 Ga0373954_0016863 3300035118 Bacteria 3276
861 Ga0373956_0015008 3300035119 Bacteria 3239
862 Ga0373956_0035180 3300035119 Bacteria 2208
863 Ga0373956_0046623 3300035119 Bacteria 1937
864 Ga0373956_0054647 3300035119 Bacteria 1799
865 Ga0373957_0003026 3300035120 Bacteria 4886
866 Ga0373957_0045277 3300035120 Bacteria 1667
867 Ga0373943_0005981 3300035170 Bacteria 5462
868 Ga0373943_0006361 3300035170 Bacteria 5307
869 Ga0373943_0033391 3300035170 Bacteria 2451
870 Ga0373946_0010792 3300035171 Bacteria 3392
871 Ga0373946_0146071 3300035171 Bacteria 1100
872 Ga0373955_0002466 3300035172 Bacteria 8083
873 Ga0373955_0007820 3300035172 Bacteria 4932
874 Ga0373955_0237654 3300035172 Bacteria 1091
875 Ga0373955_0341937 3300035172 Bacteria 905
876 Ga0373924_0002359 3300035410 Bacteria 6348
877 Ga0373924_0012183 3300035410 Bacteria 3210
878 Ga0373931_0007658 3300035691 Bacteria 5093
879 Ga0373931_0098484 3300035691 Bacteria 1641
880 Ga0373931_0148530 3300035691 Bacteria 1364
881 Ga0373931_0171129 3300035691 Bacteria 1280
882 Ga0373935_0001180 3300035692 Bacteria 14352
883 Ga0373935_0033363 3300035692 Bacteria 3202
884 Ga0373935_0049212 3300035692 Bacteria 2671
885 Ga0373935_0130757 3300035692 Bacteria 1686
886 Ga0373935_0382553 3300035692 Bacteria 1008
887 Ga0373935_0658773 3300035692 Bacteria 768
888 Ga0373927_0012626 3300035695 Bacteria 5619
889 Ga0373927_0033690 3300035695 Bacteria 3334
890 Ga0373927_0069279 3300035695 Bacteria 2283
891 Ga0373927_0084027 3300035695 Bacteria 2064
892 Ga0373927_0177471 3300035695 Bacteria 1397
893 Ga0373927_0187584 3300035695 Bacteria 1356
894 Ga0373933_0000787 3300035724 Bacteria 19357
895 Ga0373933_0005811 3300035724 Bacteria 6711
896 Ga0373933_0036459 3300035724 Bacteria 2878
897 Ga0373933_0045514 3300035724 Bacteria 2602
898 Ga0373947_0012125 3300035725 Bacteria 4935
899 Ga0373947_0022984 3300035725 Bacteria 3623
900 Ga0373947_0089676 3300035725 Bacteria 1915
901 Ga0373937_0001814 3300036401 Bacteria 17923
902 Ga0373937_0007938 3300036401 Bacteria 9201
903 Ga0373937_0140323 3300036401 Bacteria 2260
904 Ga0373937_0170675 3300036401 Bacteria 2041
905 Ga0373937_0472782 3300036401 Bacteria 1190
906 Ga0373937_0797525 3300036401 Bacteria 892
907 Ga0372808_000933 3300036459 Bacteria 2749
908 Ga0373925_0000353 3300037068 Bacteria 47782
909 Ga0373925_0003087 3300037068 Bacteria 13072
910 Ga0373925_0010490 3300037068 Bacteria 6720
911 Ga0373925_0076221 3300037068 Bacteria 2543
912 Ga0373925_0579725 3300037068 Bacteria 923
913 Ga0395900_0023857 3300037418 Bacteria 6259
914 Ga0395900_0169289 3300037418 Bacteria 2225
915 Ga0395898_0019988 3300037466 Bacteria 6809
916 Ga0395898_0192806 3300037466 Bacteria 1947
917 Ga0395898_0275800 3300037466 Bacteria 1604
918 Ga0395898_0417270 3300037466 Bacteria 1279
919 Ga0395905_0008616 3300037471 Bacteria 10049
920 Ga0395905_0014968 3300037471 Bacteria 7397
921 Ga0395905_0030507 3300037471 Bacteria 5080
922 Ga0436364_0479367 3300037853 Bacteria 1846
923 Ga0395901_0002662 3300038443 Bacteria 18025
924 Ga0395901_0183555 3300038443 Bacteria 2194
925 Ga0395901_0353861 3300038443 Bacteria 1515
926 Ga0436365_0174244 3300039437 Bacteria 1774
927 Ga0436365_0647195 3300039437 Bacteria 1061
928 Ga0436365_1394673 3300039437 Bacteria 3628
929 Ga0436360_0136997 3300039438 Bacteria 1457
930 Ga0436360_0173425 3300039438 Bacteria 5331
931 Ga0436360_0809633 3300039438 Bacteria 1801
932 Ga0436360_0865201 3300039438 Bacteria 1468
933 Ga0436361_0265785 3300039447 Bacteria 1023
934 Ga0436361_0314733 3300039447 Bacteria 864
935 Ga0436361_0632415 3300039447 Bacteria 3816
936 Ga0436363_1258628 3300039450 Bacteria 2108
937 Ga0439461_0020278 3300041410 Bacteria 1315
938 Ga0451793_0046002 3300041452 Bacteria 1678
939 Ga0451807_2283239 3300041486 Bacteria 1089
940 Ga0451843_0321225 3300041509 Bacteria 1232
941 Ga0466972_0125525 3300044658 Bacteria 1209
942 Ga0466965_0086603 3300044683 Bacteria 1589
943 Ga0466966_0000426 3300044684 Bacteria 27052
944 Ga0466961_0000208 3300044693 Bacteria 39439
945 Ga0466961_0462223 3300044693 Bacteria 768
946 Ga0466963_0137055 3300044694 Bacteria 1694
947 Ga0466964_0141621 3300044706 Bacteria 1106
948 Ga0466957_0364882 3300044842 Bacteria 982
949 Ga0466957_0502789 3300044842 Bacteria 840
950 Ga0466957_0621834 3300044842 Bacteria 757
951 Ga0466960_0074350 3300044901 Bacteria 1698
952 Ga0466959_0045855 3300045049 Bacteria 3218
953 Ga0466959_0098879 3300045049 Bacteria 2090
954 Ga0466959_0101222 3300045049 Bacteria 2062
955 Ga0466959_0482341 3300045049 Bacteria 839
956 Ga0451576_1590618 3300045051 Bacteria 678
957 Ga0466967_0075695 3300045976 Bacteria 3026
958 Ga0466967_0139641 3300045976 Bacteria 2256
959 Ga0466967_0177573 3300045976 Bacteria 2006
960 Ga0466967_0235164 3300045976 Bacteria 1746
961 Ga0466967_0514130 3300045976 Bacteria 1176
962 Ga0495617_024593 3300046452 Bacteria 2032
963 Ga0495617_086636 3300046452 Bacteria 1024
964 Ga0495592_0000284 3300046454 Bacteria 43567
965 Ga0495592_0007940 3300046454 Bacteria 7959
966 Ga0495592_0011449 3300046454 Bacteria 6712
967 Ga0495592_0030145 3300046454 Bacteria 4102
968 Ga0495592_0044849 3300046454 Bacteria 3302
969 Ga0495603_0113001 3300046455 Bacteria 1583
970 Ga0495603_0151587 3300046455 Bacteria 1346
971 Ga0495590_0066882 3300046457 Bacteria 1259
972 Ga0495629_0001471 3300046459 Bacteria 18583
973 Ga0495629_0009818 3300046459 Bacteria 6983
974 Ga0495629_0362317 3300046459 Bacteria 988
975 Ga0495629_0418101 3300046459 Bacteria 910
976 Ga0495638_0007580 3300046460 Bacteria 7764
977 Ga0495638_0024650 3300046460 Bacteria 3918
978 Ga0495638_0077447 3300046460 Bacteria 2024
979 Ga0495641_0027053 3300046461 Bacteria 2793
980 Ga0495651_0000528 3300046462 Bacteria 29605
981 Ga0495651_0001055 3300046462 Bacteria 21307
982 Ga0495651_0004953 3300046462 Bacteria 10171
983 Ga0495651_0033861 3300046462 Bacteria 3983
984 Ga0495651_0045105 3300046462 Bacteria 3416
985 Ga0495651_0119535 3300046462 Bacteria 1938
986 Ga0495651_0239621 3300046462 Bacteria 1245
987 Ga0495653_0000330 3300046463 Bacteria 38640
988 Ga0495653_0012854 3300046463 Bacteria 6833
989 Ga0495653_0051880 3300046463 Bacteria 3146
990 Ga0495653_0205184 3300046463 Bacteria 1335
991 Ga0495650_0035581 3300046471 Bacteria 2191
992 Ga0495650_0074621 3300046471 Bacteria 1322
993 Ga0495580_0017647 3300046472 Bacteria 5331
994 Ga0495580_0064783 3300046472 Bacteria 2561
995 Ga0495582_0008676 3300046473 Bacteria 5606
996 Ga0495582_0115587 3300046473 Bacteria 1509
997 Ga0495582_0321055 3300046473 Bacteria 891
998 Ga0495605_0079390 3300046474 Bacteria 1537
999 Ga0495605_0123152 3300046474 Bacteria 1174
1000 Ga0495639_0046055 3300046475 Bacteria 1974
1001 Ga0495639_0197439 3300046475 Bacteria 984
1002 Ga0495639_0207986 3300046475 Bacteria 959
1003 Ga0495639_0261230 3300046475 Bacteria 858
1004 Ga0495662_0003004 3300046476 Bacteria 8512
1005 Ga0495662_0053996 3300046476 Bacteria 1941
1006 Ga0495664_0000098 3300046477 Bacteria 43069
1007 Ga0495664_0014192 3300046477 Bacteria 4513
1008 Ga0495664_0026168 3300046477 Bacteria 3398
1009 Ga0495664_0027596 3300046477 Bacteria 3311
1010 Ga0495664_0326016 3300046477 Bacteria 926
1011 Ga0495584_0108882 3300046491 Bacteria 1401
1012 Ga0495585_0042306 3300046492 Bacteria 2552
1013 Ga0495585_0042422 3300046492 Bacteria 2548
1014 Ga0495594_0049107 3300046499 Bacteria 2319
1015 Ga0495594_0127910 3300046499 Bacteria 1438
1016 Ga0495607_0024171 3300046501 Bacteria 3792
1017 Ga0495583_0063625 3300046506 Bacteria 1639
1018 Ga0495606_0001663 3300046507 Bacteria 28893
1019 Ga0495606_0078359 3300046507 Bacteria 2061
1020 Ga0495606_0108452 3300046507 Bacteria 1678
1021 Ga0495606_0111700 3300046507 Bacteria 1647
1022 Ga0495606_0147278 3300046507 Bacteria 1385
1023 Ga0495608_0000318 3300046511 Bacteria 33912
1024 Ga0495608_0007280 3300046511 Bacteria 7824
1025 Ga0495608_0007748 3300046511 Bacteria 7561
1026 Ga0495608_0113918 3300046511 Bacteria 1737
1027 Ga0495610_0028158 3300046512 Bacteria 2975
1028 Ga0495616_0036121 3300046513 Bacteria 2552
1029 Ga0495616_0065445 3300046513 Bacteria 1771
1030 Ga0495618_0000235 3300046514 Bacteria 40243
1031 Ga0495618_0005313 3300046514 Bacteria 7864
1032 Ga0495618_0128394 3300046514 Bacteria 1623
1033 Ga0495618_0308007 3300046514 Bacteria 983
1034 Ga0495620_0024389 3300046515 Bacteria 2877
1035 Ga0495620_0036962 3300046515 Bacteria 2180
1036 Ga0495628_0001752 3300046516 Bacteria 19728
1037 Ga0495628_0008728 3300046516 Bacteria 8672
1038 Ga0495628_0123321 3300046516 Bacteria 1986
1039 Ga0495628_0156019 3300046516 Bacteria 1736
1040 Ga0495630_0002403 3300046517 Bacteria 12996
1041 Ga0495630_0007077 3300046517 Bacteria 7992
1042 Ga0495630_0535953 3300046517 Bacteria 898
1043 Ga0495630_0574089 3300046517 Bacteria 865
1044 Ga0495631_0047682 3300046518 Bacteria 1880
1045 Ga0495632_0041732 3300046519 Bacteria 2304
1046 Ga0495632_0047359 3300046519 Bacteria 2132
1047 Ga0495637_0156129 3300046520 Bacteria 858
1048 Ga0495643_0039228 3300046522 Bacteria 2590
1049 Ga0495643_0091448 3300046522 Bacteria 1569
1050 Ga0495643_0155892 3300046522 Bacteria 1127
1051 Ga0495644_0134568 3300046523 Bacteria 942
1052 Ga0495644_0221403 3300046523 Bacteria 732
1053 Ga0495648_0002078 3300046524 Bacteria 18952
1054 Ga0495648_0047321 3300046524 Bacteria 2659
1055 Ga0495648_0057044 3300046524 Bacteria 2345
1056 Ga0495648_0063629 3300046524 Bacteria 2177
1057 Ga0495648_0099715 3300046524 Bacteria 1606
1058 Ga0495666_0062522 3300046526 Bacteria 1778
1059 Ga0495652_0000305 3300046529 Bacteria 58441
1060 Ga0495652_0002427 3300046529 Bacteria 19218
1061 Ga0495652_0007898 3300046529 Bacteria 9769
1062 Ga0495652_0030776 3300046529 Bacteria 4704
1063 Ga0495652_0071606 3300046529 Bacteria 2892
1064 Ga0495652_0092860 3300046529 Bacteria 2465
1065 Ga0495652_0112414 3300046529 Bacteria 2188
1066 Ga0495654_0019069 3300046530 Bacteria 3589
1067 Ga0495665_0083069 3300046531 Bacteria 1684
1068 Ga0495665_0170711 3300046531 Bacteria 1132
1069 Ga0495640_0000388 3300046533 Bacteria 31270
1070 Ga0495640_0012229 3300046533 Bacteria 6568
1071 Ga0495640_0020152 3300046533 Bacteria 4913
1072 Ga0495640_0041579 3300046533 Bacteria 3211
1073 Ga0495586_0146090 3300046535 Bacteria 1329
1074 Ga0495587_0000249 3300046536 Bacteria 39283
1075 Ga0495587_0018684 3300046536 Bacteria 4297
1076 Ga0495587_0045874 3300046536 Bacteria 2596
1077 Ga0495587_0068307 3300046536 Bacteria 2070
1078 Ga0495609_0074972 3300046538 Bacteria 1483
1079 Ga0495609_0121791 3300046538 Bacteria 1121
1080 Ga0495597_0085522 3300046542 Bacteria 1344
1081 Ga0495597_0235764 3300046542 Bacteria 723
1082 Ga0495645_0007880 3300046543 Bacteria 7410
1083 Ga0495645_0024231 3300046543 Bacteria 4402
1084 Ga0495645_0164214 3300046543 Bacteria 1533
1085 Ga0495622_0031960 3300046557 Bacteria 2458
1086 Ga0495622_0057875 3300046557 Bacteria 1796
1087 Ga0495622_0065013 3300046557 Bacteria 1686
1088 Ga0495633_0022894 3300046558 Bacteria 3100
1089 Ga0495667_0000195 3300046559 Bacteria 40983
1090 Ga0495667_0005712 3300046559 Bacteria 8423
1091 Ga0495667_0032617 3300046559 Bacteria 3489
1092 Ga0495667_0123438 3300046559 Bacteria 1672
1093 Ga0495656_0001218 3300046615 Bacteria 8383
1094 Ga0495656_0008671 3300046615 Bacteria 3637
1095 Ga0495668_0055643 3300046616 Bacteria 2184
1096 Ga0495634_0003325 3300046642 Bacteria 12937
1097 Ga0495634_0021235 3300046642 Bacteria 4592
1098 Ga0495634_0135922 3300046642 Bacteria 1564
1099 Ga0495611_0027315 3300046648 Bacteria 2494
1100 Ga0495625_0088037 3300046660 Bacteria 2152
1101 Ga0495625_0089466 3300046660 Bacteria 2131
1102 Ga0495625_0122276 3300046660 Bacteria 1770
1103 Ga0495625_0152008 3300046660 Bacteria 1556
1104 Ga0495625_0446987 3300046660 Bacteria 799
1105 Ga0495635_0000185 3300046663 Bacteria 39314
1106 Ga0495635_0000873 3300046663 Bacteria 19766
1107 Ga0495635_0001696 3300046663 Bacteria 14837
1108 Ga0495635_0044031 3300046663 Bacteria 3079
1109 Ga0495635_0056629 3300046663 Bacteria 2698
1110 Ga0495659_0019391 3300046664 Bacteria 2276
1111 Ga0495661_0280131 3300046665 Bacteria 841
1112 Ga0495588_0013827 3300046674 Bacteria 3851
1113 Ga0495588_0048497 3300046674 Bacteria 2182
1114 Ga0495588_0068228 3300046674 Bacteria 1847
1115 Ga0495588_0250205 3300046674 Bacteria 934
1116 Ga0495657_0001331 3300046675 Bacteria 21493
1117 Ga0495657_0011291 3300046675 Bacteria 6685
1118 Ga0495657_0018550 3300046675 Bacteria 5029
1119 Ga0495657_0047169 3300046675 Bacteria 2913
1120 Ga0495599_0000168 3300046678 Bacteria 43232
1121 Ga0495599_0102140 3300046678 Bacteria 1787
1122 Ga0495623_0000586 3300046679 Bacteria 24285
1123 Ga0495623_0001768 3300046679 Bacteria 14509
1124 Ga0495623_0019551 3300046679 Bacteria 4376
1125 Ga0495623_0262791 3300046679 Bacteria 966
1126 Ga0495646_0000269 3300046680 Bacteria 26349
1127 Ga0495646_0026347 3300046680 Bacteria 3651
1128 Ga0495646_0056845 3300046680 Bacteria 2344
1129 Ga0495646_0079456 3300046680 Bacteria 1915
1130 Ga0495646_0131853 3300046680 Bacteria 1406
1131 Ga0495647_0169018 3300046681 Bacteria 946
1132 Ga0495658_0023364 3300046683 Bacteria 3281
1133 Ga0495658_0378762 3300046683 Bacteria 901
1134 Ga0495669_0015157 3300046684 Bacteria 3298
1135 Ga0495669_0064405 3300046684 Bacteria 1663
1136 Ga0495613_0030170 3300046689 Bacteria 4028
1137 Ga0495613_0038119 3300046689 Bacteria 3563
1138 Ga0495613_0062881 3300046689 Bacteria 2716
1139 Ga0495624_0115553 3300046690 Bacteria 1649
1140 Ga0495670_0072322 3300046691 Bacteria 1746
1141 Ga0495671_0094426 3300046692 Bacteria 1463
1142 Ga0495649_0005458 3300046694 Bacteria 8079
1143 Ga0495600_0000210 3300046809 Bacteria 33567
1144 Ga0495600_0001526 3300046809 Bacteria 12864
1145 Ga0495600_0005587 3300046809 Bacteria 7594
1146 Ga0495600_0021059 3300046809 Bacteria 4172
1147 Ga0495600_0104375 3300046809 Bacteria 1847
1148 Ga0495581_0031203 3300047315 Bacteria 3088
1149 Ga0495581_0041352 3300047315 Bacteria 2668
1150 Ga0495581_0075569 3300047315 Bacteria 1949
1151 Ga0495604_0000003 3300047317 Bacteria 464246
1152 Ga0495604_0002479 3300047317 Bacteria 14734
1153 Ga0495604_0007137 3300047317 Bacteria 8852
1154 Ga0495604_0009567 3300047317 Bacteria 7666
1155 Ga0495674_0000006 3300047319 Bacteria 341772
1156 Ga0495674_0016182 3300047319 Bacteria 6958
1157 Ga0495674_0017727 3300047319 Bacteria 6630
1158 Ga0495674_0029040 3300047319 Bacteria 5037
1159 Ga0495674_0164354 3300047319 Bacteria 1856
1160 Ga0495672_0028302 3300047320 Bacteria 3547
1161 Ga0495672_0039931 3300047320 Bacteria 2850
1162 Ga0495672_0125201 3300047320 Bacteria 1360
1163 Ga0495672_0182365 3300047320 Bacteria 1062
1164 Ga0495676_0035714 3300047321 Bacteria 4156
1165 Ga0495676_0060030 3300047321 Bacteria 2983
1166 Ga0495676_0190803 3300047321 Bacteria 1429
1167 Ga0495680_0001799 3300047322 Bacteria 22686
1168 Ga0495680_0005630 3300047322 Bacteria 11739
1169 Ga0495680_0018123 3300047322 Bacteria 5987
1170 Ga0495683_0047664 3300047323 Bacteria 2149
1171 Ga0495683_0127160 3300047323 Bacteria 1205
1172 Ga0495675_0000336 3300047444 Bacteria 33140
1173 Ga0495675_0249065 3300047444 Bacteria 1067
1174 Ga0495685_015331 3300047447 Bacteria 2613
1175 Ga0495684_0000287 3300047471 Bacteria 40835
1176 Ga0495684_0003082 3300047471 Bacteria 13101
1177 Ga0495684_0008230 3300047471 Bacteria 8073
1178 Ga0495684_0015851 3300047471 Bacteria 5801
1179 Ga0495686_0048054 3300047472 Bacteria 2692
1180 Ga0495686_0124666 3300047472 Bacteria 1532
1181 Ga0495686_0128036 3300047472 Bacteria 1508
1182 Ga0495593_0001718 3300047673 Bacteria 12967
1183 Ga0495593_0009416 3300047673 Bacteria 5668
1184 Ga0495593_0035007 3300047673 Bacteria 2728
1185 Ga0495593_0146138 3300047673 Bacteria 1196
1186 Ga0495593_0180805 3300047673 Bacteria 1062
1187 Ga0495593_0274359 3300047673 Bacteria 844
1188 Ga0495602_0000805 3300048088 Bacteria 29994
1189 Ga0495602_0018072 3300048088 Bacteria 7052
1190 Ga0495602_0020674 3300048088 Bacteria 6501
1191 Ga0495602_0058307 3300048088 Bacteria 3380
1192 Ga0495602_0378188 3300048088 Bacteria 1015
1193 Ga0495626_0067186 3300048091 Bacteria 1620
1194 Ga0496100_0002779 3300048903 Bacteria 8952
1195 Ga0496100_0029522 3300048903 Bacteria 3393
1196 Ga0496100_0258192 3300048903 Bacteria 1291
1197 Ga0496100_0486855 3300048903 Bacteria 949
1198 Ga0496100_0560611 3300048903 Bacteria 884
1199 Ga0496101_0001894 3300048904 Bacteria 12631
1200 Ga0496101_0054385 3300048904 Bacteria 2890
1201 Ga0496101_0056797 3300048904 Bacteria 2830
1202 Ga0496101_0093616 3300048904 Bacteria 2238
1203 Ga0496102_0002765 3300048905 Bacteria 14959
1204 Ga0496102_0040716 3300048905 Bacteria 4205
1205 Ga0496102_0065153 3300048905 Bacteria 3339
1206 Ga0496102_0081657 3300048905 Bacteria 2980
1207 Ga0496102_0377152 3300048905 Bacteria 1335
1208 Ga0496102_0689565 3300048905 Bacteria 944
1209 Ga0496103_0052822 3300048906 Bacteria 2517
1210 Ga0496103_0079512 3300048906 Bacteria 2060
1211 Ga0496103_0408764 3300048906 Bacteria 872
1212 Ga0496104_0005950 3300048907 Bacteria 10682
1213 Ga0496104_0039293 3300048907 Bacteria 4430
1214 Ga0496104_0194817 3300048907 Bacteria 1938
1215 Ga0496104_0200572 3300048907 Bacteria 1907
1216 Ga0496104_0400700 3300048907 Bacteria 1284
1217 Ga0496104_0636854 3300048907 Bacteria 975
1218 Ga0496104_0821197 3300048907 Bacteria 835
1219 Ga0496105_0004948 3300048908 Bacteria 10075
1220 Ga0496105_0014178 3300048908 Bacteria 6343
1221 Ga0496105_0038159 3300048908 Bacteria 3957
1222 Ga0496105_0041386 3300048908 Bacteria 3797
1223 Ga0496105_0053835 3300048908 Bacteria 3324
1224 Ga0496105_0082441 3300048908 Bacteria 2656
1225 Ga0496105_0201843 3300048908 Bacteria 1623
1226 Ga0496106_0000587 3300048909 Bacteria 25963
1227 Ga0496106_0005552 3300048909 Bacteria 9339
1228 Ga0496106_0019620 3300048909 Bacteria 5015
1229 Ga0496106_0051907 3300048909 Bacteria 3092
1230 Ga0496106_0053721 3300048909 Bacteria 3043
1231 Ga0496106_0219417 3300048909 Bacteria 1516
1232 Ga0496106_0649360 3300048909 Bacteria 843
1233 Ga0496107_0003023 3300048910 Bacteria 11146
1234 Ga0496107_0021695 3300048910 Bacteria 4538
1235 Ga0496107_0024155 3300048910 Bacteria 4299
1236 Ga0496107_0024903 3300048910 Bacteria 4235
1237 Ga0496107_0074497 3300048910 Bacteria 2470
1238 Ga0496107_0080438 3300048910 Bacteria 2376
1239 Ga0496107_0209770 3300048910 Bacteria 1448
1240 Ga0496107_0564105 3300048910 Bacteria 843
1241 Ga0496108_0000517 3300048911 Bacteria 30206
1242 Ga0496108_0002253 3300048911 Bacteria 15443
1243 Ga0496108_0034446 3300048911 Bacteria 4208
1244 Ga0496108_0044050 3300048911 Bacteria 3726
1245 Ga0496108_0046015 3300048911 Bacteria 3645
1246 Ga0496108_0132909 3300048911 Bacteria 2139
1247 Ga0496108_0457925 3300048911 Bacteria 1114
1248 Ga0496109_0000814 3300048912 Bacteria 26012
1249 Ga0496109_0049567 3300048912 Bacteria 3823
1250 Ga0496109_0066388 3300048912 Bacteria 3303
1251 Ga0496109_0159112 3300048912 Bacteria 2116
1252 Ga0496109_0368696 3300048912 Bacteria 1356
1253 Ga0496109_0537074 3300048912 Bacteria 1103
1254 Ga0496109_0644880 3300048912 Bacteria 996
1255 Ga0496109_0774993 3300048912 Bacteria 897
1256 Ga0496110_0016915 3300048913 Bacteria 6096
1257 Ga0496110_0026206 3300048913 Bacteria 4986
1258 Ga0496110_0053094 3300048913 Bacteria 3562
1259 Ga0496110_0067178 3300048913 Bacteria 3172
1260 Ga0496110_0149899 3300048913 Bacteria 2111
1261 Ga0496110_0177020 3300048913 Bacteria 1936
1262 Ga0496111_0009126 3300048914 Bacteria 6601
1263 Ga0496111_0046808 3300048914 Bacteria 3115
1264 Ga0496111_0123406 3300048914 Bacteria 1914
1265 Ga0496111_0139025 3300048914 Bacteria 1799
1266 Ga0496111_0175646 3300048914 Bacteria 1592
1267 Ga0496111_0367624 3300048914 Bacteria 1064
1268 Ga0496112_0000004 3300048915 Bacteria 553294
1269 Ga0496112_0000218 3300048915 Bacteria 37059
1270 Ga0496112_0016917 3300048915 Bacteria 6843
1271 Ga0496112_0037102 3300048915 Bacteria 4758
1272 Ga0496112_0043290 3300048915 Bacteria 4408
1273 Ga0496112_0044258 3300048915 Bacteria 4362
1274 Ga0496112_0068208 3300048915 Bacteria 3512
1275 Ga0496112_0128423 3300048915 Bacteria 2505
1276 Ga0496112_0145582 3300048915 Bacteria 2338
1277 Ga0496112_0163031 3300048915 Bacteria 2195
1278 Ga0496112_0286820 3300048915 Bacteria 1592
1279 Ga0496112_0655136 3300048915 Bacteria 979
1280 Ga0496113_0003899 3300048916 Bacteria 9040
1281 Ga0496113_0025279 3300048916 Bacteria 4231
1282 Ga0496113_0029742 3300048916 Bacteria 3948
1283 Ga0496113_0058245 3300048916 Bacteria 2906
1284 Ga0496113_0060028 3300048916 Bacteria 2866
1285 Ga0496113_0163310 3300048916 Bacteria 1761
1286 Ga0496113_0275455 3300048916 Bacteria 1345
1287 Ga0496113_0305047 3300048916 Bacteria 1275
1288 Ga0496113_0612111 3300048916 Bacteria 872
1289 Ga0496114_0009279 3300048917 Bacteria 7805
1290 Ga0496114_0035386 3300048917 Bacteria 4123
1291 Ga0496114_0100069 3300048917 Bacteria 2473
1292 Ga0496114_0191204 3300048917 Bacteria 1791
1293 Ga0496114_0210520 3300048917 Bacteria 1705
1294 Ga0496114_0308589 3300048917 Bacteria 1397
1295 Ga0496115_0018582 3300048918 Bacteria 5341
1296 Ga0496115_0023272 3300048918 Bacteria 4806
1297 Ga0496115_0155365 3300048918 Bacteria 1890
1298 Ga0496115_0347336 3300048918 Bacteria 1210
1299 Ga0496115_0410117 3300048918 Bacteria 1098
1300 Ga0496115_0540866 3300048918 Bacteria 932
1301 Ga0496116_0017544 3300048919 Bacteria 5549
1302 Ga0496116_0023210 3300048919 Bacteria 4626
1303 Ga0496116_0040863 3300048919 Bacteria 3188
1304 Ga0496117_0011613 3300048920 Bacteria 7871
1305 Ga0496117_0103657 3300048920 Bacteria 1792
1306 Ga0496117_0214359 3300048920 Bacteria 1077
1307 Ga0496117_0295281 3300048920 Bacteria 861
1308 Ga0496118_0004793 3300048921 Bacteria 15797
1309 Ga0496118_0045464 3300048921 Bacteria 3427
1310 Ga0496118_0056547 3300048921 Bacteria 2948
1311 Ga0496118_0062107 3300048921 Bacteria 2761
1312 Ga0496118_0070914 3300048921 Bacteria 2512
1313 Ga0496118_0071819 3300048921 Bacteria 2489
1314 Ga0496118_0265931 3300048921 Bacteria 964
1315 Ga0496119_0002647 3300048922 Bacteria 19399
1316 Ga0496119_0009808 3300048922 Bacteria 8146
1317 Ga0496119_0028133 3300048922 Bacteria 3845
1318 Ga0496119_0125808 3300048922 Bacteria 1403
1319 Ga0496120_0019815 3300048923 Bacteria 4291
1320 Ga0496120_0038353 3300048923 Bacteria 2835
1321 Ga0496120_0187901 3300048923 Bacteria 1009
1322 Ga0496120_0199312 3300048923 Bacteria 970
1323 Ga0496121_0000458 3300048924 Bacteria 80207
1324 Ga0496121_0001749 3300048924 Bacteria 35439
1325 Ga0496121_0002564 3300048924 Bacteria 27512
1326 Ga0496121_0006706 3300048924 Bacteria 14144
1327 Ga0496121_0019210 3300048924 Bacteria 6845
1328 Ga0496121_0030046 3300048924 Bacteria 5002
1329 Ga0496121_0037369 3300048924 Bacteria 4314
1330 Ga0496121_0039959 3300048924 Bacteria 4124
1331 Ga0496121_0060123 3300048924 Bacteria 3128
1332 Ga0496121_0100872 3300048924 Bacteria 2227
1333 Ga0496121_0102319 3300048924 Bacteria 2207
1334 Ga0496121_0110683 3300048924 Bacteria 2095
1335 Ga0496121_0137910 3300048924 Bacteria 1814
1336 Ga0496121_0143496 3300048924 Bacteria 1768
1337 Ga0496121_0461321 3300048924 Bacteria 816
1338 Ga0496122_0005205 3300048925 Bacteria 15617
1339 Ga0496122_0089726 3300048925 Bacteria 2100
1340 Ga0496122_0151155 3300048925 Bacteria 1433
1341 Ga0496123_0001216 3300048926 Bacteria 37600
1342 Ga0496123_0056943 3300048926 Bacteria 2549
1343 Ga0496123_0136293 3300048926 Bacteria 1350
1344 Ga0496124_0004472 3300048927 Bacteria 16313
1345 Ga0496124_0049471 3300048927 Bacteria 3586
1346 Ga0496124_0135267 3300048927 Bacteria 1952
1347 Ga0496124_0318172 3300048927 Bacteria 1115
1348 Ga0496124_0331410 3300048927 Bacteria 1085
1349 Ga0496124_0401643 3300048927 Bacteria 951
1350 Ga0496125_0007066 3300048928 Bacteria 11990
1351 Ga0496125_0028317 3300048928 Bacteria 5064
1352 Ga0496125_0035050 3300048928 Bacteria 4411
1353 Ga0496125_0063116 3300048928 Bacteria 2956
1354 Ga0496125_0130191 3300048928 Bacteria 1773
1355 Ga0496125_0163747 3300048928 Bacteria 1506
1356 Ga0496125_0347958 3300048928 Bacteria 886
1357 Ga0496125_0379986 3300048928 Bacteria 833
1358 Ga0496126_0003477 3300048929 Bacteria 19884
1359 Ga0496126_0009236 3300048929 Bacteria 10511
1360 Ga0496126_0014283 3300048929 Bacteria 8034
1361 Ga0496126_0022627 3300048929 Bacteria 6109
1362 Ga0496126_0022855 3300048929 Bacteria 6071
1363 Ga0496126_0031475 3300048929 Bacteria 5011
1364 Ga0496126_0039174 3300048929 Bacteria 4400
1365 Ga0496126_0082444 3300048929 Bacteria 2841
1366 Ga0496126_0083970 3300048929 Bacteria 2810
1367 Ga0496126_0091207 3300048929 Bacteria 2680
1368 Ga0496126_0161207 3300048929 Bacteria 1916
1369 Ga0496126_0170985 3300048929 Bacteria 1851
1370 Ga0496126_0178540 3300048929 Bacteria 1805
1371 Ga0496126_0273764 3300048929 Bacteria 1400
1372 Ga0496126_0396835 3300048929 Bacteria 1120
1373 Ga0496126_0729716 3300048929 Bacteria 767
1374 Ga0496126_0737877 3300048929 Bacteria 762
1375 Ga0496126_0739013 3300048929 Bacteria 761
1376 Ga0495682_0103925 3300049460 Bacteria 1019
1377 Ga0501031_0002252 3300049568 Bacteria 12217
1378 Ga0501031_0004417 3300049568 Bacteria 9113
1379 Ga0501031_0104072 3300049568 Bacteria 1852
1380 Ga0501032_0001822 3300049569 Bacteria 16845
1381 Ga0501032_0010877 3300049569 Bacteria 6545
1382 Ga0501032_0048106 3300049569 Bacteria 2879
1383 Ga0501032_0073698 3300049569 Bacteria 2274
1384 Ga0501033_0000108 3300049570 Bacteria 79903
1385 Ga0501033_0000827 3300049570 Bacteria 28243
1386 Ga0501033_0005609 3300049570 Bacteria 9915
1387 Ga0501033_0008341 3300049570 Bacteria 8023
1388 Ga0501033_0020768 3300049570 Bacteria 4961
1389 Ga0501033_0192451 3300049570 Bacteria 1459
1390 Ga0501034_0002449 3300049571 Bacteria 22384
1391 Ga0501034_0041720 3300049571 Bacteria 4643
1392 Ga0501034_0050134 3300049571 Bacteria 4211
1393 Ga0501034_0097719 3300049571 Bacteria 2932
1394 Ga0501034_0107244 3300049571 Bacteria 2785
1395 Ga0501034_0251907 3300049571 Bacteria 1710
1396 Ga0501036_0000149 3300049572 Bacteria 45598
1397 Ga0501036_0017788 3300049572 Bacteria 5952
1398 Ga0501036_0020595 3300049572 Bacteria 5539
1399 Ga0501036_0025415 3300049572 Bacteria 4995
1400 Ga0501036_0159903 3300049572 Bacteria 1899
1401 Ga0501036_0281244 3300049572 Bacteria 1392
1402 Ga0501037_0000153 3300049573 Bacteria 64239
1403 Ga0501037_0000888 3300049573 Bacteria 22320
1404 Ga0501037_0023604 3300049573 Bacteria 4547
1405 Ga0501037_0039773 3300049573 Bacteria 3460
1406 Ga0501037_0043447 3300049573 Bacteria 3302
1407 Ga0501038_0000138 3300049574 Bacteria 62493
1408 Ga0501038_0000999 3300049574 Bacteria 25463
1409 Ga0501038_0001121 3300049574 Bacteria 24319
1410 Ga0501038_0012358 3300049574 Bacteria 7802
1411 Ga0501038_0026754 3300049574 Bacteria 5135
1412 Ga0501038_0028683 3300049574 Bacteria 4943
1413 Ga0501038_0041649 3300049574 Bacteria 4004
1414 Ga0501038_0054303 3300049574 Bacteria 3446
1415 Ga0501038_0378460 3300049574 Bacteria 1098
1416 Ga0501039_0000842 3300049575 Bacteria 22166
1417 Ga0501039_0006162 3300049575 Bacteria 9108
1418 Ga0501039_0050475 3300049575 Bacteria 3218
1419 Ga0501039_0343199 3300049575 Bacteria 1173
1420 Ga0501040_0015506 3300049576 Bacteria 5036
1421 Ga0501041_0120074 3300049577 Bacteria 1633
1422 Ga0501041_0287448 3300049577 Bacteria 1035
1423 Ga0501042_0001932 3300049578 Bacteria 12476
1424 Ga0501042_0088976 3300049578 Bacteria 2215
1425 Ga0501043_0000085 3300049579 Bacteria 83544
1426 Ga0501043_0013390 3300049579 Bacteria 6414
1427 Ga0501043_0019654 3300049579 Bacteria 5303
1428 Ga0501043_0081607 3300049579 Bacteria 2541
1429 Ga0501043_0170027 3300049579 Bacteria 1700
1430 Ga0501046_0000267 3300049580 Bacteria 53185
1431 Ga0501046_0003985 3300049580 Bacteria 13484
1432 Ga0501046_0033529 3300049580 Bacteria 4147
1433 Ga0501046_0155285 3300049580 Bacteria 1724
1434 Ga0501047_0001785 3300049581 Bacteria 20809
1435 Ga0501047_0008455 3300049581 Bacteria 9713
1436 Ga0501047_0021518 3300049581 Bacteria 6194
1437 Ga0501047_0027991 3300049581 Bacteria 5431
1438 Ga0501047_0041733 3300049581 Bacteria 4432
1439 Ga0501047_0214787 3300049581 Bacteria 1780
1440 Ga0501047_0535426 3300049581 Bacteria 996
1441 Ga0501048_0000396 3300049582 Bacteria 30302
1442 Ga0501048_0012509 3300049582 Bacteria 6315
1443 Ga0501048_0111842 3300049582 Bacteria 1929
1444 Ga0501048_0182347 3300049582 Bacteria 1488
1445 Ga0501067_0000104 3300049583 Bacteria 48290
1446 Ga0501067_0006729 3300049583 Bacteria 6375
1447 Ga0501067_0048309 3300049583 Bacteria 2360
1448 Ga0501067_0147050 3300049583 Bacteria 1313
1449 Ga0501067_0244749 3300049583 Bacteria 998
1450 Ga0501068_0002865 3300049584 Bacteria 9179
1451 Ga0501068_0003450 3300049584 Bacteria 8510
1452 Ga0501068_0018698 3300049584 Bacteria 4014
1453 Ga0501069_0019419 3300049585 Bacteria 3675
1454 Ga0501069_0045971 3300049585 Bacteria 2420
1455 Ga0501069_0053275 3300049585 Bacteria 2253
1456 Ga0501070_0002230 3300049586 Bacteria 17026
1457 Ga0501070_0008793 3300049586 Bacteria 8538
1458 Ga0501070_0009392 3300049586 Bacteria 8267
1459 Ga0501070_0024791 3300049586 Bacteria 5031
1460 Ga0501070_0334147 3300049586 Bacteria 1231
1461 Ga0501071_0028989 3300049587 Bacteria 3904
1462 Ga0501071_0204566 3300049587 Bacteria 1484
1463 Ga0501071_0464840 3300049587 Bacteria 969
1464 Ga0501072_0019143 3300049588 Bacteria 5288
1465 Ga0501072_0032885 3300049588 Bacteria 4062
1466 Ga0501072_0316549 3300049588 Bacteria 1240
1467 Ga0501072_0624194 3300049588 Bacteria 849
1468 Ga0501073_0000221 3300049589 Bacteria 37338
1469 Ga0501073_0018870 3300049589 Bacteria 4985
1470 Ga0501073_0020114 3300049589 Bacteria 4813
1471 Ga0501073_0066091 3300049589 Bacteria 2521
1472 Ga0501073_0436788 3300049589 Bacteria 905
1473 Ga0501074_0001821 3300049590 Bacteria 14590
1474 Ga0501074_0008617 3300049590 Bacteria 7385
1475 Ga0501075_0038557 3300049591 Bacteria 3573
1476 Ga0501075_0304417 3300049591 Bacteria 1215
1477 Ga0501075_0369424 3300049591 Bacteria 1093
1478 Ga0501076_0011550 3300049592 Bacteria 6585
1479 Ga0501076_0037661 3300049592 Bacteria 3794
1480 Ga0501076_0617934 3300049592 Bacteria 894
1481 Ga0501077_0050144 3300049593 Bacteria 2653
1482 Ga0501079_0007983 3300049741 Bacteria 8021
1483 Ga0501079_0011689 3300049741 Bacteria 6706
1484 Ga0501079_0019790 3300049741 Bacteria 5143
1485 Ga0501079_0141817 3300049741 Bacteria 1872
1486 Ga0501080_0013906 3300049742 Bacteria 7408
1487 Ga0501080_0015912 3300049742 Bacteria 6938
1488 Ga0501080_0024958 3300049742 Bacteria 5544
1489 Ga0501080_0053279 3300049742 Bacteria 3766
1490 Ga0501080_0139921 3300049742 Bacteria 2238
1491 Ga0501080_0164236 3300049742 Bacteria 2049
1492 Ga0501083_0000087 3300049744 Bacteria 62691
1493 Ga0501083_0018512 3300049744 Bacteria 4853
1494 Ga0501083_0127008 3300049744 Bacteria 1672
1495 Ga0501083_0211671 3300049744 Bacteria 1264
1496 Ga0501035_0000223 3300049822 Bacteria 67732
1497 Ga0501035_0009850 3300049822 Bacteria 8874
1498 Ga0501035_0019488 3300049822 Bacteria 6236
1499 Ga0501035_0021012 3300049822 Bacteria 6000
1500 Ga0501035_0036839 3300049822 Bacteria 4432
1501 Ga0501035_0065366 3300049822 Bacteria 3231
1502 Ga0501035_0101224 3300049822 Bacteria 2528
1503 Ga0501044_0000369 3300049823 Bacteria 56363
1504 Ga0501044_0029450 3300049823 Bacteria 5789
1505 Ga0501044_0082994 3300049823 Bacteria 3241
1506 Ga0501044_0096443 3300049823 Bacteria 2978
1507 Ga0501044_0123956 3300049823 Bacteria 2582
1508 Ga0501044_0151796 3300049823 Bacteria 2298
1509 Ga0501044_0278393 3300049823 Bacteria 1607
1510 Ga0501044_0353486 3300049823 Bacteria 1388
1511 Ga0501045_0003158 3300049824 Bacteria 11262
1512 Ga0501045_0185869 3300049824 Bacteria 1548
1513 nmdc:mga03683_58016_c1 3300050489 Bacteria 1631
1514 nmdc:mga03n38_5599_c1 3300050490 Bacteria 4292
1515 nmdc:mga03n38_866_c1 3300050490 Bacteria 8124
1516 nmdc:mga00v17_14094_c1 3300050491 Bacteria 4456
1517 nmdc:mga00v17_167231_c1 3300050491 Bacteria 1417
1518 nmdc:mga00v17_364542_c1 3300050491 Bacteria 939
1519 nmdc:mga0yw44_156649_c1 3300050492 Bacteria 1489
1520 nmdc:mga0yw44_204888_c1 3300050492 Bacteria 1304
1521 nmdc:mga0yw44_2331_c1 3300050492 Bacteria 8037
1522 nmdc:mga0yw44_242690_c1 3300050492 Bacteria 1198
1523 nmdc:mga0yw44_331786_c1 3300050492 Bacteria 1022
1524 nmdc:mga0yw44_34263_c1 3300050492 Bacteria 2974
1525 nmdc:mga0k408_18012_c1 3300050493 Bacteria 3937
1526 nmdc:mga0k408_238953_c1 3300050493 Bacteria 1085
1527 nmdc:mga06z11_103129_c1 3300050494 Bacteria 1568
1528 nmdc:mga06z11_55066_c1 3300050494 Bacteria 2053
1529 nmdc:mga06z11_85073_c1 3300050494 Bacteria 1705
1530 nmdc:mga04h51_12842_c1 3300050495 Bacteria 2360
1531 nmdc:mga07m45_158907_c1 3300050496 Bacteria 1312
1532 nmdc:mga07m45_8361_c1 3300050496 Bacteria 5316
1533 nmdc:mga07m45_93596_c1 3300050496 Bacteria 1723
1534 nmdc:mga05p37_555_c1 3300050507 Bacteria 41098
1535 nmdc:mga05p37_63752_c1 3300050507 Bacteria 4535
1536 nmdc:mga05p37_824366_c1 3300050507 Bacteria 1011
1537 nmdc:mga09592_24376_c1 3300050508 Bacteria 5003
1538 nmdc:mga0qj67_382736_c1 3300050509 Bacteria 1136
1539 nmdc:mga06r32_187410_c1 3300050510 Bacteria 2056
1540 nmdc:mga06r32_76341_c1 3300050510 Bacteria 3254
1541 nmdc:mga08y16_134_c1 3300050511 Bacteria 64270
1542 nmdc:mga08y16_527942_c1 3300050511 Bacteria 1196
1543 nmdc:mga08y16_83711_c1 3300050511 Bacteria 3325
1544 nmdc:mga0n895_107862_c1 3300050512 Bacteria 2799
1545 nmdc:mga0n895_168242_c1 3300050512 Bacteria 2224
1546 nmdc:mga0n895_281199_c1 3300050512 Bacteria 1687
1547 nmdc:mga0n895_371837_c1 3300050512 Bacteria 1447
1548 nmdc:mga0rr50_23433_c1 3300050513 Bacteria 4257
1549 nmdc:mga0rr50_289107_c1 3300050513 Bacteria 1369
1550 nmdc:mga0sz30_176696_c1 3300050516 Bacteria 947
1551 nmdc:mga0sz30_38397_c1 3300050516 Bacteria 2006
1552 Ga0495601_0000004 3300053077 Bacteria 449178
1553 Ga0495601_0074263 3300053077 Bacteria 2175
1554 Ga0495601_0241907 3300053077 Bacteria 1178
1555 Ga0495612_0000008 3300053078 Bacteria 232633
1556 Ga0495612_0012354 3300053078 Bacteria 3442
1557 Ga0500635_0021603 3300053080 Bacteria 1984
1558 Ga0495595_0000299 3300053084 Bacteria 19235
1559 Ga0495595_0002435 3300053084 Bacteria 7270
1560 Ga0495619_0000410 3300053085 Bacteria 29131
1561 Ga0495619_0002051 3300053085 Bacteria 13376
1562 Ga0495619_0107032 3300053085 Bacteria 1907
1563 Ga0495619_0274955 3300053085 Bacteria 1167
1564 Ga0500643_000035 3300053087 Bacteria 184794
1565 Ga0500643_002043 3300053087 Bacteria 10818
1566 Ga0500643_095135 3300053087 Bacteria 810
1567 Ga0500583_0340185 3300053092 Bacteria 728
1568 Ga0500651_0014239 3300053093 Bacteria 4864
1569 Ga0500651_0019792 3300053093 Bacteria 4187
1570 Ga0500651_0089411 3300053093 Bacteria 1898
1571 Ga0500651_0097142 3300053093 Bacteria 1810
1572 Ga0500566_0000006 3300053094 Bacteria 153632
1573 Ga0500566_0003025 3300053094 Bacteria 10054
1574 Ga0500566_0007070 3300053094 Bacteria 6646
1575 Ga0500566_0020464 3300053094 Bacteria 3889
1576 Ga0500566_0050700 3300053094 Bacteria 2376
1577 Ga0500566_0122820 3300053094 Bacteria 1398
1578 Ga0500640_000606 3300053095 Bacteria 9307
1579 Ga0500641_0002166 3300053096 Bacteria 6961
1580 Ga0500641_0009735 3300053096 Bacteria 3459
1581 Ga0500641_0023876 3300053096 Bacteria 2355
1582 Ga0500641_0064774 3300053096 Bacteria 1528
1583 Ga0500650_0027948 3300053098 Bacteria 2541
1584 Ga0500650_0094324 3300053098 Bacteria 1401
1585 Ga0500555_006179 3300053103 Bacteria 3399
1586 Ga0500555_077440 3300053103 Bacteria 869
1587 Ga0500556_0000030 3300053104 Bacteria 165098
1588 Ga0500556_0000734 3300053104 Bacteria 19756
1589 Ga0500557_000004 3300053105 Bacteria 202318
1590 Ga0500569_008206 3300053109 Bacteria 2379
1591 Ga0500572_000132 3300053111 Bacteria 25301
1592 Ga0500572_000296 3300053111 Bacteria 17781
1593 Ga0500591_007207 3300053115 Bacteria 5111
1594 Ga0500592_001857 3300053116 Bacteria 3405
1595 Ga0500594_0015247 3300053118 Bacteria 1852
1596 Ga0500594_0058113 3300053118 Bacteria 1108
1597 Ga0500595_000306 3300053119 Bacteria 32239
1598 Ga0500595_001509 3300053119 Bacteria 12362
1599 Ga0500595_002915 3300053119 Bacteria 8182
1600 Ga0500595_014140 3300053119 Bacteria 3035
1601 Ga0500595_022512 3300053119 Bacteria 2229
1602 Ga0500595_025262 3300053119 Bacteria 2062
1603 Ga0500595_084980 3300053119 Bacteria 922
1604 Ga0500607_055375 3300053121 Bacteria 2097
1605 Ga0500608_045969 3300053122 Bacteria 2097
1606 Ga0500614_001796 3300053123 Bacteria 4975
1607 Ga0500614_034971 3300053123 Bacteria 1249
1608 Ga0500642_0000080 3300053130 Bacteria 52024
1609 Ga0500642_0000302 3300053130 Bacteria 17637
1610 Ga0500642_0059969 3300053130 Bacteria 1705
1611 Ga0500642_0145080 3300053130 Bacteria 1114
1612 Ga0500652_001386 3300053131 Bacteria 7563
1613 Ga0500652_061353 3300053131 Bacteria 1548
1614 Ga0500655_021935 3300053133 Bacteria 1200
1615 Ga0500658_0191389 3300053134 Bacteria 934
1616 Ga0500559_0000591 3300053136 Bacteria 24715
1617 Ga0500559_0000850 3300053136 Bacteria 19692
1618 Ga0500559_0001859 3300053136 Bacteria 11495
1619 Ga0500559_0067160 3300053136 Bacteria 1609
1620 Ga0500559_0102365 3300053136 Bacteria 1320
1621 Ga0500559_0228383 3300053136 Bacteria 877
1622 Ga0500568_0000978 3300053139 Bacteria 19672
1623 Ga0500568_0014177 3300053139 Bacteria 3608
1624 Ga0500568_0014813 3300053139 Bacteria 3508
1625 Ga0500568_0023458 3300053139 Bacteria 2624
1626 Ga0500568_0110948 3300053139 Bacteria 1025
1627 Ga0500568_0162847 3300053139 Bacteria 823
1628 Ga0500588_0059060 3300053146 Bacteria 1223
1629 Ga0500588_0060830 3300053146 Bacteria 1210
1630 Ga0500588_0128155 3300053146 Bacteria 901
1631 Ga0500603_000125 3300053150 Bacteria 18162
1632 Ga0500603_016027 3300053150 Bacteria 1773
1633 Ga0500603_021405 3300053150 Bacteria 1590
1634 Ga0500603_049058 3300053150 Bacteria 1150
1635 Ga0500604_0004650 3300053151 Bacteria 3636
1636 Ga0500604_0035375 3300053151 Bacteria 1486
1637 Ga0500604_0048977 3300053151 Bacteria 1299
1638 Ga0500616_0000252 3300053153 Bacteria 83060
1639 Ga0500616_0000696 3300053153 Bacteria 39234
1640 Ga0500616_0015478 3300053153 Bacteria 4360
1641 Ga0500616_0055865 3300053153 Bacteria 2062
1642 Ga0500620_001207 3300053155 Bacteria 4624
1643 Ga0500622_0002597 3300053156 Bacteria 12869
1644 Ga0500622_0003061 3300053156 Bacteria 11537
1645 Ga0500622_0088897 3300053156 Bacteria 1536
1646 Ga0500627_0219046 3300053158 Bacteria 850
1647 Ga0500627_0279057 3300053158 Bacteria 734
1648 Ga0500630_029525 3300053159 Bacteria 2697
1649 Ga0500634_0007858 3300053161 Bacteria 5295
1650 Ga0500634_0119245 3300053161 Bacteria 1287
1651 Ga0500638_001134 3300053162 Bacteria 7959
1652 Ga0500638_032065 3300053162 Bacteria 2536
1653 Ga0500638_045989 3300053162 Bacteria 2117
1654 Ga0500638_104409 3300053162 Bacteria 1317
1655 Ga0500639_000016 3300053163 Bacteria 118099
1656 Ga0500639_043671 3300053163 Bacteria 2349
1657 Ga0500639_197036 3300053163 Bacteria 870
1658 Ga0500636_0000066 3300053177 Bacteria 51367
1659 Ga0500636_0000534 3300053177 Bacteria 20700
1660 Ga0500636_0006053 3300053177 Bacteria 6941
1661 Ga0500636_0046789 3300053177 Bacteria 2550
1662 Ga0500637_0001307 3300053178 Bacteria 10481
1663 Ga0500637_0095998 3300053178 Bacteria 1717
1664 Ga0500576_039982 3300053725 Bacteria 2114
1665 Ga0500625_000123 3300053729 Bacteria 15150
1666 Ga0500645_015900 3300053730 Bacteria 2378
1667 Ga0500645_051528 3300053730 Bacteria 1200
1668 Ga0500599_009161 3300053736 Bacteria 1293
1669 Ga0500601_000139 3300053737 Bacteria 14822
1670 Ga0500601_002260 3300053737 Bacteria 2070
1671 Ga0501084_0005685 3300054114 Bacteria 10240
1672 Ga0501084_0020558 3300054114 Bacteria 5505
1673 Ga0501084_0220459 3300054114 Bacteria 1600
1674 Ga0501082_0000799 3300060353 Bacteria 27707
1675 Ga0501082_0028947 3300060353 Bacteria 4771
1676 Ga0501082_0797946 3300060353 Bacteria 826
1677 2513657908 2513237096 Bacteria 8722461
1678 2513855604 2513237137 Bacteria 9558895
1679 2513890243 2513237141 Bacteria 8496279
1680 2513919999 2513237145 Bacteria 8979722
1681 2515627145 2515154112 Bacteria 8294334
1682 2517892149 2517572143 Bacteria 9484767
1683 2524465746 2524023210 Bacteria 9029266
1684 2524534250 2524023228 Bacteria 10118060
1685 2528853891 2528768022 Bacteria 10457665
1686 2603859677 2602042107 Bacteria 6226103
1687 2644288849 2643221651 Bacteria 4798932
1688 2793062744 2791355196 Bacteria 7323613
1689 2793082406
1690 2805915107 2802429603 Bacteria 8777136
1691 2824604119 2824600985 Bacteria 8488197
1692 2824610388 2824609381 Bacteria 8672835
1693 2824659417 2824653114 Bacteria 8493680
1694 2824668831 2824661429 Bacteria 9877870
1695 2824703873 2824696289 Bacteria 8335049
1696 2824733312 2824732956 Bacteria 7810675
1697 2842040035 2842038055 Bacteria 8002051
1698 2842047020 2842045827 Bacteria 8006841
1699 2847946795 2847939898 Bacteria 8606328
1700 2857528924 2857524615 Bacteria 6615449
1701 2874598281 2874590934 Bacteria 8299676
1702 2874627570 2874620515 Bacteria 8290088
1703 2874652663 2874645413 Bacteria 8214782
1704 2876778241 2876771140 Bacteria 8287509
1705 2876825890 2876818435 Bacteria 8274608
1706 2879082035 2879074833 Bacteria 8279565
1707 2879104879 2879099564 Bacteria 10442239
1708 2879135157 2879127579 Bacteria 8294491
1709 2879145484 2879142872 Bacteria 8267021
1710 2885382753 2885374607 Bacteria 8927485
1711 2885386791 2885383462 Bacteria 9473874
1712 2888424763 2888419890 Bacteria 7857137
1713 2893070381 2893066018 Bacteria 6158120
1714 2903771796 2903768456 Bacteria 9749579
1715 2904673110 2904666416 Bacteria 8226587
1716 2904702293
1717 2906617277
1718 2906643332 2906635258 Bacteria 8601019
1719 2906662538 2906660503 Bacteria 8595048
1720 2908742432 2908739725 Bacteria 8628932
1721 2919076324 2919073203 Bacteria 6531949
1722 2919454503 2919450847 Bacteria 5631160
1723 2922374675
1724 2922430550
1725 2929621765 2929615660 Bacteria 9193770
1726 2929629928 2929624759 Bacteria 9339455
1727 2932788617 2932784394 Bacteria 9704911
1728 2932817200 2932809354 Bacteria 9135765
1729 2932825211 2932818245 Bacteria 9955613
1730 2932830265 2932828146 Bacteria 9745859
1731 2933583959 2933577622 Bacteria 9116884
1732 2935622509 2935616580 Bacteria 9032984
1733 2935642114 2935638405 Bacteria 10015038
1734 2935672502 2935665750 Bacteria 9571747
1735 2935676033 2935675223 Bacteria 9928132
1736 2935686025 2935684952 Bacteria 9590419
1737 2935697731 2935694250 Bacteria 9291695
1738 2935705865 2935703347 Bacteria 10242284
1739 2935714577 2935713505 Bacteria 9608509
1740 2935725196 2935722832 Bacteria 9608746
1741 2935732444 2935732158 Bacteria 9706831
1742 2935741823 2935741537 Bacteria 9707219
1743 2935751990 2935750917 Bacteria 9590372
1744 2935765247 2935760218 Bacteria 9817913
1745 2935802862 2935801545 Bacteria 9301974
1746 2935813306 2935810662 Bacteria 9401221
1747 2935830281 2935827899 Bacteria 10038562
1748 2935838178 2935837841 Bacteria 9454360
1749 2935860758 2935855204 Bacteria 9035059
1750 2935872269 2935864058 Bacteria 9784707
1751 2935878676 2935873716 Bacteria 9632195
1752 2935978639 2935975950 Bacteria 8347125
1753 2935994928 2935992306 Bacteria 9802711
1754 2936003571 2936002035 Bacteria 9362176
1755 2936042255 2936037263 Bacteria 9446081
1756 2940557207 2940556831 Bacteria 9590747
1757 2941539155 2941538514 Bacteria 9402094
1758 3005510550 3005506211 Bacteria 6943378
1759 3005715132 3005710791 Bacteria 7622528
1760 8006940422 8006933436 Bacteria 10410654
1761 8006980110 8006973647 Bacteria 10679141
1762 8016522043 8016511872 Bacteria 9921665
1763 8017063625 8017057580 Bacteria 10023680
1764 8019556304 8019555841 Bacteria 9642137
1765 8019569011 8019565922 Bacteria 9639779
1766 8019582951 8019576017 Bacteria 10049540
1767 8019590750 8019586578 Bacteria 10212056
1768 8019600603 8019597564 Bacteria 10041141
1769 8019617943 8019608314 Bacteria 10042931
1770 8019628436 8019619141 Bacteria 9218857
1771 8019645530 8019638758 Bacteria 9062356
1772 8019671598 8019668869 Bacteria 8791617
1773 8019684503 8019678201 Bacteria 8863603
1774 8055746069 8055742211 Bacteria 9226248
1775 8056687374 8056681323 Bacteria 8472857
1776 8056691283 8056689827 Bacteria 6712655
1777 JGI25404J52841_10030344
1778 RicEn_C9014
1779 MBSR1b_contig_11443562
1780 MBSR1b_contig_12173630
1781 CNAas_1004010
1782 JGI24740J21852_10015785
1783 JGI24739J22299_10029215
1784 JGI24737J22298_10006476
1785 JGI24735J21928_10007461
1786 JGI24744J21845_10042665
1787 JGI25406J46586_10000047
1788 JGI25153J46596_10001251
1789 JGI25153J46596_10002613
1790 JGI25153J46596_10002759
1791 JGI25153J46596_10005940
1792 JGI25160J50197_1002757
1793 JGI25160J50197_1032891
1794 JGI25404J52841_10010459
1795 JGI25404J52841_10019235
1796 Ga0055531_10022839
1797 Ga0065165_1000231
1798 Ga0065165_1001895
1799 Ga0065712_10231883
1800 Ga0065715_10160419
1801 Ga0070658_10165438
1802 Ga0070658_10194684
1803 Ga0070658_10207247
1804 Ga0070658_10344647
1805 Ga0070658_10370198
1806 Ga0070658_10637307
1807 Ga0070676_10114075
1808 Ga0070676_10124974
1809 Ga0070676_10169066
1810 Ga0070676_10216748
1811 Ga0070676_10245939
1812 Ga0070683_100015898
1813 Ga0070683_100087298
1814 Ga0070683_100090477
1815 Ga0070670_100002084
1816 Ga0070670_100018067
1817 Ga0070670_100113796
1818 Ga0070670_100127870
1819 Ga0070670_100153040
1820 Ga0070670_100171499
1821 Ga0070677_10060360
1822 Ga0070677_10086571
1823 Ga0068869_100022270
1824 Ga0068869_100030572
1825 Ga0068869_100055456
1826 Ga0068869_100119055
1827 Ga0070666_10001973
1828 Ga0070680_100055713
1829 Ga0070680_100125785
1830 Ga0070680_100169644
1831 Ga0070680_100477499
1832 Ga0070682_100617722
1833 Ga0068868_100025524
1834 Ga0068868_100109714
1835 Ga0068868_100197211
1836 Ga0068868_100254272
1837 Ga0068868_100590422
1838 Ga0070689_100055865
1839 Ga0070689_100311686
1840 Ga0070687_100262463
1841 Ga0070661_100017395
1842 Ga0070661_100357733
1843 Ga0070661_100521967
1844 Ga0070668_100002309
1845 Ga0070668_100048482
1846 Ga0070668_100051684
1847 Ga0070668_100054079
1848 Ga0070668_100066405
1849 Ga0070668_100086847
1850 Ga0070668_100138652
1851 Ga0070668_100154631
1852 Ga0070668_100194541
1853 Ga0070669_100012022
1854 Ga0070669_100086727
1855 Ga0070669_100305981
1856 Ga0070669_100309468
1857 Ga0070669_100727184
1858 Ga0070675_100012309
1859 Ga0070675_100171402
1860 Ga0070675_100394506
1861 Ga0070675_100616539
1862 Ga0070671_100081489
1863 Ga0070671_100256534
1864 Ga0070674_100058334
1865 Ga0070674_100066308
1866 Ga0070674_100093562
1867 Ga0070673_100033023
1868 Ga0070688_100042310
1869 Ga0070688_100089017
1870 Ga0070688_100345454
1871 Ga0070688_100347563
1872 Ga0070659_100053564
1873 Ga0070659_100086855
1874 Ga0070659_100173060
1875 Ga0070659_100248514
1876 Ga0070667_100000717
1877 Ga0070667_100002487
1878 Ga0070667_100066866
1879 Ga0070667_100123547
1880 Ga0070667_100243371
1881 Ga0070709_10022117
1882 Ga0070709_10073503
1883 Ga0070714_100094761
1884 Ga0070714_100119588
1885 Ga0070714_100134340
1886 Ga0070714_100269266
1887 Ga0070713_100012226
1888 Ga0070713_100017595
1889 Ga0070713_100031275
1890 Ga0070713_100056841
1891 Ga0070713_100322617
1892 Ga0070713_100438726
1893 Ga0070713_100439077
1894 Ga0070710_10001119
1895 Ga0070710_10008886
1896 Ga0070711_100002712
1897 Ga0070711_100009524
1898 Ga0070711_100010921
1899 Ga0070711_100011141
1900 Ga0070711_100745116
1901 Ga0070711_100855811
1902 Ga0070705_100232952
1903 Ga0070663_100015227
1904 Ga0070663_100051820
1905 Ga0070663_100062227
1906 Ga0070663_100152888
1907 Ga0070663_100164430
1908 Ga0070663_100213032
1909 Ga0070663_100324666
1910 Ga0070663_100357832
1911 Ga0070663_100383908
1912 Ga0070663_100569587
1913 Ga0070678_100063529
1914 Ga0070678_100064365
1915 Ga0070678_100089137
1916 Ga0070678_100122526
1917 Ga0070678_100600104
1918 Ga0070678_100609639
1919 Ga0070662_100209541
1920 Ga0070662_100287692
1921 Ga0070662_100303939
1922 Ga0070662_100392978
1923 Ga0070662_100767566
1924 Ga0070681_10042518
1925 Ga0070681_10520516
1926 Ga0068867_100002382
1927 Ga0068867_100106659
1928 Ga0068867_100110721
1929 Ga0068867_100184555
1930 Ga0068867_100497686
1931 Ga0070685_10058405
1932 Ga0070685_10263209
1933 Ga0070698_100299253
1934 Ga0070699_100064968
1935 Ga0070679_100691351
1936 Ga0070684_100009002
1937 Ga0070684_100094774
1938 Ga0070684_100098651
1939 Ga0068853_100008769
1940 Ga0068853_100093792
1941 Ga0068853_100113245
1942 Ga0068853_100372887
1943 Ga0068853_100462143
1944 Ga0070672_100002140
1945 Ga0070672_100018833
1946 Ga0070672_100084879
1947 Ga0070672_100223410
1948 Ga0070672_100248799
1949 Ga0070695_100161572
1950 Ga0070693_100070672
1951 Ga0070693_100092518
1952 Ga0070693_100509863
1953 Ga0070665_100010979
1954 Ga0070665_100025000
1955 Ga0070665_100033934
1956 Ga0070665_100051133
1957 Ga0070665_100116171
1958 Ga0070665_100290413
1959 Ga0070665_100902553
1960 Ga0070704_100508401
1961 Ga0068855_100018065
1962 Ga0068855_100033896
1963 Ga0068855_100058388
1964 Ga0068855_100110620
1965 Ga0068855_100134302
1966 Ga0068855_100150475
1967 Ga0068855_100235716
1968 Ga0068855_100240817
1969 Ga0068855_100384354
1970 Ga0070664_100012841
1971 Ga0070664_100479462
1972 Ga0070664_100492018
1973 Ga0068857_100007461
1974 Ga0068857_100011475
1975 Ga0068857_100017624
1976 Ga0068857_100028310
1977 Ga0068854_100027763
1978 Ga0068854_100036078
1979 Ga0068854_100160752
1980 Ga0068854_100184747
1981 Ga0068854_100881687
1982 Ga0068856_100000020
1983 Ga0068856_100018098
1984 Ga0068856_100026301
1985 Ga0068856_100040303
1986 Ga0068856_100077346
1987 Ga0068856_100146436
1988 Ga0068856_100242967
1989 Ga0068856_100469858
1990 Ga0068856_100861800
1991 Ga0068856_100880146
1992 Ga0070702_100132032
1993 Ga0068852_100013378
1994 Ga0068852_100031347
1995 Ga0068852_100038673
1996 Ga0068852_100180689
1997 Ga0068852_100184449
1998 Ga0068852_100733175
1999 Ga0068859_100003527
2000 Ga0068859_100006173
2001 Ga0068859_100072923
2002 Ga0068859_100144919
2003 Ga0068859_100306737
2004 Ga0068859_100351852
2005 Ga0068864_100004761
2006 Ga0068864_100150503
2007 Ga0068864_100261260
2008 Ga0068864_100629097
2009 Ga0068866_10122401
2010 Ga0068866_10122460
2011 Ga0068861_100016661
2012 Ga0068861_100038919
2013 Ga0068861_100196324
2014 Ga0068861_100387494
2015 Ga0068861_100433784
2016 Ga0068861_100741319
2017 Ga0068851_10064709
2018 Ga0068870_10035764
2019 Ga0068863_100002512
2020 Ga0068863_100141628
2021 Ga0068863_100154091
2022 Ga0068863_100627486
2023 Ga0068863_100747614
2024 Ga0068858_100015036
2025 Ga0068858_100015457
2026 Ga0068858_100071113
2027 Ga0068858_100238546
2028 Ga0068858_100314077
2029 Ga0068860_100004964
2030 Ga0068860_100016614
2031 Ga0068860_100134343
2032 Ga0068860_100186064
2033 Ga0068862_100053426
2034 Ga0068862_100136416
2035 Ga0068862_100151638
2036 Ga0068862_100281455
2037 Ga0068862_100622576
2038 Ga0081455_10011418
2039 Ga0081455_10015893
2040 Ga0081455_10019603
2041 Ga0081455_10107769
2042 Ga0081455_10185143
2043 Ga0081455_10256787
2044 Ga0081538_10020678
2045 Ga0081538_10035977
2046 Ga0081538_10088860
2047 Ga0081540_1002344
2048 Ga0081540_1002625
2049 Ga0081540_1002868
2050 Ga0081540_1003998
2051 Ga0081540_1004409
2052 Ga0081540_1009104
2053 Ga0081540_1011513
2054 Ga0081540_1011628
2055 Ga0081540_1079725
2056 Ga0081539_10000140
2057 Ga0081539_10002339
2058 Ga0081539_10013499
2059 Ga0081539_10216929
2060 Ga0070717_10006527
2061 Ga0070717_10006998
2062 Ga0070717_10186429
2063 Ga0070717_10339744
2064 Ga0070717_10650840
2065 Ga0075365_10011414
2066 Ga0075365_10029922
2067 Ga0075365_10130201
2068 Ga0075365_10157299
2069 Ga0075365_10163822
2070 Ga0075365_10383542
2071 Ga0075368_10028834
2072 Ga0075363_100036824
2073 Ga0075364_10003703
2074 Ga0075364_10072947
2075 Ga0075364_10119027
2076 Ga0075364_10180568
2077 Ga0070715_10008241
2078 Ga0070716_100008528
2079 Ga0070716_100023937
2080 Ga0070716_100041086
2081 Ga0070716_100288551
2082 Ga0070712_100046680
2083 Ga0070712_100306568
2084 Ga0075362_10000936
2085 Ga0075362_10010211
2086 Ga0075367_10032354
2087 Ga0075367_10054501
2088 Ga0075367_10168671
2089 Ga0075367_10300260
2090 Ga0075367_10321027
2091 Ga0075369_10027395
2092 Ga0075369_10042391
2093 Ga0075369_10103873
2094 Ga0075369_10124081
2095 Ga0075366_10018977
2096 Ga0075366_10083204
2097 Ga0075366_10084065
2098 Ga0097621_100005789
2099 Ga0075370_10040001
2100 Ga0075370_10053825
2101 Ga0075370_10166004
2102 Ga0075370_10234330
2103 Ga0068871_100000813
2104 Ga0068871_100130759
2105 Ga0068871_100219261
2106 Ga0068871_100272918
2107 Ga0075428_100703330
2108 Ga0075428_100833846
2109 Ga0075430_100037645
2110 Ga0075431_100000053
2111 Ga0075431_100077710
2112 Ga0075433_10931035
2113 Ga0075434_100008412
2114 Ga0075434_100443215
2115 Ga0075434_100487130
2116 Ga0075429_100004405
2117 Ga0068865_100055402
2118 Ga0068865_100079979
2119 Ga0068865_100136475
2120 Ga0068865_100220517
2121 Ga0097620_100003527
2122 Ga0097620_100006173
2123 Ga0097620_100072924
2124 Ga0097620_100144929
2125 Ga0097620_100306733
2126 Ga0097620_100351852
2127 Ga0097620_100369142
2128 Ga0099824_1027583
2129 Ga0099822_1018498
2130 Ga0099823_1041378
2131 Ga0075435_100106719
2132 Ga0075435_100175049
2133 Ga0075435_100592884
2134 Ga0099795_10001696
2135 Ga0099795_10024080
2136 Ga0105244_10168463
2137 Ga0105250_10178674
2138 Ga0105240_10024133
2139 Ga0105240_10024314
2140 Ga0105240_10036283
2141 Ga0105240_10056335
2142 Ga0105240_10259071
2143 Ga0105240_10477877
2144 Ga0105240_10719906
2145 Ga0111539_10001519
2146 Ga0111539_10482233
2147 Ga0105245_10127220
2148 Ga0105245_10206696
2149 Ga0105245_10268159
2150 Ga0105245_10449482
2151 Ga0105247_10047475
2152 Ga0105247_10068755
2153 Ga0105247_10085701
2154 Ga0105247_10270735
2155 Ga0105247_10349675
2156 Ga0105247_10448956
2157 Ga0114129_10000237
2158 Ga0114129_10115255
2159 Ga0114129_10649821
2160 Ga0105243_10215572
2161 Ga0105243_10288253
2162 Ga0105243_10574995
2163 Ga0105243_10759037
2164 Ga0105241_10005393
2165 Ga0105242_10415613
2166 Ga0105242_10910606
2167 Ga0105248_10031493
2168 Ga0105248_10040960
2169 Ga0105248_10138684
2170 Ga0105248_10161950
2171 Ga0105248_10530924
2172 Ga0105248_10724907
2173 Ga0105248_10966468
2174 Ga0105237_10032997
2175 Ga0105237_10039060
2176 Ga0105237_10049678
2177 Ga0105237_10060279
2178 Ga0105237_10131130
2179 Ga0105237_10326674
2180 Ga0105237_10544309
2181 Ga0105237_11291647
2182 Ga0105238_10024393
2183 Ga0105238_10029388
2184 Ga0105238_10033691
2185 Ga0105238_10042528
2186 Ga0105238_11320721
2187 Ga0105249_10104490
2188 Ga0105249_10177895
2189 Ga0105249_10572356
2190 Ga0099796_10098601
2191 Ga0099796_10165123
2192 Ga0105239_10022985
2193 Ga0105239_10058272
2194 Ga0105239_10113597
2195 Ga0105239_10147331
2196 Ga0105239_10367642
2197 Ga0105239_10454692
2198 Ga0105239_10768292
2199 Ga0105239_11390993
2200 Ga0105246_10045034
2201 Ga0105246_10501460
2202 Ga0105246_10734930
2203 Ga0157373_10028400
2204 Ga0157370_10024117
2205 Ga0157370_10035604
2206 Ga0157370_10163274
2207 Ga0157369_10066878
2208 Ga0157369_10121671
2209 Ga0157369_10133599
2210 Ga0157369_10161906
2211 Ga0157374_10015540
2212 Ga0157374_10055850
2213 Ga0157374_10477331
2214 Ga0157374_11113050
2215 Ga0157378_10040048
2216 Ga0157378_10222369
2217 Ga0157378_10223517
2218 Ga0163162_10010727
2219 Ga0163162_10099437
2220 Ga0163162_10207523
2221 Ga0163162_10321889
2222 Ga0163162_10464215
2223 Ga0163162_10828920
2224 Ga0157372_10021376
2225 Ga0157372_10051549
2226 Ga0157372_10140535
2227 Ga0157375_10013707
2228 Ga0157375_10087749
2229 Ga0157375_10225401
2230 Ga0157375_10298186
2231 Ga0157375_10367945
2232 Ga0157375_10373696
2233 Ga0163163_10044076
2234 Ga0163163_10056151
2235 Ga0163163_10202275
2236 Ga0163163_10453639
2237 Ga0163163_10629086
2238 Ga0163163_10672981
2239 Ga0157380_10035710
2240 Ga0157380_10136705
2241 Ga0157380_10143174
2242 Ga0157380_11240002
2243 Ga0182008_10036255
2244 Ga0157377_10060620
2245 Ga0157377_10118916
2246 Ga0157379_10002865
2247 Ga0157379_10186976
2248 Ga0157376_10122766
2249 Ga0157376_10129606
2250 Ga0157376_11176721
2251 Ga0163161_10025727
2252 Ga0163161_10026722
2253 Ga0163161_10125701
2254 Ga0214544_1000002
2255 Ga0214544_1034706
2256 Ga0214542_1000001
2257 Ga0214542_1029424
2258 Ga0214545_1000001
2259 Ga0214545_1021309
2260 Ga0214543_1000001
2261 Ga0214543_1038078
2262 Ga0213874_10022314
2263 Ga0213876_10073813
2264 Ga0213876_10252523
2265 Ga0213871_10067354
2266 Ga0209563_101475
2267 Ga0209677_100463
2268 Ga0209148_1000428
2269 Ga0209233_1010958
2270 Ga0209233_1031691
2271 Ga0209455_1004564
2272 Ga0209455_1006717
2273 Ga0209564_1001578
2274 Ga0209564_1023388
2275 Ga0209564_1052192
2276 Ga0209758_1000140
2277 Ga0209758_1000321
2278 Ga0209758_1001092
2279 Ga0209758_1002051
2280 Ga0209758_1002659
2281 Ga0209758_1003492
2282 Ga0209758_1003969
2283 Ga0209758_1094196
2284 Ga0209256_1009946
2285 Ga0209256_1022829
2286 Ga0207426_1000278
2287 Ga0207426_1000378
2288 Ga0207426_1056124
2289 Ga0209257_1000522
2290 Ga0209257_1021097
2291 Ga0207697_10206400
2292 Ga0207656_10010200
2293 Ga0207656_10058367
2294 Ga0207656_10295025
2295 Ga0207682_10038991
2296 Ga0207692_10003515
2297 Ga0207692_10008195
2298 Ga0207692_10118299
2299 Ga0207692_10213076
2300 Ga0207642_10251749
2301 Ga0207710_10058668
2302 Ga0207710_10076259
2303 Ga0207710_10175442
2304 Ga0207710_10209946
2305 Ga0207688_10046398
2306 Ga0207688_10133821
2307 Ga0207688_10292657
2308 Ga0207680_10246835
2309 Ga0207647_10002921
2310 Ga0207647_10006624
2311 Ga0207647_10259957
2312 Ga0207685_10000377
2313 Ga0207685_10008143
2314 Ga0207699_10003114
2315 Ga0207699_10012803
2316 Ga0207699_10038453
2317 Ga0207699_10111562
2318 Ga0207699_10301358
2319 Ga0207699_10422641
2320 Ga0207645_10000286
2321 Ga0207645_10065338
2322 Ga0207645_10140801
2323 Ga0207645_10234887
2324 Ga0207645_10415922
2325 Ga0207643_10054603
2326 Ga0207705_10056618
2327 Ga0207705_10195348
2328 Ga0207705_10212413
2329 Ga0207654_10001513
2330 Ga0207654_10037938
2331 Ga0207707_10031128
2332 Ga0207707_10165809
2333 Ga0207695_10000008
2334 Ga0207695_10008039
2335 Ga0207695_10032881
2336 Ga0207695_10103578
2337 Ga0207695_10238633
2338 Ga0207695_10494828
2339 Ga0207671_10059849
2340 Ga0207671_10143691
2341 Ga0207671_10192469
2342 Ga0207671_10286962
2343 Ga0207693_10001875
2344 Ga0207693_10062244
2345 Ga0207663_10000347
2346 Ga0207663_10006159
2347 Ga0207663_10040094
2348 Ga0207663_10552055
2349 Ga0207660_10047484
2350 Ga0207660_10145935
2351 Ga0207660_10251113
2352 Ga0207662_10247037
2353 Ga0207657_10005077
2354 Ga0207657_10106780
2355 Ga0207649_10028404
2356 Ga0207652_10062632
2357 Ga0207646_10158788
2358 Ga0207681_10139509
2359 Ga0207681_10233693
2360 Ga0207681_10629705
2361 Ga0207694_10000050
2362 Ga0207694_10051007
2363 Ga0207694_10265609
2364 Ga0207694_10609281
2365 Ga0207694_10688494
2366 Ga0207650_10003178
2367 Ga0207650_10012180
2368 Ga0207650_10156021
2369 Ga0207659_10267604
2370 Ga0207659_10290995
2371 Ga0207659_10480952
2372 Ga0207659_10842822
2373 Ga0207687_10014409
2374 Ga0207700_10050010
2375 Ga0207700_10085205
2376 Ga0207700_10108427
2377 Ga0207700_10197910
2378 Ga0207700_10258410
2379 Ga0207700_10382050
2380 Ga0207700_10616896
2381 Ga0207664_10038049
2382 Ga0207664_10042856
2383 Ga0207664_10055666
2384 Ga0207664_10381822
2385 Ga0207664_10454659
2386 Ga0207664_10456802
2387 Ga0207644_10329061
2388 Ga0207644_10357530
2389 Ga0207644_10565787
2390 Ga0207690_10017715
2391 Ga0207706_10153092
2392 Ga0207706_10184354
2393 Ga0207706_10199144
2394 Ga0207686_10117767
2395 Ga0207686_10209320
2396 Ga0207686_10581283
2397 Ga0207709_10046579
2398 Ga0207709_10068250
2399 Ga0207709_10119999
2400 Ga0207709_10302752
2401 Ga0207669_10041586
2402 Ga0207669_10045750
2403 Ga0207704_10048167
2404 Ga0207704_10071978
2405 Ga0207704_10221602
2406 Ga0207665_10004695
2407 Ga0207665_10045722
2408 Ga0207665_10046684
2409 Ga0207665_10050708
2410 Ga0207665_10251103
2411 Ga0207691_10002154
2412 Ga0207691_10029841
2413 Ga0207691_10058642
2414 Ga0207691_10084522
2415 Ga0207711_10010545
2416 Ga0207711_10140089
2417 Ga0207689_10002835
2418 Ga0207689_10020120
2419 Ga0207689_10113433
2420 Ga0207689_10211358
2421 Ga0207661_10006587
2422 Ga0207661_10028199
2423 Ga0207679_10546139
2424 Ga0207667_10010367
2425 Ga0207667_10027376
2426 Ga0207667_10218483
2427 Ga0207667_10218581
2428 Ga0207667_10326769
2429 Ga0207667_10471107
2430 Ga0207667_10505540
2431 Ga0207651_10199118
2432 Ga0207651_10207367
2433 Ga0207651_10623584
2434 Ga0207712_10019146
2435 Ga0207712_10083820
2436 Ga0207712_10087629
2437 Ga0207712_10122121
2438 Ga0207712_10395822
2439 Ga0207668_10014231
2440 Ga0207668_10019014
2441 Ga0207668_10039902
2442 Ga0207668_10067796
2443 Ga0207668_10122389
2444 Ga0207668_10137263
2445 Ga0207668_10249951
2446 Ga0207640_10014363
2447 Ga0207640_10037061
2448 Ga0207640_10154867
2449 Ga0207640_10218286
2450 Ga0207640_10384554
2451 Ga0207640_10534182
2452 Ga0207640_10713744
2453 Ga0207640_10766068
2454 Ga0207640_10838526
2455 Ga0207640_10840084
2456 Ga0207658_10268735
2457 Ga0207658_10305149
2458 Ga0207658_10414578
2459 Ga0207658_10534524
2460 Ga0207677_10031302
2461 Ga0207677_10116413
2462 Ga0207677_10198274
2463 Ga0207677_10403231
2464 Ga0207703_10002330
2465 Ga0207703_10004196
2466 Ga0207703_10156350
2467 Ga0207703_10268096
2468 Ga0207703_10457078
2469 Ga0207703_10847928
2470 Ga0207639_10061853
2471 Ga0207639_10132912
2472 Ga0207639_10146951
2473 Ga0207639_10327623
2474 Ga0207639_10355708
2475 Ga0207639_10396720
2476 Ga0207639_10817342
2477 Ga0207678_10021023
2478 Ga0207678_10023027
2479 Ga0207678_10035512
2480 Ga0207678_10039077
2481 Ga0207678_10041697
2482 Ga0207678_10071839
2483 Ga0207678_10105366
2484 Ga0207678_10110819
2485 Ga0207678_10118932
2486 Ga0207678_10210459
2487 Ga0207678_10211814
2488 Ga0207708_10093201
2489 Ga0207708_10657469
2490 Ga0207702_10000002
2491 Ga0207702_10000748
2492 Ga0207702_10031381
2493 Ga0207702_10049144
2494 Ga0207702_10394613
2495 Ga0207702_10570530
2496 Ga0207641_10003597
2497 Ga0207641_10007624
2498 Ga0207641_10138175
2499 Ga0207641_10235148
2500 Ga0207641_10507466
2501 Ga0207648_10023816
2502 Ga0207648_10059062
2503 Ga0207648_10116985
2504 Ga0207674_10000489
2505 Ga0207674_10003205
2506 Ga0207674_10003611
2507 Ga0207674_10014760
2508 Ga0207674_10023871
2509 Ga0207674_10729084
2510 Ga0207675_100003215
2511 Ga0207675_100075023
2512 Ga0207675_100133243
2513 Ga0207675_100234843
2514 Ga0207675_100244660
2515 Ga0207675_100347420
2516 Ga0207675_100789871
2517 Ga0207683_10002147
2518 Ga0207683_10007176
2519 Ga0207683_10014348
2520 Ga0207683_10018400
2521 Ga0207683_10195356
2522 Ga0207683_10321172
2523 Ga0207683_10367452
2524 Ga0207698_10022804
2525 Ga0207698_10047597
2526 Ga0207698_10104339
2527 Ga0207698_10138517
2528 Ga0207698_10220585
2529 Ga0209389_1000040
2530 Ga0209389_1000995
2531 Ga0209589_1000001
2532 Ga0209589_1000211
2533 Ga0209489_100001
2534 Ga0209489_100006
2535 Ga0209489_110930
2536 Ga0209700_100001
2537 Ga0209700_100005
2538 Ga0209813_10008974
2539 Ga0207428_10036206
2540 Ga0207428_10039542
2541 Ga0207428_10104190
2542 Ga0268266_10002320
2543 Ga0268266_10009271
2544 Ga0268266_10024042
2545 Ga0268266_10028180
2546 Ga0268266_10050458
2547 Ga0268266_10065849
2548 Ga0268266_10065947
2549 Ga0268266_10172149
2550 Ga0268266_10343609
2551 Ga0268266_10564449
2552 Ga0268266_10830937
2553 Ga0268265_10036410
2554 Ga0268265_10209777
2555 Ga0268265_10472323
2556 Ga0268265_10746325
2557 Ga0268264_10002930
2558 Ga0268264_10005853
2559 Ga0268264_10017488
2560 Ga0268264_10158642
2561 Ga0268264_10249367
2562 Ga0265337_1006749
2563 Ga0265334_10006955
2564 Ga0265323_10004409
2565 Ga0265322_10060032
2566 Ga0265336_10000763
2567 Ga0307517_10000249
2568 Ga0307517_10119002
2569 Ga0307515_10314902
2570 Ga0265338_10000665
2571 Ga0307511_10110325
2572 Ga0265330_10124828
2573 Ga0265332_10001409
2574 Ga0265332_10168113
2575 Ga0265325_10012262
2576 Ga0265325_10030711
2577 Ga0265325_10165341
2578 Ga0265329_10071967
2579 Ga0265340_10005726
2580 Ga0265340_10008625
2581 Ga0265339_10003832
2582 Ga0265339_10052640
2583 Ga0265331_10062535
2584 Ga0265316_10061807
2585 Ga0265316_10087120
2586 Ga0307509_10125888
2587 Ga0307408_100318538
2588 Ga0307408_100779255
2589 Ga0307508_10000018
2590 Ga0307508_10043906
2591 Ga0307508_10311566
2592 Ga0316575_10025725
2593 Ga0316579_10037283
2594 Ga0265314_10002567
2595 Ga0265314_10160306
2596 Ga0265314_10181164
2597 Ga0265342_10002171
2598 Ga0265342_10174163
2599 Ga0265342_10211170
2600 Ga0316576_10033029
2601 Ga0316578_10016515
2602 Ga0307516_10011331
2603 Ga0307516_10038640
2604 Ga0307516_10200912
2605 Ga0307516_10224017
2606 Ga0307405_10631678
2607 Ga0307413_10031350
2608 Ga0307413_10800187
2609 Ga0307410_10682828
2610 Ga0307406_10255867
2611 Ga0307412_10429143
2612 Ga0307412_10595978
2613 Ga0307416_100409035
2614 Ga0307415_100042679
2615 Ga0307507_10008461
2616 Ga0307510_10005775
2617 Ga0315911_1000006
2618 Ga0373950_0036482
2619 Ga0373926_0034351
2620 Ga0373926_0069346
2621 Ga0373926_0089882
2622 Ga0373928_0021938
2623 Ga0373934_0024742
2624 Ga0373944_0027109
2625 Ga0373949_0069780
2626 Ga0373932_0012711
2627 Ga0373936_0009212
2628 Ga0373936_0018528
2629 Ga0373936_0124171
2630 Ga0373953_0002178
2631 Ga0373953_0007285
2632 Ga0373953_0027450
2633 Ga0373953_0036308
2634 Ga0373954_0003365
2635 Ga0373954_0008989
2636 Ga0373954_0016863
2637 Ga0373956_0015008
2638 Ga0373956_0035180
2639 Ga0373956_0046623
2640 Ga0373956_0054647
2641 Ga0373957_0003026
2642 Ga0373957_0045277
2643 Ga0373943_0005981
2644 Ga0373943_0006361
2645 Ga0373943_0033391
2646 Ga0373946_0010792
2647 Ga0373946_0146071
2648 Ga0373955_0002466
2649 Ga0373955_0007820
2650 Ga0373955_0237654
2651 Ga0373955_0341937
2652 Ga0373924_0002359
2653 Ga0373924_0012183
2654 Ga0373931_0007658
2655 Ga0373931_0098484
2656 Ga0373931_0148530
2657 Ga0373931_0171129
2658 Ga0373935_0001180
2659 Ga0373935_0033363
2660 Ga0373935_0049212
2661 Ga0373935_0130757
2662 Ga0373935_0382553
2663 Ga0373935_0658773
2664 Ga0373927_0012626
2665 Ga0373927_0033690
2666 Ga0373927_0069279
2667 Ga0373927_0084027
2668 Ga0373927_0177471
2669 Ga0373927_0187584
2670 Ga0373933_0000787
2671 Ga0373933_0005811
2672 Ga0373933_0036459
2673 Ga0373933_0045514
2674 Ga0373947_0012125
2675 Ga0373947_0022984
2676 Ga0373947_0089676
2677 Ga0373937_0001814
2678 Ga0373937_0007938
2679 Ga0373937_0140323
2680 Ga0373937_0170675
2681 Ga0373937_0472782
2682 Ga0373937_0797525
2683 Ga0372808_000933
2684 Ga0373925_0000353
2685 Ga0373925_0003087
2686 Ga0373925_0010490
2687 Ga0373925_0076221
2688 Ga0373925_0579725
2689 Ga0395900_0023857
2690 Ga0395900_0169289
2691 Ga0395898_0019988
2692 Ga0395898_0192806
2693 Ga0395898_0275800
2694 Ga0395898_0417270
2695 Ga0395905_0008616
2696 Ga0395905_0014968
2697 Ga0395905_0030507
2698 Ga0436364_0479367
2699 Ga0395901_0002662
2700 Ga0395901_0183555
2701 Ga0395901_0353861
2702 Ga0436365_0174244
2703 Ga0436365_0647195
2704 Ga0436365_1394673
2705 Ga0436360_0136997
2706 Ga0436360_0173425
2707 Ga0436360_0809633
2708 Ga0436360_0865201
2709 Ga0436361_0265785
2710 Ga0436361_0314733
2711 Ga0436361_0632415
2712 Ga0436363_1258628
2713 Ga0439461_0020278
2714 Ga0451793_0046002
2715 Ga0451807_2283239
2716 Ga0451843_0321225
2717 Ga0466972_0125525
2718 Ga0466965_0086603
2719 Ga0466966_0000426
2720 Ga0466961_0000208
2721 Ga0466961_0462223
2722 Ga0466963_0137055
2723 Ga0466964_0141621
2724 Ga0466957_0364882
2725 Ga0466957_0502789
2726 Ga0466957_0621834
2727 Ga0466960_0074350
2728 Ga0466959_0045855
2729 Ga0466959_0098879
2730 Ga0466959_0101222
2731 Ga0466959_0482341
2732 Ga0451576_1590618
2733 Ga0466967_0075695
2734 Ga0466967_0139641
2735 Ga0466967_0177573
2736 Ga0466967_0235164
2737 Ga0466967_0514130
2738 Ga0495617_024593
2739 Ga0495617_086636
2740 Ga0495592_0000284
2741 Ga0495592_0007940
2742 Ga0495592_0011449
2743 Ga0495592_0030145
2744 Ga0495592_0044849
2745 Ga0495603_0113001
2746 Ga0495603_0151587
2747 Ga0495590_0066882
2748 Ga0495629_0001471
2749 Ga0495629_0009818
2750 Ga0495629_0362317
2751 Ga0495629_0418101
2752 Ga0495638_0007580
2753 Ga0495638_0024650
2754 Ga0495638_0077447
2755 Ga0495641_0027053
2756 Ga0495651_0000528
2757 Ga0495651_0001055
2758 Ga0495651_0004953
2759 Ga0495651_0033861
2760 Ga0495651_0045105
2761 Ga0495651_0119535
2762 Ga0495651_0239621
2763 Ga0495653_0000330
2764 Ga0495653_0012854
2765 Ga0495653_0051880
2766 Ga0495653_0205184
2767 Ga0495650_0035581
2768 Ga0495650_0074621
2769 Ga0495580_0017647
2770 Ga0495580_0064783
2771 Ga0495582_0008676
2772 Ga0495582_0115587
2773 Ga0495582_0321055
2774 Ga0495605_0079390
2775 Ga0495605_0123152
2776 Ga0495639_0046055
2777 Ga0495639_0197439
2778 Ga0495639_0207986
2779 Ga0495639_0261230
2780 Ga0495662_0003004
2781 Ga0495662_0053996
2782 Ga0495664_0000098
2783 Ga0495664_0014192
2784 Ga0495664_0026168
2785 Ga0495664_0027596
2786 Ga0495664_0326016
2787 Ga0495584_0108882
2788 Ga0495585_0042306
2789 Ga0495585_0042422
2790 Ga0495594_0049107
2791 Ga0495594_0127910
2792 Ga0495607_0024171
2793 Ga0495583_0063625
2794 Ga0495606_0001663
2795 Ga0495606_0078359
2796 Ga0495606_0108452
2797 Ga0495606_0111700
2798 Ga0495606_0147278
2799 Ga0495608_0000318
2800 Ga0495608_0007280
2801 Ga0495608_0007748
2802 Ga0495608_0113918
2803 Ga0495610_0028158
2804 Ga0495616_0036121
2805 Ga0495616_0065445
2806 Ga0495618_0000235
2807 Ga0495618_0005313
2808 Ga0495618_0128394
2809 Ga0495618_0308007
2810 Ga0495620_0024389
2811 Ga0495620_0036962
2812 Ga0495628_0001752
2813 Ga0495628_0008728
2814 Ga0495628_0123321
2815 Ga0495628_0156019
2816 Ga0495630_0002403
2817 Ga0495630_0007077
2818 Ga0495630_0535953
2819 Ga0495630_0574089
2820 Ga0495631_0047682
2821 Ga0495632_0041732
2822 Ga0495632_0047359
2823 Ga0495637_0156129
2824 Ga0495643_0039228
2825 Ga0495643_0091448
2826 Ga0495643_0155892
2827 Ga0495644_0134568
2828 Ga0495644_0221403
2829 Ga0495648_0002078
2830 Ga0495648_0047321
2831 Ga0495648_0057044
2832 Ga0495648_0063629
2833 Ga0495648_0099715
2834 Ga0495666_0062522
2835 Ga0495652_0000305
2836 Ga0495652_0002427
2837 Ga0495652_0007898
2838 Ga0495652_0030776
2839 Ga0495652_0071606
2840 Ga0495652_0092860
2841 Ga0495652_0112414
2842 Ga0495654_0019069
2843 Ga0495665_0083069
2844 Ga0495665_0170711
2845 Ga0495640_0000388
2846 Ga0495640_0012229
2847 Ga0495640_0020152
2848 Ga0495640_0041579
2849 Ga0495586_0146090
2850 Ga0495587_0000249
2851 Ga0495587_0018684
2852 Ga0495587_0045874
2853 Ga0495587_0068307
2854 Ga0495609_0074972
2855 Ga0495609_0121791
2856 Ga0495597_0085522
2857 Ga0495597_0235764
2858 Ga0495645_0007880
2859 Ga0495645_0024231
2860 Ga0495645_0164214
2861 Ga0495622_0031960
2862 Ga0495622_0057875
2863 Ga0495622_0065013
2864 Ga0495633_0022894
2865 Ga0495667_0000195
2866 Ga0495667_0005712
2867 Ga0495667_0032617
2868 Ga0495667_0123438
2869 Ga0495656_0001218
2870 Ga0495656_0008671
2871 Ga0495668_0055643
2872 Ga0495634_0003325
2873 Ga0495634_0021235
2874 Ga0495634_0135922
2875 Ga0495611_0027315
2876 Ga0495625_0088037
2877 Ga0495625_0089466
2878 Ga0495625_0122276
2879 Ga0495625_0152008
2880 Ga0495625_0446987
2881 Ga0495635_0000185
2882 Ga0495635_0000873
2883 Ga0495635_0001696
2884 Ga0495635_0044031
2885 Ga0495635_0056629
2886 Ga0495659_0019391
2887 Ga0495661_0280131
2888 Ga0495588_0013827
2889 Ga0495588_0048497
2890 Ga0495588_0068228
2891 Ga0495588_0250205
2892 Ga0495657_0001331
2893 Ga0495657_0011291
2894 Ga0495657_0018550
2895 Ga0495657_0047169
2896 Ga0495599_0000168
2897 Ga0495599_0102140
2898 Ga0495623_0000586
2899 Ga0495623_0001768
2900 Ga0495623_0019551
2901 Ga0495623_0262791
2902 Ga0495646_0000269
2903 Ga0495646_0026347
2904 Ga0495646_0056845
2905 Ga0495646_0079456
2906 Ga0495646_0131853
2907 Ga0495647_0169018
2908 Ga0495658_0023364
2909 Ga0495658_0378762
2910 Ga0495669_0015157
2911 Ga0495669_0064405
2912 Ga0495613_0030170
2913 Ga0495613_0038119
2914 Ga0495613_0062881
2915 Ga0495624_0115553
2916 Ga0495670_0072322
2917 Ga0495671_0094426
2918 Ga0495649_0005458
2919 Ga0495600_0000210
2920 Ga0495600_0001526
2921 Ga0495600_0005587
2922 Ga0495600_0021059
2923 Ga0495600_0104375
2924 Ga0495581_0031203
2925 Ga0495581_0041352
2926 Ga0495581_0075569
2927 Ga0495604_0000003
2928 Ga0495604_0002479
2929 Ga0495604_0007137
2930 Ga0495604_0009567
2931 Ga0495674_0000006
2932 Ga0495674_0016182
2933 Ga0495674_0017727
2934 Ga0495674_0029040
2935 Ga0495674_0164354
2936 Ga0495672_0028302
2937 Ga0495672_0039931
2938 Ga0495672_0125201
2939 Ga0495672_0182365
2940 Ga0495676_0035714
2941 Ga0495676_0060030
2942 Ga0495676_0190803
2943 Ga0495680_0001799
2944 Ga0495680_0005630
2945 Ga0495680_0018123
2946 Ga0495683_0047664
2947 Ga0495683_0127160
2948 Ga0495675_0000336
2949 Ga0495675_0249065
2950 Ga0495685_015331
2951 Ga0495684_0000287
2952 Ga0495684_0003082
2953 Ga0495684_0008230
2954 Ga0495684_0015851
2955 Ga0495686_0048054
2956 Ga0495686_0124666
2957 Ga0495686_0128036
2958 Ga0495593_0001718
2959 Ga0495593_0009416
2960 Ga0495593_0035007
2961 Ga0495593_0146138
2962 Ga0495593_0180805
2963 Ga0495593_0274359
2964 Ga0495602_0000805
2965 Ga0495602_0018072
2966 Ga0495602_0020674
2967 Ga0495602_0058307
2968 Ga0495602_0378188
2969 Ga0495626_0067186
2970 Ga0496100_0002779
2971 Ga0496100_0029522
2972 Ga0496100_0258192
2973 Ga0496100_0486855
2974 Ga0496100_0560611
2975 Ga0496101_0001894
2976 Ga0496101_0054385
2977 Ga0496101_0056797
2978 Ga0496101_0093616
2979 Ga0496102_0002765
2980 Ga0496102_0040716
2981 Ga0496102_0065153
2982 Ga0496102_0081657
2983 Ga0496102_0377152
2984 Ga0496102_0689565
2985 Ga0496103_0052822
2986 Ga0496103_0079512
2987 Ga0496103_0408764
2988 Ga0496104_0005950
2989 Ga0496104_0039293
2990 Ga0496104_0194817
2991 Ga0496104_0200572
2992 Ga0496104_0400700
2993 Ga0496104_0636854
2994 Ga0496104_0821197
2995 Ga0496105_0004948
2996 Ga0496105_0014178
2997 Ga0496105_0038159
2998 Ga0496105_0041386
2999 Ga0496105_0053835
3000 Ga0496105_0082441
3001 Ga0496105_0201843
3002 Ga0496106_0000587
3003 Ga0496106_0005552
3004 Ga0496106_0019620
3005 Ga0496106_0051907
3006 Ga0496106_0053721
3007 Ga0496106_0219417
3008 Ga0496106_0649360
3009 Ga0496107_0003023
3010 Ga0496107_0021695
3011 Ga0496107_0024155
3012 Ga0496107_0024903
3013 Ga0496107_0074497
3014 Ga0496107_0080438
3015 Ga0496107_0209770
3016 Ga0496107_0564105
3017 Ga0496108_0000517
3018 Ga0496108_0002253
3019 Ga0496108_0034446
3020 Ga0496108_0044050
3021 Ga0496108_0046015
3022 Ga0496108_0132909
3023 Ga0496108_0457925
3024 Ga0496109_0000814
3025 Ga0496109_0049567
3026 Ga0496109_0066388
3027 Ga0496109_0159112
3028 Ga0496109_0368696
3029 Ga0496109_0537074
3030 Ga0496109_0644880
3031 Ga0496109_0774993
3032 Ga0496110_0016915
3033 Ga0496110_0026206
3034 Ga0496110_0053094
3035 Ga0496110_0067178
3036 Ga0496110_0149899
3037 Ga0496110_0177020
3038 Ga0496111_0009126
3039 Ga0496111_0046808
3040 Ga0496111_0123406
3041 Ga0496111_0139025
3042 Ga0496111_0175646
3043 Ga0496111_0367624
3044 Ga0496112_0000004
3045 Ga0496112_0000218
3046 Ga0496112_0016917
3047 Ga0496112_0037102
3048 Ga0496112_0043290
3049 Ga0496112_0044258
3050 Ga0496112_0068208
3051 Ga0496112_0128423
3052 Ga0496112_0145582
3053 Ga0496112_0163031
3054 Ga0496112_0286820
3055 Ga0496112_0655136
3056 Ga0496113_0003899
3057 Ga0496113_0025279
3058 Ga0496113_0029742
3059 Ga0496113_0058245
3060 Ga0496113_0060028
3061 Ga0496113_0163310
3062 Ga0496113_0275455
3063 Ga0496113_0305047
3064 Ga0496113_0612111
3065 Ga0496114_0009279
3066 Ga0496114_0035386
3067 Ga0496114_0100069
3068 Ga0496114_0191204
3069 Ga0496114_0210520
3070 Ga0496114_0308589
3071 Ga0496115_0018582
3072 Ga0496115_0023272
3073 Ga0496115_0155365
3074 Ga0496115_0347336
3075 Ga0496115_0410117
3076 Ga0496115_0540866
3077 Ga0496116_0017544
3078 Ga0496116_0023210
3079 Ga0496116_0040863
3080 Ga0496117_0011613
3081 Ga0496117_0103657
3082 Ga0496117_0214359
3083 Ga0496117_0295281
3084 Ga0496118_0004793
3085 Ga0496118_0045464
3086 Ga0496118_0056547
3087 Ga0496118_0062107
3088 Ga0496118_0070914
3089 Ga0496118_0071819
3090 Ga0496118_0265931
3091 Ga0496119_0002647
3092 Ga0496119_0009808
3093 Ga0496119_0028133
3094 Ga0496119_0125808
3095 Ga0496120_0019815
3096 Ga0496120_0038353
3097 Ga0496120_0187901
3098 Ga0496120_0199312
3099 Ga0496121_0000458
3100 Ga0496121_0001749
3101 Ga0496121_0002564
3102 Ga0496121_0006706
3103 Ga0496121_0019210
3104 Ga0496121_0030046
3105 Ga0496121_0037369
3106 Ga0496121_0039959
3107 Ga0496121_0060123
3108 Ga0496121_0100872
3109 Ga0496121_0102319
3110 Ga0496121_0110683
3111 Ga0496121_0137910
3112 Ga0496121_0143496
3113 Ga0496121_0461321
3114 Ga0496122_0005205
3115 Ga0496122_0089726
3116 Ga0496122_0151155
3117 Ga0496123_0001216
3118 Ga0496123_0056943
3119 Ga0496123_0136293
3120 Ga0496124_0004472
3121 Ga0496124_0049471
3122 Ga0496124_0135267
3123 Ga0496124_0318172
3124 Ga0496124_0331410
3125 Ga0496124_0401643
3126 Ga0496125_0007066
3127 Ga0496125_0028317
3128 Ga0496125_0035050
3129 Ga0496125_0063116
3130 Ga0496125_0130191
3131 Ga0496125_0163747
3132 Ga0496125_0347958
3133 Ga0496125_0379986
3134 Ga0496126_0003477
3135 Ga0496126_0009236
3136 Ga0496126_0014283
3137 Ga0496126_0022627
3138 Ga0496126_0022855
3139 Ga0496126_0031475
3140 Ga0496126_0039174
3141 Ga0496126_0082444
3142 Ga0496126_0083970
3143 Ga0496126_0091207
3144 Ga0496126_0161207
3145 Ga0496126_0170985
3146 Ga0496126_0178540
3147 Ga0496126_0273764
3148 Ga0496126_0396835
3149 Ga0496126_0729716
3150 Ga0496126_0737877
3151 Ga0496126_0739013
3152 Ga0495682_0103925
3153 Ga0501031_0002252
3154 Ga0501031_0004417
3155 Ga0501031_0104072
3156 Ga0501032_0001822
3157 Ga0501032_0010877
3158 Ga0501032_0048106
3159 Ga0501032_0073698
3160 Ga0501033_0000108
3161 Ga0501033_0000827
3162 Ga0501033_0005609
3163 Ga0501033_0008341
3164 Ga0501033_0020768
3165 Ga0501033_0192451
3166 Ga0501034_0002449
3167 Ga0501034_0041720
3168 Ga0501034_0050134
3169 Ga0501034_0097719
3170 Ga0501034_0107244
3171 Ga0501034_0251907
3172 Ga0501036_0000149
3173 Ga0501036_0017788
3174 Ga0501036_0020595
3175 Ga0501036_0025415
3176 Ga0501036_0159903
3177 Ga0501036_0281244
3178 Ga0501037_0000153
3179 Ga0501037_0000888
3180 Ga0501037_0023604
3181 Ga0501037_0039773
3182 Ga0501037_0043447
3183 Ga0501038_0000138
3184 Ga0501038_0000999
3185 Ga0501038_0001121
3186 Ga0501038_0012358
3187 Ga0501038_0026754
3188 Ga0501038_0028683
3189 Ga0501038_0041649
3190 Ga0501038_0054303
3191 Ga0501038_0378460
3192 Ga0501039_0000842
3193 Ga0501039_0006162
3194 Ga0501039_0050475
3195 Ga0501039_0343199
3196 Ga0501040_0015506
3197 Ga0501041_0120074
3198 Ga0501041_0287448
3199 Ga0501042_0001932
3200 Ga0501042_0088976
3201 Ga0501043_0000085
3202 Ga0501043_0013390
3203 Ga0501043_0019654
3204 Ga0501043_0081607
3205 Ga0501043_0170027
3206 Ga0501046_0000267
3207 Ga0501046_0003985
3208 Ga0501046_0033529
3209 Ga0501046_0155285
3210 Ga0501047_0001785
3211 Ga0501047_0008455
3212 Ga0501047_0021518
3213 Ga0501047_0027991
3214 Ga0501047_0041733
3215 Ga0501047_0214787
3216 Ga0501047_0535426
3217 Ga0501048_0000396
3218 Ga0501048_0012509
3219 Ga0501048_0111842
3220 Ga0501048_0182347
3221 Ga0501067_0000104
3222 Ga0501067_0006729
3223 Ga0501067_0048309
3224 Ga0501067_0147050
3225 Ga0501067_0244749
3226 Ga0501068_0002865
3227 Ga0501068_0003450
3228 Ga0501068_0018698
3229 Ga0501069_0019419
3230 Ga0501069_0045971
3231 Ga0501069_0053275
3232 Ga0501070_0002230
3233 Ga0501070_0008793
3234 Ga0501070_0009392
3235 Ga0501070_0024791
3236 Ga0501070_0334147
3237 Ga0501071_0028989
3238 Ga0501071_0204566
3239 Ga0501071_0464840
3240 Ga0501072_0019143
3241 Ga0501072_0032885
3242 Ga0501072_0316549
3243 Ga0501072_0624194
3244 Ga0501073_0000221
3245 Ga0501073_0018870
3246 Ga0501073_0020114
3247 Ga0501073_0066091
3248 Ga0501073_0436788
3249 Ga0501074_0001821
3250 Ga0501074_0008617
3251 Ga0501075_0038557
3252 Ga0501075_0304417
3253 Ga0501075_0369424
3254 Ga0501076_0011550
3255 Ga0501076_0037661
3256 Ga0501076_0617934
3257 Ga0501077_0050144
3258 Ga0501079_0007983
3259 Ga0501079_0011689
3260 Ga0501079_0019790
3261 Ga0501079_0141817
3262 Ga0501080_0013906
3263 Ga0501080_0015912
3264 Ga0501080_0024958
3265 Ga0501080_0053279
3266 Ga0501080_0139921
3267 Ga0501080_0164236
3268 Ga0501083_0000087
3269 Ga0501083_0018512
3270 Ga0501083_0127008
3271 Ga0501083_0211671
3272 Ga0501035_0000223
3273 Ga0501035_0009850
3274 Ga0501035_0019488
3275 Ga0501035_0021012
3276 Ga0501035_0036839
3277 Ga0501035_0065366
3278 Ga0501035_0101224
3279 Ga0501044_0000369
3280 Ga0501044_0029450
3281 Ga0501044_0082994
3282 Ga0501044_0096443
3283 Ga0501044_0123956
3284 Ga0501044_0151796
3285 Ga0501044_0278393
3286 Ga0501044_0353486
3287 Ga0501045_0003158
3288 Ga0501045_0185869
3289 nmdc:mga03683_58016_c1
3290 nmdc:mga03n38_5599_c1
3291 nmdc:mga03n38_866_c1
3292 nmdc:mga00v17_14094_c1
3293 nmdc:mga00v17_167231_c1
3294 nmdc:mga00v17_364542_c1
3295 nmdc:mga0yw44_156649_c1
3296 nmdc:mga0yw44_204888_c1
3297 nmdc:mga0yw44_2331_c1
3298 nmdc:mga0yw44_242690_c1
3299 nmdc:mga0yw44_331786_c1
3300 nmdc:mga0yw44_34263_c1
3301 nmdc:mga0k408_18012_c1
3302 nmdc:mga0k408_238953_c1
3303 nmdc:mga06z11_103129_c1
3304 nmdc:mga06z11_55066_c1
3305 nmdc:mga06z11_85073_c1
3306 nmdc:mga04h51_12842_c1
3307 nmdc:mga07m45_158907_c1
3308 nmdc:mga07m45_8361_c1
3309 nmdc:mga07m45_93596_c1
3310 nmdc:mga05p37_555_c1
3311 nmdc:mga05p37_63752_c1
3312 nmdc:mga05p37_824366_c1
3313 nmdc:mga09592_24376_c1
3314 nmdc:mga0qj67_382736_c1
3315 nmdc:mga06r32_187410_c1
3316 nmdc:mga06r32_76341_c1
3317 nmdc:mga08y16_134_c1
3318 nmdc:mga08y16_527942_c1
3319 nmdc:mga08y16_83711_c1
3320 nmdc:mga0n895_107862_c1
3321 nmdc:mga0n895_168242_c1
3322 nmdc:mga0n895_281199_c1
3323 nmdc:mga0n895_371837_c1
3324 nmdc:mga0rr50_23433_c1
3325 nmdc:mga0rr50_289107_c1
3326 nmdc:mga0sz30_176696_c1
3327 nmdc:mga0sz30_38397_c1
3328 Ga0495601_0000004
3329 Ga0495601_0074263
3330 Ga0495601_0241907
3331 Ga0495612_0000008
3332 Ga0495612_0012354
3333 Ga0500635_0021603
3334 Ga0495595_0000299
3335 Ga0495595_0002435
3336 Ga0495619_0000410
3337 Ga0495619_0002051
3338 Ga0495619_0107032
3339 Ga0495619_0274955
3340 Ga0500643_000035
3341 Ga0500643_002043
3342 Ga0500643_095135
3343 Ga0500583_0340185
3344 Ga0500651_0014239
3345 Ga0500651_0019792
3346 Ga0500651_0089411
3347 Ga0500651_0097142
3348 Ga0500566_0000006
3349 Ga0500566_0003025
3350 Ga0500566_0007070
3351 Ga0500566_0020464
3352 Ga0500566_0050700
3353 Ga0500566_0122820
3354 Ga0500640_000606
3355 Ga0500641_0002166
3356 Ga0500641_0009735
3357 Ga0500641_0023876
3358 Ga0500641_0064774
3359 Ga0500650_0027948
3360 Ga0500650_0094324
3361 Ga0500555_006179
3362 Ga0500555_077440
3363 Ga0500556_0000030
3364 Ga0500556_0000734
3365 Ga0500557_000004
3366 Ga0500569_008206
3367 Ga0500572_000132
3368 Ga0500572_000296
3369 Ga0500591_007207
3370 Ga0500592_001857
3371 Ga0500594_0015247
3372 Ga0500594_0058113
3373 Ga0500595_000306
3374 Ga0500595_001509
3375 Ga0500595_002915
3376 Ga0500595_014140
3377 Ga0500595_022512
3378 Ga0500595_025262
3379 Ga0500595_084980
3380 Ga0500607_055375
3381 Ga0500608_045969
3382 Ga0500614_001796
3383 Ga0500614_034971
3384 Ga0500642_0000080
3385 Ga0500642_0000302
3386 Ga0500642_0059969
3387 Ga0500642_0145080
3388 Ga0500652_001386
3389 Ga0500652_061353
3390 Ga0500655_021935
3391 Ga0500658_0191389
3392 Ga0500559_0000591
3393 Ga0500559_0000850
3394 Ga0500559_0001859
3395 Ga0500559_0067160
3396 Ga0500559_0102365
3397 Ga0500559_0228383
3398 Ga0500568_0000978
3399 Ga0500568_0014177
3400 Ga0500568_0014813
3401 Ga0500568_0023458
3402 Ga0500568_0110948
3403 Ga0500568_0162847
3404 Ga0500588_0059060
3405 Ga0500588_0060830
3406 Ga0500588_0128155
3407 Ga0500603_000125
3408 Ga0500603_016027
3409 Ga0500603_021405
3410 Ga0500603_049058
3411 Ga0500604_0004650
3412 Ga0500604_0035375
3413 Ga0500604_0048977
3414 Ga0500616_0000252
3415 Ga0500616_0000696
3416 Ga0500616_0015478
3417 Ga0500616_0055865
3418 Ga0500620_001207
3419 Ga0500622_0002597
3420 Ga0500622_0003061
3421 Ga0500622_0088897
3422 Ga0500627_0219046
3423 Ga0500627_0279057
3424 Ga0500630_029525
3425 Ga0500634_0007858
3426 Ga0500634_0119245
3427 Ga0500638_001134
3428 Ga0500638_032065
3429 Ga0500638_045989
3430 Ga0500638_104409
3431 Ga0500639_000016
3432 Ga0500639_043671
3433 Ga0500639_197036
3434 Ga0500636_0000066
3435 Ga0500636_0000534
3436 Ga0500636_0006053
3437 Ga0500636_0046789
3438 Ga0500637_0001307
3439 Ga0500637_0095998
3440 Ga0500576_039982
3441 Ga0500625_000123
3442 Ga0500645_015900
3443 Ga0500645_051528
3444 Ga0500599_009161
3445 Ga0500601_000139
3446 Ga0500601_002260
3447 Ga0501084_0005685
3448 Ga0501084_0020558
3449 Ga0501084_0220459
3450 Ga0501082_0000799
3451 Ga0501082_0028947
3452 Ga0501082_0797946
3453 2513657908
3454 2513855604
3455 2513890243
3456 2513919999
3457 2515627145
3458 2517892149
3459 2524465746
3460 2524534250
3461 2528853891
3462 2603859677
3463 2644288849
3464 2793062744
3465 2793082406
3466 2805915107
3467 2824604119
3468 2824610388
3469 2824659417
3470 2824668831
3471 2824703873
3472 2824733312
3473 2842040035
3474 2842047020
3475 2847946795
3476 2857528924
3477 2874598281
3478 2874627570
3479 2874652663
3480 2876778241
3481 2876825890
3482 2879082035
3483 2879104879
3484 2879135157
3485 2879145484
3486 2885382753
3487 2885386791
3488 2888424763
3489 2893070381
3490 2903771796
3491 2904673110
3492 2904702293
3493 2906617277
3494 2906643332
3495 2906662538
3496 2908742432
3497 2919076324
3498 2919454503
3499 2922374675
3500 2922430550
3501 2929621765
3502 2929629928
3503 2932788617
3504 2932817200
3505 2932825211
3506 2932830265
3507 2933583959
3508 2935622509
3509 2935642114
3510 2935672502
3511 2935676033
3512 2935686025
3513 2935697731
3514 2935705865
3515 2935714577
3516 2935725196
3517 2935732444
3518 2935741823
3519 2935751990
3520 2935765247
3521 2935802862
3522 2935813306
3523 2935830281
3524 2935838178
3525 2935860758
3526 2935872269
3527 2935878676
3528 2935978639
3529 2935994928
3530 2936003571
3531 2936042255
3532 2940557207
3533 2941539155
3534 3005510550
3535 3005715132
3536 8006940422
3537 8006980110
3538 8016522043
3539 8017063625
3540 8019556304
3541 8019569011
3542 8019582951
3543 8019590750
3544 8019600603
3545 8019617943
3546 8019628436
3547 8019645530
3548 8019671598
3549 8019684503
3550 8055746069
3551 8056687374
3552 8056691283

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01728

FtsJ

FtsJ-like methyltransferase

93

271

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7o9m-assembly1.cif.gz_n human mitochondrial ribosome large subunit assembly intermediate with mterf4-nsun4, mrm2, mtg1 and the malsu module 0.9571 17 223
7o9k-assembly1.cif.gz_n human mitochondrial ribosome large subunit assembly intermediate with mterf4-nsun4, mrm2, mtg1, the malsu module, gtpbp5 and mtef-tu 0.9528 44 223
8ia0-assembly1.cif.gz_CS cryo-em structure of a chaetomium thermophilum pre-60s ribosomal subunit - state puf6 0.9274 33 226
8i9v-assembly1.cif.gz_CS cryo-em structure of a chaetomium thermophilum pre-60s ribosomal subunit - state dbp10-2 0.9261 33 226
1ej0-assembly1.cif.gz_A ftsj rna methyltransferase complexed with s-adenosylmethionine, mercury derivative 0.9235 45 223
ID Description Score Start End Superfamily
af_P78860_27_218_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9389 44 223 3.40.50.150
af_Q58771_22_215_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9382 44 226 3.40.50.150
af_Q9VDT6_58_249_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9376 44 226 3.40.50.150
af_Q4CQP4_20_264_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9286 44 222 3.40.50.150
af_O62251_31_214_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9268 44 223 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A3S5IZV3-F1-model_v4 Ribosomal RNA large subunit methyltransferase E (EC 2.1.1.166) (23S rRNA Um2552 methyltransferase) (rRNA (uridine-2'-O-)-methyltransferase) 0.9755 48 223 GO:0008650
AF-A0A1B3NIC8-F1-model_v4 Ribosomal RNA large subunit methyltransferase E (EC 2.1.1.166) (23S rRNA Um2552 methyltransferase) (rRNA (uridine-2'-O-)-methyltransferase) 0.9732 9 226 GO:0005737
GO:0008650
AF-A0A0K6HEM9-F1-model_v4 deleted 0.9731 8 226
AF-E0THU5-F1-model_v4 Ribosomal RNA large subunit methyltransferase E (EC 2.1.1.166) (23S rRNA Um2552 methyltransferase) (rRNA (uridine-2'-O-)-methyltransferase) 0.9726 9 225 GO:0005737
GO:0008650
AF-Q0AQH3-F1-model_v4 Ribosomal RNA large subunit methyltransferase E (EC 2.1.1.166) (23S rRNA Um2552 methyltransferase) (rRNA (uridine-2'-O-)-methyltransferase) 0.9724 9 223 GO:0005737
GO:0008650

Map