F495665
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1777 | 656 | 3554 | 155 |
Family's Representative Sequence
| Representative Sequence | 3300009147|Ga0114129_10052779|Ga0114129_100527793 |
| Length | 177 |
| Sequence | LRICRAENEAGGLFHQPGEEEMPRSPIFGQREVSPDPRYHDKLVGKFINVLMSGGKKSIAEGVCYRAFDVIQQKTGNDPLKVFRSAIDNVKPLVEVKSRRVGGASYQVPVEIRPVRRTSLALRWIAEYSKARGGKSMPEKLAGELLDAANNTGASVKKREDTHRMAEANKAFAHYRW |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300003163 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 4 | 3300003574 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 5 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 6 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 7 | 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 8 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 9 | 3300003735 | Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 10 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 11 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 12 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 13 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 14 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 23 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 27 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 40 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 57 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 58 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 64 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 67 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 69 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 74 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 76 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 77 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 78 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 80 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 81 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 82 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 83 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 84 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 85 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 86 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 87 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 88 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 89 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 90 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 91 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 92 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 93 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 94 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 96 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 97 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 98 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 99 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 100 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 101 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 102 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 103 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 104 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 105 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 107 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 108 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 109 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 110 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 111 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 112 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 113 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 114 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 115 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 116 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 118 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 119 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 120 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009987 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG | Metagenome | Rhizosphere |
| 132 | 3300009993 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG | Metagenome | Rhizosphere |
| 133 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300012503 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R | Metagenome | Rhizosphere |
| 135 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 147 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 152 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 153 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 154 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 155 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 156 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 157 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 158 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 159 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 160 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 161 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 162 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 163 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 169 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 170 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 171 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 172 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 173 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 174 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 239 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 250 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 252 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 256 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 257 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 258 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 259 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 260 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 261 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 262 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 263 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 264 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 265 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 266 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 267 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 268 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 269 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 270 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 271 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 272 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 273 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 274 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 275 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 276 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 277 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 278 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 279 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 280 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 281 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 282 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 283 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 284 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 285 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 286 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 287 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 288 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 289 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 290 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 291 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 292 | 3300033527 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 293 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 294 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 295 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 296 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 297 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 298 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 299 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 300 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 301 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 302 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 303 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 304 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 305 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 306 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 307 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 308 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 309 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 310 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 311 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 312 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 313 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 314 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 315 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 316 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 317 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 318 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 319 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 320 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 321 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 322 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 323 | 3300038725 | Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 | Metagenome | Unclassified |
| 324 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 325 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 326 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 327 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 328 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 329 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 330 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 331 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 332 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 333 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 334 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 335 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 336 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 337 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 338 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 339 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 340 | 3300041461 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT | Metatranscriptome | Rhizoplane |
| 341 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 342 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 343 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 344 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 345 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 346 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 347 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 348 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 349 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 350 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 351 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 352 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 353 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 354 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 355 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 356 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 357 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 358 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 359 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 360 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 361 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 362 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 363 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 364 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 365 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 366 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 367 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 368 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 369 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 370 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 371 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 372 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 373 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 427 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 428 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 429 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 430 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 431 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 432 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 433 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 434 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 435 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 436 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 437 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 438 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 439 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 440 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 441 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 442 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 443 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 444 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 445 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 446 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 447 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 448 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 449 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 450 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 451 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 452 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 453 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 454 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 455 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 456 | 3300049131 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 457 | 3300049132 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 458 | 3300049133 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 459 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 460 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 461 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 462 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 464 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 465 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 466 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 467 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 468 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 469 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 470 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 471 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 472 | 3300049535 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 473 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 474 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 475 | 3300049538 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 476 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 477 | 3300049547 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 478 | 3300049548 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 479 | 3300049550 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 480 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 481 | 3300049553 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 482 | 3300049554 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 483 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 484 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 485 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 486 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 487 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 488 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 489 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 490 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 491 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 492 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 493 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 494 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 495 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 496 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 497 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 498 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 499 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 500 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 501 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 502 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 503 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 504 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 505 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 506 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 507 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 508 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 509 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 510 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 511 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 512 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 513 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 514 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 515 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 516 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 517 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 518 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 519 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 520 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 521 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 522 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 523 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 524 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 525 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 526 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 527 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 528 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 529 | 3300049768 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought | Metagenome | Rhizosphere |
| 530 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 531 | 3300049771 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control | Metagenome | Rhizosphere |
| 532 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 533 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 534 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 535 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 536 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 537 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 538 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 539 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 540 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 541 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 542 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 543 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 544 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 545 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 546 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 547 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 548 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 549 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 550 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 551 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 552 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 553 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 554 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 555 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 556 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 557 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 558 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 559 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 560 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 561 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 562 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 563 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 564 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 565 | 3300053100 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere | Metagenome | Endosphere |
| 566 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 567 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 568 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 569 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 570 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 571 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 572 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 573 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 574 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 575 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 576 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 577 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 578 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 579 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 580 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 581 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 582 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 583 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 584 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 585 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 586 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 587 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 588 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 589 | 3300059478 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 590 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 591 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 592 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 593 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 594 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 595 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 596 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 597 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 598 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 599 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 600 | 2547132424 | Nocardia nova SH22a | Isolate | Unclassified |
| 601 | 2548877040 | Paenibacillus sonchi X19-5 | Isolate | Rhizosphere |
| 602 | 2551306166 | Nocardia tenerifensis NBRC 101015 | Isolate | Rhizosphere |
| 603 | 2563366752 | Paenibacillus pini JCM 16418 | Isolate | Rhizosphere |
| 604 | 2571042143 | Paenibacillus graminis RSA19 | Isolate | Unclassified |
| 605 | 2571042588 | Paenibacillus zanthoxyli JH29 | Isolate | Unclassified |
| 606 | 2576861424 | Paenibacillus sabinae T27 | Isolate | Rhizosphere |
| 607 | 2579778775 | Paenibacillus durus P3L-5 | Isolate | Unclassified |
| 608 | 2600255286 | Paenibacillus sp. NFR01 | Isolate | Rhizoplane |
| 609 | 2619619294 | Paenibacillus durus ATCC 35681 | Isolate | Unclassified |
| 610 | 2643221543 | Paenibacillus sp. Root52 | Isolate | Unclassified |
| 611 | 2687453129 | Halotalea alkalilenta IHB B 13600 | Isolate | Unclassified |
| 612 | 2721755693 | Paenibacillus polymyxa YC0573 | Isolate | Rhizosphere |
| 613 | 2728368933 | Paenibacillus jilunlii DSM 23019 | Isolate | Rhizosphere |
| 614 | 2728369359 | Paenibacillus polymyxa YC0136 | Isolate | Rhizosphere |
| 615 | 2744054611 | Aldersonia kunmingensis DSM 45001 | Isolate | Rhizosphere |
| 616 | 2751185905 | Paenibacillus kribbensis 6hRe76 | Isolate | Unclassified |
| 617 | 2802428803 | Paenibacillus peoriae NMA1017 | Isolate | Rhizosphere |
| 618 | 2816332119 | Kribbella amoyensis DSM 24683 | Isolate | Rhizosphere |
| 619 | 2821111986 | Paenibacillus illinoisensis 582 | Isolate | Unclassified |
| 620 | 2831905167 | Ammoniphilus oxalaticus RAOx-1 | Isolate | Rhizosphere |
| 621 | 2836160341 | Unclassified Planctomycetes Bin 134 | Isolate | Unclassified |
| 622 | 2858438669 | Leuconostoc mesenteroides YL48 | Isolate | Unclassified |
| 623 | 2864733723 | Paenibacillus sp. JGP012 | Isolate | Rhizosphere |
| 624 | 2881633906 | Lactiplantibacillus garii FI11369 | Isolate | Unclassified |
| 625 | 2881636855 | Paenibacillus sp. 7197 | Isolate | Rhizosphere |
| 626 | 2885526491 | Paenibacillus sp. LK1 | Isolate | Rhizosphere |
| 627 | 2889042446 | Paenibacillus sp. 37 | Isolate | Rhizosphere |
| 628 | 2889276214 | Paenibacillus sp. PvR133 | Isolate | Rhizosphere |
| 629 | 2902799365 | Mycolicibacterium sp. P1-5 | Isolate | Unclassified |
| 630 | 2904162308 | Paenibacillus sp. AD87 | Isolate | Unclassified |
| 631 | 2904490793 | Paenibacillus sp. 1295 | Isolate | Rhizosphere |
| 632 | 2904595352 | Paenibacillus sp. 1182 | Isolate | Unclassified |
| 633 | 2907202186 | Paenibacillus sp. HJL G12 | Isolate | Unclassified |
| 634 | 2919160200 | Paenibacillus sp. 2003 | Isolate | Unclassified |
| 635 | 2919713450 | Nocardia kruczakiae 4272 | Isolate | Rhizosphere |
| 636 | 2928519762 | Leuconostoc citreum 1377 | Isolate | Rhizosphere |
| 637 | 2931384279 | Paenibacillus sp. DR312 | Isolate | Rhizosphere |
| 638 | 2938649242 | Paenibacillus helianthi P26E | Isolate | Rhizosphere |
| 639 | 2939582691 | Mycolicibacterium sp. 624 | Isolate | Rhizosphere |
| 640 | 2939679117 | Paenibacillus sp. 4624 | Isolate | Rhizosphere |
| 641 | 2939702853 | Paenibacillus sp. PvR008 | Isolate | Rhizosphere |
| 642 | 2945991243 | Paenibacillus sp. B21a W2I17 | Isolate | Rhizosphere |
| 643 | 2946053406 | Paenibacillus sp. W4I10 | Isolate | Rhizosphere |
| 644 | 2968558590 | Paenibacillus sp. P3E | Isolate | Rhizosphere |
| 645 | 2971403814 | Paenibacillus tritici LMG 29502 | Isolate | Unclassified |
| 646 | 2971511577 | Paenibacillus apii 7124 | Isolate | Rhizosphere |
| 647 | 2980176882 | Paenibacillus apii 7028 | Isolate | Rhizosphere |
| 648 | 2984527788 | Paenibacillus sp. SORGH_AS306 | Isolate | Aerial Root |
| 649 | 2984532647 | Paenibacillus sp. SORGH_AS338 | Isolate | Aerial Root |
| 650 | 2988225383 | Paenibacillus sp. P46E | Isolate | Rhizosphere |
| 651 | 2996632988 | Paenibacillus sp. P32E | Isolate | Rhizosphere |
| 652 | 2996706504 | Paenibacillus sp. OT2-17 | Isolate | Rhizosphere |
| 653 | 648028048 | Paenibacillus polymyxa E681 | Isolate | Rhizosphere |
| 654 | 8007371054 | Clostridium sp. YIM B02515 | Isolate | Unclassified |
| 655 | 8054465665 | Paenibacillus sonchi IIRRBNF1 | Isolate | Rhizosphere |
| 656 | 8057977335 | Paenibacillus oenotherae DT7-4 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 88.46 |
| Metatranscriptomes | 8.33 |
| Isolates | 3.21 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.11 |
| Bulb | 0 |
| Endosphere | 6.08 |
| Nodule | 0.17 |
| Rhizoplane | 2.7 |
| Rhizosphere | 84.52 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.17 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0114129_10052779 | 3300009147 | Bacteria | 5705 |
| 2 | JGI24740J21852_10062791 | 3300001979 | Bacteria | 1018 |
| 3 | Ga0006759J45824_1056753 | 3300003163 | Bacteria | 819 |
| 4 | Ga0007410J51695_1045473 | 3300003574 | Bacteria | 4266 |
| 5 | Ga0007409J51694_1024387 | 3300003575 | Bacteria | 4829 |
| 6 | Ga0007409J51694_1044244 | 3300003575 | Bacteria | 1192 |
| 7 | Ga0007409J51694_1053788 | 3300003575 | Bacteria | 1033 |
| 8 | Ga0006562J51391_1000361 | 3300003578 | Bacteria | 31803 |
| 9 | Ga0007429J51699_1048322 | 3300003579 | Bacteria | 2474 |
| 10 | Ga0032354_1045657 | 3300003693 | Bacteria | 1119 |
| 11 | Ga0006780_1027699 | 3300003735 | Bacteria | 649 |
| 12 | Ga0055538_1000286 | 3300003751 | Bacteria | 25743 |
| 13 | Ga0055534_1039117 | 3300003784 | Bacteria | 704 |
| 14 | Ga0055531_10000796 | 3300003794 | Bacteria | 26168 |
| 15 | Ga0065712_10205784 | 3300005290 | Bacteria | 1091 |
| 16 | Ga0065712_10433300 | 3300005290 | Bacteria | 701 |
| 17 | Ga0065715_10187396 | 3300005293 | Bacteria | 1436 |
| 18 | Ga0065715_10788439 | 3300005293 | Bacteria | 615 |
| 19 | Ga0065707_10221170 | 3300005295 | Bacteria | 1224 |
| 20 | Ga0065707_10401296 | 3300005295 | Bacteria | 852 |
| 21 | Ga0065707_10797972 | 3300005295 | Bacteria | 600 |
| 22 | Ga0070658_10011068 | 3300005327 | Bacteria | 7231 |
| 23 | Ga0070676_10024501 | 3300005328 | Bacteria | 3400 |
| 24 | Ga0070676_10031540 | 3300005328 | Bacteria | 3029 |
| 25 | Ga0070683_100070071 | 3300005329 | Bacteria | 3271 |
| 26 | Ga0070683_100362380 | 3300005329 | Bacteria | 1381 |
| 27 | Ga0070690_100496054 | 3300005330 | Bacteria | 913 |
| 28 | Ga0070670_100002056 | 3300005331 | Bacteria | 16473 |
| 29 | Ga0070670_100002307 | 3300005331 | Bacteria | 15724 |
| 30 | Ga0070670_100122163 | 3300005331 | Bacteria | 2246 |
| 31 | Ga0070670_100743315 | 3300005331 | Bacteria | 884 |
| 32 | Ga0070670_100779258 | 3300005331 | Bacteria | 863 |
| 33 | Ga0070670_101189417 | 3300005331 | Bacteria | 696 |
| 34 | Ga0070677_10274493 | 3300005333 | Bacteria | 847 |
| 35 | Ga0068869_100031842 | 3300005334 | Bacteria | 3712 |
| 36 | Ga0068869_100308649 | 3300005334 | Bacteria | 1280 |
| 37 | Ga0070666_10007485 | 3300005335 | Bacteria | 6730 |
| 38 | Ga0070666_10011570 | 3300005335 | Bacteria | 5543 |
| 39 | Ga0070666_10068020 | 3300005335 | Bacteria | 2419 |
| 40 | Ga0070680_100003723 | 3300005336 | Bacteria | 11390 |
| 41 | Ga0070680_100195764 | 3300005336 | Bacteria | 1704 |
| 42 | Ga0070680_100295731 | 3300005336 | Bacteria | 1373 |
| 43 | Ga0070680_100454173 | 3300005336 | Bacteria | 1094 |
| 44 | Ga0070682_100323179 | 3300005337 | Bacteria | 1140 |
| 45 | Ga0070682_100632636 | 3300005337 | Bacteria | 849 |
| 46 | Ga0068868_100013048 | 3300005338 | Bacteria | 6083 |
| 47 | Ga0068868_100015066 | 3300005338 | Bacteria | 5710 |
| 48 | Ga0070660_100062353 | 3300005339 | Bacteria | 2896 |
| 49 | Ga0070660_100112711 | 3300005339 | Bacteria | 2165 |
| 50 | Ga0070660_100451428 | 3300005339 | Bacteria | 1066 |
| 51 | Ga0070660_100999793 | 3300005339 | Bacteria | 707 |
| 52 | Ga0070689_100051783 | 3300005340 | Bacteria | 3174 |
| 53 | Ga0070691_10001573 | 3300005341 | Bacteria | 9854 |
| 54 | Ga0070691_10041261 | 3300005341 | Bacteria | 2181 |
| 55 | Ga0070691_10332720 | 3300005341 | Bacteria | 839 |
| 56 | Ga0070687_100267135 | 3300005343 | Bacteria | 1071 |
| 57 | Ga0070661_100059480 | 3300005344 | Bacteria | 2802 |
| 58 | Ga0070661_100169676 | 3300005344 | Bacteria | 1656 |
| 59 | Ga0070661_100524424 | 3300005344 | Bacteria | 950 |
| 60 | Ga0070692_11085699 | 3300005345 | Bacteria | 564 |
| 61 | Ga0070668_100010252 | 3300005347 | Bacteria | 6954 |
| 62 | Ga0070668_100038252 | 3300005347 | Bacteria | 3666 |
| 63 | Ga0070668_100106275 | 3300005347 | Bacteria | 2230 |
| 64 | Ga0070668_100620390 | 3300005347 | Bacteria | 948 |
| 65 | Ga0070668_100638545 | 3300005347 | Bacteria | 934 |
| 66 | Ga0070669_100002726 | 3300005353 | Bacteria | 12745 |
| 67 | Ga0070669_100005517 | 3300005353 | Bacteria | 9132 |
| 68 | Ga0070669_100007539 | 3300005353 | Bacteria | 7792 |
| 69 | Ga0070669_100068379 | 3300005353 | Bacteria | 2622 |
| 70 | Ga0070669_100098147 | 3300005353 | Bacteria | 2206 |
| 71 | Ga0070669_100425785 | 3300005353 | Bacteria | 1090 |
| 72 | Ga0070669_100795325 | 3300005353 | Bacteria | 804 |
| 73 | Ga0070675_100001855 | 3300005354 | Bacteria | 15584 |
| 74 | Ga0070675_100050526 | 3300005354 | Bacteria | 3414 |
| 75 | Ga0070675_100589636 | 3300005354 | Bacteria | 1007 |
| 76 | Ga0070675_100690899 | 3300005354 | Bacteria | 929 |
| 77 | Ga0070671_100002650 | 3300005355 | Bacteria | 13853 |
| 78 | Ga0070671_100079732 | 3300005355 | Bacteria | 2737 |
| 79 | Ga0070671_100108997 | 3300005355 | Bacteria | 2325 |
| 80 | Ga0070674_100026730 | 3300005356 | Bacteria | 3773 |
| 81 | Ga0070674_100983210 | 3300005356 | Bacteria | 740 |
| 82 | Ga0070673_100078071 | 3300005364 | Bacteria | 2677 |
| 83 | Ga0070673_100155510 | 3300005364 | Bacteria | 1940 |
| 84 | Ga0070673_100213006 | 3300005364 | Bacteria | 1669 |
| 85 | Ga0070688_100019751 | 3300005365 | Bacteria | 3907 |
| 86 | Ga0070688_100099621 | 3300005365 | Bacteria | 1914 |
| 87 | Ga0070688_100261347 | 3300005365 | Bacteria | 1236 |
| 88 | Ga0070688_101595404 | 3300005365 | Bacteria | 533 |
| 89 | Ga0070659_100036885 | 3300005366 | Bacteria | 3811 |
| 90 | Ga0070659_100109173 | 3300005366 | Bacteria | 2233 |
| 91 | Ga0070659_100509516 | 3300005366 | Bacteria | 1026 |
| 92 | Ga0070659_101167546 | 3300005366 | Bacteria | 680 |
| 93 | Ga0070667_100000182 | 3300005367 | Bacteria | 75588 |
| 94 | Ga0070667_100002380 | 3300005367 | Bacteria | 16473 |
| 95 | Ga0070667_100418432 | 3300005367 | Bacteria | 1221 |
| 96 | Ga0070667_100815303 | 3300005367 | Bacteria | 867 |
| 97 | Ga0070703_10001173 | 3300005406 | Bacteria | 8060 |
| 98 | Ga0070703_10326511 | 3300005406 | Bacteria | 647 |
| 99 | Ga0070709_10024990 | 3300005434 | Bacteria | 3524 |
| 100 | Ga0070714_100129571 | 3300005435 | Bacteria | 2253 |
| 101 | Ga0070714_100226624 | 3300005435 | Bacteria | 1720 |
| 102 | Ga0070714_100269172 | 3300005435 | Bacteria | 1579 |
| 103 | Ga0070713_100747594 | 3300005436 | Bacteria | 935 |
| 104 | Ga0070713_100800516 | 3300005436 | Bacteria | 903 |
| 105 | Ga0070713_100980339 | 3300005436 | Bacteria | 815 |
| 106 | Ga0070710_10084937 | 3300005437 | Bacteria | 1856 |
| 107 | Ga0070710_10944094 | 3300005437 | Bacteria | 625 |
| 108 | Ga0070701_10018588 | 3300005438 | Bacteria | 3269 |
| 109 | Ga0070701_10035019 | 3300005438 | Bacteria | 2520 |
| 110 | Ga0070711_100070775 | 3300005439 | Bacteria | 2457 |
| 111 | Ga0070711_100956753 | 3300005439 | Bacteria | 733 |
| 112 | Ga0070705_100416041 | 3300005440 | Bacteria | 999 |
| 113 | Ga0070705_100650429 | 3300005440 | Bacteria | 822 |
| 114 | Ga0070705_100718649 | 3300005440 | Bacteria | 786 |
| 115 | Ga0070705_100853656 | 3300005440 | Bacteria | 729 |
| 116 | Ga0070700_100093217 | 3300005441 | Bacteria | 1970 |
| 117 | Ga0070700_100470498 | 3300005441 | Bacteria | 961 |
| 118 | Ga0070694_100202448 | 3300005444 | Bacteria | 1480 |
| 119 | Ga0070694_100650595 | 3300005444 | Bacteria | 853 |
| 120 | Ga0070694_100756494 | 3300005444 | Bacteria | 794 |
| 121 | Ga0070708_100074062 | 3300005445 | Bacteria | 3070 |
| 122 | Ga0070708_100085147 | 3300005445 | Bacteria | 2869 |
| 123 | Ga0070708_100135308 | 3300005445 | Bacteria | 2282 |
| 124 | Ga0070708_100322218 | 3300005445 | Bacteria | 1456 |
| 125 | Ga0070708_100459989 | 3300005445 | Bacteria | 1200 |
| 126 | Ga0070708_100566970 | 3300005445 | Bacteria | 1071 |
| 127 | Ga0070708_100647681 | 3300005445 | Bacteria | 996 |
| 128 | Ga0070708_100833710 | 3300005445 | Bacteria | 866 |
| 129 | Ga0070663_100108856 | 3300005455 | Bacteria | 2079 |
| 130 | Ga0070678_100000927 | 3300005456 | Bacteria | 15059 |
| 131 | Ga0070678_100014242 | 3300005456 | Bacteria | 5010 |
| 132 | Ga0070662_100035689 | 3300005457 | Bacteria | 3513 |
| 133 | Ga0070662_100194092 | 3300005457 | Bacteria | 1608 |
| 134 | Ga0070662_100821884 | 3300005457 | Bacteria | 790 |
| 135 | Ga0070681_10064027 | 3300005458 | Bacteria | 3649 |
| 136 | Ga0070681_10074973 | 3300005458 | Bacteria | 3343 |
| 137 | Ga0070681_10140829 | 3300005458 | Bacteria | 2342 |
| 138 | Ga0070681_10160548 | 3300005458 | Bacteria | 2172 |
| 139 | Ga0070681_10302540 | 3300005458 | Bacteria | 1509 |
| 140 | Ga0070681_11366447 | 3300005458 | Bacteria | 632 |
| 141 | Ga0068867_100018242 | 3300005459 | Bacteria | 4986 |
| 142 | Ga0068867_100615540 | 3300005459 | Bacteria | 949 |
| 143 | Ga0068867_101048138 | 3300005459 | Bacteria | 742 |
| 144 | Ga0070685_10000930 | 3300005466 | Bacteria | 15763 |
| 145 | Ga0070685_10004383 | 3300005466 | Bacteria | 7127 |
| 146 | Ga0070685_10447033 | 3300005466 | Bacteria | 905 |
| 147 | Ga0070685_10858622 | 3300005466 | Bacteria | 673 |
| 148 | Ga0070706_100004748 | 3300005467 | Bacteria | 13027 |
| 149 | Ga0070706_100010395 | 3300005467 | Bacteria | 8642 |
| 150 | Ga0070706_100195565 | 3300005467 | Bacteria | 1889 |
| 151 | Ga0070706_100295987 | 3300005467 | Bacteria | 1510 |
| 152 | Ga0070706_100377769 | 3300005467 | Bacteria | 1320 |
| 153 | Ga0070706_100695757 | 3300005467 | Bacteria | 943 |
| 154 | Ga0070706_101081020 | 3300005467 | Bacteria | 739 |
| 155 | Ga0070706_101233574 | 3300005467 | Bacteria | 687 |
| 156 | Ga0070706_101293644 | 3300005467 | Bacteria | 669 |
| 157 | Ga0070707_100010518 | 3300005468 | Bacteria | 8621 |
| 158 | Ga0070707_100105435 | 3300005468 | Bacteria | 2733 |
| 159 | Ga0070707_100142800 | 3300005468 | Bacteria | 2330 |
| 160 | Ga0070707_100323337 | 3300005468 | Bacteria | 1499 |
| 161 | Ga0070707_100432910 | 3300005468 | Bacteria | 1276 |
| 162 | Ga0070707_100435994 | 3300005468 | Bacteria | 1271 |
| 163 | Ga0070707_100781246 | 3300005468 | Bacteria | 919 |
| 164 | Ga0070698_100006097 | 3300005471 | Bacteria | 13130 |
| 165 | Ga0070698_100008328 | 3300005471 | Bacteria | 11206 |
| 166 | Ga0070698_100166789 | 3300005471 | Bacteria | 2145 |
| 167 | Ga0070698_100317497 | 3300005471 | Bacteria | 1488 |
| 168 | Ga0070698_100334147 | 3300005471 | Bacteria | 1446 |
| 169 | Ga0070698_100575861 | 3300005471 | Bacteria | 1066 |
| 170 | Ga0070699_100105922 | 3300005518 | Bacteria | 2466 |
| 171 | Ga0070699_100207864 | 3300005518 | Bacteria | 1742 |
| 172 | Ga0070699_100413333 | 3300005518 | Bacteria | 1221 |
| 173 | Ga0070699_100666870 | 3300005518 | Bacteria | 950 |
| 174 | Ga0070699_100692849 | 3300005518 | Bacteria | 931 |
| 175 | Ga0070679_100164291 | 3300005530 | Bacteria | 2194 |
| 176 | Ga0070679_100344877 | 3300005530 | Bacteria | 1437 |
| 177 | Ga0070679_100380252 | 3300005530 | Bacteria | 1359 |
| 178 | Ga0070679_101498256 | 3300005530 | Unclassified | 621 |
| 179 | Ga0070684_100632503 | 3300005535 | Bacteria | 996 |
| 180 | Ga0070697_100034402 | 3300005536 | Bacteria | 4085 |
| 181 | Ga0070697_100054813 | 3300005536 | Bacteria | 3241 |
| 182 | Ga0070697_100152055 | 3300005536 | Bacteria | 1951 |
| 183 | Ga0070697_100384757 | 3300005536 | Bacteria | 1215 |
| 184 | Ga0070697_100856785 | 3300005536 | Bacteria | 805 |
| 185 | Ga0068853_100297257 | 3300005539 | Bacteria | 1492 |
| 186 | Ga0070672_100000814 | 3300005543 | Bacteria | 18629 |
| 187 | Ga0070672_100051306 | 3300005543 | Bacteria | 3216 |
| 188 | Ga0070672_100121632 | 3300005543 | Bacteria | 2137 |
| 189 | Ga0070686_100948786 | 3300005544 | Bacteria | 703 |
| 190 | Ga0070695_100310790 | 3300005545 | Bacteria | 1168 |
| 191 | Ga0070695_100389550 | 3300005545 | Bacteria | 1054 |
| 192 | Ga0070695_100475360 | 3300005545 | Bacteria | 962 |
| 193 | Ga0070695_100940369 | 3300005545 | Bacteria | 700 |
| 194 | Ga0070696_100000402 | 3300005546 | Bacteria | 26803 |
| 195 | Ga0070696_100048070 | 3300005546 | Bacteria | 2961 |
| 196 | Ga0070696_100193086 | 3300005546 | Bacteria | 1516 |
| 197 | Ga0070696_100217708 | 3300005546 | Bacteria | 1432 |
| 198 | Ga0070665_100021718 | 3300005548 | Bacteria | 6454 |
| 199 | Ga0070665_100044489 | 3300005548 | Bacteria | 4458 |
| 200 | Ga0070665_100078166 | 3300005548 | Bacteria | 3315 |
| 201 | Ga0070665_100198917 | 3300005548 | Bacteria | 2004 |
| 202 | Ga0070665_100279518 | 3300005548 | Bacteria | 1671 |
| 203 | Ga0070665_100759495 | 3300005548 | Bacteria | 983 |
| 204 | Ga0070704_100077393 | 3300005549 | Bacteria | 2436 |
| 205 | Ga0070704_100211849 | 3300005549 | Bacteria | 1570 |
| 206 | Ga0070704_100449554 | 3300005549 | Bacteria | 1109 |
| 207 | Ga0068855_100113615 | 3300005563 | Bacteria | 3106 |
| 208 | Ga0068855_100825082 | 3300005563 | Bacteria | 984 |
| 209 | Ga0068855_101013049 | 3300005563 | Bacteria | 872 |
| 210 | Ga0070664_100001142 | 3300005564 | Bacteria | 21014 |
| 211 | Ga0070664_100035211 | 3300005564 | Bacteria | 4202 |
| 212 | Ga0070664_100437670 | 3300005564 | Bacteria | 1199 |
| 213 | Ga0068857_100050906 | 3300005577 | Bacteria | 3674 |
| 214 | Ga0068857_100182193 | 3300005577 | Bacteria | 1911 |
| 215 | Ga0068857_100713020 | 3300005577 | Bacteria | 954 |
| 216 | Ga0068857_101352058 | 3300005577 | Bacteria | 692 |
| 217 | Ga0068854_100309562 | 3300005578 | Bacteria | 1280 |
| 218 | Ga0068854_100393055 | 3300005578 | Bacteria | 1145 |
| 219 | Ga0068854_102230401 | 3300005578 | Bacteria | 507 |
| 220 | Ga0068856_100056262 | 3300005614 | Bacteria | 3881 |
| 221 | Ga0068856_100178454 | 3300005614 | Bacteria | 2136 |
| 222 | Ga0068856_100446824 | 3300005614 | Bacteria | 1313 |
| 223 | Ga0070702_100526875 | 3300005615 | Bacteria | 872 |
| 224 | Ga0068852_100003070 | 3300005616 | Bacteria | 11621 |
| 225 | Ga0068852_100470368 | 3300005616 | Bacteria | 1247 |
| 226 | Ga0068852_102310890 | 3300005616 | Bacteria | 559 |
| 227 | Ga0068859_100001212 | 3300005617 | Bacteria | 26299 |
| 228 | Ga0068859_100154528 | 3300005617 | Bacteria | 2371 |
| 229 | Ga0068859_100191981 | 3300005617 | Bacteria | 2127 |
| 230 | Ga0068859_100479394 | 3300005617 | Bacteria | 1339 |
| 231 | Ga0068859_100577431 | 3300005617 | Bacteria | 1218 |
| 232 | Ga0068859_100715338 | 3300005617 | Bacteria | 1092 |
| 233 | Ga0068859_102458176 | 3300005617 | Bacteria | 574 |
| 234 | Ga0068864_100001987 | 3300005618 | Bacteria | 16839 |
| 235 | Ga0068864_100038254 | 3300005618 | Bacteria | 4096 |
| 236 | Ga0068864_100381975 | 3300005618 | Bacteria | 1335 |
| 237 | Ga0068864_100623740 | 3300005618 | Bacteria | 1048 |
| 238 | Ga0068864_100996834 | 3300005618 | Bacteria | 831 |
| 239 | Ga0068866_10745053 | 3300005718 | Bacteria | 676 |
| 240 | Ga0068866_10782184 | 3300005718 | Bacteria | 662 |
| 241 | Ga0068861_100163348 | 3300005719 | Bacteria | 1839 |
| 242 | Ga0068861_100196098 | 3300005719 | Bacteria | 1692 |
| 243 | Ga0068861_100316050 | 3300005719 | Bacteria | 1359 |
| 244 | Ga0068861_100507038 | 3300005719 | Bacteria | 1092 |
| 245 | Ga0068861_101109228 | 3300005719 | Bacteria | 761 |
| 246 | Ga0068851_10041616 | 3300005834 | Bacteria | 2311 |
| 247 | Ga0068870_10011131 | 3300005840 | Bacteria | 4158 |
| 248 | Ga0068863_100167450 | 3300005841 | Bacteria | 2107 |
| 249 | Ga0068863_100283806 | 3300005841 | Bacteria | 1605 |
| 250 | Ga0068858_100000013 | 3300005842 | Bacteria | 216466 |
| 251 | Ga0068858_100019338 | 3300005842 | Bacteria | 6368 |
| 252 | Ga0068858_100028843 | 3300005842 | Bacteria | 5153 |
| 253 | Ga0068858_100212692 | 3300005842 | Bacteria | 1830 |
| 254 | Ga0068860_100000374 | 3300005843 | Bacteria | 58635 |
| 255 | Ga0068860_100011522 | 3300005843 | Bacteria | 8716 |
| 256 | Ga0068860_100021948 | 3300005843 | Bacteria | 6177 |
| 257 | Ga0068862_100000276 | 3300005844 | Bacteria | 57404 |
| 258 | Ga0068862_100003483 | 3300005844 | Bacteria | 13529 |
| 259 | Ga0068862_100005911 | 3300005844 | Bacteria | 10190 |
| 260 | Ga0068862_100045432 | 3300005844 | Bacteria | 3748 |
| 261 | Ga0068862_100091212 | 3300005844 | Bacteria | 2653 |
| 262 | Ga0068862_100733804 | 3300005844 | Bacteria | 959 |
| 263 | Ga0081455_10002585 | 3300005937 | Bacteria | 21454 |
| 264 | Ga0081455_10111457 | 3300005937 | Bacteria | 2174 |
| 265 | Ga0081455_10183819 | 3300005937 | Bacteria | 1580 |
| 266 | Ga0081538_10000250 | 3300005981 | Bacteria | 60946 |
| 267 | Ga0081538_10002047 | 3300005981 | Bacteria | 20127 |
| 268 | Ga0081538_10004242 | 3300005981 | Bacteria | 13295 |
| 269 | Ga0081538_10039894 | 3300005981 | Bacteria | 3003 |
| 270 | Ga0081538_10120647 | 3300005981 | Bacteria | 1261 |
| 271 | Ga0081540_1085069 | 3300005983 | Bacteria | 1410 |
| 272 | Ga0081539_10001506 | 3300005985 | Bacteria | 39339 |
| 273 | Ga0081539_10038405 | 3300005985 | Bacteria | 2838 |
| 274 | Ga0070717_10562072 | 3300006028 | Bacteria | 1033 |
| 275 | Ga0070717_11060191 | 3300006028 | Bacteria | 738 |
| 276 | Ga0075365_10036922 | 3300006038 | Bacteria | 3169 |
| 277 | Ga0075365_10180100 | 3300006038 | Bacteria | 1477 |
| 278 | Ga0075368_10139348 | 3300006042 | Bacteria | 1010 |
| 279 | Ga0075363_100242932 | 3300006048 | Bacteria | 1035 |
| 280 | Ga0075364_10008451 | 3300006051 | Bacteria | 6154 |
| 281 | Ga0075364_10089506 | 3300006051 | Bacteria | 2041 |
| 282 | Ga0075364_10130309 | 3300006051 | Bacteria | 1687 |
| 283 | Ga0075364_10138190 | 3300006051 | Bacteria | 1638 |
| 284 | Ga0075364_10931267 | 3300006051 | Bacteria | 591 |
| 285 | Ga0070716_100036854 | 3300006173 | Bacteria | 2699 |
| 286 | Ga0070716_100043350 | 3300006173 | Bacteria | 2515 |
| 287 | Ga0070716_100915053 | 3300006173 | Bacteria | 688 |
| 288 | Ga0070712_100652436 | 3300006175 | Bacteria | 894 |
| 289 | Ga0075362_10107326 | 3300006177 | Bacteria | 1311 |
| 290 | Ga0075362_10290799 | 3300006177 | Bacteria | 809 |
| 291 | Ga0075367_10048764 | 3300006178 | Bacteria | 2495 |
| 292 | Ga0075367_10304347 | 3300006178 | Bacteria | 1004 |
| 293 | Ga0075367_10551589 | 3300006178 | Bacteria | 732 |
| 294 | Ga0075369_10009439 | 3300006186 | Bacteria | 3790 |
| 295 | Ga0075366_10030187 | 3300006195 | Bacteria | 3186 |
| 296 | Ga0075366_10269193 | 3300006195 | Bacteria | 1040 |
| 297 | Ga0097621_100021807 | 3300006237 | Bacteria | 4963 |
| 298 | Ga0097621_100033421 | 3300006237 | Bacteria | 4096 |
| 299 | Ga0097621_101602749 | 3300006237 | Bacteria | 619 |
| 300 | Ga0075370_10291095 | 3300006353 | Bacteria | 970 |
| 301 | Ga0068871_100068667 | 3300006358 | Bacteria | 2910 |
| 302 | Ga0068871_100426541 | 3300006358 | Bacteria | 1185 |
| 303 | Ga0068871_100713525 | 3300006358 | Bacteria | 919 |
| 304 | Ga0075428_100003062 | 3300006844 | Bacteria | 18244 |
| 305 | Ga0075428_100004546 | 3300006844 | Bacteria | 15340 |
| 306 | Ga0075428_100033214 | 3300006844 | Bacteria | 5698 |
| 307 | Ga0075428_100126007 | 3300006844 | Bacteria | 2787 |
| 308 | Ga0075428_100317282 | 3300006844 | Bacteria | 1675 |
| 309 | Ga0075428_100343670 | 3300006844 | Bacteria | 1602 |
| 310 | Ga0075428_100986906 | 3300006844 | Bacteria | 892 |
| 311 | Ga0075430_100032747 | 3300006846 | Bacteria | 4411 |
| 312 | Ga0075430_100049244 | 3300006846 | Bacteria | 3556 |
| 313 | Ga0075430_100110180 | 3300006846 | Bacteria | 2296 |
| 314 | Ga0075430_100379192 | 3300006846 | Bacteria | 1167 |
| 315 | Ga0075430_100657733 | 3300006846 | Bacteria | 864 |
| 316 | Ga0075431_100026718 | 3300006847 | Bacteria | 5921 |
| 317 | Ga0075431_100033578 | 3300006847 | Bacteria | 5288 |
| 318 | Ga0075431_100165858 | 3300006847 | Bacteria | 2270 |
| 319 | Ga0075431_100355293 | 3300006847 | Bacteria | 1472 |
| 320 | Ga0075431_100447503 | 3300006847 | Bacteria | 1288 |
| 321 | Ga0075431_100451883 | 3300006847 | Bacteria | 1280 |
| 322 | Ga0075431_100645950 | 3300006847 | Bacteria | 1039 |
| 323 | Ga0075431_100901646 | 3300006847 | Bacteria | 854 |
| 324 | Ga0075433_10100351 | 3300006852 | Bacteria | 2563 |
| 325 | Ga0075433_10109925 | 3300006852 | Bacteria | 2445 |
| 326 | Ga0075433_10980210 | 3300006852 | Bacteria | 736 |
| 327 | Ga0075434_100211111 | 3300006871 | Bacteria | 1961 |
| 328 | Ga0075434_100388549 | 3300006871 | Bacteria | 1416 |
| 329 | Ga0075434_100540207 | 3300006871 | Bacteria | 1185 |
| 330 | Ga0075434_100669565 | 3300006871 | Bacteria | 1056 |
| 331 | Ga0075429_100195963 | 3300006880 | Bacteria | 1770 |
| 332 | Ga0075429_100196902 | 3300006880 | Bacteria | 1765 |
| 333 | Ga0075429_100604815 | 3300006880 | Bacteria | 961 |
| 334 | Ga0068865_100014036 | 3300006881 | Bacteria | 5083 |
| 335 | Ga0068865_100092886 | 3300006881 | Bacteria | 2193 |
| 336 | Ga0075436_100060685 | 3300006914 | Bacteria | 2612 |
| 337 | Ga0075436_100136803 | 3300006914 | Bacteria | 1720 |
| 338 | Ga0075436_100145833 | 3300006914 | Bacteria | 1664 |
| 339 | Ga0075436_100568409 | 3300006914 | Bacteria | 833 |
| 340 | Ga0097620_100001212 | 3300006931 | Bacteria | 26299 |
| 341 | Ga0097620_100154522 | 3300006931 | Bacteria | 2371 |
| 342 | Ga0097620_100191985 | 3300006931 | Bacteria | 2127 |
| 343 | Ga0097620_100479396 | 3300006931 | Bacteria | 1339 |
| 344 | Ga0097620_100577369 | 3300006931 | Bacteria | 1218 |
| 345 | Ga0097620_100715339 | 3300006931 | Bacteria | 1092 |
| 346 | Ga0097620_102457864 | 3300006931 | Bacteria | 574 |
| 347 | Ga0079104_1009762 | 3300006946 | Bacteria | 3223 |
| 348 | Ga0075435_100177205 | 3300007076 | Bacteria | 1800 |
| 349 | Ga0075435_100648233 | 3300007076 | Bacteria | 917 |
| 350 | Ga0099794_10000508 | 3300007265 | Bacteria | 13062 |
| 351 | Ga0099794_10327384 | 3300007265 | Bacteria | 795 |
| 352 | Ga0105251_10002306 | 3300009011 | Bacteria | 15129 |
| 353 | Ga0105240_10011091 | 3300009093 | Bacteria | 12601 |
| 354 | Ga0105240_10949345 | 3300009093 | Bacteria | 922 |
| 355 | Ga0105240_11054150 | 3300009093 | Bacteria | 867 |
| 356 | Ga0105240_11930560 | 3300009093 | Bacteria | 614 |
| 357 | Ga0111539_10002526 | 3300009094 | Bacteria | 24232 |
| 358 | Ga0111539_10006226 | 3300009094 | Bacteria | 15401 |
| 359 | Ga0111539_10033972 | 3300009094 | Bacteria | 6188 |
| 360 | Ga0111539_10045810 | 3300009094 | Bacteria | 5234 |
| 361 | Ga0111539_10119988 | 3300009094 | Bacteria | 3081 |
| 362 | Ga0111539_11327730 | 3300009094 | Bacteria | 835 |
| 363 | Ga0111539_12677412 | 3300009094 | Bacteria | 578 |
| 364 | Ga0105245_10228988 | 3300009098 | Bacteria | 1797 |
| 365 | Ga0105247_10000181 | 3300009101 | Bacteria | 61066 |
| 366 | Ga0105247_10030953 | 3300009101 | Bacteria | 3246 |
| 367 | Ga0105247_10329141 | 3300009101 | Bacteria | 1068 |
| 368 | Ga0114129_10252490 | 3300009147 | Bacteria | 2367 |
| 369 | Ga0114129_10525152 | 3300009147 | Bacteria | 1543 |
| 370 | Ga0114129_10534694 | 3300009147 | Bacteria | 1526 |
| 371 | Ga0114129_10557193 | 3300009147 | Bacteria | 1490 |
| 372 | Ga0114129_10642192 | 3300009147 | Bacteria | 1371 |
| 373 | Ga0114129_11211130 | 3300009147 | Bacteria | 940 |
| 374 | Ga0114129_11268287 | 3300009147 | Bacteria | 915 |
| 375 | Ga0105241_10110539 | 3300009174 | Bacteria | 2199 |
| 376 | Ga0105241_10843562 | 3300009174 | Bacteria | 847 |
| 377 | Ga0105242_10974134 | 3300009176 | Bacteria | 854 |
| 378 | Ga0105242_11038382 | 3300009176 | Bacteria | 830 |
| 379 | Ga0105242_11083070 | 3300009176 | Bacteria | 814 |
| 380 | Ga0105242_11108704 | 3300009176 | Bacteria | 806 |
| 381 | Ga0105248_10003161 | 3300009177 | Bacteria | 18236 |
| 382 | Ga0105248_10005609 | 3300009177 | Bacteria | 13788 |
| 383 | Ga0105248_10054570 | 3300009177 | Bacteria | 4482 |
| 384 | Ga0105248_10202547 | 3300009177 | Bacteria | 2236 |
| 385 | Ga0105248_11169156 | 3300009177 | Bacteria | 870 |
| 386 | Ga0105248_11675059 | 3300009177 | Bacteria | 721 |
| 387 | Ga0105237_10144547 | 3300009545 | Bacteria | 2373 |
| 388 | Ga0105237_10399263 | 3300009545 | Bacteria | 1380 |
| 389 | Ga0105237_10879343 | 3300009545 | Bacteria | 903 |
| 390 | Ga0105237_11448212 | 3300009545 | Bacteria | 693 |
| 391 | Ga0105237_11509674 | 3300009545 | Bacteria | 679 |
| 392 | Ga0105238_10001522 | 3300009551 | Bacteria | 23226 |
| 393 | Ga0105249_10000022 | 3300009553 | Bacteria | 258377 |
| 394 | Ga0105249_10002948 | 3300009553 | Bacteria | 14678 |
| 395 | Ga0105249_10573766 | 3300009553 | Bacteria | 1181 |
| 396 | Ga0105249_12169361 | 3300009553 | Bacteria | 628 |
| 397 | Ga0105249_12320707 | 3300009553 | Bacteria | 609 |
| 398 | Ga0105030_101848 | 3300009987 | Bacteria | 1865 |
| 399 | Ga0105030_102476 | 3300009987 | Bacteria | 1604 |
| 400 | Ga0105028_100806 | 3300009993 | Bacteria | 3343 |
| 401 | Ga0105246_10002108 | 3300011119 | Bacteria | 12002 |
| 402 | Ga0105246_11729437 | 3300011119 | Bacteria | 595 |
| 403 | Ga0157313_1011174 | 3300012503 | Bacteria | 775 |
| 404 | Ga0157373_10315847 | 3300013100 | Bacteria | 1111 |
| 405 | Ga0157373_10964041 | 3300013100 | Bacteria | 635 |
| 406 | Ga0157373_11449903 | 3300013100 | Bacteria | 523 |
| 407 | Ga0157371_10041037 | 3300013102 | Bacteria | 3303 |
| 408 | Ga0157371_10241189 | 3300013102 | Bacteria | 1300 |
| 409 | Ga0157371_10729077 | 3300013102 | Bacteria | 743 |
| 410 | Ga0157371_11231855 | 3300013102 | Bacteria | 577 |
| 411 | Ga0157370_10094954 | 3300013104 | Bacteria | 2797 |
| 412 | Ga0157370_10179549 | 3300013104 | Bacteria | 1967 |
| 413 | Ga0157369_10008427 | 3300013105 | Bacteria | 11824 |
| 414 | Ga0157369_10157994 | 3300013105 | Bacteria | 2394 |
| 415 | Ga0157369_11046278 | 3300013105 | Bacteria | 835 |
| 416 | Ga0157374_10020253 | 3300013296 | Bacteria | 5899 |
| 417 | Ga0157374_10033961 | 3300013296 | Bacteria | 4657 |
| 418 | Ga0157374_10116700 | 3300013296 | Bacteria | 2572 |
| 419 | Ga0157374_10961198 | 3300013296 | Bacteria | 873 |
| 420 | Ga0157378_10027056 | 3300013297 | Bacteria | 5059 |
| 421 | Ga0157378_10158034 | 3300013297 | Bacteria | 2118 |
| 422 | Ga0157378_11837221 | 3300013297 | Bacteria | 654 |
| 423 | Ga0163162_10063704 | 3300013306 | Bacteria | 3730 |
| 424 | Ga0163162_10098775 | 3300013306 | Bacteria | 3009 |
| 425 | Ga0163162_10358336 | 3300013306 | Bacteria | 1591 |
| 426 | Ga0163162_11203684 | 3300013306 | Bacteria | 860 |
| 427 | Ga0157372_10031755 | 3300013307 | Bacteria | 5785 |
| 428 | Ga0157372_10044546 | 3300013307 | Bacteria | 4917 |
| 429 | Ga0157372_10359163 | 3300013307 | Bacteria | 1697 |
| 430 | Ga0157372_11157986 | 3300013307 | Bacteria | 894 |
| 431 | Ga0157375_10028414 | 3300013308 | Bacteria | 5242 |
| 432 | Ga0157375_11205163 | 3300013308 | Bacteria | 888 |
| 433 | Ga0157375_11282974 | 3300013308 | Bacteria | 861 |
| 434 | Ga0163163_10000199 | 3300014325 | Bacteria | 62045 |
| 435 | Ga0163163_10039676 | 3300014325 | Bacteria | 4597 |
| 436 | Ga0163163_10283003 | 3300014325 | Bacteria | 1710 |
| 437 | Ga0163163_11312959 | 3300014325 | Bacteria | 785 |
| 438 | Ga0163163_11733838 | 3300014325 | Bacteria | 685 |
| 439 | Ga0157380_10010587 | 3300014326 | Bacteria | 6634 |
| 440 | Ga0157380_10043910 | 3300014326 | Bacteria | 3500 |
| 441 | Ga0157380_10250024 | 3300014326 | Bacteria | 1604 |
| 442 | Ga0157380_10566971 | 3300014326 | Bacteria | 1117 |
| 443 | Ga0157380_10847868 | 3300014326 | Bacteria | 935 |
| 444 | Ga0182008_10041010 | 3300014497 | Bacteria | 2309 |
| 445 | Ga0182008_10152397 | 3300014497 | Bacteria | 1160 |
| 446 | Ga0182008_10185051 | 3300014497 | Bacteria | 1055 |
| 447 | Ga0157377_10604671 | 3300014745 | Bacteria | 783 |
| 448 | Ga0157379_10000012 | 3300014968 | Bacteria | 110577 |
| 449 | Ga0157379_10008899 | 3300014968 | Bacteria | 8753 |
| 450 | Ga0157379_10320944 | 3300014968 | Bacteria | 1414 |
| 451 | Ga0157379_10542569 | 3300014968 | Bacteria | 1081 |
| 452 | Ga0157379_10756558 | 3300014968 | Bacteria | 915 |
| 453 | Ga0157376_10031032 | 3300014969 | Bacteria | 4274 |
| 454 | Ga0157376_10075218 | 3300014969 | Bacteria | 2881 |
| 455 | Ga0157376_10351575 | 3300014969 | Bacteria | 1410 |
| 456 | Ga0163161_10034746 | 3300017792 | Bacteria | 3606 |
| 457 | Ga0163161_10101216 | 3300017792 | Bacteria | 2145 |
| 458 | Ga0163161_10148631 | 3300017792 | Bacteria | 1779 |
| 459 | Ga0197907_10842842 | 3300020069 | Bacteria | 1419 |
| 460 | Ga0206356_11319651 | 3300020070 | Bacteria | 1173 |
| 461 | Ga0206356_11500601 | 3300020070 | Bacteria | 613 |
| 462 | Ga0206349_1024608 | 3300020075 | Bacteria | 1452 |
| 463 | Ga0206349_1745230 | 3300020075 | Bacteria | 1009 |
| 464 | Ga0206355_1475037 | 3300020076 | Bacteria | 1769 |
| 465 | Ga0206351_10124469 | 3300020077 | Bacteria | 828 |
| 466 | Ga0206350_11502833 | 3300020080 | Bacteria | 746 |
| 467 | Ga0206354_10460387 | 3300020081 | Bacteria | 698 |
| 468 | Ga0206354_11431530 | 3300020081 | Bacteria | 1223 |
| 469 | Ga0206353_10817384 | 3300020082 | Bacteria | 1162 |
| 470 | Ga0206353_12021091 | 3300020082 | Bacteria | 1090 |
| 471 | Ga0213874_10150616 | 3300021377 | Bacteria | 811 |
| 472 | Ga0213876_10199108 | 3300021384 | Bacteria | 1064 |
| 473 | Ga0213876_10386189 | 3300021384 | Bacteria | 745 |
| 474 | Ga0213876_10474630 | 3300021384 | Bacteria | 665 |
| 475 | Ga0213871_10096089 | 3300021441 | Bacteria | 863 |
| 476 | Ga0224712_10057651 | 3300022467 | Bacteria | 1536 |
| 477 | Ga0224712_10125609 | 3300022467 | Bacteria | 1115 |
| 478 | Ga0224712_10142605 | 3300022467 | Bacteria | 1056 |
| 479 | Ga0224712_10204700 | 3300022467 | Bacteria | 898 |
| 480 | Ga0224712_10210212 | 3300022467 | Bacteria | 887 |
| 481 | Ga0209784_100141 | 3300025224 | Bacteria | 67045 |
| 482 | Ga0209566_101957 | 3300025225 | Bacteria | 4436 |
| 483 | Ga0209437_100331 | 3300025233 | Bacteria | 58796 |
| 484 | Ga0209148_1003100 | 3300025254 | Bacteria | 4860 |
| 485 | Ga0209455_1000393 | 3300025272 | Bacteria | 37949 |
| 486 | Ga0209675_1014358 | 3300025291 | Bacteria | 2416 |
| 487 | Ga0209676_1018090 | 3300025292 | Bacteria | 2469 |
| 488 | Ga0209025_1000976 | 3300025294 | Bacteria | 42839 |
| 489 | Ga0209758_1000005 | 3300025297 | Bacteria | 1368918 |
| 490 | Ga0209758_1042548 | 3300025297 | Bacteria | 1683 |
| 491 | Ga0209050_1004058 | 3300025298 | Bacteria | 10250 |
| 492 | Ga0209051_1059511 | 3300025303 | Bacteria | 1211 |
| 493 | Ga0209257_1000023 | 3300025304 | Bacteria | 753019 |
| 494 | Ga0209257_1000923 | 3300025304 | Bacteria | 40837 |
| 495 | Ga0207697_10007079 | 3300025315 | Bacteria | 5022 |
| 496 | Ga0207656_10036264 | 3300025321 | Bacteria | 2069 |
| 497 | Ga0207655_1005399 | 3300025728 | Bacteria | 8701 |
| 498 | Ga0207653_10000346 | 3300025885 | Bacteria | 23405 |
| 499 | Ga0207682_10127891 | 3300025893 | Bacteria | 1132 |
| 500 | Ga0207682_10395621 | 3300025893 | Bacteria | 653 |
| 501 | Ga0207692_10110914 | 3300025898 | Bacteria | 1521 |
| 502 | Ga0207692_10214080 | 3300025898 | Bacteria | 1139 |
| 503 | Ga0207710_10000091 | 3300025900 | Bacteria | 121330 |
| 504 | Ga0207710_10008322 | 3300025900 | Bacteria | 4376 |
| 505 | Ga0207710_10356931 | 3300025900 | Bacteria | 745 |
| 506 | Ga0207680_10029742 | 3300025903 | Bacteria | 3073 |
| 507 | Ga0207680_10049566 | 3300025903 | Bacteria | 2500 |
| 508 | Ga0207680_10074560 | 3300025903 | Bacteria | 2113 |
| 509 | Ga0207680_10358063 | 3300025903 | Bacteria | 1026 |
| 510 | Ga0207645_10008194 | 3300025907 | Bacteria | 7317 |
| 511 | Ga0207645_10035340 | 3300025907 | Bacteria | 3209 |
| 512 | Ga0207643_10023070 | 3300025908 | Bacteria | 3430 |
| 513 | Ga0207705_10304545 | 3300025909 | Bacteria | 1223 |
| 514 | Ga0207705_10351368 | 3300025909 | Bacteria | 1136 |
| 515 | Ga0207705_10361585 | 3300025909 | Bacteria | 1119 |
| 516 | Ga0207705_11435716 | 3300025909 | Bacteria | 524 |
| 517 | Ga0207684_10000334 | 3300025910 | Bacteria | 65725 |
| 518 | Ga0207684_10136811 | 3300025910 | Bacteria | 2104 |
| 519 | Ga0207684_10393676 | 3300025910 | Bacteria | 1191 |
| 520 | Ga0207684_10458021 | 3300025910 | Bacteria | 1095 |
| 521 | Ga0207684_10567323 | 3300025910 | Bacteria | 970 |
| 522 | Ga0207684_10749161 | 3300025910 | Bacteria | 828 |
| 523 | Ga0207654_10205690 | 3300025911 | Bacteria | 1298 |
| 524 | Ga0207707_10045958 | 3300025912 | Bacteria | 3803 |
| 525 | Ga0207707_10167807 | 3300025912 | Bacteria | 1918 |
| 526 | Ga0207707_10196532 | 3300025912 | Bacteria | 1759 |
| 527 | Ga0207707_10337211 | 3300025912 | Bacteria | 1300 |
| 528 | Ga0207707_10538797 | 3300025912 | Bacteria | 993 |
| 529 | Ga0207707_10571493 | 3300025912 | Bacteria | 959 |
| 530 | Ga0207695_10122875 | 3300025913 | Bacteria | 2562 |
| 531 | Ga0207695_10190635 | 3300025913 | Bacteria | 1967 |
| 532 | Ga0207695_11092495 | 3300025913 | Bacteria | 677 |
| 533 | Ga0207695_11656623 | 3300025913 | Bacteria | 520 |
| 534 | Ga0207671_10399627 | 3300025914 | Bacteria | 1093 |
| 535 | Ga0207671_10968327 | 3300025914 | Bacteria | 671 |
| 536 | Ga0207671_11198884 | 3300025914 | Bacteria | 594 |
| 537 | Ga0207693_10077869 | 3300025915 | Bacteria | 2596 |
| 538 | Ga0207663_10823415 | 3300025916 | Bacteria | 740 |
| 539 | Ga0207663_10868801 | 3300025916 | Bacteria | 720 |
| 540 | Ga0207660_10005445 | 3300025917 | Bacteria | 8259 |
| 541 | Ga0207660_10008048 | 3300025917 | Bacteria | 6818 |
| 542 | Ga0207660_10064903 | 3300025917 | Bacteria | 2636 |
| 543 | Ga0207660_10675224 | 3300025917 | Bacteria | 843 |
| 544 | Ga0207662_10164270 | 3300025918 | Bacteria | 1420 |
| 545 | Ga0207662_10264263 | 3300025918 | Bacteria | 1134 |
| 546 | Ga0207657_10048317 | 3300025919 | Bacteria | 3715 |
| 547 | Ga0207657_10174189 | 3300025919 | Bacteria | 1742 |
| 548 | Ga0207657_10443624 | 3300025919 | Bacteria | 1019 |
| 549 | Ga0207649_10002438 | 3300025920 | Bacteria | 10409 |
| 550 | Ga0207649_10178053 | 3300025920 | Bacteria | 1486 |
| 551 | Ga0207652_10112919 | 3300025921 | Bacteria | 2411 |
| 552 | Ga0207652_10355703 | 3300025921 | Bacteria | 1322 |
| 553 | Ga0207652_10421559 | 3300025921 | Bacteria | 1204 |
| 554 | Ga0207652_10467773 | 3300025921 | Bacteria | 1136 |
| 555 | Ga0207646_10135949 | 3300025922 | Bacteria | 2213 |
| 556 | Ga0207646_10167285 | 3300025922 | Bacteria | 1985 |
| 557 | Ga0207646_10256716 | 3300025922 | Bacteria | 1580 |
| 558 | Ga0207646_10272139 | 3300025922 | Bacteria | 1531 |
| 559 | Ga0207646_10833926 | 3300025922 | Bacteria | 820 |
| 560 | Ga0207681_10001456 | 3300025923 | Bacteria | 15236 |
| 561 | Ga0207681_10002180 | 3300025923 | Bacteria | 12482 |
| 562 | Ga0207681_10006813 | 3300025923 | Bacteria | 7007 |
| 563 | Ga0207681_10013464 | 3300025923 | Bacteria | 5062 |
| 564 | Ga0207681_10046795 | 3300025923 | Bacteria | 2910 |
| 565 | Ga0207681_10442108 | 3300025923 | Bacteria | 1057 |
| 566 | Ga0207694_10012483 | 3300025924 | Bacteria | 6405 |
| 567 | Ga0207650_10000013 | 3300025925 | Bacteria | 409471 |
| 568 | Ga0207650_10160995 | 3300025925 | Bacteria | 1778 |
| 569 | Ga0207650_10208889 | 3300025925 | Bacteria | 1567 |
| 570 | Ga0207650_10773257 | 3300025925 | Bacteria | 813 |
| 571 | Ga0207659_10007946 | 3300025926 | Bacteria | 6560 |
| 572 | Ga0207659_10328932 | 3300025926 | Bacteria | 1263 |
| 573 | Ga0207687_10012723 | 3300025927 | Bacteria | 5499 |
| 574 | Ga0207700_10090203 | 3300025928 | Bacteria | 2418 |
| 575 | Ga0207700_10239771 | 3300025928 | Bacteria | 1545 |
| 576 | Ga0207700_11788753 | 3300025928 | Bacteria | 540 |
| 577 | Ga0207664_10005552 | 3300025929 | Bacteria | 8636 |
| 578 | Ga0207664_10077392 | 3300025929 | Bacteria | 2695 |
| 579 | Ga0207664_10302913 | 3300025929 | Bacteria | 1406 |
| 580 | Ga0207664_10788504 | 3300025929 | Bacteria | 855 |
| 581 | Ga0207664_11588432 | 3300025929 | Bacteria | 576 |
| 582 | Ga0207644_10001768 | 3300025931 | Bacteria | 13998 |
| 583 | Ga0207644_10050886 | 3300025931 | Bacteria | 2971 |
| 584 | Ga0207644_10875608 | 3300025931 | Bacteria | 752 |
| 585 | Ga0207690_10050292 | 3300025932 | Bacteria | 2782 |
| 586 | Ga0207690_10054602 | 3300025932 | Bacteria | 2687 |
| 587 | Ga0207690_10852156 | 3300025932 | Bacteria | 754 |
| 588 | Ga0207690_11171081 | 3300025932 | Bacteria | 641 |
| 589 | Ga0207706_10010117 | 3300025933 | Bacteria | 8636 |
| 590 | Ga0207706_10224570 | 3300025933 | Bacteria | 1644 |
| 591 | Ga0207706_10418505 | 3300025933 | Bacteria | 1161 |
| 592 | Ga0207686_10537377 | 3300025934 | Bacteria | 912 |
| 593 | Ga0207670_10136812 | 3300025936 | Bacteria | 1802 |
| 594 | Ga0207670_11271652 | 3300025936 | Bacteria | 624 |
| 595 | Ga0207669_10597939 | 3300025937 | Bacteria | 896 |
| 596 | Ga0207704_10004526 | 3300025938 | Bacteria | 6357 |
| 597 | Ga0207704_10436926 | 3300025938 | Bacteria | 1041 |
| 598 | Ga0207704_10768918 | 3300025938 | Bacteria | 802 |
| 599 | Ga0207665_10075043 | 3300025939 | Bacteria | 2316 |
| 600 | Ga0207691_10002993 | 3300025940 | Bacteria | 16486 |
| 601 | Ga0207691_10016889 | 3300025940 | Bacteria | 6924 |
| 602 | Ga0207691_10201557 | 3300025940 | Bacteria | 1732 |
| 603 | Ga0207691_10236755 | 3300025940 | Bacteria | 1579 |
| 604 | Ga0207691_10339181 | 3300025940 | Bacteria | 1287 |
| 605 | Ga0207691_10830920 | 3300025940 | Bacteria | 775 |
| 606 | Ga0207711_10000194 | 3300025941 | Bacteria | 65127 |
| 607 | Ga0207711_10001175 | 3300025941 | Bacteria | 24912 |
| 608 | Ga0207711_10006894 | 3300025941 | Bacteria | 9541 |
| 609 | Ga0207711_10021671 | 3300025941 | Bacteria | 5368 |
| 610 | Ga0207711_10301200 | 3300025941 | Bacteria | 1479 |
| 611 | Ga0207711_10926764 | 3300025941 | Bacteria | 809 |
| 612 | Ga0207689_10025398 | 3300025942 | Bacteria | 4964 |
| 613 | Ga0207689_10408396 | 3300025942 | Bacteria | 1132 |
| 614 | Ga0207689_10525094 | 3300025942 | Bacteria | 993 |
| 615 | Ga0207661_10891224 | 3300025944 | Bacteria | 819 |
| 616 | Ga0207679_10029782 | 3300025945 | Bacteria | 3804 |
| 617 | Ga0207679_10252057 | 3300025945 | Bacteria | 1501 |
| 618 | Ga0207679_10292481 | 3300025945 | Bacteria | 1401 |
| 619 | Ga0207667_10071802 | 3300025949 | Bacteria | 3598 |
| 620 | Ga0207667_10552714 | 3300025949 | Bacteria | 1164 |
| 621 | Ga0207667_11510105 | 3300025949 | Bacteria | 643 |
| 622 | Ga0207651_10089284 | 3300025960 | Bacteria | 2249 |
| 623 | Ga0207651_10362796 | 3300025960 | Bacteria | 1223 |
| 624 | Ga0207712_10000005 | 3300025961 | Bacteria | 608697 |
| 625 | Ga0207712_10003305 | 3300025961 | Bacteria | 10226 |
| 626 | Ga0207712_10189765 | 3300025961 | Bacteria | 1621 |
| 627 | Ga0207668_10017667 | 3300025972 | Bacteria | 4474 |
| 628 | Ga0207668_10610667 | 3300025972 | Bacteria | 951 |
| 629 | Ga0207668_10649424 | 3300025972 | Bacteria | 923 |
| 630 | Ga0207668_11345961 | 3300025972 | Bacteria | 643 |
| 631 | Ga0207668_11778855 | 3300025972 | Bacteria | 556 |
| 632 | Ga0207640_10079202 | 3300025981 | Bacteria | 2239 |
| 633 | Ga0207640_10181862 | 3300025981 | Bacteria | 1577 |
| 634 | Ga0207658_10000005 | 3300025986 | Bacteria | 408341 |
| 635 | Ga0207658_10000316 | 3300025986 | Bacteria | 48662 |
| 636 | Ga0207658_10302480 | 3300025986 | Bacteria | 1378 |
| 637 | Ga0207658_10364561 | 3300025986 | Bacteria | 1261 |
| 638 | Ga0207677_10014761 | 3300026023 | Bacteria | 4573 |
| 639 | Ga0207677_10030582 | 3300026023 | Bacteria | 3439 |
| 640 | Ga0207677_10966275 | 3300026023 | Bacteria | 771 |
| 641 | Ga0207703_10000009 | 3300026035 | Bacteria | 343983 |
| 642 | Ga0207703_10033398 | 3300026035 | Bacteria | 4078 |
| 643 | Ga0207703_10062349 | 3300026035 | Bacteria | 3054 |
| 644 | Ga0207703_10111119 | 3300026035 | Bacteria | 2339 |
| 645 | Ga0207703_11728902 | 3300026035 | Bacteria | 601 |
| 646 | Ga0207639_10316704 | 3300026041 | Bacteria | 1384 |
| 647 | Ga0207639_10497360 | 3300026041 | Bacteria | 1113 |
| 648 | Ga0207639_10510140 | 3300026041 | Bacteria | 1100 |
| 649 | Ga0207639_10593627 | 3300026041 | Bacteria | 1021 |
| 650 | Ga0207639_11450136 | 3300026041 | Bacteria | 644 |
| 651 | Ga0207678_10172580 | 3300026067 | Bacteria | 1846 |
| 652 | Ga0207678_10237000 | 3300026067 | Bacteria | 1562 |
| 653 | Ga0207678_10329191 | 3300026067 | Bacteria | 1315 |
| 654 | Ga0207708_10089329 | 3300026075 | Bacteria | 2374 |
| 655 | Ga0207708_10214586 | 3300026075 | Bacteria | 1539 |
| 656 | Ga0207708_10226090 | 3300026075 | Bacteria | 1501 |
| 657 | Ga0207708_10300724 | 3300026075 | Bacteria | 1305 |
| 658 | Ga0207708_11339146 | 3300026075 | Bacteria | 628 |
| 659 | Ga0207702_10017536 | 3300026078 | Bacteria | 5923 |
| 660 | Ga0207702_10035955 | 3300026078 | Bacteria | 4142 |
| 661 | Ga0207702_10985906 | 3300026078 | Bacteria | 836 |
| 662 | Ga0207641_10000374 | 3300026088 | Bacteria | 53088 |
| 663 | Ga0207641_10015593 | 3300026088 | Bacteria | 6227 |
| 664 | Ga0207641_10020220 | 3300026088 | Bacteria | 5465 |
| 665 | Ga0207648_10016611 | 3300026089 | Bacteria | 6719 |
| 666 | Ga0207648_10146278 | 3300026089 | Bacteria | 2084 |
| 667 | Ga0207648_10204641 | 3300026089 | Bacteria | 1751 |
| 668 | Ga0207676_10000010 | 3300026095 | Bacteria | 519402 |
| 669 | Ga0207676_10150527 | 3300026095 | Bacteria | 2003 |
| 670 | Ga0207676_10647724 | 3300026095 | Bacteria | 1019 |
| 671 | Ga0207676_11685973 | 3300026095 | Bacteria | 632 |
| 672 | Ga0207674_10024732 | 3300026116 | Bacteria | 6410 |
| 673 | Ga0207674_10300504 | 3300026116 | Bacteria | 1554 |
| 674 | Ga0207674_10367003 | 3300026116 | Bacteria | 1392 |
| 675 | Ga0207674_10783050 | 3300026116 | Bacteria | 921 |
| 676 | Ga0207675_100187679 | 3300026118 | Bacteria | 1982 |
| 677 | Ga0207675_100289825 | 3300026118 | Bacteria | 1592 |
| 678 | Ga0207675_100451240 | 3300026118 | Bacteria | 1274 |
| 679 | Ga0207683_10002751 | 3300026121 | Bacteria | 15358 |
| 680 | Ga0207683_10013665 | 3300026121 | Bacteria | 6924 |
| 681 | Ga0207698_10187568 | 3300026142 | Bacteria | 1838 |
| 682 | Ga0207698_11363396 | 3300026142 | Bacteria | 724 |
| 683 | Ga0207698_11947356 | 3300026142 | Bacteria | 602 |
| 684 | Ga0209281_1000059 | 3300027111 | Bacteria | 295913 |
| 685 | Ga0209281_1000435 | 3300027111 | Bacteria | 61761 |
| 686 | Ga0209969_1007660 | 3300027360 | Bacteria | 1526 |
| 687 | Ga0209996_1058107 | 3300027395 | Bacteria | 592 |
| 688 | Ga0209984_1006559 | 3300027424 | Bacteria | 1429 |
| 689 | Ga0210000_1009267 | 3300027462 | Bacteria | 1447 |
| 690 | Ga0209968_1004394 | 3300027526 | Bacteria | 2116 |
| 691 | Ga0209999_1006517 | 3300027543 | Bacteria | 2097 |
| 692 | Ga0209588_1000251 | 3300027671 | Bacteria | 14257 |
| 693 | Ga0209588_1000362 | 3300027671 | Bacteria | 11821 |
| 694 | Ga0209588_1001330 | 3300027671 | Bacteria | 6421 |
| 695 | Ga0209971_1012667 | 3300027682 | Bacteria | 1996 |
| 696 | Ga0209971_1017060 | 3300027682 | Bacteria | 1722 |
| 697 | Ga0209971_1045820 | 3300027682 | Bacteria | 1055 |
| 698 | Ga0209971_1070692 | 3300027682 | Bacteria | 847 |
| 699 | Ga0209966_1005494 | 3300027695 | Bacteria | 2177 |
| 700 | Ga0209966_1013498 | 3300027695 | Bacteria | 1513 |
| 701 | Ga0209998_10000827 | 3300027717 | Bacteria | 7990 |
| 702 | Ga0209813_10021644 | 3300027866 | Bacteria | 1810 |
| 703 | Ga0209974_10031372 | 3300027876 | Bacteria | 1759 |
| 704 | Ga0209974_10039058 | 3300027876 | Bacteria | 1579 |
| 705 | Ga0207428_10007006 | 3300027907 | Bacteria | 10323 |
| 706 | Ga0207428_10206281 | 3300027907 | Bacteria | 1478 |
| 707 | Ga0207428_10216488 | 3300027907 | Bacteria | 1437 |
| 708 | Ga0268266_10005783 | 3300028379 | Bacteria | 11451 |
| 709 | Ga0268266_10015745 | 3300028379 | Bacteria | 6476 |
| 710 | Ga0268266_10025628 | 3300028379 | Bacteria | 5016 |
| 711 | Ga0268266_10322818 | 3300028379 | Bacteria | 1445 |
| 712 | Ga0268266_10509776 | 3300028379 | Bacteria | 1149 |
| 713 | Ga0268266_11185826 | 3300028379 | Bacteria | 738 |
| 714 | Ga0268265_10000005 | 3300028380 | Bacteria | 535350 |
| 715 | Ga0268265_10005692 | 3300028380 | Bacteria | 8511 |
| 716 | Ga0268265_10312014 | 3300028380 | Bacteria | 1420 |
| 717 | Ga0268264_10000005 | 3300028381 | Bacteria | 934972 |
| 718 | Ga0268264_10000036 | 3300028381 | Bacteria | 392994 |
| 719 | Ga0268264_10021192 | 3300028381 | Bacteria | 5310 |
| 720 | Ga0265337_1018941 | 3300028556 | Bacteria | 2178 |
| 721 | Ga0265334_10000696 | 3300028573 | Bacteria | 16863 |
| 722 | Ga0265336_10057375 | 3300028666 | Bacteria | 1169 |
| 723 | Ga0307517_10314249 | 3300028786 | Bacteria | 871 |
| 724 | Ga0265338_10001162 | 3300028800 | Bacteria | 43495 |
| 725 | Ga0265338_10002345 | 3300028800 | Bacteria | 28610 |
| 726 | Ga0265338_10003372 | 3300028800 | Bacteria | 22558 |
| 727 | Ga0265338_10016708 | 3300028800 | Bacteria | 7953 |
| 728 | Ga0265338_10123235 | 3300028800 | Bacteria | 2061 |
| 729 | Ga0265338_10146696 | 3300028800 | Bacteria | 1840 |
| 730 | Ga0265338_10415861 | 3300028800 | Bacteria | 956 |
| 731 | Ga0307511_10145620 | 3300030521 | Bacteria | 1377 |
| 732 | Ga0265320_10032146 | 3300031240 | Bacteria | 2690 |
| 733 | Ga0265339_10023939 | 3300031249 | Bacteria | 3524 |
| 734 | Ga0265331_10026588 | 3300031250 | Bacteria | 2907 |
| 735 | Ga0265331_10293791 | 3300031250 | Bacteria | 728 |
| 736 | Ga0265327_10000312 | 3300031251 | Bacteria | 93831 |
| 737 | Ga0265327_10002455 | 3300031251 | Bacteria | 19557 |
| 738 | Ga0265327_10027637 | 3300031251 | Bacteria | 3260 |
| 739 | Ga0307513_10361209 | 3300031456 | Bacteria | 1197 |
| 740 | Ga0307509_10025225 | 3300031507 | Bacteria | 6643 |
| 741 | Ga0307408_100009220 | 3300031548 | Bacteria | 6506 |
| 742 | Ga0307408_100033362 | 3300031548 | Bacteria | 3597 |
| 743 | Ga0307408_100051835 | 3300031548 | Bacteria | 2958 |
| 744 | Ga0307408_100201566 | 3300031548 | Bacteria | 1611 |
| 745 | Ga0307408_100307066 | 3300031548 | Bacteria | 1331 |
| 746 | Ga0307408_100373555 | 3300031548 | Bacteria | 1217 |
| 747 | Ga0307408_100384788 | 3300031548 | Bacteria | 1200 |
| 748 | Ga0307408_100919291 | 3300031548 | Bacteria | 802 |
| 749 | Ga0307408_101466484 | 3300031548 | Bacteria | 644 |
| 750 | Ga0307408_101505937 | 3300031548 | Bacteria | 636 |
| 751 | Ga0316575_10015099 | 3300031665 | Bacteria | 2909 |
| 752 | Ga0316575_10043573 | 3300031665 | Bacteria | 1779 |
| 753 | Ga0316575_10300843 | 3300031665 | Bacteria | 678 |
| 754 | Ga0316579_10000529 | 3300031691 | Bacteria | 12544 |
| 755 | Ga0316579_10003688 | 3300031691 | Bacteria | 6028 |
| 756 | Ga0316579_10050777 | 3300031691 | Bacteria | 1940 |
| 757 | Ga0316579_10054667 | 3300031691 | Bacteria | 1872 |
| 758 | Ga0316579_10067394 | 3300031691 | Bacteria | 1691 |
| 759 | Ga0265314_10190213 | 3300031711 | Bacteria | 1222 |
| 760 | Ga0316576_10013705 | 3300031727 | Bacteria | 5399 |
| 761 | Ga0316576_10015936 | 3300031727 | Bacteria | 5061 |
| 762 | Ga0316576_10025514 | 3300031727 | Bacteria | 4139 |
| 763 | Ga0316576_10028479 | 3300031727 | Bacteria | 3938 |
| 764 | Ga0316576_10038662 | 3300031727 | Bacteria | 3422 |
| 765 | Ga0316576_10039585 | 3300031727 | Bacteria | 3384 |
| 766 | Ga0316576_10063805 | 3300031727 | Bacteria | 2704 |
| 767 | Ga0316576_10097640 | 3300031727 | Bacteria | 2193 |
| 768 | Ga0316576_10158683 | 3300031727 | Bacteria | 1705 |
| 769 | Ga0316576_10173970 | 3300031727 | Bacteria | 1625 |
| 770 | Ga0316576_10221555 | 3300031727 | Bacteria | 1423 |
| 771 | Ga0316576_10280276 | 3300031727 | Bacteria | 1248 |
| 772 | Ga0316578_10000297 | 3300031728 | Bacteria | 15165 |
| 773 | Ga0316578_10023580 | 3300031728 | Bacteria | 3444 |
| 774 | Ga0316578_10058895 | 3300031728 | Bacteria | 2259 |
| 775 | Ga0316578_10133274 | 3300031728 | Bacteria | 1495 |
| 776 | Ga0316578_10157443 | 3300031728 | Bacteria | 1369 |
| 777 | Ga0316578_10166409 | 3300031728 | Bacteria | 1329 |
| 778 | Ga0316578_10211993 | 3300031728 | Bacteria | 1165 |
| 779 | Ga0316578_10346719 | 3300031728 | Bacteria | 884 |
| 780 | Ga0307516_10146217 | 3300031730 | Bacteria | 2128 |
| 781 | Ga0307405_10001836 | 3300031731 | Bacteria | 9108 |
| 782 | Ga0307405_10042077 | 3300031731 | Bacteria | 2778 |
| 783 | Ga0307405_10249253 | 3300031731 | Bacteria | 1320 |
| 784 | Ga0307405_10268093 | 3300031731 | Bacteria | 1279 |
| 785 | Ga0307405_10377575 | 3300031731 | Bacteria | 1102 |
| 786 | Ga0307405_10422933 | 3300031731 | Bacteria | 1049 |
| 787 | Ga0307405_10490602 | 3300031731 | Bacteria | 982 |
| 788 | Ga0307405_11580594 | 3300031731 | Bacteria | 578 |
| 789 | Ga0316577_10002578 | 3300031733 | Bacteria | 9002 |
| 790 | Ga0316577_10011579 | 3300031733 | Bacteria | 4780 |
| 791 | Ga0316577_10078658 | 3300031733 | Bacteria | 1842 |
| 792 | Ga0316577_10095415 | 3300031733 | Bacteria | 1666 |
| 793 | Ga0316577_10103642 | 3300031733 | Bacteria | 1595 |
| 794 | Ga0316577_10253383 | 3300031733 | Bacteria | 996 |
| 795 | Ga0307413_10008860 | 3300031824 | Bacteria | 4779 |
| 796 | Ga0307413_10018651 | 3300031824 | Bacteria | 3646 |
| 797 | Ga0307413_10044677 | 3300031824 | Bacteria | 2620 |
| 798 | Ga0307413_10046732 | 3300031824 | Bacteria | 2576 |
| 799 | Ga0307413_10052233 | 3300031824 | Bacteria | 2467 |
| 800 | Ga0307413_10134669 | 3300031824 | Bacteria | 1697 |
| 801 | Ga0307413_10366790 | 3300031824 | Bacteria | 1117 |
| 802 | Ga0307413_10567553 | 3300031824 | Bacteria | 923 |
| 803 | Ga0307413_10607980 | 3300031824 | Bacteria | 896 |
| 804 | Ga0307413_10903068 | 3300031824 | Bacteria | 750 |
| 805 | Ga0307413_10989002 | 3300031824 | Bacteria | 720 |
| 806 | Ga0307413_11054498 | 3300031824 | Bacteria | 700 |
| 807 | Ga0307413_11204081 | 3300031824 | Bacteria | 659 |
| 808 | Ga0307410_10019636 | 3300031852 | Bacteria | 4115 |
| 809 | Ga0307410_10042454 | 3300031852 | Bacteria | 3006 |
| 810 | Ga0307410_10042619 | 3300031852 | Bacteria | 3001 |
| 811 | Ga0307410_10052182 | 3300031852 | Bacteria | 2760 |
| 812 | Ga0307410_10082498 | 3300031852 | Bacteria | 2262 |
| 813 | Ga0307410_10132191 | 3300031852 | Bacteria | 1835 |
| 814 | Ga0307410_10172794 | 3300031852 | Bacteria | 1630 |
| 815 | Ga0307410_10351954 | 3300031852 | Bacteria | 1177 |
| 816 | Ga0307410_10496441 | 3300031852 | Bacteria | 1003 |
| 817 | Ga0307410_11333103 | 3300031852 | Bacteria | 628 |
| 818 | Ga0307406_10013051 | 3300031901 | Bacteria | 4749 |
| 819 | Ga0307406_10062091 | 3300031901 | Bacteria | 2416 |
| 820 | Ga0307406_10074031 | 3300031901 | Bacteria | 2241 |
| 821 | Ga0307406_10088711 | 3300031901 | Bacteria | 2076 |
| 822 | Ga0307406_10214984 | 3300031901 | Bacteria | 1425 |
| 823 | Ga0307406_10315395 | 3300031901 | Bacteria | 1207 |
| 824 | Ga0307406_10801055 | 3300031901 | Bacteria | 795 |
| 825 | Ga0307406_10975829 | 3300031901 | Bacteria | 726 |
| 826 | Ga0307407_10002652 | 3300031903 | Bacteria | 7079 |
| 827 | Ga0307407_10028799 | 3300031903 | Bacteria | 2974 |
| 828 | Ga0307407_10029059 | 3300031903 | Bacteria | 2964 |
| 829 | Ga0307407_10129502 | 3300031903 | Bacteria | 1612 |
| 830 | Ga0307407_10266576 | 3300031903 | Bacteria | 1180 |
| 831 | Ga0307407_10695366 | 3300031903 | Bacteria | 765 |
| 832 | Ga0307407_11022856 | 3300031903 | Bacteria | 639 |
| 833 | Ga0307407_11227052 | 3300031903 | Bacteria | 586 |
| 834 | Ga0307412_10100902 | 3300031911 | Bacteria | 2041 |
| 835 | Ga0307412_10106966 | 3300031911 | Bacteria | 1990 |
| 836 | Ga0307412_10133062 | 3300031911 | Bacteria | 1809 |
| 837 | Ga0307412_10430609 | 3300031911 | Bacteria | 1081 |
| 838 | Ga0307412_10467138 | 3300031911 | Bacteria | 1043 |
| 839 | Ga0307412_10740698 | 3300031911 | Bacteria | 847 |
| 840 | Ga0307412_10758762 | 3300031911 | Bacteria | 838 |
| 841 | Ga0307412_10771780 | 3300031911 | Bacteria | 832 |
| 842 | Ga0307412_10851557 | 3300031911 | Bacteria | 795 |
| 843 | Ga0307412_11882971 | 3300031911 | Bacteria | 552 |
| 844 | Ga0307409_100000888 | 3300031995 | Bacteria | 13857 |
| 845 | Ga0307409_100002284 | 3300031995 | Bacteria | 9931 |
| 846 | Ga0307409_100028482 | 3300031995 | Bacteria | 3980 |
| 847 | Ga0307409_100081501 | 3300031995 | Bacteria | 2616 |
| 848 | Ga0307409_100241061 | 3300031995 | Bacteria | 1646 |
| 849 | Ga0307409_100335946 | 3300031995 | Bacteria | 1419 |
| 850 | Ga0307409_100994843 | 3300031995 | Bacteria | 856 |
| 851 | Ga0307409_102611639 | 3300031995 | Bacteria | 533 |
| 852 | Ga0307416_100026442 | 3300032002 | Bacteria | 4276 |
| 853 | Ga0307416_100043587 | 3300032002 | Bacteria | 3514 |
| 854 | Ga0307416_100047997 | 3300032002 | Bacteria | 3384 |
| 855 | Ga0307416_100054613 | 3300032002 | Bacteria | 3212 |
| 856 | Ga0307416_100100154 | 3300032002 | Bacteria | 2519 |
| 857 | Ga0307416_100154183 | 3300032002 | Bacteria | 2112 |
| 858 | Ga0307416_100203453 | 3300032002 | Bacteria | 1881 |
| 859 | Ga0307416_100284928 | 3300032002 | Bacteria | 1632 |
| 860 | Ga0307416_100291755 | 3300032002 | Bacteria | 1615 |
| 861 | Ga0307416_100332627 | 3300032002 | Bacteria | 1527 |
| 862 | Ga0307416_100383147 | 3300032002 | Bacteria | 1437 |
| 863 | Ga0307416_100429826 | 3300032002 | Bacteria | 1367 |
| 864 | Ga0307416_100638348 | 3300032002 | Bacteria | 1148 |
| 865 | Ga0307416_100700859 | 3300032002 | Bacteria | 1102 |
| 866 | Ga0307416_100739180 | 3300032002 | Bacteria | 1076 |
| 867 | Ga0307416_101731383 | 3300032002 | Bacteria | 729 |
| 868 | Ga0307416_102263424 | 3300032002 | Bacteria | 644 |
| 869 | Ga0307414_10018271 | 3300032004 | Bacteria | 4311 |
| 870 | Ga0307414_10024309 | 3300032004 | Bacteria | 3862 |
| 871 | Ga0307414_10131036 | 3300032004 | Bacteria | 1946 |
| 872 | Ga0307414_10425217 | 3300032004 | Bacteria | 1159 |
| 873 | Ga0307414_11095404 | 3300032004 | Bacteria | 735 |
| 874 | Ga0307414_11333040 | 3300032004 | Bacteria | 666 |
| 875 | Ga0307414_11471199 | 3300032004 | Unclassified | 634 |
| 876 | Ga0307414_11716381 | 3300032004 | Bacteria | 586 |
| 877 | Ga0307411_10000730 | 3300032005 | Bacteria | 12114 |
| 878 | Ga0307411_10039068 | 3300032005 | Bacteria | 2999 |
| 879 | Ga0307411_10070769 | 3300032005 | Bacteria | 2361 |
| 880 | Ga0307411_10071855 | 3300032005 | Bacteria | 2347 |
| 881 | Ga0307411_10141901 | 3300032005 | Bacteria | 1772 |
| 882 | Ga0307411_10417075 | 3300032005 | Bacteria | 1114 |
| 883 | Ga0307411_10466572 | 3300032005 | Bacteria | 1060 |
| 884 | Ga0307411_11288362 | 3300032005 | Bacteria | 665 |
| 885 | Ga0307411_12254602 | 3300032005 | Bacteria | 511 |
| 886 | Ga0307415_100004429 | 3300032126 | Bacteria | 7283 |
| 887 | Ga0307415_100009003 | 3300032126 | Bacteria | 5568 |
| 888 | Ga0307415_100025447 | 3300032126 | Bacteria | 3714 |
| 889 | Ga0307415_100038401 | 3300032126 | Bacteria | 3155 |
| 890 | Ga0307415_100109461 | 3300032126 | Bacteria | 2046 |
| 891 | Ga0307415_100174003 | 3300032126 | Bacteria | 1682 |
| 892 | Ga0307415_100236818 | 3300032126 | Bacteria | 1474 |
| 893 | Ga0307415_100250330 | 3300032126 | Bacteria | 1439 |
| 894 | Ga0307415_100293352 | 3300032126 | Bacteria | 1343 |
| 895 | Ga0307415_100495902 | 3300032126 | Bacteria | 1066 |
| 896 | Ga0307415_101033149 | 3300032126 | Bacteria | 766 |
| 897 | Ga0307415_102180569 | 3300032126 | Bacteria | 542 |
| 898 | Ga0316583_10237049 | 3300032133 | Bacteria | 632 |
| 899 | Ga0316585_10003510 | 3300032137 | Bacteria | 4316 |
| 900 | Ga0316580_10020515 | 3300032139 | Bacteria | 2036 |
| 901 | Ga0316580_10027818 | 3300032139 | Bacteria | 1747 |
| 902 | Ga0316580_10034344 | 3300032139 | Bacteria | 1570 |
| 903 | Ga0316580_10042966 | 3300032139 | Bacteria | 1395 |
| 904 | Ga0316580_10085789 | 3300032139 | Bacteria | 963 |
| 905 | Ga0316593_10011628 | 3300032168 | Bacteria | 2563 |
| 906 | Ga0316593_10018591 | 3300032168 | Bacteria | 2138 |
| 907 | Ga0316593_10035094 | 3300032168 | Bacteria | 1649 |
| 908 | Ga0316593_10048644 | 3300032168 | Bacteria | 1428 |
| 909 | Ga0316593_10062619 | 3300032168 | Bacteria | 1274 |
| 910 | Ga0316593_10067614 | 3300032168 | Bacteria | 1231 |
| 911 | Ga0316593_10071721 | 3300032168 | Bacteria | 1199 |
| 912 | Ga0316593_10079782 | 3300032168 | Bacteria | 1141 |
| 913 | Ga0316593_10082715 | 3300032168 | Bacteria | 1122 |
| 914 | Ga0316593_10091462 | 3300032168 | Bacteria | 1072 |
| 915 | Ga0316593_10092605 | 3300032168 | Bacteria | 1065 |
| 916 | Ga0316593_10234034 | 3300032168 | Bacteria | 684 |
| 917 | Ga0316593_10292797 | 3300032168 | Bacteria | 615 |
| 918 | Ga0307507_10220676 | 3300033179 | Bacteria | 1275 |
| 919 | Ga0316592_1011620 | 3300033524 | Bacteria | 1793 |
| 920 | Ga0316592_1020031 | 3300033524 | Bacteria | 1418 |
| 921 | Ga0316592_1024046 | 3300033524 | Bacteria | 1310 |
| 922 | Ga0316592_1029073 | 3300033524 | Bacteria | 1199 |
| 923 | Ga0316592_1044259 | 3300033524 | Bacteria | 989 |
| 924 | Ga0316592_1113556 | 3300033524 | Bacteria | 627 |
| 925 | Ga0316586_1006419 | 3300033527 | Bacteria | 1688 |
| 926 | Ga0316586_1013980 | 3300033527 | Bacteria | 1262 |
| 927 | Ga0316586_1054077 | 3300033527 | Bacteria | 722 |
| 928 | Ga0316588_1000381 | 3300033528 | Bacteria | 5824 |
| 929 | Ga0316588_1016871 | 3300033528 | Bacteria | 1622 |
| 930 | Ga0316588_1029418 | 3300033528 | Bacteria | 1284 |
| 931 | Ga0316588_1033697 | 3300033528 | Bacteria | 1208 |
| 932 | Ga0316588_1035423 | 3300033528 | Bacteria | 1182 |
| 933 | Ga0316588_1040871 | 3300033528 | Bacteria | 1108 |
| 934 | Ga0316588_1066071 | 3300033528 | Bacteria | 885 |
| 935 | Ga0316588_1067351 | 3300033528 | Bacteria | 877 |
| 936 | Ga0316587_1001390 | 3300033529 | Bacteria | 2963 |
| 937 | Ga0316587_1001397 | 3300033529 | Bacteria | 2958 |
| 938 | Ga0316587_1069775 | 3300033529 | Bacteria | 657 |
| 939 | Ga0316596_1000809 | 3300033541 | Bacteria | 5807 |
| 940 | Ga0316596_1001581 | 3300033541 | Bacteria | 4652 |
| 941 | Ga0316596_1003169 | 3300033541 | Bacteria | 3586 |
| 942 | Ga0316596_1003639 | 3300033541 | Bacteria | 3398 |
| 943 | Ga0316596_1005690 | 3300033541 | Bacteria | 2860 |
| 944 | Ga0316596_1007456 | 3300033541 | Bacteria | 2585 |
| 945 | Ga0316596_1041747 | 3300033541 | Bacteria | 1206 |
| 946 | Ga0316596_1042102 | 3300033541 | Bacteria | 1201 |
| 947 | Ga0316596_1044118 | 3300033541 | Bacteria | 1174 |
| 948 | Ga0316596_1044890 | 3300033541 | Bacteria | 1165 |
| 949 | Ga0316596_1063526 | 3300033541 | Bacteria | 986 |
| 950 | Ga0316596_1078007 | 3300033541 | Bacteria | 889 |
| 951 | Ga0316596_1081354 | 3300033541 | Bacteria | 871 |
| 952 | Ga0316596_1085247 | 3300033541 | Bacteria | 850 |
| 953 | Ga0316596_1136194 | 3300033541 | Bacteria | 671 |
| 954 | Ga0316596_1159106 | 3300033541 | Bacteria | 622 |
| 955 | Ga0316596_1190243 | 3300033541 | Bacteria | 569 |
| 956 | Ga0316596_1228787 | 3300033541 | Bacteria | 521 |
| 957 | Ga0373930_0014155 | 3300034816 | Bacteria | 1481 |
| 958 | Ga0373959_0028220 | 3300034820 | Bacteria | 1120 |
| 959 | Ga0373952_0043857 | 3300035092 | Bacteria | 1043 |
| 960 | Ga0373932_0315955 | 3300035112 | Bacteria | 586 |
| 961 | Ga0373945_0136371 | 3300035116 | Bacteria | 987 |
| 962 | Ga0373953_0182086 | 3300035117 | Bacteria | 906 |
| 963 | Ga0373956_0296800 | 3300035119 | Bacteria | 770 |
| 964 | Ga0373957_0132503 | 3300035120 | Bacteria | 1015 |
| 965 | Ga0373946_0244297 | 3300035171 | Bacteria | 874 |
| 966 | Ga0373946_0414680 | 3300035171 | Bacteria | 681 |
| 967 | Ga0373942_0048711 | 3300035207 | Bacteria | 1181 |
| 968 | Ga0373942_0115231 | 3300035207 | Bacteria | 835 |
| 969 | Ga0373962_0197196 | 3300035242 | Bacteria | 680 |
| 970 | Ga0316574_0009869 | 3300035398 | Bacteria | 5367 |
| 971 | Ga0316574_0010199 | 3300035398 | Bacteria | 5296 |
| 972 | Ga0316574_0010767 | 3300035398 | Bacteria | 5179 |
| 973 | Ga0316574_0015270 | 3300035398 | Bacteria | 4454 |
| 974 | Ga0316574_0017334 | 3300035398 | Bacteria | 4215 |
| 975 | Ga0316574_0020530 | 3300035398 | Bacteria | 3911 |
| 976 | Ga0316574_0025730 | 3300035398 | Bacteria | 3534 |
| 977 | Ga0316574_0037156 | 3300035398 | Bacteria | 2985 |
| 978 | Ga0316574_0056033 | 3300035398 | Bacteria | 2465 |
| 979 | Ga0316574_0062050 | 3300035398 | Bacteria | 2348 |
| 980 | Ga0316574_0076353 | 3300035398 | Bacteria | 2122 |
| 981 | Ga0316574_0104644 | 3300035398 | Bacteria | 1812 |
| 982 | Ga0316574_0165851 | 3300035398 | Bacteria | 1422 |
| 983 | Ga0316574_0177983 | 3300035398 | Bacteria | 1369 |
| 984 | Ga0316574_0186096 | 3300035398 | Bacteria | 1336 |
| 985 | Ga0316574_0340285 | 3300035398 | Bacteria | 950 |
| 986 | Ga0316574_0370418 | 3300035398 | Bacteria | 905 |
| 987 | Ga0316574_0414430 | 3300035398 | Bacteria | 847 |
| 988 | Ga0316574_0772972 | 3300035398 | Bacteria | 586 |
| 989 | Ga0373924_0056426 | 3300035410 | Bacteria | 1636 |
| 990 | Ga0373924_0284831 | 3300035410 | Bacteria | 733 |
| 991 | Ga0373924_0286149 | 3300035410 | Bacteria | 731 |
| 992 | Ga0373935_0469570 | 3300035692 | Bacteria | 911 |
| 993 | Ga0373935_0470283 | 3300035692 | Bacteria | 910 |
| 994 | Ga0373927_0685057 | 3300035695 | Bacteria | 677 |
| 995 | Ga0373933_0253844 | 3300035724 | Bacteria | 1133 |
| 996 | Ga0373933_0552244 | 3300035724 | Bacteria | 756 |
| 997 | Ga0373947_0492266 | 3300035725 | Bacteria | 833 |
| 998 | Ga0373937_0004917 | 3300036401 | Bacteria | 11361 |
| 999 | Ga0373937_0115042 | 3300036401 | Bacteria | 2504 |
| 1000 | Ga0373937_0242538 | 3300036401 | Bacteria | 1698 |
| 1001 | Ga0373937_0243744 | 3300036401 | Bacteria | 1694 |
| 1002 | Ga0373937_0395534 | 3300036401 | Bacteria | 1311 |
| 1003 | Ga0316582_0011881 | 3300036647 | Bacteria | 4836 |
| 1004 | Ga0316582_0024484 | 3300036647 | Bacteria | 3614 |
| 1005 | Ga0316582_0061207 | 3300036647 | Bacteria | 2415 |
| 1006 | Ga0316582_0065118 | 3300036647 | Bacteria | 2346 |
| 1007 | Ga0316582_0148192 | 3300036647 | Bacteria | 1585 |
| 1008 | Ga0316582_0151574 | 3300036647 | Bacteria | 1567 |
| 1009 | Ga0316582_0153311 | 3300036647 | Bacteria | 1558 |
| 1010 | Ga0316582_0248393 | 3300036647 | Bacteria | 1219 |
| 1011 | Ga0316582_0248868 | 3300036647 | Bacteria | 1218 |
| 1012 | Ga0316582_0379677 | 3300036647 | Bacteria | 973 |
| 1013 | Ga0316582_0876016 | 3300036647 | Bacteria | 614 |
| 1014 | Ga0316584_0001224 | 3300036712 | Bacteria | 15162 |
| 1015 | Ga0316584_0017856 | 3300036712 | Bacteria | 5110 |
| 1016 | Ga0316584_0022065 | 3300036712 | Bacteria | 4639 |
| 1017 | Ga0316584_0034071 | 3300036712 | Bacteria | 3774 |
| 1018 | Ga0316584_0071847 | 3300036712 | Bacteria | 2593 |
| 1019 | Ga0316584_0078936 | 3300036712 | Bacteria | 2465 |
| 1020 | Ga0316584_0122871 | 3300036712 | Bacteria | 1939 |
| 1021 | Ga0316584_0178391 | 3300036712 | Bacteria | 1573 |
| 1022 | Ga0316584_0187936 | 3300036712 | Bacteria | 1528 |
| 1023 | Ga0316584_0430803 | 3300036712 | Bacteria | 935 |
| 1024 | Ga0316584_0644193 | 3300036712 | Bacteria | 731 |
| 1025 | Ga0316584_0840487 | 3300036712 | Bacteria | 621 |
| 1026 | Ga0395899_0018915 | 3300037312 | Bacteria | 5234 |
| 1027 | Ga0395899_0040785 | 3300037312 | Bacteria | 3471 |
| 1028 | Ga0395900_0005893 | 3300037418 | Bacteria | 12798 |
| 1029 | Ga0395900_0042149 | 3300037418 | Bacteria | 4702 |
| 1030 | Ga0395900_1127151 | 3300037418 | Bacteria | 701 |
| 1031 | Ga0395900_1690463 | 3300037418 | Bacteria | 544 |
| 1032 | Ga0395898_0010463 | 3300037466 | Bacteria | 9696 |
| 1033 | Ga0395898_0103035 | 3300037466 | Bacteria | 2739 |
| 1034 | Ga0395905_0001744 | 3300037471 | Bacteria | 25404 |
| 1035 | Ga0395905_0001868 | 3300037471 | Bacteria | 24254 |
| 1036 | Ga0395905_0003132 | 3300037471 | Bacteria | 17831 |
| 1037 | Ga0395905_1440911 | 3300037471 | Bacteria | 593 |
| 1038 | Ga0316581_0016906 | 3300037588 | Bacteria | 2100 |
| 1039 | Ga0316581_0023744 | 3300037588 | Bacteria | 1815 |
| 1040 | Ga0316581_0138789 | 3300037588 | Bacteria | 749 |
| 1041 | Ga0436364_1352329 | 3300037853 | Bacteria | 974 |
| 1042 | Ga0436364_1565178 | 3300037853 | Bacteria | 3189 |
| 1043 | Ga0395901_0005863 | 3300038443 | Bacteria | 12427 |
| 1044 | Ga0395901_0021450 | 3300038443 | Bacteria | 6617 |
| 1045 | Ga0395901_0120202 | 3300038443 | Bacteria | 2761 |
| 1046 | Ga0400484_13801 | 3300038725 | Bacteria | 11964 |
| 1047 | Ga0400490_04174 | 3300038726 | Bacteria | 1213 |
| 1048 | Ga0400490_17180 | 3300038726 | Bacteria | 2959 |
| 1049 | Ga0400488_15248 | 3300038741 | Bacteria | 1931 |
| 1050 | Ga0400488_39600 | 3300038741 | Bacteria | 2728 |
| 1051 | Ga0400483_042512 | 3300039062 | Bacteria | 39121 |
| 1052 | Ga0400483_201072 | 3300039062 | Bacteria | 1413 |
| 1053 | Ga0400483_213487 | 3300039062 | Bacteria | 31656 |
| 1054 | Ga0400483_240025 | 3300039062 | Bacteria | 15258 |
| 1055 | Ga0400483_257690 | 3300039062 | Bacteria | 1464 |
| 1056 | Ga0400489_36376 | 3300039093 | Bacteria | 1344 |
| 1057 | Ga0436365_0411139 | 3300039437 | Bacteria | 785 |
| 1058 | Ga0436365_1018434 | 3300039437 | Bacteria | 1935 |
| 1059 | Ga0436360_0649591 | 3300039438 | Bacteria | 786 |
| 1060 | Ga0436360_1050896 | 3300039438 | Bacteria | 697 |
| 1061 | Ga0436361_0672840 | 3300039447 | Bacteria | 1362 |
| 1062 | Ga0436363_1297639 | 3300039450 | Bacteria | 716 |
| 1063 | Ga0436362_0262950 | 3300039453 | Bacteria | 787 |
| 1064 | Ga0439439_0012711 | 3300041406 | Bacteria | 2038 |
| 1065 | Ga0439439_0073821 | 3300041406 | Bacteria | 916 |
| 1066 | Ga0439439_0104370 | 3300041406 | Bacteria | 782 |
| 1067 | Ga0439453_0034568 | 3300041408 | Bacteria | 971 |
| 1068 | Ga0439461_0044592 | 3300041410 | Bacteria | 968 |
| 1069 | Ga0451793_0134173 | 3300041452 | Bacteria | 608 |
| 1070 | Ga0451797_0187552 | 3300041453 | Bacteria | 808 |
| 1071 | Ga0451798_0564405 | 3300041458 | Bacteria | 1000 |
| 1072 | Ga0451802_0912448 | 3300041460 | Bacteria | 572 |
| 1073 | Ga0451805_111226 | 3300041461 | Bacteria | 1018 |
| 1074 | Ga0451804_0943745 | 3300041463 | Bacteria | 807 |
| 1075 | Ga0451849_1137113 | 3300041505 | Bacteria | 1082 |
| 1076 | Ga0451843_1162918 | 3300041509 | Bacteria | 522 |
| 1077 | Ga0439445_0096997 | 3300042004 | Bacteria | 834 |
| 1078 | Ga0439449_0028437 | 3300042007 | Bacteria | 2083 |
| 1079 | Ga0439450_222320 | 3300042008 | Bacteria | 509 |
| 1080 | Ga0439457_050041 | 3300042014 | Bacteria | 938 |
| 1081 | Ga0439457_075968 | 3300042014 | Bacteria | 769 |
| 1082 | Ga0439462_0008464 | 3300042015 | Bacteria | 2594 |
| 1083 | Ga0450899_042530 | 3300042135 | Bacteria | 570 |
| 1084 | Ga0450906_103493 | 3300042145 | Bacteria | 520 |
| 1085 | Ga0439446_0017862 | 3300042156 | Bacteria | 1984 |
| 1086 | Ga0439446_0018404 | 3300042156 | Bacteria | 1957 |
| 1087 | Ga0439446_0131953 | 3300042156 | Bacteria | 811 |
| 1088 | Ga0439434_0001854 | 3300042435 | Bacteria | 6140 |
| 1089 | Ga0439434_0038465 | 3300042435 | Bacteria | 1466 |
| 1090 | Ga0439434_0150917 | 3300042435 | Bacteria | 769 |
| 1091 | Ga0439459_0043864 | 3300042438 | Bacteria | 960 |
| 1092 | Ga0439460_0178804 | 3300042461 | Bacteria | 717 |
| 1093 | Ga0451577_0727715 | 3300042876 | Bacteria | 898 |
| 1094 | Ga0451577_1102548 | 3300042876 | Bacteria | 710 |
| 1095 | Ga0466972_0079865 | 3300044658 | Bacteria | 1557 |
| 1096 | Ga0466972_0272818 | 3300044658 | Bacteria | 790 |
| 1097 | Ga0453683_0002122 | 3300044673 | Bacteria | 15802 |
| 1098 | Ga0453683_0045739 | 3300044673 | Bacteria | 2744 |
| 1099 | Ga0453683_0047226 | 3300044673 | Bacteria | 2699 |
| 1100 | Ga0453683_0285400 | 3300044673 | Bacteria | 1055 |
| 1101 | Ga0466965_0001322 | 3300044683 | Bacteria | 9902 |
| 1102 | Ga0466966_0043386 | 3300044684 | Bacteria | 2883 |
| 1103 | Ga0466966_0088746 | 3300044684 | Bacteria | 1921 |
| 1104 | Ga0466966_0429380 | 3300044684 | Bacteria | 794 |
| 1105 | Ga0466966_0742273 | 3300044684 | Bacteria | 592 |
| 1106 | Ga0466961_0025978 | 3300044693 | Bacteria | 3764 |
| 1107 | Ga0466961_0800899 | 3300044693 | Bacteria | 562 |
| 1108 | Ga0466963_0008869 | 3300044694 | Bacteria | 6034 |
| 1109 | Ga0466963_0011988 | 3300044694 | Bacteria | 5295 |
| 1110 | Ga0466963_0069046 | 3300044694 | Bacteria | 2374 |
| 1111 | Ga0466963_0206289 | 3300044694 | Bacteria | 1375 |
| 1112 | Ga0466963_0503017 | 3300044694 | Bacteria | 855 |
| 1113 | Ga0466963_0526437 | 3300044694 | Bacteria | 835 |
| 1114 | Ga0466964_0014369 | 3300044706 | Bacteria | 3010 |
| 1115 | Ga0466964_0087549 | 3300044706 | Bacteria | 1349 |
| 1116 | Ga0466964_0274343 | 3300044706 | Bacteria | 840 |
| 1117 | Ga0453684_0000030 | 3300044712 | Bacteria | 752725 |
| 1118 | Ga0453684_0058221 | 3300044712 | Bacteria | 4992 |
| 1119 | Ga0453684_0273528 | 3300044712 | Bacteria | 1929 |
| 1120 | Ga0453684_0436051 | 3300044712 | Bacteria | 1461 |
| 1121 | Ga0466971_0005382 | 3300044719 | Bacteria | 5551 |
| 1122 | Ga0466971_0081726 | 3300044719 | Bacteria | 1474 |
| 1123 | Ga0466971_0451842 | 3300044719 | Bacteria | 630 |
| 1124 | Ga0466968_0221528 | 3300044735 | Bacteria | 891 |
| 1125 | Ga0466970_0524232 | 3300044765 | Bacteria | 683 |
| 1126 | Ga0466970_0685483 | 3300044765 | Bacteria | 597 |
| 1127 | Ga0466957_0018493 | 3300044842 | Bacteria | 4093 |
| 1128 | Ga0466957_0685025 | 3300044842 | Bacteria | 723 |
| 1129 | Ga0466957_0751630 | 3300044842 | Bacteria | 690 |
| 1130 | Ga0466960_0004112 | 3300044901 | Bacteria | 5659 |
| 1131 | Ga0466960_0027379 | 3300044901 | Bacteria | 2599 |
| 1132 | Ga0466960_0105437 | 3300044901 | Bacteria | 1457 |
| 1133 | Ga0466960_0256359 | 3300044901 | Bacteria | 973 |
| 1134 | Ga0466960_0711597 | 3300044901 | Bacteria | 603 |
| 1135 | Ga0466959_0373744 | 3300045049 | Bacteria | 970 |
| 1136 | Ga0466959_0623042 | 3300045049 | Bacteria | 725 |
| 1137 | Ga0451576_0034587 | 3300045051 | Bacteria | 5366 |
| 1138 | Ga0451576_0094308 | 3300045051 | Bacteria | 3112 |
| 1139 | Ga0451576_0176896 | 3300045051 | Bacteria | 2228 |
| 1140 | Ga0451576_0223479 | 3300045051 | Bacteria | 1966 |
| 1141 | Ga0451576_0236149 | 3300045051 | Bacteria | 1909 |
| 1142 | Ga0451576_0379212 | 3300045051 | Bacteria | 1482 |
| 1143 | Ga0451576_0713888 | 3300045051 | Bacteria | 1053 |
| 1144 | Ga0451576_0844554 | 3300045051 | Bacteria | 961 |
| 1145 | Ga0451576_1240659 | 3300045051 | Bacteria | 778 |
| 1146 | Ga0451576_1470185 | 3300045051 | Bacteria | 708 |
| 1147 | Ga0451576_2445980 | 3300045051 | Bacteria | 534 |
| 1148 | Ga0451576_2578631 | 3300045051 | Bacteria | 518 |
| 1149 | Ga0466958_0011995 | 3300045836 | Bacteria | 4896 |
| 1150 | Ga0466958_0103983 | 3300045836 | Bacteria | 1768 |
| 1151 | Ga0466958_0202515 | 3300045836 | Bacteria | 1263 |
| 1152 | Ga0466958_0788886 | 3300045836 | Bacteria | 619 |
| 1153 | Ga0466967_0000260 | 3300045976 | Bacteria | 23213 |
| 1154 | Ga0466967_0024578 | 3300045976 | Bacteria | 4956 |
| 1155 | Ga0466967_0025168 | 3300045976 | Bacteria | 4904 |
| 1156 | Ga0466967_0025228 | 3300045976 | Bacteria | 4899 |
| 1157 | Ga0466967_0088218 | 3300045976 | Bacteria | 2814 |
| 1158 | Ga0466967_0129582 | 3300045976 | Bacteria | 2340 |
| 1159 | Ga0466967_0183342 | 3300045976 | Bacteria | 1975 |
| 1160 | Ga0466967_0190619 | 3300045976 | Bacteria | 1937 |
| 1161 | Ga0466967_1459616 | 3300045976 | Bacteria | 681 |
| 1162 | Ga0495590_0215806 | 3300046457 | Bacteria | 708 |
| 1163 | Ga0495590_0430037 | 3300046457 | Bacteria | 509 |
| 1164 | Ga0495591_073300 | 3300046458 | Bacteria | 885 |
| 1165 | Ga0495629_0220882 | 3300046459 | Bacteria | 1307 |
| 1166 | Ga0495629_0723576 | 3300046459 | Bacteria | 660 |
| 1167 | Ga0495638_0009097 | 3300046460 | Bacteria | 6993 |
| 1168 | Ga0495651_0005682 | 3300046462 | Bacteria | 9506 |
| 1169 | Ga0495653_0008336 | 3300046463 | Bacteria | 8495 |
| 1170 | Ga0495582_0151087 | 3300046473 | Bacteria | 1318 |
| 1171 | Ga0495582_0703510 | 3300046473 | Bacteria | 585 |
| 1172 | Ga0495605_0000144 | 3300046474 | Bacteria | 91642 |
| 1173 | Ga0495639_0146345 | 3300046475 | Bacteria | 1138 |
| 1174 | Ga0495662_0057920 | 3300046476 | Bacteria | 1871 |
| 1175 | Ga0495584_0277529 | 3300046491 | Bacteria | 851 |
| 1176 | Ga0495584_0545613 | 3300046491 | Bacteria | 591 |
| 1177 | Ga0495594_0323879 | 3300046499 | Bacteria | 878 |
| 1178 | Ga0495596_0173456 | 3300046500 | Bacteria | 838 |
| 1179 | Ga0495608_0017970 | 3300046511 | Bacteria | 4886 |
| 1180 | Ga0495618_0646603 | 3300046514 | Bacteria | 626 |
| 1181 | Ga0495620_0003895 | 3300046515 | Bacteria | 8511 |
| 1182 | Ga0495620_0032377 | 3300046515 | Bacteria | 2383 |
| 1183 | Ga0495644_0175111 | 3300046523 | Bacteria | 824 |
| 1184 | Ga0495648_0267277 | 3300046524 | Bacteria | 817 |
| 1185 | Ga0495642_0087810 | 3300046528 | Bacteria | 1314 |
| 1186 | Ga0495642_0250150 | 3300046528 | Bacteria | 775 |
| 1187 | Ga0495642_0304815 | 3300046528 | Bacteria | 698 |
| 1188 | Ga0495652_0101654 | 3300046529 | Bacteria | 2330 |
| 1189 | Ga0495665_0224532 | 3300046531 | Bacteria | 971 |
| 1190 | Ga0495587_0049529 | 3300046536 | Bacteria | 2486 |
| 1191 | Ga0495587_0160622 | 3300046536 | Bacteria | 1279 |
| 1192 | Ga0495598_0101336 | 3300046537 | Bacteria | 953 |
| 1193 | Ga0495621_0007265 | 3300046539 | Bacteria | 3274 |
| 1194 | Ga0495597_0126995 | 3300046542 | Bacteria | 1060 |
| 1195 | Ga0495645_0182631 | 3300046543 | Bacteria | 1436 |
| 1196 | Ga0495645_0194050 | 3300046543 | Bacteria | 1382 |
| 1197 | Ga0495633_0257756 | 3300046558 | Bacteria | 795 |
| 1198 | Ga0495667_0133675 | 3300046559 | Bacteria | 1600 |
| 1199 | Ga0495611_0372065 | 3300046648 | Bacteria | 655 |
| 1200 | Ga0495625_0475370 | 3300046660 | Bacteria | 768 |
| 1201 | Ga0495659_0447765 | 3300046664 | Bacteria | 562 |
| 1202 | Ga0495588_0424716 | 3300046674 | Bacteria | 698 |
| 1203 | Ga0495657_0019796 | 3300046675 | Bacteria | 4852 |
| 1204 | Ga0495657_0049535 | 3300046675 | Bacteria | 2829 |
| 1205 | Ga0495646_0133534 | 3300046680 | Bacteria | 1395 |
| 1206 | Ga0495647_0106869 | 3300046681 | Bacteria | 1164 |
| 1207 | Ga0495658_0124398 | 3300046683 | Bacteria | 1563 |
| 1208 | Ga0495658_0291853 | 3300046683 | Bacteria | 1030 |
| 1209 | Ga0495658_0398990 | 3300046683 | Bacteria | 877 |
| 1210 | Ga0495658_0504771 | 3300046683 | Bacteria | 774 |
| 1211 | Ga0495658_0531907 | 3300046683 | Bacteria | 752 |
| 1212 | Ga0495613_0229453 | 3300046689 | Bacteria | 1301 |
| 1213 | Ga0495670_0113638 | 3300046691 | Bacteria | 1403 |
| 1214 | Ga0495649_0028579 | 3300046694 | Bacteria | 3090 |
| 1215 | Ga0495649_0137605 | 3300046694 | Bacteria | 1287 |
| 1216 | Ga0495600_0020890 | 3300046809 | Bacteria | 4190 |
| 1217 | Ga0495660_0009935 | 3300046810 | Bacteria | 5539 |
| 1218 | Ga0495604_0033102 | 3300047317 | Bacteria | 4093 |
| 1219 | Ga0495636_0267324 | 3300047318 | Bacteria | 794 |
| 1220 | Ga0495674_0984632 | 3300047319 | Bacteria | 647 |
| 1221 | Ga0495672_0030541 | 3300047320 | Bacteria | 3378 |
| 1222 | Ga0495672_0138890 | 3300047320 | Bacteria | 1271 |
| 1223 | Ga0495672_0139990 | 3300047320 | Bacteria | 1265 |
| 1224 | Ga0495672_0230801 | 3300047320 | Bacteria | 908 |
| 1225 | Ga0495687_062534 | 3300047443 | Bacteria | 1527 |
| 1226 | Ga0495677_0108729 | 3300047445 | Bacteria | 1053 |
| 1227 | Ga0495685_281047 | 3300047447 | Bacteria | 525 |
| 1228 | Ga0495681_0029101 | 3300047470 | Bacteria | 2832 |
| 1229 | Ga0495686_0101905 | 3300047472 | Bacteria | 1730 |
| 1230 | Ga0495686_0199055 | 3300047472 | Bacteria | 1151 |
| 1231 | Ga0495686_0646705 | 3300047472 | Bacteria | 544 |
| 1232 | Ga0495602_0074737 | 3300048088 | Bacteria | 2879 |
| 1233 | Ga0495615_0188320 | 3300048090 | Bacteria | 632 |
| 1234 | Ga0495626_0191734 | 3300048091 | Bacteria | 842 |
| 1235 | Ga0496100_0221912 | 3300048903 | Bacteria | 1387 |
| 1236 | Ga0496100_0471630 | 3300048903 | Bacteria | 964 |
| 1237 | Ga0496101_0016894 | 3300048904 | Bacteria | 4940 |
| 1238 | Ga0496101_0341002 | 3300048904 | Bacteria | 1177 |
| 1239 | Ga0496102_0000050 | 3300048905 | Bacteria | 179469 |
| 1240 | Ga0496102_0376386 | 3300048905 | Bacteria | 1336 |
| 1241 | Ga0496102_0393460 | 3300048905 | Bacteria | 1303 |
| 1242 | Ga0496102_0768705 | 3300048905 | Bacteria | 886 |
| 1243 | Ga0496103_0000738 | 3300048906 | Bacteria | 24107 |
| 1244 | Ga0496103_0005759 | 3300048906 | Bacteria | 7396 |
| 1245 | Ga0496103_0056019 | 3300048906 | Bacteria | 2446 |
| 1246 | Ga0496103_0062323 | 3300048906 | Bacteria | 2321 |
| 1247 | Ga0496104_0096215 | 3300048907 | Bacteria | 2833 |
| 1248 | Ga0496104_0213358 | 3300048907 | Bacteria | 1842 |
| 1249 | Ga0496104_0919689 | 3300048907 | Bacteria | 780 |
| 1250 | Ga0496106_0200422 | 3300048909 | Bacteria | 1588 |
| 1251 | Ga0496106_0422043 | 3300048909 | Bacteria | 1072 |
| 1252 | Ga0496107_0197664 | 3300048910 | Bacteria | 1494 |
| 1253 | Ga0496108_0057986 | 3300048911 | Bacteria | 3253 |
| 1254 | Ga0496108_0125018 | 3300048911 | Bacteria | 2207 |
| 1255 | Ga0496109_0061202 | 3300048912 | Bacteria | 3441 |
| 1256 | Ga0496109_0145275 | 3300048912 | Bacteria | 2219 |
| 1257 | Ga0496109_0155049 | 3300048912 | Bacteria | 2145 |
| 1258 | Ga0496109_0557470 | 3300048912 | Bacteria | 1081 |
| 1259 | Ga0496109_0823312 | 3300048912 | Bacteria | 866 |
| 1260 | Ga0496110_0029583 | 3300048913 | Bacteria | 4716 |
| 1261 | Ga0496110_0176663 | 3300048913 | Bacteria | 1938 |
| 1262 | Ga0496110_0304192 | 3300048913 | Bacteria | 1452 |
| 1263 | Ga0496110_0872908 | 3300048913 | Bacteria | 805 |
| 1264 | Ga0496111_0196293 | 3300048914 | Bacteria | 1500 |
| 1265 | Ga0496112_0063859 | 3300048915 | Bacteria | 3632 |
| 1266 | Ga0496112_0171394 | 3300048915 | Bacteria | 2135 |
| 1267 | Ga0496113_0086112 | 3300048916 | Bacteria | 2414 |
| 1268 | Ga0496113_0430585 | 3300048916 | Bacteria | 1060 |
| 1269 | Ga0496113_0855066 | 3300048916 | Bacteria | 721 |
| 1270 | Ga0496114_0016103 | 3300048917 | Bacteria | 6017 |
| 1271 | Ga0496114_0107755 | 3300048917 | Bacteria | 2385 |
| 1272 | Ga0496114_0416134 | 3300048917 | Bacteria | 1190 |
| 1273 | Ga0496114_0582570 | 3300048917 | Bacteria | 987 |
| 1274 | Ga0496115_0233226 | 3300048918 | Bacteria | 1517 |
| 1275 | Ga0496115_0393634 | 3300048918 | Bacteria | 1125 |
| 1276 | Ga0496116_0005219 | 3300048919 | Bacteria | 12155 |
| 1277 | Ga0496116_0016498 | 3300048919 | Bacteria | 5774 |
| 1278 | Ga0496116_0028538 | 3300048919 | Bacteria | 4039 |
| 1279 | Ga0496116_0032021 | 3300048919 | Bacteria | 3753 |
| 1280 | Ga0496116_0037968 | 3300048919 | Bacteria | 3351 |
| 1281 | Ga0496116_0111123 | 3300048919 | Bacteria | 1610 |
| 1282 | Ga0496116_0333705 | 3300048919 | Bacteria | 703 |
| 1283 | Ga0496117_0000124 | 3300048920 | Bacteria | 169701 |
| 1284 | Ga0496117_0000459 | 3300048920 | Bacteria | 68055 |
| 1285 | Ga0496117_0024453 | 3300048920 | Bacteria | 4778 |
| 1286 | Ga0496117_0131342 | 3300048920 | Bacteria | 1517 |
| 1287 | Ga0496118_0001032 | 3300048921 | Bacteria | 43337 |
| 1288 | Ga0496118_0019632 | 3300048921 | Bacteria | 6032 |
| 1289 | Ga0496118_0021782 | 3300048921 | Bacteria | 5627 |
| 1290 | Ga0496118_0367079 | 3300048921 | Bacteria | 761 |
| 1291 | Ga0496119_0000020 | 3300048922 | Bacteria | 285602 |
| 1292 | Ga0496119_0000469 | 3300048922 | Bacteria | 54992 |
| 1293 | Ga0496119_0004045 | 3300048922 | Bacteria | 14813 |
| 1294 | Ga0496119_0009837 | 3300048922 | Bacteria | 8127 |
| 1295 | Ga0496119_0367175 | 3300048922 | Bacteria | 693 |
| 1296 | Ga0496120_0000006 | 3300048923 | Bacteria | 445068 |
| 1297 | Ga0496120_0003209 | 3300048923 | Bacteria | 15193 |
| 1298 | Ga0496120_0004266 | 3300048923 | Bacteria | 12159 |
| 1299 | Ga0496120_0016181 | 3300048923 | Bacteria | 4882 |
| 1300 | Ga0496120_0022493 | 3300048923 | Bacteria | 3965 |
| 1301 | Ga0496121_0008166 | 3300048924 | Bacteria | 12432 |
| 1302 | Ga0496121_0172631 | 3300048924 | Bacteria | 1568 |
| 1303 | Ga0496121_0713910 | 3300048924 | Bacteria | 601 |
| 1304 | Ga0496122_0000040 | 3300048925 | Bacteria | 285095 |
| 1305 | Ga0496122_0000197 | 3300048925 | Bacteria | 136124 |
| 1306 | Ga0496122_0000802 | 3300048925 | Bacteria | 60277 |
| 1307 | Ga0496122_0017826 | 3300048925 | Bacteria | 6603 |
| 1308 | Ga0496122_0037855 | 3300048925 | Bacteria | 3875 |
| 1309 | Ga0496122_0060916 | 3300048925 | Bacteria | 2775 |
| 1310 | Ga0496122_0095327 | 3300048925 | Bacteria | 2011 |
| 1311 | Ga0496123_0000446 | 3300048926 | Bacteria | 73975 |
| 1312 | Ga0496123_0005785 | 3300048926 | Bacteria | 12279 |
| 1313 | Ga0496123_0013945 | 3300048926 | Bacteria | 6697 |
| 1314 | Ga0496123_0032101 | 3300048926 | Bacteria | 3809 |
| 1315 | Ga0496123_0058166 | 3300048926 | Bacteria | 2510 |
| 1316 | Ga0496123_0116296 | 3300048926 | Bacteria | 1515 |
| 1317 | Ga0496123_0348516 | 3300048926 | Bacteria | 689 |
| 1318 | Ga0496124_0000697 | 3300048927 | Bacteria | 55040 |
| 1319 | Ga0496124_0004781 | 3300048927 | Bacteria | 15591 |
| 1320 | Ga0496124_0025594 | 3300048927 | Bacteria | 5343 |
| 1321 | Ga0496124_0031210 | 3300048927 | Bacteria | 4719 |
| 1322 | Ga0496124_0080158 | 3300048927 | Bacteria | 2687 |
| 1323 | Ga0496124_0148202 | 3300048927 | Bacteria | 1844 |
| 1324 | Ga0496124_0208641 | 3300048927 | Bacteria | 1480 |
| 1325 | Ga0496124_0840335 | 3300048927 | Bacteria | 564 |
| 1326 | Ga0496125_0000010 | 3300048928 | Bacteria | 671167 |
| 1327 | Ga0496125_0001385 | 3300048928 | Bacteria | 35466 |
| 1328 | Ga0496125_0008367 | 3300048928 | Bacteria | 10847 |
| 1329 | Ga0496125_0071942 | 3300048928 | Bacteria | 2698 |
| 1330 | Ga0496125_0078830 | 3300048928 | Bacteria | 2529 |
| 1331 | Ga0496125_0084920 | 3300048928 | Bacteria | 2401 |
| 1332 | Ga0496126_0000060 | 3300048929 | Bacteria | 264944 |
| 1333 | Ga0496126_0000249 | 3300048929 | Bacteria | 116527 |
| 1334 | Ga0496126_0004639 | 3300048929 | Bacteria | 16261 |
| 1335 | Ga0496126_0008481 | 3300048929 | Bacteria | 11079 |
| 1336 | Ga0496126_0044132 | 3300048929 | Bacteria | 4107 |
| 1337 | Ga0496126_0048452 | 3300048929 | Bacteria | 3882 |
| 1338 | Ga0496126_0083884 | 3300048929 | Bacteria | 2811 |
| 1339 | Ga0496126_0177859 | 3300048929 | Bacteria | 1809 |
| 1340 | Ga0496126_0320285 | 3300048929 | Bacteria | 1274 |
| 1341 | Ga0501306_004128 | 3300049127 | Bacteria | 1610 |
| 1342 | Ga0501306_011179 | 3300049127 | Bacteria | 1141 |
| 1343 | Ga0501306_019243 | 3300049127 | Bacteria | 940 |
| 1344 | Ga0501306_034773 | 3300049127 | Bacteria | 762 |
| 1345 | Ga0501308_008276 | 3300049128 | Bacteria | 1110 |
| 1346 | Ga0501308_025975 | 3300049128 | Bacteria | 762 |
| 1347 | Ga0501309_012806 | 3300049129 | Bacteria | 1109 |
| 1348 | Ga0501309_013735 | 3300049129 | Bacteria | 1081 |
| 1349 | Ga0501309_030024 | 3300049129 | Bacteria | 799 |
| 1350 | Ga0501310_005255 | 3300049130 | Bacteria | 1325 |
| 1351 | Ga0501310_021926 | 3300049130 | Bacteria | 802 |
| 1352 | Ga0501310_023788 | 3300049130 | Bacteria | 781 |
| 1353 | Ga0501310_066367 | 3300049130 | Bacteria | 546 |
| 1354 | Ga0501341_00990 | 3300049131 | Bacteria | 1344 |
| 1355 | Ga0501343_012538 | 3300049132 | Bacteria | 705 |
| 1356 | Ga0501344_00344 | 3300049133 | Bacteria | 1866 |
| 1357 | Ga0501304_004410 | 3300049160 | Bacteria | 1067 |
| 1358 | Ga0501305_000354 | 3300049161 | Bacteria | 3644 |
| 1359 | Ga0501305_002631 | 3300049161 | Bacteria | 1957 |
| 1360 | Ga0501305_004263 | 3300049161 | Bacteria | 1672 |
| 1361 | Ga0501305_021675 | 3300049161 | Bacteria | 951 |
| 1362 | Ga0501305_076380 | 3300049161 | Bacteria | 596 |
| 1363 | Ga0501307_010639 | 3300049162 | Bacteria | 1068 |
| 1364 | Ga0501307_015224 | 3300049162 | Bacteria | 947 |
| 1365 | Ga0501307_051673 | 3300049162 | Bacteria | 620 |
| 1366 | Ga0495682_0191167 | 3300049460 | Bacteria | 727 |
| 1367 | Ga0501296_054618 | 3300049519 | Bacteria | 592 |
| 1368 | Ga0501298_003486 | 3300049521 | Bacteria | 2436 |
| 1369 | Ga0501311_039898 | 3300049527 | Bacteria | 709 |
| 1370 | Ga0501312_007402 | 3300049528 | Bacteria | 1398 |
| 1371 | Ga0501312_008754 | 3300049528 | Bacteria | 1321 |
| 1372 | Ga0501312_042860 | 3300049528 | Bacteria | 744 |
| 1373 | Ga0501312_045601 | 3300049528 | Bacteria | 727 |
| 1374 | Ga0501313_017594 | 3300049529 | Bacteria | 865 |
| 1375 | Ga0501315_000671 | 3300049531 | Bacteria | 2511 |
| 1376 | Ga0501315_008465 | 3300049531 | Bacteria | 1197 |
| 1377 | Ga0501315_009978 | 3300049531 | Bacteria | 1132 |
| 1378 | Ga0501316_001491 | 3300049532 | Bacteria | 2002 |
| 1379 | Ga0501316_018011 | 3300049532 | Bacteria | 870 |
| 1380 | Ga0501317_012886 | 3300049533 | Bacteria | 1038 |
| 1381 | Ga0501317_016772 | 3300049533 | Bacteria | 954 |
| 1382 | Ga0501318_000076 | 3300049534 | Bacteria | 4173 |
| 1383 | Ga0501318_013989 | 3300049534 | Bacteria | 941 |
| 1384 | Ga0501318_029125 | 3300049534 | Bacteria | 743 |
| 1385 | Ga0501319_000318 | 3300049535 | Bacteria | 2143 |
| 1386 | Ga0501320_014398 | 3300049536 | Bacteria | 855 |
| 1387 | Ga0501320_027491 | 3300049536 | Bacteria | 692 |
| 1388 | Ga0501321_000053 | 3300049537 | Bacteria | 4992 |
| 1389 | Ga0501321_026267 | 3300049537 | Bacteria | 755 |
| 1390 | Ga0501322_007193 | 3300049538 | Bacteria | 805 |
| 1391 | Ga0501323_000765 | 3300049539 | Bacteria | 2555 |
| 1392 | Ga0501331_05466 | 3300049547 | Bacteria | 726 |
| 1393 | Ga0501332_06617 | 3300049548 | Bacteria | 728 |
| 1394 | Ga0501334_00959 | 3300049550 | Bacteria | 1505 |
| 1395 | Ga0501334_02915 | 3300049550 | Bacteria | 1039 |
| 1396 | Ga0501335_001605 | 3300049551 | Bacteria | 1752 |
| 1397 | Ga0501335_010688 | 3300049551 | Bacteria | 890 |
| 1398 | Ga0501337_008190 | 3300049553 | Bacteria | 739 |
| 1399 | Ga0501338_00177 | 3300049554 | Bacteria | 2433 |
| 1400 | Ga0501338_00925 | 3300049554 | Bacteria | 1470 |
| 1401 | Ga0501031_0239667 | 3300049568 | Bacteria | 1179 |
| 1402 | Ga0501031_0557327 | 3300049568 | Bacteria | 738 |
| 1403 | Ga0501031_0681951 | 3300049568 | Bacteria | 660 |
| 1404 | Ga0501032_0325101 | 3300049569 | Bacteria | 992 |
| 1405 | Ga0501032_0346242 | 3300049569 | Bacteria | 957 |
| 1406 | Ga0501033_0002077 | 3300049570 | Bacteria | 17392 |
| 1407 | Ga0501033_0036910 | 3300049570 | Bacteria | 3660 |
| 1408 | Ga0501033_0294107 | 3300049570 | Bacteria | 1145 |
| 1409 | Ga0501033_0955939 | 3300049570 | Bacteria | 574 |
| 1410 | Ga0501034_0031313 | 3300049571 | Bacteria | 5403 |
| 1411 | Ga0501034_0059457 | 3300049571 | Bacteria | 3839 |
| 1412 | Ga0501034_0283524 | 3300049571 | Bacteria | 1596 |
| 1413 | Ga0501034_0318454 | 3300049571 | Bacteria | 1489 |
| 1414 | Ga0501036_0052778 | 3300049572 | Bacteria | 3443 |
| 1415 | Ga0501036_0104853 | 3300049572 | Bacteria | 2391 |
| 1416 | Ga0501036_0139089 | 3300049572 | Bacteria | 2049 |
| 1417 | Ga0501036_0767058 | 3300049572 | Bacteria | 795 |
| 1418 | Ga0501036_1190458 | 3300049572 | Bacteria | 621 |
| 1419 | Ga0501037_0105375 | 3300049573 | Bacteria | 2032 |
| 1420 | Ga0501037_0590647 | 3300049573 | Bacteria | 746 |
| 1421 | Ga0501037_0900533 | 3300049573 | Bacteria | 580 |
| 1422 | Ga0501038_0015370 | 3300049574 | Bacteria | 6959 |
| 1423 | Ga0501038_0046222 | 3300049574 | Bacteria | 3775 |
| 1424 | Ga0501038_0365187 | 3300049574 | Bacteria | 1122 |
| 1425 | Ga0501038_0809845 | 3300049574 | Bacteria | 696 |
| 1426 | Ga0501039_0045555 | 3300049575 | Bacteria | 3389 |
| 1427 | Ga0501039_0307863 | 3300049575 | Bacteria | 1245 |
| 1428 | Ga0501039_0339287 | 3300049575 | Bacteria | 1181 |
| 1429 | Ga0501039_0621604 | 3300049575 | Bacteria | 846 |
| 1430 | Ga0501039_1428197 | 3300049575 | Bacteria | 532 |
| 1431 | Ga0501040_0005770 | 3300049576 | Bacteria | 8012 |
| 1432 | Ga0501040_0040510 | 3300049576 | Bacteria | 3170 |
| 1433 | Ga0501040_0090079 | 3300049576 | Bacteria | 2132 |
| 1434 | Ga0501040_0301814 | 3300049576 | Bacteria | 1145 |
| 1435 | Ga0501041_0264148 | 3300049577 | Bacteria | 1082 |
| 1436 | Ga0501041_0546311 | 3300049577 | Bacteria | 738 |
| 1437 | Ga0501042_0004502 | 3300049578 | Bacteria | 8892 |
| 1438 | Ga0501042_0113857 | 3300049578 | Bacteria | 1948 |
| 1439 | Ga0501042_0118621 | 3300049578 | Bacteria | 1905 |
| 1440 | Ga0501042_0139499 | 3300049578 | Bacteria | 1747 |
| 1441 | Ga0501042_0328640 | 3300049578 | Bacteria | 1105 |
| 1442 | Ga0501042_0710417 | 3300049578 | Bacteria | 731 |
| 1443 | Ga0501042_0941121 | 3300049578 | Bacteria | 629 |
| 1444 | Ga0501043_0024294 | 3300049579 | Bacteria | 4756 |
| 1445 | Ga0501043_0105082 | 3300049579 | Bacteria | 2219 |
| 1446 | Ga0501043_0109899 | 3300049579 | Bacteria | 2165 |
| 1447 | Ga0501043_0281220 | 3300049579 | Bacteria | 1275 |
| 1448 | Ga0501046_0068472 | 3300049580 | Bacteria | 2763 |
| 1449 | Ga0501046_0149900 | 3300049580 | Bacteria | 1760 |
| 1450 | Ga0501046_0350647 | 3300049580 | Bacteria | 1072 |
| 1451 | Ga0501046_0363537 | 3300049580 | Bacteria | 1049 |
| 1452 | Ga0501046_0689292 | 3300049580 | Bacteria | 720 |
| 1453 | Ga0501047_0002309 | 3300049581 | Bacteria | 18240 |
| 1454 | Ga0501047_0100345 | 3300049581 | Bacteria | 2774 |
| 1455 | Ga0501047_0213392 | 3300049581 | Bacteria | 1788 |
| 1456 | Ga0501047_0356868 | 3300049581 | Bacteria | 1298 |
| 1457 | Ga0501047_0931947 | 3300049581 | Bacteria | 682 |
| 1458 | Ga0501048_0361060 | 3300049582 | Bacteria | 1036 |
| 1459 | Ga0501048_0509645 | 3300049582 | Bacteria | 863 |
| 1460 | Ga0501067_0067304 | 3300049583 | Bacteria | 1983 |
| 1461 | Ga0501067_0223633 | 3300049583 | Bacteria | 1048 |
| 1462 | Ga0501067_0465359 | 3300049583 | Bacteria | 706 |
| 1463 | Ga0501067_0620618 | 3300049583 | Bacteria | 607 |
| 1464 | Ga0501068_0298892 | 3300049584 | Bacteria | 1030 |
| 1465 | Ga0501068_0471549 | 3300049584 | Bacteria | 813 |
| 1466 | Ga0501068_0580432 | 3300049584 | Bacteria | 730 |
| 1467 | Ga0501068_0635252 | 3300049584 | Bacteria | 696 |
| 1468 | Ga0501068_0668152 | 3300049584 | Bacteria | 679 |
| 1469 | Ga0501069_0088758 | 3300049585 | Bacteria | 1748 |
| 1470 | Ga0501069_0484116 | 3300049585 | Bacteria | 737 |
| 1471 | Ga0501069_0578759 | 3300049585 | Bacteria | 673 |
| 1472 | Ga0501070_0071197 | 3300049586 | Bacteria | 2879 |
| 1473 | Ga0501070_0904573 | 3300049586 | Bacteria | 688 |
| 1474 | Ga0501071_0137989 | 3300049587 | Bacteria | 1815 |
| 1475 | Ga0501071_0143582 | 3300049587 | Bacteria | 1779 |
| 1476 | Ga0501071_0574053 | 3300049587 | Bacteria | 866 |
| 1477 | Ga0501072_0142181 | 3300049588 | Bacteria | 1913 |
| 1478 | Ga0501072_0392103 | 3300049588 | Bacteria | 1102 |
| 1479 | Ga0501072_0686193 | 3300049588 | Bacteria | 805 |
| 1480 | Ga0501072_0931213 | 3300049588 | Bacteria | 678 |
| 1481 | Ga0501072_1307190 | 3300049588 | Unclassified | 562 |
| 1482 | Ga0501073_0001779 | 3300049589 | Bacteria | 16021 |
| 1483 | Ga0501073_0037654 | 3300049589 | Bacteria | 3432 |
| 1484 | Ga0501073_0045274 | 3300049589 | Bacteria | 3098 |
| 1485 | Ga0501073_0069833 | 3300049589 | Bacteria | 2447 |
| 1486 | Ga0501073_0788141 | 3300049589 | Bacteria | 655 |
| 1487 | Ga0501074_0047398 | 3300049590 | Bacteria | 3107 |
| 1488 | Ga0501074_0332456 | 3300049590 | Bacteria | 1078 |
| 1489 | Ga0501074_0746388 | 3300049590 | Bacteria | 690 |
| 1490 | Ga0501075_0102422 | 3300049591 | Bacteria | 2174 |
| 1491 | Ga0501075_0180640 | 3300049591 | Bacteria | 1610 |
| 1492 | Ga0501075_0225133 | 3300049591 | Bacteria | 1430 |
| 1493 | Ga0501075_0456490 | 3300049591 | Bacteria | 974 |
| 1494 | Ga0501075_0464714 | 3300049591 | Bacteria | 965 |
| 1495 | Ga0501076_0026372 | 3300049592 | Bacteria | 4500 |
| 1496 | Ga0501076_0060048 | 3300049592 | Bacteria | 3024 |
| 1497 | Ga0501076_0071790 | 3300049592 | Bacteria | 2770 |
| 1498 | Ga0501076_0333132 | 3300049592 | Bacteria | 1245 |
| 1499 | Ga0501076_0349664 | 3300049592 | Bacteria | 1214 |
| 1500 | Ga0501076_0351125 | 3300049592 | Bacteria | 1211 |
| 1501 | Ga0501076_0715550 | 3300049592 | Bacteria | 826 |
| 1502 | Ga0501077_0002225 | 3300049593 | Bacteria | 11699 |
| 1503 | Ga0501077_0061022 | 3300049593 | Bacteria | 2392 |
| 1504 | Ga0501077_0375412 | 3300049593 | Bacteria | 908 |
| 1505 | Ga0501202_002850 | 3300049652 | Bacteria | 2933 |
| 1506 | Ga0501206_037206 | 3300049653 | Bacteria | 741 |
| 1507 | Ga0501216_001830 | 3300049660 | Bacteria | 2933 |
| 1508 | Ga0501217_002693 | 3300049661 | Bacteria | 3524 |
| 1509 | Ga0501224_003367 | 3300049664 | Bacteria | 2225 |
| 1510 | Ga0501249_006077 | 3300049679 | Bacteria | 2480 |
| 1511 | Ga0501249_113337 | 3300049679 | Bacteria | 657 |
| 1512 | Ga0501252_008618 | 3300049682 | Bacteria | 1175 |
| 1513 | Ga0501257_003539 | 3300049686 | Bacteria | 3360 |
| 1514 | Ga0501259_009288 | 3300049688 | Bacteria | 1595 |
| 1515 | Ga0501259_010099 | 3300049688 | Bacteria | 1539 |
| 1516 | Ga0501259_063762 | 3300049688 | Bacteria | 776 |
| 1517 | Ga0501261_047600 | 3300049690 | Bacteria | 694 |
| 1518 | Ga0501221_005725 | 3300049704 | Bacteria | 2086 |
| 1519 | Ga0501225_0007785 | 3300049705 | Bacteria | 3093 |
| 1520 | Ga0501225_0020042 | 3300049705 | Bacteria | 1849 |
| 1521 | Ga0501225_0111885 | 3300049705 | Bacteria | 806 |
| 1522 | Ga0501234_003516 | 3300049707 | Bacteria | 2464 |
| 1523 | Ga0501079_0051731 | 3300049741 | Bacteria | 3172 |
| 1524 | Ga0501079_0386375 | 3300049741 | Bacteria | 1097 |
| 1525 | Ga0501079_0948462 | 3300049741 | Bacteria | 678 |
| 1526 | Ga0501079_0962490 | 3300049741 | Bacteria | 672 |
| 1527 | Ga0501080_0052697 | 3300049742 | Bacteria | 3787 |
| 1528 | Ga0501080_0054417 | 3300049742 | Bacteria | 3726 |
| 1529 | Ga0501080_0112659 | 3300049742 | Bacteria | 2522 |
| 1530 | Ga0501080_0504950 | 3300049742 | Bacteria | 1080 |
| 1531 | Ga0501081_0096566 | 3300049743 | Bacteria | 2085 |
| 1532 | Ga0501083_0030882 | 3300049744 | Bacteria | 3677 |
| 1533 | Ga0501083_0032176 | 3300049744 | Bacteria | 3598 |
| 1534 | Ga0501083_0070828 | 3300049744 | Bacteria | 2318 |
| 1535 | Ga0501083_0111041 | 3300049744 | Bacteria | 1803 |
| 1536 | Ga0501083_0180954 | 3300049744 | Bacteria | 1376 |
| 1537 | Ga0501083_0201983 | 3300049744 | Bacteria | 1296 |
| 1538 | Ga0501083_0604150 | 3300049744 | Bacteria | 714 |
| 1539 | Ga0501263_029440 | 3300049760 | Bacteria | 770 |
| 1540 | Ga0501266_009896 | 3300049763 | Bacteria | 1209 |
| 1541 | Ga0501268_057571 | 3300049765 | Bacteria | 764 |
| 1542 | Ga0501271_011828 | 3300049768 | Bacteria | 938 |
| 1543 | Ga0501271_037720 | 3300049768 | Bacteria | 619 |
| 1544 | Ga0501273_011484 | 3300049770 | Bacteria | 1104 |
| 1545 | Ga0501273_036072 | 3300049770 | Bacteria | 718 |
| 1546 | Ga0501274_036867 | 3300049771 | Bacteria | 574 |
| 1547 | Ga0501283_023041 | 3300049779 | Bacteria | 1008 |
| 1548 | Ga0501035_0058280 | 3300049822 | Bacteria | 3442 |
| 1549 | Ga0501035_0395011 | 3300049822 | Bacteria | 1151 |
| 1550 | Ga0501035_0445753 | 3300049822 | Bacteria | 1071 |
| 1551 | Ga0501035_0657809 | 3300049822 | Bacteria | 849 |
| 1552 | Ga0501035_0771759 | 3300049822 | Bacteria | 770 |
| 1553 | Ga0501035_0969163 | 3300049822 | Bacteria | 670 |
| 1554 | Ga0501044_0011869 | 3300049823 | Bacteria | 9439 |
| 1555 | Ga0501044_0016973 | 3300049823 | Bacteria | 7810 |
| 1556 | Ga0501044_0028240 | 3300049823 | Bacteria | 5922 |
| 1557 | Ga0501044_0257531 | 3300049823 | Bacteria | 1684 |
| 1558 | Ga0501044_0291894 | 3300049823 | Bacteria | 1562 |
| 1559 | Ga0501044_0321932 | 3300049823 | Bacteria | 1470 |
| 1560 | Ga0501044_0643917 | 3300049823 | Bacteria | 949 |
| 1561 | Ga0501045_0039819 | 3300049824 | Bacteria | 3420 |
| 1562 | Ga0501045_0043958 | 3300049824 | Bacteria | 3253 |
| 1563 | Ga0501045_0046494 | 3300049824 | Bacteria | 3161 |
| 1564 | Ga0501045_0144542 | 3300049824 | Bacteria | 1769 |
| 1565 | Ga0501045_0168014 | 3300049824 | Bacteria | 1634 |
| 1566 | Ga0501045_0422494 | 3300049824 | Bacteria | 992 |
| 1567 | nmdc:mga03683_203910_c1 | 3300050489 | Bacteria | 908 |
| 1568 | nmdc:mga03683_245770_c1 | 3300050489 | Bacteria | 830 |
| 1569 | nmdc:mga03683_3690_c1 | 3300050489 | Bacteria | 4986 |
| 1570 | nmdc:mga03683_50000_c1 | 3300050489 | Bacteria | 1742 |
| 1571 | nmdc:mga03n38_45693_c1 | 3300050490 | Bacteria | 1930 |
| 1572 | nmdc:mga00v17_109370_c2 | 3300050491 | Bacteria | 1403 |
| 1573 | nmdc:mga00v17_202146_c1 | 3300050491 | Bacteria | 1284 |
| 1574 | nmdc:mga00v17_235130_c1 | 3300050491 | Bacteria | 1188 |
| 1575 | nmdc:mga00v17_400727_c1 | 3300050491 | Bacteria | 892 |
| 1576 | nmdc:mga00v17_411433_c1 | 3300050491 | Bacteria | 879 |
| 1577 | nmdc:mga00v17_429649_c1 | 3300050491 | Bacteria | 858 |
| 1578 | nmdc:mga00v17_6109_c1 | 3300050491 | Bacteria | 6376 |
| 1579 | nmdc:mga00v17_760893_c1 | 3300050491 | Bacteria | 619 |
| 1580 | nmdc:mga0yw44_34558_c1 | 3300050492 | Bacteria | 2963 |
| 1581 | nmdc:mga0yw44_953311_c1 | 3300050492 | Bacteria | 581 |
| 1582 | nmdc:mga0k408_116036_c1 | 3300050493 | Bacteria | 1584 |
| 1583 | nmdc:mga0k408_142373_c1 | 3300050493 | Bacteria | 1427 |
| 1584 | nmdc:mga0k408_159465_c1 | 3300050493 | Bacteria | 1344 |
| 1585 | nmdc:mga0k408_233297_c1 | 3300050493 | Bacteria | 1098 |
| 1586 | nmdc:mga0k408_287630_c1 | 3300050493 | Bacteria | 981 |
| 1587 | nmdc:mga06z11_119779_c1 | 3300050494 | Bacteria | 1467 |
| 1588 | nmdc:mga06z11_225767_c1 | 3300050494 | Bacteria | 1096 |
| 1589 | nmdc:mga06z11_325888_c1 | 3300050494 | Bacteria | 917 |
| 1590 | nmdc:mga06z11_527802_c1 | 3300050494 | Bacteria | 716 |
| 1591 | nmdc:mga06z11_574376_c1 | 3300050494 | Bacteria | 685 |
| 1592 | nmdc:mga04h51_111434_c1 | 3300050495 | Bacteria | 1009 |
| 1593 | nmdc:mga04h51_9587_c1 | 3300050495 | Bacteria | 2633 |
| 1594 | nmdc:mga07m45_40104_c1 | 3300050496 | Bacteria | 2620 |
| 1595 | nmdc:mga07m45_490199_c1 | 3300050496 | Bacteria | 712 |
| 1596 | nmdc:mga05p37_1161337_c1 | 3300050507 | Bacteria | 802 |
| 1597 | nmdc:mga05p37_1237033_c1 | 3300050507 | Bacteria | 768 |
| 1598 | nmdc:mga05p37_239822_c1 | 3300050507 | Bacteria | 2181 |
| 1599 | nmdc:mga05p37_765563_c1 | 3300050507 | Bacteria | 1062 |
| 1600 | nmdc:mga09592_207886_c1 | 3300050508 | Bacteria | 1695 |
| 1601 | nmdc:mga09592_300820_c1 | 3300050508 | Bacteria | 1391 |
| 1602 | nmdc:mga09592_406872_c1 | 3300050508 | Bacteria | 1176 |
| 1603 | nmdc:mga09592_51303_c1 | 3300050508 | Bacteria | 3480 |
| 1604 | nmdc:mga0qj67_27097_c1 | 3300050509 | Bacteria | 4440 |
| 1605 | nmdc:mga0qj67_38612_c1 | 3300050509 | Bacteria | 3746 |
| 1606 | nmdc:mga0qj67_429468_c1 | 3300050509 | Bacteria | 1065 |
| 1607 | nmdc:mga0qj67_453162_c1 | 3300050509 | Bacteria | 1033 |
| 1608 | nmdc:mga0qj67_562728_c1 | 3300050509 | Bacteria | 914 |
| 1609 | nmdc:mga0qj67_637581_c1 | 3300050509 | Bacteria | 851 |
| 1610 | nmdc:mga0qj67_813293_c1 | 3300050509 | Bacteria | 739 |
| 1611 | nmdc:mga0qj67_852665_c1 | 3300050509 | Bacteria | 719 |
| 1612 | nmdc:mga06r32_157928_c1 | 3300050510 | Bacteria | 2250 |
| 1613 | nmdc:mga06r32_35520_c1 | 3300050510 | Bacteria | 4703 |
| 1614 | nmdc:mga06r32_49523_c1 | 3300050510 | Bacteria | 4017 |
| 1615 | nmdc:mga06r32_502358_c1 | 3300050510 | Bacteria | 1189 |
| 1616 | nmdc:mga06r32_717576_c1 | 3300050510 | Bacteria | 964 |
| 1617 | nmdc:mga08y16_1022_c1 | 3300050511 | Bacteria | 27431 |
| 1618 | nmdc:mga08y16_220889_c1 | 3300050511 | Bacteria | 1962 |
| 1619 | nmdc:mga08y16_9663_c1 | 3300050511 | Bacteria | 10126 |
| 1620 | nmdc:mga0n895_1024074_c1 | 3300050512 | Bacteria | 806 |
| 1621 | nmdc:mga0n895_1075394_c1 | 3300050512 | Bacteria | 783 |
| 1622 | nmdc:mga0n895_420937_c1 | 3300050512 | Bacteria | 1350 |
| 1623 | nmdc:mga0n895_56685_c1 | 3300050512 | Bacteria | 3861 |
| 1624 | nmdc:mga0n895_584764_c1 | 3300050512 | Bacteria | 1120 |
| 1625 | nmdc:mga0rr50_1713724_c1 | 3300050513 | Bacteria | 529 |
| 1626 | nmdc:mga0rr50_59188_c1 | 3300050513 | Bacteria | 2875 |
| 1627 | nmdc:mga0rr50_739011_c1 | 3300050513 | Bacteria | 840 |
| 1628 | nmdc:mga08x19_257980_c1 | 3300050514 | Bacteria | 1205 |
| 1629 | nmdc:mga08x19_389314_c1 | 3300050514 | Bacteria | 977 |
| 1630 | nmdc:mga08x19_430151_c1 | 3300050514 | Bacteria | 928 |
| 1631 | nmdc:mga08x19_52577_c1 | 3300050514 | Bacteria | 2620 |
| 1632 | nmdc:mga08x19_70094_c1 | 3300050514 | Bacteria | 2284 |
| 1633 | nmdc:mga0a205_115431_c1 | 3300050515 | Bacteria | 2584 |
| 1634 | nmdc:mga0a205_17156_c2 | 3300050515 | Bacteria | 6126 |
| 1635 | nmdc:mga0a205_73030_c1 | 3300050515 | Bacteria | 3315 |
| 1636 | nmdc:mga0sz30_12087_c1 | 3300050516 | Bacteria | 3351 |
| 1637 | Ga0495612_0370940 | 3300053078 | Bacteria | 648 |
| 1638 | Ga0495595_0091572 | 3300053084 | Bacteria | 1459 |
| 1639 | Ga0495595_0236186 | 3300053084 | Bacteria | 914 |
| 1640 | Ga0495619_0026457 | 3300053085 | Bacteria | 3732 |
| 1641 | Ga0495619_0518288 | 3300053085 | Bacteria | 819 |
| 1642 | Ga0500578_0465597 | 3300053086 | Bacteria | 717 |
| 1643 | Ga0500643_000257 | 3300053087 | Bacteria | 48350 |
| 1644 | Ga0500643_053885 | 3300053087 | Bacteria | 1143 |
| 1645 | Ga0500644_0129712 | 3300053088 | Bacteria | 991 |
| 1646 | Ga0500644_0354935 | 3300053088 | Bacteria | 635 |
| 1647 | Ga0500646_0016200 | 3300053090 | Bacteria | 1945 |
| 1648 | Ga0500646_0236975 | 3300053090 | Bacteria | 638 |
| 1649 | Ga0500651_0114828 | 3300053093 | Bacteria | 1640 |
| 1650 | Ga0500566_0000145 | 3300053094 | Bacteria | 36304 |
| 1651 | Ga0500566_0045964 | 3300053094 | Bacteria | 2511 |
| 1652 | Ga0500641_0002249 | 3300053096 | Bacteria | 6833 |
| 1653 | Ga0500641_0058100 | 3300053096 | Bacteria | 1606 |
| 1654 | Ga0500650_0000177 | 3300053098 | Bacteria | 15840 |
| 1655 | Ga0500650_0511293 | 3300053098 | Bacteria | 510 |
| 1656 | Ga0500660_140434 | 3300053100 | Bacteria | 961 |
| 1657 | Ga0500555_005122 | 3300053103 | Bacteria | 3719 |
| 1658 | Ga0500557_031195 | 3300053105 | Bacteria | 1616 |
| 1659 | Ga0500562_021173 | 3300053108 | Bacteria | 1690 |
| 1660 | Ga0500594_0016341 | 3300053118 | Bacteria | 1802 |
| 1661 | Ga0500595_002532 | 3300053119 | Bacteria | 8971 |
| 1662 | Ga0500608_116868 | 3300053122 | Bacteria | 1215 |
| 1663 | Ga0500608_220941 | 3300053122 | Bacteria | 765 |
| 1664 | Ga0500642_0216137 | 3300053130 | Bacteria | 889 |
| 1665 | Ga0500652_003651 | 3300053131 | Bacteria | 4682 |
| 1666 | Ga0500658_0069513 | 3300053134 | Bacteria | 1482 |
| 1667 | Ga0500658_0216002 | 3300053134 | Bacteria | 878 |
| 1668 | Ga0500559_0058956 | 3300053136 | Bacteria | 1708 |
| 1669 | Ga0500559_0380517 | 3300053136 | Bacteria | 658 |
| 1670 | Ga0500568_0081998 | 3300053139 | Bacteria | 1223 |
| 1671 | Ga0500588_0094677 | 3300053146 | Bacteria | 1020 |
| 1672 | Ga0500588_0126585 | 3300053146 | Bacteria | 906 |
| 1673 | Ga0500588_0327001 | 3300053146 | Bacteria | 581 |
| 1674 | Ga0500588_0378764 | 3300053146 | Bacteria | 538 |
| 1675 | Ga0500604_0000214 | 3300053151 | Bacteria | 16659 |
| 1676 | Ga0500616_0001092 | 3300053153 | Bacteria | 28214 |
| 1677 | Ga0500620_112386 | 3300053155 | Bacteria | 954 |
| 1678 | Ga0500624_003750 | 3300053157 | Bacteria | 1992 |
| 1679 | Ga0500611_078959 | 3300053727 | Bacteria | 817 |
| 1680 | Ga0500609_002976 | 3300053731 | Bacteria | 2410 |
| 1681 | Ga0500609_015081 | 3300053731 | Bacteria | 1046 |
| 1682 | Ga0500656_003084 | 3300053732 | Bacteria | 1538 |
| 1683 | Ga0500587_007081 | 3300053739 | Bacteria | 1470 |
| 1684 | Ga0501084_0057691 | 3300054114 | Bacteria | 3248 |
| 1685 | Ga0501084_0118958 | 3300054114 | Bacteria | 2221 |
| 1686 | Ga0501084_0157081 | 3300054114 | Bacteria | 1918 |
| 1687 | Ga0501084_0374341 | 3300054114 | Bacteria | 1203 |
| 1688 | Ga0501084_0390070 | 3300054114 | Bacteria | 1176 |
| 1689 | Ga0501084_0457944 | 3300054114 | Bacteria | 1078 |
| 1690 | Ga0501084_0529287 | 3300054114 | Bacteria | 996 |
| 1691 | Ga0501084_0687767 | 3300054114 | Bacteria | 863 |
| 1692 | Ga0501084_0904140 | 3300054114 | Bacteria | 742 |
| 1693 | Ga0590071_031159 | 3300059421 | Bacteria | 1271 |
| 1694 | Ga0590077_060469 | 3300059426 | Bacteria | 859 |
| 1695 | Ga0587093_007145 | 3300059478 | Bacteria | 1238 |
| 1696 | Ga0587077_063377 | 3300059493 | Bacteria | 807 |
| 1697 | Ga0587106_014502 | 3300059605 | Bacteria | 1087 |
| 1698 | Ga0587106_044840 | 3300059605 | Bacteria | 764 |
| 1699 | Ga0587067_000785 | 3300059640 | Bacteria | 3067 |
| 1700 | Ga0587067_001858 | 3300059640 | Bacteria | 2386 |
| 1701 | Ga0587067_014676 | 3300059640 | Bacteria | 1259 |
| 1702 | Ga0587067_016174 | 3300059640 | Bacteria | 1222 |
| 1703 | Ga0587067_025488 | 3300059640 | Bacteria | 1052 |
| 1704 | Ga0587072_094599 | 3300059643 | Bacteria | 663 |
| 1705 | Ga0587076_031150 | 3300059645 | Bacteria | 946 |
| 1706 | Ga0587107_085843 | 3300059652 | Bacteria | 600 |
| 1707 | Ga0587111_0002690 | 3300060346 | Bacteria | 2416 |
| 1708 | Ga0501082_0025094 | 3300060353 | Bacteria | 5135 |
| 1709 | Ga0501082_0029360 | 3300060353 | Bacteria | 4737 |
| 1710 | Ga0501082_0047364 | 3300060353 | Bacteria | 3705 |
| 1711 | Ga0501082_0063845 | 3300060353 | Bacteria | 3170 |
| 1712 | Ga0501082_0137871 | 3300060353 | Bacteria | 2117 |
| 1713 | Ga0501082_0176034 | 3300060353 | Bacteria | 1860 |
| 1714 | Ga0501082_0371792 | 3300060353 | Bacteria | 1247 |
| 1715 | Ga0501082_0451807 | 3300060353 | Bacteria | 1123 |
| 1716 | Ga0501082_0780856 | 3300060353 | Bacteria | 836 |
| 1717 | Ga0466962_0002136 | 3300061719 | Bacteria | 9340 |
| 1718 | Ga0530510_0265649 | 3300061734 | Bacteria | 1280 |
| 1719 | Ga0530510_0388764 | 3300061734 | Bacteria | 1050 |
| 1720 | Ga0530510_0495140 | 3300061734 | Bacteria | 926 |
| 1721 | 2548699150 | 2547132424 | Bacteria | 8348532 |
| 1722 | 2550903208 | 2548877040 | Bacteria | 7507281 |
| 1723 | 2552110954 | 2551306166 | Bacteria | 9731570 |
| 1724 | 2563930184 | 2563366752 | Bacteria | 4961801 |
| 1725 | 2571530818 | 2571042143 | Bacteria | 6986194 |
| 1726 | 2573041357 | 2571042588 | Bacteria | 5045676 |
| 1727 | 2578338894 | 2576861424 | Bacteria | 5270569 |
| 1728 | 2580935017 | 2579778775 | Bacteria | 5360914 |
| 1729 | 2601641744 | 2600255286 | Bacteria | 5390125 |
| 1730 | 2621273305 | 2619619294 | Bacteria | 5575484 |
| 1731 | 2643738834 | 2643221543 | Bacteria | 6628015 |
| 1732 | 2687580640 | 2687453129 | Bacteria | 4387428 |
| 1733 | 2723606202 | 2721755693 | Bacteria | 6126117 |
| 1734 | 2728529881 | 2728368933 | Bacteria | 7044283 |
| 1735 | 2730136825 | 2728369359 | Bacteria | 5621728 |
| 1736 | 2744957418 | 2744054611 | Bacteria | 5611514 |
| 1737 | 2753813088 | 2751185905 | Bacteria | 6142767 |
| 1738 | 2802440716 | 2802428803 | Bacteria | 5806948 |
| 1739 | 2816421172 | 2816332119 | Bacteria | 8120218 |
| 1740 | 2821118313 | 2821111986 | Bacteria | 6894338 |
| 1741 | 2831907792 | 2831905167 | Bacteria | 3319172 |
| 1742 | 2836166066 | 2836160341 | Unclassified | 5867367 |
| 1743 | 2858440298 | 2858438669 | Bacteria | 2058402 |
| 1744 | 2864738879 | 2864733723 | Bacteria | 6770668 |
| 1745 | 2881635240 | 2881633906 | Bacteria | 2972201 |
| 1746 | 2881639861 | 2881636855 | Bacteria | 5205297 |
| 1747 | 2885529923 | 2885526491 | Bacteria | 7164189 |
| 1748 | 2889048017 | 2889042446 | Bacteria | 7618936 |
| 1749 | 2889276755 | 2889276214 | Bacteria | 5979355 |
| 1750 | 2902803555 | 2902799365 | Bacteria | 5419524 |
| 1751 | 2904168146 | 2904162308 | Bacteria | 7086713 |
| 1752 | 2904496957 | 2904490793 | Bacteria | 7046938 |
| 1753 | 2904600772 | 2904595352 | Bacteria | 6124848 |
| 1754 | 2907208208 | 2907202186 | Bacteria | 6632024 |
| 1755 | 2919166240 | 2919160200 | Bacteria | 6929020 |
| 1756 | 2919717102 | 2919713450 | Bacteria | 7431245 |
| 1757 | 2928521468 | 2928519762 | Bacteria | 1953908 |
| 1758 | 2931385123 | 2931384279 | Bacteria | 7299545 |
| 1759 | 2938653398 | 2938649242 | Bacteria | 7118381 |
| 1760 | 2939586671 | 2939582691 | Bacteria | 7088898 |
| 1761 | 2939685115 | 2939679117 | Bacteria | 6921672 |
| 1762 | 2939707595 | 2939702853 | Bacteria | 5139229 |
| 1763 | 2945996254 | 2945991243 | Bacteria | 7008369 |
| 1764 | 2946058944 | 2946053406 | Bacteria | 6978655 |
| 1765 | 2968562375 | 2968558590 | Bacteria | 6956864 |
| 1766 | 2971406744 | 2971403814 | Bacteria | 7370929 |
| 1767 | 2971513780 | 2971511577 | Bacteria | 5404012 |
| 1768 | 2980179433 | 2980176882 | Bacteria | 5397533 |
| 1769 | 2984531169 | 2984527788 | Bacteria | 5288478 |
| 1770 | 2984537278 | 2984532647 | Bacteria | 5288506 |
| 1771 | 2988229882 | 2988225383 | Bacteria | 7221625 |
| 1772 | 2996636931 | 2996632988 | Bacteria | 6921523 |
| 1773 | 2996707493 | 2996706504 | Bacteria | 5757485 |
| 1774 | 648172195 | 648028048 | Bacteria | 5394884 |
| 1775 | 8007374820 | 8007371054 | Bacteria | 4849201 |
| 1776 | 8054471322 | 8054465665 | Bacteria | 7323556 |
| 1777 | 8057979864 | 8057977335 | Bacteria | 5694872 |
| 1778 | Ga0114129_10052779 | |||
| 1779 | JGI24740J21852_10062791 | |||
| 1780 | Ga0006759J45824_1056753 | |||
| 1781 | Ga0007410J51695_1045473 | |||
| 1782 | Ga0007409J51694_1024387 | |||
| 1783 | Ga0007409J51694_1044244 | |||
| 1784 | Ga0007409J51694_1053788 | |||
| 1785 | Ga0006562J51391_1000361 | |||
| 1786 | Ga0007429J51699_1048322 | |||
| 1787 | Ga0032354_1045657 | |||
| 1788 | Ga0006780_1027699 | |||
| 1789 | Ga0055538_1000286 | |||
| 1790 | Ga0055534_1039117 | |||
| 1791 | Ga0055531_10000796 | |||
| 1792 | Ga0065712_10205784 | |||
| 1793 | Ga0065712_10433300 | |||
| 1794 | Ga0065715_10187396 | |||
| 1795 | Ga0065715_10788439 | |||
| 1796 | Ga0065707_10221170 | |||
| 1797 | Ga0065707_10401296 | |||
| 1798 | Ga0065707_10797972 | |||
| 1799 | Ga0070658_10011068 | |||
| 1800 | Ga0070676_10024501 | |||
| 1801 | Ga0070676_10031540 | |||
| 1802 | Ga0070683_100070071 | |||
| 1803 | Ga0070683_100362380 | |||
| 1804 | Ga0070690_100496054 | |||
| 1805 | Ga0070670_100002056 | |||
| 1806 | Ga0070670_100002307 | |||
| 1807 | Ga0070670_100122163 | |||
| 1808 | Ga0070670_100743315 | |||
| 1809 | Ga0070670_100779258 | |||
| 1810 | Ga0070670_101189417 | |||
| 1811 | Ga0070677_10274493 | |||
| 1812 | Ga0068869_100031842 | |||
| 1813 | Ga0068869_100308649 | |||
| 1814 | Ga0070666_10007485 | |||
| 1815 | Ga0070666_10011570 | |||
| 1816 | Ga0070666_10068020 | |||
| 1817 | Ga0070680_100003723 | |||
| 1818 | Ga0070680_100195764 | |||
| 1819 | Ga0070680_100295731 | |||
| 1820 | Ga0070680_100454173 | |||
| 1821 | Ga0070682_100323179 | |||
| 1822 | Ga0070682_100632636 | |||
| 1823 | Ga0068868_100013048 | |||
| 1824 | Ga0068868_100015066 | |||
| 1825 | Ga0070660_100062353 | |||
| 1826 | Ga0070660_100112711 | |||
| 1827 | Ga0070660_100451428 | |||
| 1828 | Ga0070660_100999793 | |||
| 1829 | Ga0070689_100051783 | |||
| 1830 | Ga0070691_10001573 | |||
| 1831 | Ga0070691_10041261 | |||
| 1832 | Ga0070691_10332720 | |||
| 1833 | Ga0070687_100267135 | |||
| 1834 | Ga0070661_100059480 | |||
| 1835 | Ga0070661_100169676 | |||
| 1836 | Ga0070661_100524424 | |||
| 1837 | Ga0070692_11085699 | |||
| 1838 | Ga0070668_100010252 | |||
| 1839 | Ga0070668_100038252 | |||
| 1840 | Ga0070668_100106275 | |||
| 1841 | Ga0070668_100620390 | |||
| 1842 | Ga0070668_100638545 | |||
| 1843 | Ga0070669_100002726 | |||
| 1844 | Ga0070669_100005517 | |||
| 1845 | Ga0070669_100007539 | |||
| 1846 | Ga0070669_100068379 | |||
| 1847 | Ga0070669_100098147 | |||
| 1848 | Ga0070669_100425785 | |||
| 1849 | Ga0070669_100795325 | |||
| 1850 | Ga0070675_100001855 | |||
| 1851 | Ga0070675_100050526 | |||
| 1852 | Ga0070675_100589636 | |||
| 1853 | Ga0070675_100690899 | |||
| 1854 | Ga0070671_100002650 | |||
| 1855 | Ga0070671_100079732 | |||
| 1856 | Ga0070671_100108997 | |||
| 1857 | Ga0070674_100026730 | |||
| 1858 | Ga0070674_100983210 | |||
| 1859 | Ga0070673_100078071 | |||
| 1860 | Ga0070673_100155510 | |||
| 1861 | Ga0070673_100213006 | |||
| 1862 | Ga0070688_100019751 | |||
| 1863 | Ga0070688_100099621 | |||
| 1864 | Ga0070688_100261347 | |||
| 1865 | Ga0070688_101595404 | |||
| 1866 | Ga0070659_100036885 | |||
| 1867 | Ga0070659_100109173 | |||
| 1868 | Ga0070659_100509516 | |||
| 1869 | Ga0070659_101167546 | |||
| 1870 | Ga0070667_100000182 | |||
| 1871 | Ga0070667_100002380 | |||
| 1872 | Ga0070667_100418432 | |||
| 1873 | Ga0070667_100815303 | |||
| 1874 | Ga0070703_10001173 | |||
| 1875 | Ga0070703_10326511 | |||
| 1876 | Ga0070709_10024990 | |||
| 1877 | Ga0070714_100129571 | |||
| 1878 | Ga0070714_100226624 | |||
| 1879 | Ga0070714_100269172 | |||
| 1880 | Ga0070713_100747594 | |||
| 1881 | Ga0070713_100800516 | |||
| 1882 | Ga0070713_100980339 | |||
| 1883 | Ga0070710_10084937 | |||
| 1884 | Ga0070710_10944094 | |||
| 1885 | Ga0070701_10018588 | |||
| 1886 | Ga0070701_10035019 | |||
| 1887 | Ga0070711_100070775 | |||
| 1888 | Ga0070711_100956753 | |||
| 1889 | Ga0070705_100416041 | |||
| 1890 | Ga0070705_100650429 | |||
| 1891 | Ga0070705_100718649 | |||
| 1892 | Ga0070705_100853656 | |||
| 1893 | Ga0070700_100093217 | |||
| 1894 | Ga0070700_100470498 | |||
| 1895 | Ga0070694_100202448 | |||
| 1896 | Ga0070694_100650595 | |||
| 1897 | Ga0070694_100756494 | |||
| 1898 | Ga0070708_100074062 | |||
| 1899 | Ga0070708_100085147 | |||
| 1900 | Ga0070708_100135308 | |||
| 1901 | Ga0070708_100322218 | |||
| 1902 | Ga0070708_100459989 | |||
| 1903 | Ga0070708_100566970 | |||
| 1904 | Ga0070708_100647681 | |||
| 1905 | Ga0070708_100833710 | |||
| 1906 | Ga0070663_100108856 | |||
| 1907 | Ga0070678_100000927 | |||
| 1908 | Ga0070678_100014242 | |||
| 1909 | Ga0070662_100035689 | |||
| 1910 | Ga0070662_100194092 | |||
| 1911 | Ga0070662_100821884 | |||
| 1912 | Ga0070681_10064027 | |||
| 1913 | Ga0070681_10074973 | |||
| 1914 | Ga0070681_10140829 | |||
| 1915 | Ga0070681_10160548 | |||
| 1916 | Ga0070681_10302540 | |||
| 1917 | Ga0070681_11366447 | |||
| 1918 | Ga0068867_100018242 | |||
| 1919 | Ga0068867_100615540 | |||
| 1920 | Ga0068867_101048138 | |||
| 1921 | Ga0070685_10000930 | |||
| 1922 | Ga0070685_10004383 | |||
| 1923 | Ga0070685_10447033 | |||
| 1924 | Ga0070685_10858622 | |||
| 1925 | Ga0070706_100004748 | |||
| 1926 | Ga0070706_100010395 | |||
| 1927 | Ga0070706_100195565 | |||
| 1928 | Ga0070706_100295987 | |||
| 1929 | Ga0070706_100377769 | |||
| 1930 | Ga0070706_100695757 | |||
| 1931 | Ga0070706_101081020 | |||
| 1932 | Ga0070706_101233574 | |||
| 1933 | Ga0070706_101293644 | |||
| 1934 | Ga0070707_100010518 | |||
| 1935 | Ga0070707_100105435 | |||
| 1936 | Ga0070707_100142800 | |||
| 1937 | Ga0070707_100323337 | |||
| 1938 | Ga0070707_100432910 | |||
| 1939 | Ga0070707_100435994 | |||
| 1940 | Ga0070707_100781246 | |||
| 1941 | Ga0070698_100006097 | |||
| 1942 | Ga0070698_100008328 | |||
| 1943 | Ga0070698_100166789 | |||
| 1944 | Ga0070698_100317497 | |||
| 1945 | Ga0070698_100334147 | |||
| 1946 | Ga0070698_100575861 | |||
| 1947 | Ga0070699_100105922 | |||
| 1948 | Ga0070699_100207864 | |||
| 1949 | Ga0070699_100413333 | |||
| 1950 | Ga0070699_100666870 | |||
| 1951 | Ga0070699_100692849 | |||
| 1952 | Ga0070679_100164291 | |||
| 1953 | Ga0070679_100344877 | |||
| 1954 | Ga0070679_100380252 | |||
| 1955 | Ga0070679_101498256 | |||
| 1956 | Ga0070684_100632503 | |||
| 1957 | Ga0070697_100034402 | |||
| 1958 | Ga0070697_100054813 | |||
| 1959 | Ga0070697_100152055 | |||
| 1960 | Ga0070697_100384757 | |||
| 1961 | Ga0070697_100856785 | |||
| 1962 | Ga0068853_100297257 | |||
| 1963 | Ga0070672_100000814 | |||
| 1964 | Ga0070672_100051306 | |||
| 1965 | Ga0070672_100121632 | |||
| 1966 | Ga0070686_100948786 | |||
| 1967 | Ga0070695_100310790 | |||
| 1968 | Ga0070695_100389550 | |||
| 1969 | Ga0070695_100475360 | |||
| 1970 | Ga0070695_100940369 | |||
| 1971 | Ga0070696_100000402 | |||
| 1972 | Ga0070696_100048070 | |||
| 1973 | Ga0070696_100193086 | |||
| 1974 | Ga0070696_100217708 | |||
| 1975 | Ga0070665_100021718 | |||
| 1976 | Ga0070665_100044489 | |||
| 1977 | Ga0070665_100078166 | |||
| 1978 | Ga0070665_100198917 | |||
| 1979 | Ga0070665_100279518 | |||
| 1980 | Ga0070665_100759495 | |||
| 1981 | Ga0070704_100077393 | |||
| 1982 | Ga0070704_100211849 | |||
| 1983 | Ga0070704_100449554 | |||
| 1984 | Ga0068855_100113615 | |||
| 1985 | Ga0068855_100825082 | |||
| 1986 | Ga0068855_101013049 | |||
| 1987 | Ga0070664_100001142 | |||
| 1988 | Ga0070664_100035211 | |||
| 1989 | Ga0070664_100437670 | |||
| 1990 | Ga0068857_100050906 | |||
| 1991 | Ga0068857_100182193 | |||
| 1992 | Ga0068857_100713020 | |||
| 1993 | Ga0068857_101352058 | |||
| 1994 | Ga0068854_100309562 | |||
| 1995 | Ga0068854_100393055 | |||
| 1996 | Ga0068854_102230401 | |||
| 1997 | Ga0068856_100056262 | |||
| 1998 | Ga0068856_100178454 | |||
| 1999 | Ga0068856_100446824 | |||
| 2000 | Ga0070702_100526875 | |||
| 2001 | Ga0068852_100003070 | |||
| 2002 | Ga0068852_100470368 | |||
| 2003 | Ga0068852_102310890 | |||
| 2004 | Ga0068859_100001212 | |||
| 2005 | Ga0068859_100154528 | |||
| 2006 | Ga0068859_100191981 | |||
| 2007 | Ga0068859_100479394 | |||
| 2008 | Ga0068859_100577431 | |||
| 2009 | Ga0068859_100715338 | |||
| 2010 | Ga0068859_102458176 | |||
| 2011 | Ga0068864_100001987 | |||
| 2012 | Ga0068864_100038254 | |||
| 2013 | Ga0068864_100381975 | |||
| 2014 | Ga0068864_100623740 | |||
| 2015 | Ga0068864_100996834 | |||
| 2016 | Ga0068866_10745053 | |||
| 2017 | Ga0068866_10782184 | |||
| 2018 | Ga0068861_100163348 | |||
| 2019 | Ga0068861_100196098 | |||
| 2020 | Ga0068861_100316050 | |||
| 2021 | Ga0068861_100507038 | |||
| 2022 | Ga0068861_101109228 | |||
| 2023 | Ga0068851_10041616 | |||
| 2024 | Ga0068870_10011131 | |||
| 2025 | Ga0068863_100167450 | |||
| 2026 | Ga0068863_100283806 | |||
| 2027 | Ga0068858_100000013 | |||
| 2028 | Ga0068858_100019338 | |||
| 2029 | Ga0068858_100028843 | |||
| 2030 | Ga0068858_100212692 | |||
| 2031 | Ga0068860_100000374 | |||
| 2032 | Ga0068860_100011522 | |||
| 2033 | Ga0068860_100021948 | |||
| 2034 | Ga0068862_100000276 | |||
| 2035 | Ga0068862_100003483 | |||
| 2036 | Ga0068862_100005911 | |||
| 2037 | Ga0068862_100045432 | |||
| 2038 | Ga0068862_100091212 | |||
| 2039 | Ga0068862_100733804 | |||
| 2040 | Ga0081455_10002585 | |||
| 2041 | Ga0081455_10111457 | |||
| 2042 | Ga0081455_10183819 | |||
| 2043 | Ga0081538_10000250 | |||
| 2044 | Ga0081538_10002047 | |||
| 2045 | Ga0081538_10004242 | |||
| 2046 | Ga0081538_10039894 | |||
| 2047 | Ga0081538_10120647 | |||
| 2048 | Ga0081540_1085069 | |||
| 2049 | Ga0081539_10001506 | |||
| 2050 | Ga0081539_10038405 | |||
| 2051 | Ga0070717_10562072 | |||
| 2052 | Ga0070717_11060191 | |||
| 2053 | Ga0075365_10036922 | |||
| 2054 | Ga0075365_10180100 | |||
| 2055 | Ga0075368_10139348 | |||
| 2056 | Ga0075363_100242932 | |||
| 2057 | Ga0075364_10008451 | |||
| 2058 | Ga0075364_10089506 | |||
| 2059 | Ga0075364_10130309 | |||
| 2060 | Ga0075364_10138190 | |||
| 2061 | Ga0075364_10931267 | |||
| 2062 | Ga0070716_100036854 | |||
| 2063 | Ga0070716_100043350 | |||
| 2064 | Ga0070716_100915053 | |||
| 2065 | Ga0070712_100652436 | |||
| 2066 | Ga0075362_10107326 | |||
| 2067 | Ga0075362_10290799 | |||
| 2068 | Ga0075367_10048764 | |||
| 2069 | Ga0075367_10304347 | |||
| 2070 | Ga0075367_10551589 | |||
| 2071 | Ga0075369_10009439 | |||
| 2072 | Ga0075366_10030187 | |||
| 2073 | Ga0075366_10269193 | |||
| 2074 | Ga0097621_100021807 | |||
| 2075 | Ga0097621_100033421 | |||
| 2076 | Ga0097621_101602749 | |||
| 2077 | Ga0075370_10291095 | |||
| 2078 | Ga0068871_100068667 | |||
| 2079 | Ga0068871_100426541 | |||
| 2080 | Ga0068871_100713525 | |||
| 2081 | Ga0075428_100003062 | |||
| 2082 | Ga0075428_100004546 | |||
| 2083 | Ga0075428_100033214 | |||
| 2084 | Ga0075428_100126007 | |||
| 2085 | Ga0075428_100317282 | |||
| 2086 | Ga0075428_100343670 | |||
| 2087 | Ga0075428_100986906 | |||
| 2088 | Ga0075430_100032747 | |||
| 2089 | Ga0075430_100049244 | |||
| 2090 | Ga0075430_100110180 | |||
| 2091 | Ga0075430_100379192 | |||
| 2092 | Ga0075430_100657733 | |||
| 2093 | Ga0075431_100026718 | |||
| 2094 | Ga0075431_100033578 | |||
| 2095 | Ga0075431_100165858 | |||
| 2096 | Ga0075431_100355293 | |||
| 2097 | Ga0075431_100447503 | |||
| 2098 | Ga0075431_100451883 | |||
| 2099 | Ga0075431_100645950 | |||
| 2100 | Ga0075431_100901646 | |||
| 2101 | Ga0075433_10100351 | |||
| 2102 | Ga0075433_10109925 | |||
| 2103 | Ga0075433_10980210 | |||
| 2104 | Ga0075434_100211111 | |||
| 2105 | Ga0075434_100388549 | |||
| 2106 | Ga0075434_100540207 | |||
| 2107 | Ga0075434_100669565 | |||
| 2108 | Ga0075429_100195963 | |||
| 2109 | Ga0075429_100196902 | |||
| 2110 | Ga0075429_100604815 | |||
| 2111 | Ga0068865_100014036 | |||
| 2112 | Ga0068865_100092886 | |||
| 2113 | Ga0075436_100060685 | |||
| 2114 | Ga0075436_100136803 | |||
| 2115 | Ga0075436_100145833 | |||
| 2116 | Ga0075436_100568409 | |||
| 2117 | Ga0097620_100001212 | |||
| 2118 | Ga0097620_100154522 | |||
| 2119 | Ga0097620_100191985 | |||
| 2120 | Ga0097620_100479396 | |||
| 2121 | Ga0097620_100577369 | |||
| 2122 | Ga0097620_100715339 | |||
| 2123 | Ga0097620_102457864 | |||
| 2124 | Ga0079104_1009762 | |||
| 2125 | Ga0075435_100177205 | |||
| 2126 | Ga0075435_100648233 | |||
| 2127 | Ga0099794_10000508 | |||
| 2128 | Ga0099794_10327384 | |||
| 2129 | Ga0105251_10002306 | |||
| 2130 | Ga0105240_10011091 | |||
| 2131 | Ga0105240_10949345 | |||
| 2132 | Ga0105240_11054150 | |||
| 2133 | Ga0105240_11930560 | |||
| 2134 | Ga0111539_10002526 | |||
| 2135 | Ga0111539_10006226 | |||
| 2136 | Ga0111539_10033972 | |||
| 2137 | Ga0111539_10045810 | |||
| 2138 | Ga0111539_10119988 | |||
| 2139 | Ga0111539_11327730 | |||
| 2140 | Ga0111539_12677412 | |||
| 2141 | Ga0105245_10228988 | |||
| 2142 | Ga0105247_10000181 | |||
| 2143 | Ga0105247_10030953 | |||
| 2144 | Ga0105247_10329141 | |||
| 2145 | Ga0114129_10252490 | |||
| 2146 | Ga0114129_10525152 | |||
| 2147 | Ga0114129_10534694 | |||
| 2148 | Ga0114129_10557193 | |||
| 2149 | Ga0114129_10642192 | |||
| 2150 | Ga0114129_11211130 | |||
| 2151 | Ga0114129_11268287 | |||
| 2152 | Ga0105241_10110539 | |||
| 2153 | Ga0105241_10843562 | |||
| 2154 | Ga0105242_10974134 | |||
| 2155 | Ga0105242_11038382 | |||
| 2156 | Ga0105242_11083070 | |||
| 2157 | Ga0105242_11108704 | |||
| 2158 | Ga0105248_10003161 | |||
| 2159 | Ga0105248_10005609 | |||
| 2160 | Ga0105248_10054570 | |||
| 2161 | Ga0105248_10202547 | |||
| 2162 | Ga0105248_11169156 | |||
| 2163 | Ga0105248_11675059 | |||
| 2164 | Ga0105237_10144547 | |||
| 2165 | Ga0105237_10399263 | |||
| 2166 | Ga0105237_10879343 | |||
| 2167 | Ga0105237_11448212 | |||
| 2168 | Ga0105237_11509674 | |||
| 2169 | Ga0105238_10001522 | |||
| 2170 | Ga0105249_10000022 | |||
| 2171 | Ga0105249_10002948 | |||
| 2172 | Ga0105249_10573766 | |||
| 2173 | Ga0105249_12169361 | |||
| 2174 | Ga0105249_12320707 | |||
| 2175 | Ga0105030_101848 | |||
| 2176 | Ga0105030_102476 | |||
| 2177 | Ga0105028_100806 | |||
| 2178 | Ga0105246_10002108 | |||
| 2179 | Ga0105246_11729437 | |||
| 2180 | Ga0157313_1011174 | |||
| 2181 | Ga0157373_10315847 | |||
| 2182 | Ga0157373_10964041 | |||
| 2183 | Ga0157373_11449903 | |||
| 2184 | Ga0157371_10041037 | |||
| 2185 | Ga0157371_10241189 | |||
| 2186 | Ga0157371_10729077 | |||
| 2187 | Ga0157371_11231855 | |||
| 2188 | Ga0157370_10094954 | |||
| 2189 | Ga0157370_10179549 | |||
| 2190 | Ga0157369_10008427 | |||
| 2191 | Ga0157369_10157994 | |||
| 2192 | Ga0157369_11046278 | |||
| 2193 | Ga0157374_10020253 | |||
| 2194 | Ga0157374_10033961 | |||
| 2195 | Ga0157374_10116700 | |||
| 2196 | Ga0157374_10961198 | |||
| 2197 | Ga0157378_10027056 | |||
| 2198 | Ga0157378_10158034 | |||
| 2199 | Ga0157378_11837221 | |||
| 2200 | Ga0163162_10063704 | |||
| 2201 | Ga0163162_10098775 | |||
| 2202 | Ga0163162_10358336 | |||
| 2203 | Ga0163162_11203684 | |||
| 2204 | Ga0157372_10031755 | |||
| 2205 | Ga0157372_10044546 | |||
| 2206 | Ga0157372_10359163 | |||
| 2207 | Ga0157372_11157986 | |||
| 2208 | Ga0157375_10028414 | |||
| 2209 | Ga0157375_11205163 | |||
| 2210 | Ga0157375_11282974 | |||
| 2211 | Ga0163163_10000199 | |||
| 2212 | Ga0163163_10039676 | |||
| 2213 | Ga0163163_10283003 | |||
| 2214 | Ga0163163_11312959 | |||
| 2215 | Ga0163163_11733838 | |||
| 2216 | Ga0157380_10010587 | |||
| 2217 | Ga0157380_10043910 | |||
| 2218 | Ga0157380_10250024 | |||
| 2219 | Ga0157380_10566971 | |||
| 2220 | Ga0157380_10847868 | |||
| 2221 | Ga0182008_10041010 | |||
| 2222 | Ga0182008_10152397 | |||
| 2223 | Ga0182008_10185051 | |||
| 2224 | Ga0157377_10604671 | |||
| 2225 | Ga0157379_10000012 | |||
| 2226 | Ga0157379_10008899 | |||
| 2227 | Ga0157379_10320944 | |||
| 2228 | Ga0157379_10542569 | |||
| 2229 | Ga0157379_10756558 | |||
| 2230 | Ga0157376_10031032 | |||
| 2231 | Ga0157376_10075218 | |||
| 2232 | Ga0157376_10351575 | |||
| 2233 | Ga0163161_10034746 | |||
| 2234 | Ga0163161_10101216 | |||
| 2235 | Ga0163161_10148631 | |||
| 2236 | Ga0197907_10842842 | |||
| 2237 | Ga0206356_11319651 | |||
| 2238 | Ga0206356_11500601 | |||
| 2239 | Ga0206349_1024608 | |||
| 2240 | Ga0206349_1745230 | |||
| 2241 | Ga0206355_1475037 | |||
| 2242 | Ga0206351_10124469 | |||
| 2243 | Ga0206350_11502833 | |||
| 2244 | Ga0206354_10460387 | |||
| 2245 | Ga0206354_11431530 | |||
| 2246 | Ga0206353_10817384 | |||
| 2247 | Ga0206353_12021091 | |||
| 2248 | Ga0213874_10150616 | |||
| 2249 | Ga0213876_10199108 | |||
| 2250 | Ga0213876_10386189 | |||
| 2251 | Ga0213876_10474630 | |||
| 2252 | Ga0213871_10096089 | |||
| 2253 | Ga0224712_10057651 | |||
| 2254 | Ga0224712_10125609 | |||
| 2255 | Ga0224712_10142605 | |||
| 2256 | Ga0224712_10204700 | |||
| 2257 | Ga0224712_10210212 | |||
| 2258 | Ga0209784_100141 | |||
| 2259 | Ga0209566_101957 | |||
| 2260 | Ga0209437_100331 | |||
| 2261 | Ga0209148_1003100 | |||
| 2262 | Ga0209455_1000393 | |||
| 2263 | Ga0209675_1014358 | |||
| 2264 | Ga0209676_1018090 | |||
| 2265 | Ga0209025_1000976 | |||
| 2266 | Ga0209758_1000005 | |||
| 2267 | Ga0209758_1042548 | |||
| 2268 | Ga0209050_1004058 | |||
| 2269 | Ga0209051_1059511 | |||
| 2270 | Ga0209257_1000023 | |||
| 2271 | Ga0209257_1000923 | |||
| 2272 | Ga0207697_10007079 | |||
| 2273 | Ga0207656_10036264 | |||
| 2274 | Ga0207655_1005399 | |||
| 2275 | Ga0207653_10000346 | |||
| 2276 | Ga0207682_10127891 | |||
| 2277 | Ga0207682_10395621 | |||
| 2278 | Ga0207692_10110914 | |||
| 2279 | Ga0207692_10214080 | |||
| 2280 | Ga0207710_10000091 | |||
| 2281 | Ga0207710_10008322 | |||
| 2282 | Ga0207710_10356931 | |||
| 2283 | Ga0207680_10029742 | |||
| 2284 | Ga0207680_10049566 | |||
| 2285 | Ga0207680_10074560 | |||
| 2286 | Ga0207680_10358063 | |||
| 2287 | Ga0207645_10008194 | |||
| 2288 | Ga0207645_10035340 | |||
| 2289 | Ga0207643_10023070 | |||
| 2290 | Ga0207705_10304545 | |||
| 2291 | Ga0207705_10351368 | |||
| 2292 | Ga0207705_10361585 | |||
| 2293 | Ga0207705_11435716 | |||
| 2294 | Ga0207684_10000334 | |||
| 2295 | Ga0207684_10136811 | |||
| 2296 | Ga0207684_10393676 | |||
| 2297 | Ga0207684_10458021 | |||
| 2298 | Ga0207684_10567323 | |||
| 2299 | Ga0207684_10749161 | |||
| 2300 | Ga0207654_10205690 | |||
| 2301 | Ga0207707_10045958 | |||
| 2302 | Ga0207707_10167807 | |||
| 2303 | Ga0207707_10196532 | |||
| 2304 | Ga0207707_10337211 | |||
| 2305 | Ga0207707_10538797 | |||
| 2306 | Ga0207707_10571493 | |||
| 2307 | Ga0207695_10122875 | |||
| 2308 | Ga0207695_10190635 | |||
| 2309 | Ga0207695_11092495 | |||
| 2310 | Ga0207695_11656623 | |||
| 2311 | Ga0207671_10399627 | |||
| 2312 | Ga0207671_10968327 | |||
| 2313 | Ga0207671_11198884 | |||
| 2314 | Ga0207693_10077869 | |||
| 2315 | Ga0207663_10823415 | |||
| 2316 | Ga0207663_10868801 | |||
| 2317 | Ga0207660_10005445 | |||
| 2318 | Ga0207660_10008048 | |||
| 2319 | Ga0207660_10064903 | |||
| 2320 | Ga0207660_10675224 | |||
| 2321 | Ga0207662_10164270 | |||
| 2322 | Ga0207662_10264263 | |||
| 2323 | Ga0207657_10048317 | |||
| 2324 | Ga0207657_10174189 | |||
| 2325 | Ga0207657_10443624 | |||
| 2326 | Ga0207649_10002438 | |||
| 2327 | Ga0207649_10178053 | |||
| 2328 | Ga0207652_10112919 | |||
| 2329 | Ga0207652_10355703 | |||
| 2330 | Ga0207652_10421559 | |||
| 2331 | Ga0207652_10467773 | |||
| 2332 | Ga0207646_10135949 | |||
| 2333 | Ga0207646_10167285 | |||
| 2334 | Ga0207646_10256716 | |||
| 2335 | Ga0207646_10272139 | |||
| 2336 | Ga0207646_10833926 | |||
| 2337 | Ga0207681_10001456 | |||
| 2338 | Ga0207681_10002180 | |||
| 2339 | Ga0207681_10006813 | |||
| 2340 | Ga0207681_10013464 | |||
| 2341 | Ga0207681_10046795 | |||
| 2342 | Ga0207681_10442108 | |||
| 2343 | Ga0207694_10012483 | |||
| 2344 | Ga0207650_10000013 | |||
| 2345 | Ga0207650_10160995 | |||
| 2346 | Ga0207650_10208889 | |||
| 2347 | Ga0207650_10773257 | |||
| 2348 | Ga0207659_10007946 | |||
| 2349 | Ga0207659_10328932 | |||
| 2350 | Ga0207687_10012723 | |||
| 2351 | Ga0207700_10090203 | |||
| 2352 | Ga0207700_10239771 | |||
| 2353 | Ga0207700_11788753 | |||
| 2354 | Ga0207664_10005552 | |||
| 2355 | Ga0207664_10077392 | |||
| 2356 | Ga0207664_10302913 | |||
| 2357 | Ga0207664_10788504 | |||
| 2358 | Ga0207664_11588432 | |||
| 2359 | Ga0207644_10001768 | |||
| 2360 | Ga0207644_10050886 | |||
| 2361 | Ga0207644_10875608 | |||
| 2362 | Ga0207690_10050292 | |||
| 2363 | Ga0207690_10054602 | |||
| 2364 | Ga0207690_10852156 | |||
| 2365 | Ga0207690_11171081 | |||
| 2366 | Ga0207706_10010117 | |||
| 2367 | Ga0207706_10224570 | |||
| 2368 | Ga0207706_10418505 | |||
| 2369 | Ga0207686_10537377 | |||
| 2370 | Ga0207670_10136812 | |||
| 2371 | Ga0207670_11271652 | |||
| 2372 | Ga0207669_10597939 | |||
| 2373 | Ga0207704_10004526 | |||
| 2374 | Ga0207704_10436926 | |||
| 2375 | Ga0207704_10768918 | |||
| 2376 | Ga0207665_10075043 | |||
| 2377 | Ga0207691_10002993 | |||
| 2378 | Ga0207691_10016889 | |||
| 2379 | Ga0207691_10201557 | |||
| 2380 | Ga0207691_10236755 | |||
| 2381 | Ga0207691_10339181 | |||
| 2382 | Ga0207691_10830920 | |||
| 2383 | Ga0207711_10000194 | |||
| 2384 | Ga0207711_10001175 | |||
| 2385 | Ga0207711_10006894 | |||
| 2386 | Ga0207711_10021671 | |||
| 2387 | Ga0207711_10301200 | |||
| 2388 | Ga0207711_10926764 | |||
| 2389 | Ga0207689_10025398 | |||
| 2390 | Ga0207689_10408396 | |||
| 2391 | Ga0207689_10525094 | |||
| 2392 | Ga0207661_10891224 | |||
| 2393 | Ga0207679_10029782 | |||
| 2394 | Ga0207679_10252057 | |||
| 2395 | Ga0207679_10292481 | |||
| 2396 | Ga0207667_10071802 | |||
| 2397 | Ga0207667_10552714 | |||
| 2398 | Ga0207667_11510105 | |||
| 2399 | Ga0207651_10089284 | |||
| 2400 | Ga0207651_10362796 | |||
| 2401 | Ga0207712_10000005 | |||
| 2402 | Ga0207712_10003305 | |||
| 2403 | Ga0207712_10189765 | |||
| 2404 | Ga0207668_10017667 | |||
| 2405 | Ga0207668_10610667 | |||
| 2406 | Ga0207668_10649424 | |||
| 2407 | Ga0207668_11345961 | |||
| 2408 | Ga0207668_11778855 | |||
| 2409 | Ga0207640_10079202 | |||
| 2410 | Ga0207640_10181862 | |||
| 2411 | Ga0207658_10000005 | |||
| 2412 | Ga0207658_10000316 | |||
| 2413 | Ga0207658_10302480 | |||
| 2414 | Ga0207658_10364561 | |||
| 2415 | Ga0207677_10014761 | |||
| 2416 | Ga0207677_10030582 | |||
| 2417 | Ga0207677_10966275 | |||
| 2418 | Ga0207703_10000009 | |||
| 2419 | Ga0207703_10033398 | |||
| 2420 | Ga0207703_10062349 | |||
| 2421 | Ga0207703_10111119 | |||
| 2422 | Ga0207703_11728902 | |||
| 2423 | Ga0207639_10316704 | |||
| 2424 | Ga0207639_10497360 | |||
| 2425 | Ga0207639_10510140 | |||
| 2426 | Ga0207639_10593627 | |||
| 2427 | Ga0207639_11450136 | |||
| 2428 | Ga0207678_10172580 | |||
| 2429 | Ga0207678_10237000 | |||
| 2430 | Ga0207678_10329191 | |||
| 2431 | Ga0207708_10089329 | |||
| 2432 | Ga0207708_10214586 | |||
| 2433 | Ga0207708_10226090 | |||
| 2434 | Ga0207708_10300724 | |||
| 2435 | Ga0207708_11339146 | |||
| 2436 | Ga0207702_10017536 | |||
| 2437 | Ga0207702_10035955 | |||
| 2438 | Ga0207702_10985906 | |||
| 2439 | Ga0207641_10000374 | |||
| 2440 | Ga0207641_10015593 | |||
| 2441 | Ga0207641_10020220 | |||
| 2442 | Ga0207648_10016611 | |||
| 2443 | Ga0207648_10146278 | |||
| 2444 | Ga0207648_10204641 | |||
| 2445 | Ga0207676_10000010 | |||
| 2446 | Ga0207676_10150527 | |||
| 2447 | Ga0207676_10647724 | |||
| 2448 | Ga0207676_11685973 | |||
| 2449 | Ga0207674_10024732 | |||
| 2450 | Ga0207674_10300504 | |||
| 2451 | Ga0207674_10367003 | |||
| 2452 | Ga0207674_10783050 | |||
| 2453 | Ga0207675_100187679 | |||
| 2454 | Ga0207675_100289825 | |||
| 2455 | Ga0207675_100451240 | |||
| 2456 | Ga0207683_10002751 | |||
| 2457 | Ga0207683_10013665 | |||
| 2458 | Ga0207698_10187568 | |||
| 2459 | Ga0207698_11363396 | |||
| 2460 | Ga0207698_11947356 | |||
| 2461 | Ga0209281_1000059 | |||
| 2462 | Ga0209281_1000435 | |||
| 2463 | Ga0209969_1007660 | |||
| 2464 | Ga0209996_1058107 | |||
| 2465 | Ga0209984_1006559 | |||
| 2466 | Ga0210000_1009267 | |||
| 2467 | Ga0209968_1004394 | |||
| 2468 | Ga0209999_1006517 | |||
| 2469 | Ga0209588_1000251 | |||
| 2470 | Ga0209588_1000362 | |||
| 2471 | Ga0209588_1001330 | |||
| 2472 | Ga0209971_1012667 | |||
| 2473 | Ga0209971_1017060 | |||
| 2474 | Ga0209971_1045820 | |||
| 2475 | Ga0209971_1070692 | |||
| 2476 | Ga0209966_1005494 | |||
| 2477 | Ga0209966_1013498 | |||
| 2478 | Ga0209998_10000827 | |||
| 2479 | Ga0209813_10021644 | |||
| 2480 | Ga0209974_10031372 | |||
| 2481 | Ga0209974_10039058 | |||
| 2482 | Ga0207428_10007006 | |||
| 2483 | Ga0207428_10206281 | |||
| 2484 | Ga0207428_10216488 | |||
| 2485 | Ga0268266_10005783 | |||
| 2486 | Ga0268266_10015745 | |||
| 2487 | Ga0268266_10025628 | |||
| 2488 | Ga0268266_10322818 | |||
| 2489 | Ga0268266_10509776 | |||
| 2490 | Ga0268266_11185826 | |||
| 2491 | Ga0268265_10000005 | |||
| 2492 | Ga0268265_10005692 | |||
| 2493 | Ga0268265_10312014 | |||
| 2494 | Ga0268264_10000005 | |||
| 2495 | Ga0268264_10000036 | |||
| 2496 | Ga0268264_10021192 | |||
| 2497 | Ga0265337_1018941 | |||
| 2498 | Ga0265334_10000696 | |||
| 2499 | Ga0265336_10057375 | |||
| 2500 | Ga0307517_10314249 | |||
| 2501 | Ga0265338_10001162 | |||
| 2502 | Ga0265338_10002345 | |||
| 2503 | Ga0265338_10003372 | |||
| 2504 | Ga0265338_10016708 | |||
| 2505 | Ga0265338_10123235 | |||
| 2506 | Ga0265338_10146696 | |||
| 2507 | Ga0265338_10415861 | |||
| 2508 | Ga0307511_10145620 | |||
| 2509 | Ga0265320_10032146 | |||
| 2510 | Ga0265339_10023939 | |||
| 2511 | Ga0265331_10026588 | |||
| 2512 | Ga0265331_10293791 | |||
| 2513 | Ga0265327_10000312 | |||
| 2514 | Ga0265327_10002455 | |||
| 2515 | Ga0265327_10027637 | |||
| 2516 | Ga0307513_10361209 | |||
| 2517 | Ga0307509_10025225 | |||
| 2518 | Ga0307408_100009220 | |||
| 2519 | Ga0307408_100033362 | |||
| 2520 | Ga0307408_100051835 | |||
| 2521 | Ga0307408_100201566 | |||
| 2522 | Ga0307408_100307066 | |||
| 2523 | Ga0307408_100373555 | |||
| 2524 | Ga0307408_100384788 | |||
| 2525 | Ga0307408_100919291 | |||
| 2526 | Ga0307408_101466484 | |||
| 2527 | Ga0307408_101505937 | |||
| 2528 | Ga0316575_10015099 | |||
| 2529 | Ga0316575_10043573 | |||
| 2530 | Ga0316575_10300843 | |||
| 2531 | Ga0316579_10000529 | |||
| 2532 | Ga0316579_10003688 | |||
| 2533 | Ga0316579_10050777 | |||
| 2534 | Ga0316579_10054667 | |||
| 2535 | Ga0316579_10067394 | |||
| 2536 | Ga0265314_10190213 | |||
| 2537 | Ga0316576_10013705 | |||
| 2538 | Ga0316576_10015936 | |||
| 2539 | Ga0316576_10025514 | |||
| 2540 | Ga0316576_10028479 | |||
| 2541 | Ga0316576_10038662 | |||
| 2542 | Ga0316576_10039585 | |||
| 2543 | Ga0316576_10063805 | |||
| 2544 | Ga0316576_10097640 | |||
| 2545 | Ga0316576_10158683 | |||
| 2546 | Ga0316576_10173970 | |||
| 2547 | Ga0316576_10221555 | |||
| 2548 | Ga0316576_10280276 | |||
| 2549 | Ga0316578_10000297 | |||
| 2550 | Ga0316578_10023580 | |||
| 2551 | Ga0316578_10058895 | |||
| 2552 | Ga0316578_10133274 | |||
| 2553 | Ga0316578_10157443 | |||
| 2554 | Ga0316578_10166409 | |||
| 2555 | Ga0316578_10211993 | |||
| 2556 | Ga0316578_10346719 | |||
| 2557 | Ga0307516_10146217 | |||
| 2558 | Ga0307405_10001836 | |||
| 2559 | Ga0307405_10042077 | |||
| 2560 | Ga0307405_10249253 | |||
| 2561 | Ga0307405_10268093 | |||
| 2562 | Ga0307405_10377575 | |||
| 2563 | Ga0307405_10422933 | |||
| 2564 | Ga0307405_10490602 | |||
| 2565 | Ga0307405_11580594 | |||
| 2566 | Ga0316577_10002578 | |||
| 2567 | Ga0316577_10011579 | |||
| 2568 | Ga0316577_10078658 | |||
| 2569 | Ga0316577_10095415 | |||
| 2570 | Ga0316577_10103642 | |||
| 2571 | Ga0316577_10253383 | |||
| 2572 | Ga0307413_10008860 | |||
| 2573 | Ga0307413_10018651 | |||
| 2574 | Ga0307413_10044677 | |||
| 2575 | Ga0307413_10046732 | |||
| 2576 | Ga0307413_10052233 | |||
| 2577 | Ga0307413_10134669 | |||
| 2578 | Ga0307413_10366790 | |||
| 2579 | Ga0307413_10567553 | |||
| 2580 | Ga0307413_10607980 | |||
| 2581 | Ga0307413_10903068 | |||
| 2582 | Ga0307413_10989002 | |||
| 2583 | Ga0307413_11054498 | |||
| 2584 | Ga0307413_11204081 | |||
| 2585 | Ga0307410_10019636 | |||
| 2586 | Ga0307410_10042454 | |||
| 2587 | Ga0307410_10042619 | |||
| 2588 | Ga0307410_10052182 | |||
| 2589 | Ga0307410_10082498 | |||
| 2590 | Ga0307410_10132191 | |||
| 2591 | Ga0307410_10172794 | |||
| 2592 | Ga0307410_10351954 | |||
| 2593 | Ga0307410_10496441 | |||
| 2594 | Ga0307410_11333103 | |||
| 2595 | Ga0307406_10013051 | |||
| 2596 | Ga0307406_10062091 | |||
| 2597 | Ga0307406_10074031 | |||
| 2598 | Ga0307406_10088711 | |||
| 2599 | Ga0307406_10214984 | |||
| 2600 | Ga0307406_10315395 | |||
| 2601 | Ga0307406_10801055 | |||
| 2602 | Ga0307406_10975829 | |||
| 2603 | Ga0307407_10002652 | |||
| 2604 | Ga0307407_10028799 | |||
| 2605 | Ga0307407_10029059 | |||
| 2606 | Ga0307407_10129502 | |||
| 2607 | Ga0307407_10266576 | |||
| 2608 | Ga0307407_10695366 | |||
| 2609 | Ga0307407_11022856 | |||
| 2610 | Ga0307407_11227052 | |||
| 2611 | Ga0307412_10100902 | |||
| 2612 | Ga0307412_10106966 | |||
| 2613 | Ga0307412_10133062 | |||
| 2614 | Ga0307412_10430609 | |||
| 2615 | Ga0307412_10467138 | |||
| 2616 | Ga0307412_10740698 | |||
| 2617 | Ga0307412_10758762 | |||
| 2618 | Ga0307412_10771780 | |||
| 2619 | Ga0307412_10851557 | |||
| 2620 | Ga0307412_11882971 | |||
| 2621 | Ga0307409_100000888 | |||
| 2622 | Ga0307409_100002284 | |||
| 2623 | Ga0307409_100028482 | |||
| 2624 | Ga0307409_100081501 | |||
| 2625 | Ga0307409_100241061 | |||
| 2626 | Ga0307409_100335946 | |||
| 2627 | Ga0307409_100994843 | |||
| 2628 | Ga0307409_102611639 | |||
| 2629 | Ga0307416_100026442 | |||
| 2630 | Ga0307416_100043587 | |||
| 2631 | Ga0307416_100047997 | |||
| 2632 | Ga0307416_100054613 | |||
| 2633 | Ga0307416_100100154 | |||
| 2634 | Ga0307416_100154183 | |||
| 2635 | Ga0307416_100203453 | |||
| 2636 | Ga0307416_100284928 | |||
| 2637 | Ga0307416_100291755 | |||
| 2638 | Ga0307416_100332627 | |||
| 2639 | Ga0307416_100383147 | |||
| 2640 | Ga0307416_100429826 | |||
| 2641 | Ga0307416_100638348 | |||
| 2642 | Ga0307416_100700859 | |||
| 2643 | Ga0307416_100739180 | |||
| 2644 | Ga0307416_101731383 | |||
| 2645 | Ga0307416_102263424 | |||
| 2646 | Ga0307414_10018271 | |||
| 2647 | Ga0307414_10024309 | |||
| 2648 | Ga0307414_10131036 | |||
| 2649 | Ga0307414_10425217 | |||
| 2650 | Ga0307414_11095404 | |||
| 2651 | Ga0307414_11333040 | |||
| 2652 | Ga0307414_11471199 | |||
| 2653 | Ga0307414_11716381 | |||
| 2654 | Ga0307411_10000730 | |||
| 2655 | Ga0307411_10039068 | |||
| 2656 | Ga0307411_10070769 | |||
| 2657 | Ga0307411_10071855 | |||
| 2658 | Ga0307411_10141901 | |||
| 2659 | Ga0307411_10417075 | |||
| 2660 | Ga0307411_10466572 | |||
| 2661 | Ga0307411_11288362 | |||
| 2662 | Ga0307411_12254602 | |||
| 2663 | Ga0307415_100004429 | |||
| 2664 | Ga0307415_100009003 | |||
| 2665 | Ga0307415_100025447 | |||
| 2666 | Ga0307415_100038401 | |||
| 2667 | Ga0307415_100109461 | |||
| 2668 | Ga0307415_100174003 | |||
| 2669 | Ga0307415_100236818 | |||
| 2670 | Ga0307415_100250330 | |||
| 2671 | Ga0307415_100293352 | |||
| 2672 | Ga0307415_100495902 | |||
| 2673 | Ga0307415_101033149 | |||
| 2674 | Ga0307415_102180569 | |||
| 2675 | Ga0316583_10237049 | |||
| 2676 | Ga0316585_10003510 | |||
| 2677 | Ga0316580_10020515 | |||
| 2678 | Ga0316580_10027818 | |||
| 2679 | Ga0316580_10034344 | |||
| 2680 | Ga0316580_10042966 | |||
| 2681 | Ga0316580_10085789 | |||
| 2682 | Ga0316593_10011628 | |||
| 2683 | Ga0316593_10018591 | |||
| 2684 | Ga0316593_10035094 | |||
| 2685 | Ga0316593_10048644 | |||
| 2686 | Ga0316593_10062619 | |||
| 2687 | Ga0316593_10067614 | |||
| 2688 | Ga0316593_10071721 | |||
| 2689 | Ga0316593_10079782 | |||
| 2690 | Ga0316593_10082715 | |||
| 2691 | Ga0316593_10091462 | |||
| 2692 | Ga0316593_10092605 | |||
| 2693 | Ga0316593_10234034 | |||
| 2694 | Ga0316593_10292797 | |||
| 2695 | Ga0307507_10220676 | |||
| 2696 | Ga0316592_1011620 | |||
| 2697 | Ga0316592_1020031 | |||
| 2698 | Ga0316592_1024046 | |||
| 2699 | Ga0316592_1029073 | |||
| 2700 | Ga0316592_1044259 | |||
| 2701 | Ga0316592_1113556 | |||
| 2702 | Ga0316586_1006419 | |||
| 2703 | Ga0316586_1013980 | |||
| 2704 | Ga0316586_1054077 | |||
| 2705 | Ga0316588_1000381 | |||
| 2706 | Ga0316588_1016871 | |||
| 2707 | Ga0316588_1029418 | |||
| 2708 | Ga0316588_1033697 | |||
| 2709 | Ga0316588_1035423 | |||
| 2710 | Ga0316588_1040871 | |||
| 2711 | Ga0316588_1066071 | |||
| 2712 | Ga0316588_1067351 | |||
| 2713 | Ga0316587_1001390 | |||
| 2714 | Ga0316587_1001397 | |||
| 2715 | Ga0316587_1069775 | |||
| 2716 | Ga0316596_1000809 | |||
| 2717 | Ga0316596_1001581 | |||
| 2718 | Ga0316596_1003169 | |||
| 2719 | Ga0316596_1003639 | |||
| 2720 | Ga0316596_1005690 | |||
| 2721 | Ga0316596_1007456 | |||
| 2722 | Ga0316596_1041747 | |||
| 2723 | Ga0316596_1042102 | |||
| 2724 | Ga0316596_1044118 | |||
| 2725 | Ga0316596_1044890 | |||
| 2726 | Ga0316596_1063526 | |||
| 2727 | Ga0316596_1078007 | |||
| 2728 | Ga0316596_1081354 | |||
| 2729 | Ga0316596_1085247 | |||
| 2730 | Ga0316596_1136194 | |||
| 2731 | Ga0316596_1159106 | |||
| 2732 | Ga0316596_1190243 | |||
| 2733 | Ga0316596_1228787 | |||
| 2734 | Ga0373930_0014155 | |||
| 2735 | Ga0373959_0028220 | |||
| 2736 | Ga0373952_0043857 | |||
| 2737 | Ga0373932_0315955 | |||
| 2738 | Ga0373945_0136371 | |||
| 2739 | Ga0373953_0182086 | |||
| 2740 | Ga0373956_0296800 | |||
| 2741 | Ga0373957_0132503 | |||
| 2742 | Ga0373946_0244297 | |||
| 2743 | Ga0373946_0414680 | |||
| 2744 | Ga0373942_0048711 | |||
| 2745 | Ga0373942_0115231 | |||
| 2746 | Ga0373962_0197196 | |||
| 2747 | Ga0316574_0009869 | |||
| 2748 | Ga0316574_0010199 | |||
| 2749 | Ga0316574_0010767 | |||
| 2750 | Ga0316574_0015270 | |||
| 2751 | Ga0316574_0017334 | |||
| 2752 | Ga0316574_0020530 | |||
| 2753 | Ga0316574_0025730 | |||
| 2754 | Ga0316574_0037156 | |||
| 2755 | Ga0316574_0056033 | |||
| 2756 | Ga0316574_0062050 | |||
| 2757 | Ga0316574_0076353 | |||
| 2758 | Ga0316574_0104644 | |||
| 2759 | Ga0316574_0165851 | |||
| 2760 | Ga0316574_0177983 | |||
| 2761 | Ga0316574_0186096 | |||
| 2762 | Ga0316574_0340285 | |||
| 2763 | Ga0316574_0370418 | |||
| 2764 | Ga0316574_0414430 | |||
| 2765 | Ga0316574_0772972 | |||
| 2766 | Ga0373924_0056426 | |||
| 2767 | Ga0373924_0284831 | |||
| 2768 | Ga0373924_0286149 | |||
| 2769 | Ga0373935_0469570 | |||
| 2770 | Ga0373935_0470283 | |||
| 2771 | Ga0373927_0685057 | |||
| 2772 | Ga0373933_0253844 | |||
| 2773 | Ga0373933_0552244 | |||
| 2774 | Ga0373947_0492266 | |||
| 2775 | Ga0373937_0004917 | |||
| 2776 | Ga0373937_0115042 | |||
| 2777 | Ga0373937_0242538 | |||
| 2778 | Ga0373937_0243744 | |||
| 2779 | Ga0373937_0395534 | |||
| 2780 | Ga0316582_0011881 | |||
| 2781 | Ga0316582_0024484 | |||
| 2782 | Ga0316582_0061207 | |||
| 2783 | Ga0316582_0065118 | |||
| 2784 | Ga0316582_0148192 | |||
| 2785 | Ga0316582_0151574 | |||
| 2786 | Ga0316582_0153311 | |||
| 2787 | Ga0316582_0248393 | |||
| 2788 | Ga0316582_0248868 | |||
| 2789 | Ga0316582_0379677 | |||
| 2790 | Ga0316582_0876016 | |||
| 2791 | Ga0316584_0001224 | |||
| 2792 | Ga0316584_0017856 | |||
| 2793 | Ga0316584_0022065 | |||
| 2794 | Ga0316584_0034071 | |||
| 2795 | Ga0316584_0071847 | |||
| 2796 | Ga0316584_0078936 | |||
| 2797 | Ga0316584_0122871 | |||
| 2798 | Ga0316584_0178391 | |||
| 2799 | Ga0316584_0187936 | |||
| 2800 | Ga0316584_0430803 | |||
| 2801 | Ga0316584_0644193 | |||
| 2802 | Ga0316584_0840487 | |||
| 2803 | Ga0395899_0018915 | |||
| 2804 | Ga0395899_0040785 | |||
| 2805 | Ga0395900_0005893 | |||
| 2806 | Ga0395900_0042149 | |||
| 2807 | Ga0395900_1127151 | |||
| 2808 | Ga0395900_1690463 | |||
| 2809 | Ga0395898_0010463 | |||
| 2810 | Ga0395898_0103035 | |||
| 2811 | Ga0395905_0001744 | |||
| 2812 | Ga0395905_0001868 | |||
| 2813 | Ga0395905_0003132 | |||
| 2814 | Ga0395905_1440911 | |||
| 2815 | Ga0316581_0016906 | |||
| 2816 | Ga0316581_0023744 | |||
| 2817 | Ga0316581_0138789 | |||
| 2818 | Ga0436364_1352329 | |||
| 2819 | Ga0436364_1565178 | |||
| 2820 | Ga0395901_0005863 | |||
| 2821 | Ga0395901_0021450 | |||
| 2822 | Ga0395901_0120202 | |||
| 2823 | Ga0400484_13801 | |||
| 2824 | Ga0400490_04174 | |||
| 2825 | Ga0400490_17180 | |||
| 2826 | Ga0400488_15248 | |||
| 2827 | Ga0400488_39600 | |||
| 2828 | Ga0400483_042512 | |||
| 2829 | Ga0400483_201072 | |||
| 2830 | Ga0400483_213487 | |||
| 2831 | Ga0400483_240025 | |||
| 2832 | Ga0400483_257690 | |||
| 2833 | Ga0400489_36376 | |||
| 2834 | Ga0436365_0411139 | |||
| 2835 | Ga0436365_1018434 | |||
| 2836 | Ga0436360_0649591 | |||
| 2837 | Ga0436360_1050896 | |||
| 2838 | Ga0436361_0672840 | |||
| 2839 | Ga0436363_1297639 | |||
| 2840 | Ga0436362_0262950 | |||
| 2841 | Ga0439439_0012711 | |||
| 2842 | Ga0439439_0073821 | |||
| 2843 | Ga0439439_0104370 | |||
| 2844 | Ga0439453_0034568 | |||
| 2845 | Ga0439461_0044592 | |||
| 2846 | Ga0451793_0134173 | |||
| 2847 | Ga0451797_0187552 | |||
| 2848 | Ga0451798_0564405 | |||
| 2849 | Ga0451802_0912448 | |||
| 2850 | Ga0451805_111226 | |||
| 2851 | Ga0451804_0943745 | |||
| 2852 | Ga0451849_1137113 | |||
| 2853 | Ga0451843_1162918 | |||
| 2854 | Ga0439445_0096997 | |||
| 2855 | Ga0439449_0028437 | |||
| 2856 | Ga0439450_222320 | |||
| 2857 | Ga0439457_050041 | |||
| 2858 | Ga0439457_075968 | |||
| 2859 | Ga0439462_0008464 | |||
| 2860 | Ga0450899_042530 | |||
| 2861 | Ga0450906_103493 | |||
| 2862 | Ga0439446_0017862 | |||
| 2863 | Ga0439446_0018404 | |||
| 2864 | Ga0439446_0131953 | |||
| 2865 | Ga0439434_0001854 | |||
| 2866 | Ga0439434_0038465 | |||
| 2867 | Ga0439434_0150917 | |||
| 2868 | Ga0439459_0043864 | |||
| 2869 | Ga0439460_0178804 | |||
| 2870 | Ga0451577_0727715 | |||
| 2871 | Ga0451577_1102548 | |||
| 2872 | Ga0466972_0079865 | |||
| 2873 | Ga0466972_0272818 | |||
| 2874 | Ga0453683_0002122 | |||
| 2875 | Ga0453683_0045739 | |||
| 2876 | Ga0453683_0047226 | |||
| 2877 | Ga0453683_0285400 | |||
| 2878 | Ga0466965_0001322 | |||
| 2879 | Ga0466966_0043386 | |||
| 2880 | Ga0466966_0088746 | |||
| 2881 | Ga0466966_0429380 | |||
| 2882 | Ga0466966_0742273 | |||
| 2883 | Ga0466961_0025978 | |||
| 2884 | Ga0466961_0800899 | |||
| 2885 | Ga0466963_0008869 | |||
| 2886 | Ga0466963_0011988 | |||
| 2887 | Ga0466963_0069046 | |||
| 2888 | Ga0466963_0206289 | |||
| 2889 | Ga0466963_0503017 | |||
| 2890 | Ga0466963_0526437 | |||
| 2891 | Ga0466964_0014369 | |||
| 2892 | Ga0466964_0087549 | |||
| 2893 | Ga0466964_0274343 | |||
| 2894 | Ga0453684_0000030 | |||
| 2895 | Ga0453684_0058221 | |||
| 2896 | Ga0453684_0273528 | |||
| 2897 | Ga0453684_0436051 | |||
| 2898 | Ga0466971_0005382 | |||
| 2899 | Ga0466971_0081726 | |||
| 2900 | Ga0466971_0451842 | |||
| 2901 | Ga0466968_0221528 | |||
| 2902 | Ga0466970_0524232 | |||
| 2903 | Ga0466970_0685483 | |||
| 2904 | Ga0466957_0018493 | |||
| 2905 | Ga0466957_0685025 | |||
| 2906 | Ga0466957_0751630 | |||
| 2907 | Ga0466960_0004112 | |||
| 2908 | Ga0466960_0027379 | |||
| 2909 | Ga0466960_0105437 | |||
| 2910 | Ga0466960_0256359 | |||
| 2911 | Ga0466960_0711597 | |||
| 2912 | Ga0466959_0373744 | |||
| 2913 | Ga0466959_0623042 | |||
| 2914 | Ga0451576_0034587 | |||
| 2915 | Ga0451576_0094308 | |||
| 2916 | Ga0451576_0176896 | |||
| 2917 | Ga0451576_0223479 | |||
| 2918 | Ga0451576_0236149 | |||
| 2919 | Ga0451576_0379212 | |||
| 2920 | Ga0451576_0713888 | |||
| 2921 | Ga0451576_0844554 | |||
| 2922 | Ga0451576_1240659 | |||
| 2923 | Ga0451576_1470185 | |||
| 2924 | Ga0451576_2445980 | |||
| 2925 | Ga0451576_2578631 | |||
| 2926 | Ga0466958_0011995 | |||
| 2927 | Ga0466958_0103983 | |||
| 2928 | Ga0466958_0202515 | |||
| 2929 | Ga0466958_0788886 | |||
| 2930 | Ga0466967_0000260 | |||
| 2931 | Ga0466967_0024578 | |||
| 2932 | Ga0466967_0025168 | |||
| 2933 | Ga0466967_0025228 | |||
| 2934 | Ga0466967_0088218 | |||
| 2935 | Ga0466967_0129582 | |||
| 2936 | Ga0466967_0183342 | |||
| 2937 | Ga0466967_0190619 | |||
| 2938 | Ga0466967_1459616 | |||
| 2939 | Ga0495590_0215806 | |||
| 2940 | Ga0495590_0430037 | |||
| 2941 | Ga0495591_073300 | |||
| 2942 | Ga0495629_0220882 | |||
| 2943 | Ga0495629_0723576 | |||
| 2944 | Ga0495638_0009097 | |||
| 2945 | Ga0495651_0005682 | |||
| 2946 | Ga0495653_0008336 | |||
| 2947 | Ga0495582_0151087 | |||
| 2948 | Ga0495582_0703510 | |||
| 2949 | Ga0495605_0000144 | |||
| 2950 | Ga0495639_0146345 | |||
| 2951 | Ga0495662_0057920 | |||
| 2952 | Ga0495584_0277529 | |||
| 2953 | Ga0495584_0545613 | |||
| 2954 | Ga0495594_0323879 | |||
| 2955 | Ga0495596_0173456 | |||
| 2956 | Ga0495608_0017970 | |||
| 2957 | Ga0495618_0646603 | |||
| 2958 | Ga0495620_0003895 | |||
| 2959 | Ga0495620_0032377 | |||
| 2960 | Ga0495644_0175111 | |||
| 2961 | Ga0495648_0267277 | |||
| 2962 | Ga0495642_0087810 | |||
| 2963 | Ga0495642_0250150 | |||
| 2964 | Ga0495642_0304815 | |||
| 2965 | Ga0495652_0101654 | |||
| 2966 | Ga0495665_0224532 | |||
| 2967 | Ga0495587_0049529 | |||
| 2968 | Ga0495587_0160622 | |||
| 2969 | Ga0495598_0101336 | |||
| 2970 | Ga0495621_0007265 | |||
| 2971 | Ga0495597_0126995 | |||
| 2972 | Ga0495645_0182631 | |||
| 2973 | Ga0495645_0194050 | |||
| 2974 | Ga0495633_0257756 | |||
| 2975 | Ga0495667_0133675 | |||
| 2976 | Ga0495611_0372065 | |||
| 2977 | Ga0495625_0475370 | |||
| 2978 | Ga0495659_0447765 | |||
| 2979 | Ga0495588_0424716 | |||
| 2980 | Ga0495657_0019796 | |||
| 2981 | Ga0495657_0049535 | |||
| 2982 | Ga0495646_0133534 | |||
| 2983 | Ga0495647_0106869 | |||
| 2984 | Ga0495658_0124398 | |||
| 2985 | Ga0495658_0291853 | |||
| 2986 | Ga0495658_0398990 | |||
| 2987 | Ga0495658_0504771 | |||
| 2988 | Ga0495658_0531907 | |||
| 2989 | Ga0495613_0229453 | |||
| 2990 | Ga0495670_0113638 | |||
| 2991 | Ga0495649_0028579 | |||
| 2992 | Ga0495649_0137605 | |||
| 2993 | Ga0495600_0020890 | |||
| 2994 | Ga0495660_0009935 | |||
| 2995 | Ga0495604_0033102 | |||
| 2996 | Ga0495636_0267324 | |||
| 2997 | Ga0495674_0984632 | |||
| 2998 | Ga0495672_0030541 | |||
| 2999 | Ga0495672_0138890 | |||
| 3000 | Ga0495672_0139990 | |||
| 3001 | Ga0495672_0230801 | |||
| 3002 | Ga0495687_062534 | |||
| 3003 | Ga0495677_0108729 | |||
| 3004 | Ga0495685_281047 | |||
| 3005 | Ga0495681_0029101 | |||
| 3006 | Ga0495686_0101905 | |||
| 3007 | Ga0495686_0199055 | |||
| 3008 | Ga0495686_0646705 | |||
| 3009 | Ga0495602_0074737 | |||
| 3010 | Ga0495615_0188320 | |||
| 3011 | Ga0495626_0191734 | |||
| 3012 | Ga0496100_0221912 | |||
| 3013 | Ga0496100_0471630 | |||
| 3014 | Ga0496101_0016894 | |||
| 3015 | Ga0496101_0341002 | |||
| 3016 | Ga0496102_0000050 | |||
| 3017 | Ga0496102_0376386 | |||
| 3018 | Ga0496102_0393460 | |||
| 3019 | Ga0496102_0768705 | |||
| 3020 | Ga0496103_0000738 | |||
| 3021 | Ga0496103_0005759 | |||
| 3022 | Ga0496103_0056019 | |||
| 3023 | Ga0496103_0062323 | |||
| 3024 | Ga0496104_0096215 | |||
| 3025 | Ga0496104_0213358 | |||
| 3026 | Ga0496104_0919689 | |||
| 3027 | Ga0496106_0200422 | |||
| 3028 | Ga0496106_0422043 | |||
| 3029 | Ga0496107_0197664 | |||
| 3030 | Ga0496108_0057986 | |||
| 3031 | Ga0496108_0125018 | |||
| 3032 | Ga0496109_0061202 | |||
| 3033 | Ga0496109_0145275 | |||
| 3034 | Ga0496109_0155049 | |||
| 3035 | Ga0496109_0557470 | |||
| 3036 | Ga0496109_0823312 | |||
| 3037 | Ga0496110_0029583 | |||
| 3038 | Ga0496110_0176663 | |||
| 3039 | Ga0496110_0304192 | |||
| 3040 | Ga0496110_0872908 | |||
| 3041 | Ga0496111_0196293 | |||
| 3042 | Ga0496112_0063859 | |||
| 3043 | Ga0496112_0171394 | |||
| 3044 | Ga0496113_0086112 | |||
| 3045 | Ga0496113_0430585 | |||
| 3046 | Ga0496113_0855066 | |||
| 3047 | Ga0496114_0016103 | |||
| 3048 | Ga0496114_0107755 | |||
| 3049 | Ga0496114_0416134 | |||
| 3050 | Ga0496114_0582570 | |||
| 3051 | Ga0496115_0233226 | |||
| 3052 | Ga0496115_0393634 | |||
| 3053 | Ga0496116_0005219 | |||
| 3054 | Ga0496116_0016498 | |||
| 3055 | Ga0496116_0028538 | |||
| 3056 | Ga0496116_0032021 | |||
| 3057 | Ga0496116_0037968 | |||
| 3058 | Ga0496116_0111123 | |||
| 3059 | Ga0496116_0333705 | |||
| 3060 | Ga0496117_0000124 | |||
| 3061 | Ga0496117_0000459 | |||
| 3062 | Ga0496117_0024453 | |||
| 3063 | Ga0496117_0131342 | |||
| 3064 | Ga0496118_0001032 | |||
| 3065 | Ga0496118_0019632 | |||
| 3066 | Ga0496118_0021782 | |||
| 3067 | Ga0496118_0367079 | |||
| 3068 | Ga0496119_0000020 | |||
| 3069 | Ga0496119_0000469 | |||
| 3070 | Ga0496119_0004045 | |||
| 3071 | Ga0496119_0009837 | |||
| 3072 | Ga0496119_0367175 | |||
| 3073 | Ga0496120_0000006 | |||
| 3074 | Ga0496120_0003209 | |||
| 3075 | Ga0496120_0004266 | |||
| 3076 | Ga0496120_0016181 | |||
| 3077 | Ga0496120_0022493 | |||
| 3078 | Ga0496121_0008166 | |||
| 3079 | Ga0496121_0172631 | |||
| 3080 | Ga0496121_0713910 | |||
| 3081 | Ga0496122_0000040 | |||
| 3082 | Ga0496122_0000197 | |||
| 3083 | Ga0496122_0000802 | |||
| 3084 | Ga0496122_0017826 | |||
| 3085 | Ga0496122_0037855 | |||
| 3086 | Ga0496122_0060916 | |||
| 3087 | Ga0496122_0095327 | |||
| 3088 | Ga0496123_0000446 | |||
| 3089 | Ga0496123_0005785 | |||
| 3090 | Ga0496123_0013945 | |||
| 3091 | Ga0496123_0032101 | |||
| 3092 | Ga0496123_0058166 | |||
| 3093 | Ga0496123_0116296 | |||
| 3094 | Ga0496123_0348516 | |||
| 3095 | Ga0496124_0000697 | |||
| 3096 | Ga0496124_0004781 | |||
| 3097 | Ga0496124_0025594 | |||
| 3098 | Ga0496124_0031210 | |||
| 3099 | Ga0496124_0080158 | |||
| 3100 | Ga0496124_0148202 | |||
| 3101 | Ga0496124_0208641 | |||
| 3102 | Ga0496124_0840335 | |||
| 3103 | Ga0496125_0000010 | |||
| 3104 | Ga0496125_0001385 | |||
| 3105 | Ga0496125_0008367 | |||
| 3106 | Ga0496125_0071942 | |||
| 3107 | Ga0496125_0078830 | |||
| 3108 | Ga0496125_0084920 | |||
| 3109 | Ga0496126_0000060 | |||
| 3110 | Ga0496126_0000249 | |||
| 3111 | Ga0496126_0004639 | |||
| 3112 | Ga0496126_0008481 | |||
| 3113 | Ga0496126_0044132 | |||
| 3114 | Ga0496126_0048452 | |||
| 3115 | Ga0496126_0083884 | |||
| 3116 | Ga0496126_0177859 | |||
| 3117 | Ga0496126_0320285 | |||
| 3118 | Ga0501306_004128 | |||
| 3119 | Ga0501306_011179 | |||
| 3120 | Ga0501306_019243 | |||
| 3121 | Ga0501306_034773 | |||
| 3122 | Ga0501308_008276 | |||
| 3123 | Ga0501308_025975 | |||
| 3124 | Ga0501309_012806 | |||
| 3125 | Ga0501309_013735 | |||
| 3126 | Ga0501309_030024 | |||
| 3127 | Ga0501310_005255 | |||
| 3128 | Ga0501310_021926 | |||
| 3129 | Ga0501310_023788 | |||
| 3130 | Ga0501310_066367 | |||
| 3131 | Ga0501341_00990 | |||
| 3132 | Ga0501343_012538 | |||
| 3133 | Ga0501344_00344 | |||
| 3134 | Ga0501304_004410 | |||
| 3135 | Ga0501305_000354 | |||
| 3136 | Ga0501305_002631 | |||
| 3137 | Ga0501305_004263 | |||
| 3138 | Ga0501305_021675 | |||
| 3139 | Ga0501305_076380 | |||
| 3140 | Ga0501307_010639 | |||
| 3141 | Ga0501307_015224 | |||
| 3142 | Ga0501307_051673 | |||
| 3143 | Ga0495682_0191167 | |||
| 3144 | Ga0501296_054618 | |||
| 3145 | Ga0501298_003486 | |||
| 3146 | Ga0501311_039898 | |||
| 3147 | Ga0501312_007402 | |||
| 3148 | Ga0501312_008754 | |||
| 3149 | Ga0501312_042860 | |||
| 3150 | Ga0501312_045601 | |||
| 3151 | Ga0501313_017594 | |||
| 3152 | Ga0501315_000671 | |||
| 3153 | Ga0501315_008465 | |||
| 3154 | Ga0501315_009978 | |||
| 3155 | Ga0501316_001491 | |||
| 3156 | Ga0501316_018011 | |||
| 3157 | Ga0501317_012886 | |||
| 3158 | Ga0501317_016772 | |||
| 3159 | Ga0501318_000076 | |||
| 3160 | Ga0501318_013989 | |||
| 3161 | Ga0501318_029125 | |||
| 3162 | Ga0501319_000318 | |||
| 3163 | Ga0501320_014398 | |||
| 3164 | Ga0501320_027491 | |||
| 3165 | Ga0501321_000053 | |||
| 3166 | Ga0501321_026267 | |||
| 3167 | Ga0501322_007193 | |||
| 3168 | Ga0501323_000765 | |||
| 3169 | Ga0501331_05466 | |||
| 3170 | Ga0501332_06617 | |||
| 3171 | Ga0501334_00959 | |||
| 3172 | Ga0501334_02915 | |||
| 3173 | Ga0501335_001605 | |||
| 3174 | Ga0501335_010688 | |||
| 3175 | Ga0501337_008190 | |||
| 3176 | Ga0501338_00177 | |||
| 3177 | Ga0501338_00925 | |||
| 3178 | Ga0501031_0239667 | |||
| 3179 | Ga0501031_0557327 | |||
| 3180 | Ga0501031_0681951 | |||
| 3181 | Ga0501032_0325101 | |||
| 3182 | Ga0501032_0346242 | |||
| 3183 | Ga0501033_0002077 | |||
| 3184 | Ga0501033_0036910 | |||
| 3185 | Ga0501033_0294107 | |||
| 3186 | Ga0501033_0955939 | |||
| 3187 | Ga0501034_0031313 | |||
| 3188 | Ga0501034_0059457 | |||
| 3189 | Ga0501034_0283524 | |||
| 3190 | Ga0501034_0318454 | |||
| 3191 | Ga0501036_0052778 | |||
| 3192 | Ga0501036_0104853 | |||
| 3193 | Ga0501036_0139089 | |||
| 3194 | Ga0501036_0767058 | |||
| 3195 | Ga0501036_1190458 | |||
| 3196 | Ga0501037_0105375 | |||
| 3197 | Ga0501037_0590647 | |||
| 3198 | Ga0501037_0900533 | |||
| 3199 | Ga0501038_0015370 | |||
| 3200 | Ga0501038_0046222 | |||
| 3201 | Ga0501038_0365187 | |||
| 3202 | Ga0501038_0809845 | |||
| 3203 | Ga0501039_0045555 | |||
| 3204 | Ga0501039_0307863 | |||
| 3205 | Ga0501039_0339287 | |||
| 3206 | Ga0501039_0621604 | |||
| 3207 | Ga0501039_1428197 | |||
| 3208 | Ga0501040_0005770 | |||
| 3209 | Ga0501040_0040510 | |||
| 3210 | Ga0501040_0090079 | |||
| 3211 | Ga0501040_0301814 | |||
| 3212 | Ga0501041_0264148 | |||
| 3213 | Ga0501041_0546311 | |||
| 3214 | Ga0501042_0004502 | |||
| 3215 | Ga0501042_0113857 | |||
| 3216 | Ga0501042_0118621 | |||
| 3217 | Ga0501042_0139499 | |||
| 3218 | Ga0501042_0328640 | |||
| 3219 | Ga0501042_0710417 | |||
| 3220 | Ga0501042_0941121 | |||
| 3221 | Ga0501043_0024294 | |||
| 3222 | Ga0501043_0105082 | |||
| 3223 | Ga0501043_0109899 | |||
| 3224 | Ga0501043_0281220 | |||
| 3225 | Ga0501046_0068472 | |||
| 3226 | Ga0501046_0149900 | |||
| 3227 | Ga0501046_0350647 | |||
| 3228 | Ga0501046_0363537 | |||
| 3229 | Ga0501046_0689292 | |||
| 3230 | Ga0501047_0002309 | |||
| 3231 | Ga0501047_0100345 | |||
| 3232 | Ga0501047_0213392 | |||
| 3233 | Ga0501047_0356868 | |||
| 3234 | Ga0501047_0931947 | |||
| 3235 | Ga0501048_0361060 | |||
| 3236 | Ga0501048_0509645 | |||
| 3237 | Ga0501067_0067304 | |||
| 3238 | Ga0501067_0223633 | |||
| 3239 | Ga0501067_0465359 | |||
| 3240 | Ga0501067_0620618 | |||
| 3241 | Ga0501068_0298892 | |||
| 3242 | Ga0501068_0471549 | |||
| 3243 | Ga0501068_0580432 | |||
| 3244 | Ga0501068_0635252 | |||
| 3245 | Ga0501068_0668152 | |||
| 3246 | Ga0501069_0088758 | |||
| 3247 | Ga0501069_0484116 | |||
| 3248 | Ga0501069_0578759 | |||
| 3249 | Ga0501070_0071197 | |||
| 3250 | Ga0501070_0904573 | |||
| 3251 | Ga0501071_0137989 | |||
| 3252 | Ga0501071_0143582 | |||
| 3253 | Ga0501071_0574053 | |||
| 3254 | Ga0501072_0142181 | |||
| 3255 | Ga0501072_0392103 | |||
| 3256 | Ga0501072_0686193 | |||
| 3257 | Ga0501072_0931213 | |||
| 3258 | Ga0501072_1307190 | |||
| 3259 | Ga0501073_0001779 | |||
| 3260 | Ga0501073_0037654 | |||
| 3261 | Ga0501073_0045274 | |||
| 3262 | Ga0501073_0069833 | |||
| 3263 | Ga0501073_0788141 | |||
| 3264 | Ga0501074_0047398 | |||
| 3265 | Ga0501074_0332456 | |||
| 3266 | Ga0501074_0746388 | |||
| 3267 | Ga0501075_0102422 | |||
| 3268 | Ga0501075_0180640 | |||
| 3269 | Ga0501075_0225133 | |||
| 3270 | Ga0501075_0456490 | |||
| 3271 | Ga0501075_0464714 | |||
| 3272 | Ga0501076_0026372 | |||
| 3273 | Ga0501076_0060048 | |||
| 3274 | Ga0501076_0071790 | |||
| 3275 | Ga0501076_0333132 | |||
| 3276 | Ga0501076_0349664 | |||
| 3277 | Ga0501076_0351125 | |||
| 3278 | Ga0501076_0715550 | |||
| 3279 | Ga0501077_0002225 | |||
| 3280 | Ga0501077_0061022 | |||
| 3281 | Ga0501077_0375412 | |||
| 3282 | Ga0501202_002850 | |||
| 3283 | Ga0501206_037206 | |||
| 3284 | Ga0501216_001830 | |||
| 3285 | Ga0501217_002693 | |||
| 3286 | Ga0501224_003367 | |||
| 3287 | Ga0501249_006077 | |||
| 3288 | Ga0501249_113337 | |||
| 3289 | Ga0501252_008618 | |||
| 3290 | Ga0501257_003539 | |||
| 3291 | Ga0501259_009288 | |||
| 3292 | Ga0501259_010099 | |||
| 3293 | Ga0501259_063762 | |||
| 3294 | Ga0501261_047600 | |||
| 3295 | Ga0501221_005725 | |||
| 3296 | Ga0501225_0007785 | |||
| 3297 | Ga0501225_0020042 | |||
| 3298 | Ga0501225_0111885 | |||
| 3299 | Ga0501234_003516 | |||
| 3300 | Ga0501079_0051731 | |||
| 3301 | Ga0501079_0386375 | |||
| 3302 | Ga0501079_0948462 | |||
| 3303 | Ga0501079_0962490 | |||
| 3304 | Ga0501080_0052697 | |||
| 3305 | Ga0501080_0054417 | |||
| 3306 | Ga0501080_0112659 | |||
| 3307 | Ga0501080_0504950 | |||
| 3308 | Ga0501081_0096566 | |||
| 3309 | Ga0501083_0030882 | |||
| 3310 | Ga0501083_0032176 | |||
| 3311 | Ga0501083_0070828 | |||
| 3312 | Ga0501083_0111041 | |||
| 3313 | Ga0501083_0180954 | |||
| 3314 | Ga0501083_0201983 | |||
| 3315 | Ga0501083_0604150 | |||
| 3316 | Ga0501263_029440 | |||
| 3317 | Ga0501266_009896 | |||
| 3318 | Ga0501268_057571 | |||
| 3319 | Ga0501271_011828 | |||
| 3320 | Ga0501271_037720 | |||
| 3321 | Ga0501273_011484 | |||
| 3322 | Ga0501273_036072 | |||
| 3323 | Ga0501274_036867 | |||
| 3324 | Ga0501283_023041 | |||
| 3325 | Ga0501035_0058280 | |||
| 3326 | Ga0501035_0395011 | |||
| 3327 | Ga0501035_0445753 | |||
| 3328 | Ga0501035_0657809 | |||
| 3329 | Ga0501035_0771759 | |||
| 3330 | Ga0501035_0969163 | |||
| 3331 | Ga0501044_0011869 | |||
| 3332 | Ga0501044_0016973 | |||
| 3333 | Ga0501044_0028240 | |||
| 3334 | Ga0501044_0257531 | |||
| 3335 | Ga0501044_0291894 | |||
| 3336 | Ga0501044_0321932 | |||
| 3337 | Ga0501044_0643917 | |||
| 3338 | Ga0501045_0039819 | |||
| 3339 | Ga0501045_0043958 | |||
| 3340 | Ga0501045_0046494 | |||
| 3341 | Ga0501045_0144542 | |||
| 3342 | Ga0501045_0168014 | |||
| 3343 | Ga0501045_0422494 | |||
| 3344 | nmdc:mga03683_203910_c1 | |||
| 3345 | nmdc:mga03683_245770_c1 | |||
| 3346 | nmdc:mga03683_3690_c1 | |||
| 3347 | nmdc:mga03683_50000_c1 | |||
| 3348 | nmdc:mga03n38_45693_c1 | |||
| 3349 | nmdc:mga00v17_109370_c2 | |||
| 3350 | nmdc:mga00v17_202146_c1 | |||
| 3351 | nmdc:mga00v17_235130_c1 | |||
| 3352 | nmdc:mga00v17_400727_c1 | |||
| 3353 | nmdc:mga00v17_411433_c1 | |||
| 3354 | nmdc:mga00v17_429649_c1 | |||
| 3355 | nmdc:mga00v17_6109_c1 | |||
| 3356 | nmdc:mga00v17_760893_c1 | |||
| 3357 | nmdc:mga0yw44_34558_c1 | |||
| 3358 | nmdc:mga0yw44_953311_c1 | |||
| 3359 | nmdc:mga0k408_116036_c1 | |||
| 3360 | nmdc:mga0k408_142373_c1 | |||
| 3361 | nmdc:mga0k408_159465_c1 | |||
| 3362 | nmdc:mga0k408_233297_c1 | |||
| 3363 | nmdc:mga0k408_287630_c1 | |||
| 3364 | nmdc:mga06z11_119779_c1 | |||
| 3365 | nmdc:mga06z11_225767_c1 | |||
| 3366 | nmdc:mga06z11_325888_c1 | |||
| 3367 | nmdc:mga06z11_527802_c1 | |||
| 3368 | nmdc:mga06z11_574376_c1 | |||
| 3369 | nmdc:mga04h51_111434_c1 | |||
| 3370 | nmdc:mga04h51_9587_c1 | |||
| 3371 | nmdc:mga07m45_40104_c1 | |||
| 3372 | nmdc:mga07m45_490199_c1 | |||
| 3373 | nmdc:mga05p37_1161337_c1 | |||
| 3374 | nmdc:mga05p37_1237033_c1 | |||
| 3375 | nmdc:mga05p37_239822_c1 | |||
| 3376 | nmdc:mga05p37_765563_c1 | |||
| 3377 | nmdc:mga09592_207886_c1 | |||
| 3378 | nmdc:mga09592_300820_c1 | |||
| 3379 | nmdc:mga09592_406872_c1 | |||
| 3380 | nmdc:mga09592_51303_c1 | |||
| 3381 | nmdc:mga0qj67_27097_c1 | |||
| 3382 | nmdc:mga0qj67_38612_c1 | |||
| 3383 | nmdc:mga0qj67_429468_c1 | |||
| 3384 | nmdc:mga0qj67_453162_c1 | |||
| 3385 | nmdc:mga0qj67_562728_c1 | |||
| 3386 | nmdc:mga0qj67_637581_c1 | |||
| 3387 | nmdc:mga0qj67_813293_c1 | |||
| 3388 | nmdc:mga0qj67_852665_c1 | |||
| 3389 | nmdc:mga06r32_157928_c1 | |||
| 3390 | nmdc:mga06r32_35520_c1 | |||
| 3391 | nmdc:mga06r32_49523_c1 | |||
| 3392 | nmdc:mga06r32_502358_c1 | |||
| 3393 | nmdc:mga06r32_717576_c1 | |||
| 3394 | nmdc:mga08y16_1022_c1 | |||
| 3395 | nmdc:mga08y16_220889_c1 | |||
| 3396 | nmdc:mga08y16_9663_c1 | |||
| 3397 | nmdc:mga0n895_1024074_c1 | |||
| 3398 | nmdc:mga0n895_1075394_c1 | |||
| 3399 | nmdc:mga0n895_420937_c1 | |||
| 3400 | nmdc:mga0n895_56685_c1 | |||
| 3401 | nmdc:mga0n895_584764_c1 | |||
| 3402 | nmdc:mga0rr50_1713724_c1 | |||
| 3403 | nmdc:mga0rr50_59188_c1 | |||
| 3404 | nmdc:mga0rr50_739011_c1 | |||
| 3405 | nmdc:mga08x19_257980_c1 | |||
| 3406 | nmdc:mga08x19_389314_c1 | |||
| 3407 | nmdc:mga08x19_430151_c1 | |||
| 3408 | nmdc:mga08x19_52577_c1 | |||
| 3409 | nmdc:mga08x19_70094_c1 | |||
| 3410 | nmdc:mga0a205_115431_c1 | |||
| 3411 | nmdc:mga0a205_17156_c2 | |||
| 3412 | nmdc:mga0a205_73030_c1 | |||
| 3413 | nmdc:mga0sz30_12087_c1 | |||
| 3414 | Ga0495612_0370940 | |||
| 3415 | Ga0495595_0091572 | |||
| 3416 | Ga0495595_0236186 | |||
| 3417 | Ga0495619_0026457 | |||
| 3418 | Ga0495619_0518288 | |||
| 3419 | Ga0500578_0465597 | |||
| 3420 | Ga0500643_000257 | |||
| 3421 | Ga0500643_053885 | |||
| 3422 | Ga0500644_0129712 | |||
| 3423 | Ga0500644_0354935 | |||
| 3424 | Ga0500646_0016200 | |||
| 3425 | Ga0500646_0236975 | |||
| 3426 | Ga0500651_0114828 | |||
| 3427 | Ga0500566_0000145 | |||
| 3428 | Ga0500566_0045964 | |||
| 3429 | Ga0500641_0002249 | |||
| 3430 | Ga0500641_0058100 | |||
| 3431 | Ga0500650_0000177 | |||
| 3432 | Ga0500650_0511293 | |||
| 3433 | Ga0500660_140434 | |||
| 3434 | Ga0500555_005122 | |||
| 3435 | Ga0500557_031195 | |||
| 3436 | Ga0500562_021173 | |||
| 3437 | Ga0500594_0016341 | |||
| 3438 | Ga0500595_002532 | |||
| 3439 | Ga0500608_116868 | |||
| 3440 | Ga0500608_220941 | |||
| 3441 | Ga0500642_0216137 | |||
| 3442 | Ga0500652_003651 | |||
| 3443 | Ga0500658_0069513 | |||
| 3444 | Ga0500658_0216002 | |||
| 3445 | Ga0500559_0058956 | |||
| 3446 | Ga0500559_0380517 | |||
| 3447 | Ga0500568_0081998 | |||
| 3448 | Ga0500588_0094677 | |||
| 3449 | Ga0500588_0126585 | |||
| 3450 | Ga0500588_0327001 | |||
| 3451 | Ga0500588_0378764 | |||
| 3452 | Ga0500604_0000214 | |||
| 3453 | Ga0500616_0001092 | |||
| 3454 | Ga0500620_112386 | |||
| 3455 | Ga0500624_003750 | |||
| 3456 | Ga0500611_078959 | |||
| 3457 | Ga0500609_002976 | |||
| 3458 | Ga0500609_015081 | |||
| 3459 | Ga0500656_003084 | |||
| 3460 | Ga0500587_007081 | |||
| 3461 | Ga0501084_0057691 | |||
| 3462 | Ga0501084_0118958 | |||
| 3463 | Ga0501084_0157081 | |||
| 3464 | Ga0501084_0374341 | |||
| 3465 | Ga0501084_0390070 | |||
| 3466 | Ga0501084_0457944 | |||
| 3467 | Ga0501084_0529287 | |||
| 3468 | Ga0501084_0687767 | |||
| 3469 | Ga0501084_0904140 | |||
| 3470 | Ga0590071_031159 | |||
| 3471 | Ga0590077_060469 | |||
| 3472 | Ga0587093_007145 | |||
| 3473 | Ga0587077_063377 | |||
| 3474 | Ga0587106_014502 | |||
| 3475 | Ga0587106_044840 | |||
| 3476 | Ga0587067_000785 | |||
| 3477 | Ga0587067_001858 | |||
| 3478 | Ga0587067_014676 | |||
| 3479 | Ga0587067_016174 | |||
| 3480 | Ga0587067_025488 | |||
| 3481 | Ga0587072_094599 | |||
| 3482 | Ga0587076_031150 | |||
| 3483 | Ga0587107_085843 | |||
| 3484 | Ga0587111_0002690 | |||
| 3485 | Ga0501082_0025094 | |||
| 3486 | Ga0501082_0029360 | |||
| 3487 | Ga0501082_0047364 | |||
| 3488 | Ga0501082_0063845 | |||
| 3489 | Ga0501082_0137871 | |||
| 3490 | Ga0501082_0176034 | |||
| 3491 | Ga0501082_0371792 | |||
| 3492 | Ga0501082_0451807 | |||
| 3493 | Ga0501082_0780856 | |||
| 3494 | Ga0466962_0002136 | |||
| 3495 | Ga0530510_0265649 | |||
| 3496 | Ga0530510_0388764 | |||
| 3497 | Ga0530510_0495140 | |||
| 3498 | 2548699150 | |||
| 3499 | 2550903208 | |||
| 3500 | 2552110954 | |||
| 3501 | 2563930184 | |||
| 3502 | 2571530818 | |||
| 3503 | 2573041357 | |||
| 3504 | 2578338894 | |||
| 3505 | 2580935017 | |||
| 3506 | 2601641744 | |||
| 3507 | 2621273305 | |||
| 3508 | 2643738834 | |||
| 3509 | 2687580640 | |||
| 3510 | 2723606202 | |||
| 3511 | 2728529881 | |||
| 3512 | 2730136825 | |||
| 3513 | 2744957418 | |||
| 3514 | 2753813088 | |||
| 3515 | 2802440716 | |||
| 3516 | 2816421172 | |||
| 3517 | 2821118313 | |||
| 3518 | 2831907792 | |||
| 3519 | 2836166066 | |||
| 3520 | 2858440298 | |||
| 3521 | 2864738879 | |||
| 3522 | 2881635240 | |||
| 3523 | 2881639861 | |||
| 3524 | 2885529923 | |||
| 3525 | 2889048017 | |||
| 3526 | 2889276755 | |||
| 3527 | 2902803555 | |||
| 3528 | 2904168146 | |||
| 3529 | 2904496957 | |||
| 3530 | 2904600772 | |||
| 3531 | 2907208208 | |||
| 3532 | 2919166240 | |||
| 3533 | 2919717102 | |||
| 3534 | 2928521468 | |||
| 3535 | 2931385123 | |||
| 3536 | 2938653398 | |||
| 3537 | 2939586671 | |||
| 3538 | 2939685115 | |||
| 3539 | 2939707595 | |||
| 3540 | 2945996254 | |||
| 3541 | 2946058944 | |||
| 3542 | 2968562375 | |||
| 3543 | 2971406744 | |||
| 3544 | 2971513780 | |||
| 3545 | 2980179433 | |||
| 3546 | 2984531169 | |||
| 3547 | 2984537278 | |||
| 3548 | 2988229882 | |||
| 3549 | 2996636931 | |||
| 3550 | 2996707493 | |||
| 3551 | 648172195 | |||
| 3552 | 8007374820 | |||
| 3553 | 8054471322 | |||
| 3554 | 8057979864 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8cdv-assembly1.cif.gz_H | rnase r bound to a 30s degradation intermediate (state ii) | 0.9877 | 17 | 126 |
| 7nhl-assembly1.cif.gz_h | vgaa-lc, an antibiotic resistance abcf, in complex with 70s ribosome from staphylococcus aureus | 0.984 | 11 | 150 |
| 7nhn-assembly1.cif.gz_h | vgal, an antibiotic resistance abcf, in complex with 70s ribosome from listeria monocytogenes | 0.9801 | 11 | 150 |
| 7nhl-assembly1.cif.gz_h | vgaa-lc, an antibiotic resistance abcf, in complex with 70s ribosome from staphylococcus aureus | 0.97 | 11 | 150 |
| 8caz-assembly1.cif.gz_G | empty 30s head | 0.9699 | 7 | 152 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P48940_2_156_1.10.455.10 | Mainly Alpha;Orthogonal Bundle;Ribosomal Protein S7;Ribosomal protein S7/S5 | 0.9786 | 1 | 155 | 1.10.455.10 |
| 5mmjg00 | Mainly Alpha;Orthogonal Bundle;Ribosomal Protein S7;Ribosomal protein S7/S5 | 0.9634 | 1 | 154 | 1.10.455.10 |
| 5x8rg00 | Mainly Alpha;Orthogonal Bundle;Ribosomal Protein S7;Ribosomal protein S7/S5 | 0.9624 | 5 | 150 | 1.10.455.10 |
| 4qcoG00 | Mainly Alpha;Orthogonal Bundle;Ribosomal Protein S7;Ribosomal protein S7/S5 | 0.9607 | 1 | 155 | 1.10.455.10 |
| 5mmjg00 | Mainly Alpha;Orthogonal Bundle;Ribosomal Protein S7;Ribosomal protein S7/S5 | 0.9574 | 1 | 154 | 1.10.455.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3S1UAE0-F1-model_v4 | 30S ribosomal protein S7 | 1.002 | 33 | 155 |
GO:0000049
GO:0003735 GO:0006412 GO:0015935 GO:0019843 |
| AF-A0A7Y2PLF6-F1-model_v4 | Ribosomal protein S7 | 1 | 11 | 147 |
GO:0003735
GO:0006412 GO:0015935 GO:0019843 |
| AF-A0A2V2RP19-F1-model_v4 | 30S ribosomal protein S7 | 0.9986 | 55 | 155 |
GO:0003735
GO:0006412 GO:0015935 GO:0019843 |
| AF-A0A838VDW6-F1-model_v4 | 30S ribosomal protein S7 | 0.9986 | 50 | 155 |
GO:0000049
GO:0003735 GO:0006412 GO:0015935 GO:0019843 |
| AF-A0A0G1KI38-F1-model_v4 | 30S ribosomal protein S7 | 0.9977 | 30 | 155 |
GO:0003735
GO:0006412 GO:0015935 GO:0019843 |